ELF 4t:D4 (   9DPlO fr4D$r7D$SD$tУr7D$ r7D$r7D$ r7j1X PX1%Qu.UU1ҹudr7ndr7_X5 PX1% Qurdr7UU1ҹs#dr719ҜYX1ȩdr7"# "İ"#1tr7r7r7 r7r7hr7lr7 pr7tr7|xr7|r7 r7r7=v`r7r7 r7r7r7r7 r7r7r7r7 r7r7t74:Tpm_Ё4:TЃ1pm_ S} ~ 0)1/ 0) B S 0)  ` S^0 S 0F 5r7" /"hKË SЍ^S 0r7ЍУr7Ѝp1S 0P!`r7Sփ_^][ZYXύvT$ D$PPg̀̀WD$|$ ffL$L$f_ÐVWk_ЋǀЋt$|$L$)9r&L$k_Ћ_^1ONL$k_Ћ_^1ÐVWt$ |$L$)9rL$_^ONL$_^ÐL$L$L$vVWjt$|$D$=DYWu\tXI k_ЋǂntGIy|$D$Q P*Ytk_Ћǂ󤏂_^1ÐVWk_ЋjǀЋt$|$D$4(k_Ћ_^1Ék_Ћ_^ÉVWt$ |$T$=DYWu%) k_ЋǁЁ uRWZ)s1Ixu1u?k_Ћǀpи)9s‰D$BJt uJ1p_?]VW k_ЋǁpЋt$ |$T$)9s‰D$BJt uJ1? k_ЋǁL$)ыT$t _^ÉVWt$ |$T$BJt uJ1?L$)ыT$t _^ÉD$؎иXXjPˍvD$`hp x$P1ÐD$`hp xP$1@ËD$DVЍ`VЋJPBAHËL$QAIJQ9u DVÍvtXV2,f8ntjSV,u]G~}t&t >t}tUE P0UP41 t&e[^_ÍvU WVS]u ^,EFFF8UBB)‰V<};tC@;u&S#SS%t&C@tދC@&;uSS 5t&C@ xUBB9|1Ʌt̋C@ t&;uSS %t&C@ F;t܋C@ t&;u SC@ FFV89|;F<~V 1FFF F@ȋ}FșVEPVvujjjV, F F4F00jjVSQt'`Uuh(/ t&hA/ C$C(F$t C(V$P(s((^(e[^_US]U ECCPjjhR葆 t h`/i ;u S C@ ҃SCPjjtP3> t h/ CPjhh s t h/ C Ph{tPss藊 t h /諳 C$C(C,/Ѓ{t/ЉC0CtF@ >tFUPs,[>tF@ &>t2FXrvCpu֍x}M}t9r#fHV=ff+MfMQC xRpPe[^_ÐUE MU@tt  RQu 1ÐUWVS]} 1E S0tEPWRSƃS4t EPWRSp9} EU UMe[^_ÐUS]C9C tjSs,uuuu S]ÍvU WVS]h_ǃ;tQC@;t7C@} $;tC@3ubS_SSōvS뫐t&SEt&SEDt&SEt&C@߈MtC@t&;tCHt&;tC@t&;uSS5t&C@ Eh'LSЃ;tˋC@t&;7St&;tC@t&3u:S7SEt&SEDt&SLt&C@ MtC@t&;tCHt&E;tC@;uTSQSEzSaSEbt&Set&Set&C@$Eh'LSЃ;tC@t&;tCUP;tC@;tC@t&Wӂe[^_ÍvUEuu p,ÐUSM9uQ&A@9u QA@9u QA@9u QA@9u QA@9u QA@9u QA@9u QA@9u QA@9u QA@9u QA@9u QA@9u QA@9u QA@[ÍvUSM9u QA@9u QA@9u QA@9u QA@9u QA@9u QA@9u QA@9u QA@9u QA@9u QA@9u QA@9u QA@yt ]9uQ t&A@9u QEAX[ÍvU,WVS]E EE EhEUR ~|EEEEE]1;}}Auu]]UzuUEPUBUU FCG;}|ˋEEE E EMuUREP~e[^_ÍvUSMU Eܛ7 7Ѓ9uQ vA@9u QAX[UVSMu ^ ˈ]9!A@ 9AXF FX]9A@9AX^ ]9A@ 9tkAXt&^ ˈ]9tDA@ 9t,AXF$Q QEϋQ 븍t&QE딍t&Q rQEBQ$QEQ QQ A@ tA9tAt&u Q A@ tfuQ Q$t&Q(A@ tA&9tۋAt&uQ Q Q A@ tA [^ÐU WVSu ^ ^SEPFЃjLSЃ  FPEPFЃjLSЃSEPFЃjLSЃ OyÍe[^_U WVS} ]wVEPGЃjLSЃ Ktl]t w G!ƃVEPGЃjLSЃ GPEPGЃjLSЃVEPGЃjLSЃ ue[^_UWVSu} ]EWVjjWV" jjWVjSWV jEPWVwVGЃjLSЃG GPVGЃjLSЃwVGЃjLSЃVЉ#_ G GPVGЃjLSЃwVGЃjLSЃ EeuV#G tMG GPVGЃjLSЃwVGЃjLSЃ MywVGЃjLS1uEe[^_U WVSu] }SVLjjSV jjSVjWSV jEPSVjjSV jEPSVvsVCЃjLSЍe[^_ÐU,WVS7С 7ЉE=7u"jj577Ѓ Uz*u7ЈB*7Ћuu+Ey7E7ЉU9rV1M9wK57ЉuEU<u EUuD$EEEE1uU}9vu79r)Rj7S#1ۃ7ЋU @UJ*Uш@URuP踴u157Љ7ЋE 7Ѝe[^_UWVSE7Ћ5 7Ѓj@wE)} t E }7Љ]U9vE=7uEU jjEPpEu Ui1+&UWPR׳7157Љ֋U 7Ѐ<u D1$xEE9E|5 7ЋE)ӋE URvEe[^_ÉUEU txuP@x u P @USEU Mt,xt@.P&vPt&x t@t& [ÉUWVS]} Mu519sB{ u SfC9r$Sfmt&{ tSff[^_UWVS]u Mu519sB{ u S1fCf9r"Sfot&{ tSff[^_UWVS]u Mu519sA{ u S1 C9r Sov{ tS[^_ÐUWVS]} Mu519sA{ u SvC9r$Smt&{ tS[^_ÐUS]E tPh/ݙ CPCPh/ ]ÍvUE tPh/虙 E@Ph/聙 ÉUEjj(PBÉUEjj(PBÉUVSu]  PjVBЃjjtPVje[^ÍvUVS]u Sj LSE1 t&jjS@ЃjLSЃjSЃ|EE$Yu7ЃV F.u jthLSЃ=7u%jh/jjjj`hU{ 7Ѓ @1FhE^,s8F@0uKCt`u F.uN$hLSЃEP7PS t"C€fStWVucE<<GjF.u j^,E&ED.tMj UURED.tEEFEE]jhTЋURvHU <E<Oy1|@ufD.<Oye[^_ÉUVS]0tc^C$uZC@0 tjS@XЃt?t&K$F)|.}d.V)D6VSF,Ѝe[^ÍvU WVS]u j@'lǃS Vs[ ÃWl؍e[^_ÍvUVS]j@kƃSVke[^UVS]S$u1u{ u SRC@Jt&jS:t&0 t7SjFPsrDBPЉ‹CPTC@Tt 1"c$߀c$jVSF0ЅuK$e[^ÐUSEX8jSrIy]ÐU WVSu>u7ЃVF.jtSVǃ} te9tavFPh / tuh@/֏ tuhI/蹏 hR/詏 9e[^_ÐUS]jSCj LSЃj j(S@Ѓh'LSЃjj(S@Ѓh'LSЋ]ÉU WVSu] 1jVj LSЃjVЈEjVЃjVj LSЃjVЈEjVЃ utu}}< }|}}.jdLSЃGX}}}}؍e[^_ÍvUWVSu}EF+<(&E9}~ jdLSЃjVЈÈ^(]8^)t^)EPjjVRuAF$t;jVjVЈÈ^(] 8^)t^)EPjjV a#E ;ERt#jVЈF+EEPjjVEe[^_ÍvU WVSu1]FVjM APvrDBPЉ‹FPTF@Tu1AjdLSЃGU9|VjM APvrDBPЉ‹FPTe[^_ÍvU WVS]j@2gNj0t uW'gC$hT/S b/Шt\/Rhf/> vhq/. vh/ C$ t$SjFPsrDBPЉ‹CPTc$߃ c$jVSF0t&h/SvWefe[^_ÐUWVSuF8xF4G0 tTÃV SBTe[^_ÉUWVSE E=Qt=QtkUE=vEE PEPÃt uMqS舐EjS EUBWMuEuE <t&ËEENjuEx@ UBK|ǃBǃǃǃ$k_ЉC|Ph9Њ$PjCPhrE @C8CPCDCLk_ЉC4CxCPCPW\hSGD(@"@:u싓$B$B@?@=v@>BPuT싓$2 BT$2 tYƀƀt&ƀuyWuxt&’8`bc@Wt?SuW싓W$&BW$BWEƀ?@88B`t&3@b-@cu+‘(&‡+ ut׋t&]ÍvU WVSux jhj P@ Ѓ  E$<u- x tjjR P@ Ѓ AUt1z t%j j@;)lj$PRB Ѓ u"PEPTh@/Ep @t SVSV< e[^_ÉU WVS}t&SWNye[^_ÐUMu!E tPuPPQѼÍvU WVS]u’&1t Gtvu b @bȅu c @c P4d7Th/n S.jjhjjjS貘S`e[^_ÐULWVSuEEPV5tDƀE %qw|1wAHw&+’븍&!YQiwAL&a =w3=| w=- = =w=vv=cQt狆@Qu»t&EċAUċE܅t4z t(j j@]܋;)lj$PRB Ѓ ]܅u=EPV86URM Qh/l Vh/h t&;Ct$CC@, vC@, SV$WCPXGtF tw"t6mTh /1l TQ@&UE0XEЍҍBEЉEԋ]܋[,]؋U܋@t RV軞M+ɉЍЍ,M؉A G]Ԁ{wU܋@$?<wGGGM؊AGGG]܋SB$9B(ujEPURMQVZ) ]0#EftOU܋B$ @BGM؋G AG]܋C0 G jj M+ɉЍЍP(WG Ѓ z tQjM܋A(pjA(0RB Ѓ y t%jrjQA Ѓ ]C4KSVA@Q@v}܋G@@|uWhOЋGhPq i u7@KLCRU܋BhP_ u $2 $2uEPTh`/ki u d @dPu Q @QPu > @>Pu = @=Ph/h u e @ePu> t&@>ȅu= t&@=% PV&|Pu Pu<t&@<Ph /g u¸ Pu»Puº Pu¹ Pu  @Ph`/(g u  @Pu  @Ph/f u B @Ph/f u`:`@`Ph/mf V谠Ɔ dž dždž t@:t&V30> u d @dPuEPTh /e V6 MQVCI VyN u ? @?؃u  @PSuEPTh/Ie l u ? @?؃u  @PSuEPTh/d ]v'u  @!ǁt-t%Wh /d V.V u»t&E̋]؃Űt7z t+j j@M )$PERB Ѓ }uMuURh`/_ t&uSMQVF.t&dždžV_7 ]  u u t&@  uhu2/?24@tˋH?tNjHu  @Ju싖 B Bu v@ujdLSЃKuɃu싖$B$BVURV+h/b u»t&ЋAt?z t%j j@;)lj$PRB Ѓ t C@, jEPVju@u»v؅u ? @?EȋAt1z t%j j@;)lj$PRB Ѓ 179EtGw 79EuCp  @P47h/` Cp s4Cp$u< u@< t //Ph /0` C4t<19s6C,D%PC,4C,DPWh`/_ G;{4rʃSVwCu C@,$CC@, t_uB싖B t&B BuB싖B t&B Bqu3…0… 9ˆ>ȅtɋ t&tƀuuEPTh/^ u»vЋAt1z t%j j@;)lj$PRB Ѓ DC :jjj@PB$?PtAz} BAP@tpPVtxTh/] Vh/rY u ȋDPu Q @QPQh /] V\hU/X Th`/\ ud t&@dPu Q @QPu > @>Pu = @=Ph/W\ u d @dPu e @ePu> v@>ȅu= t&@=% PVoPu Pu<t&@<Ph/][ u¸ Pu»Puº Pu¹ Pu  @Ph`/Z u  @Pu  @Ph/7Z Vzh/ V u"t&…@PU Rh/Y u*‘'‡, utыe[^_ÉUWVSut,uu@tEBEAEEt0u ƒU@ MEu @ !}tnu싖4B4Bu ’K@ !EA}AuEBuhTh4/(X tƀu‘t&   ?V u» ؋`lt=z t1j j@` )$P`RB Ѓ lEt-u<|@<}E}u F@ÃU/ЅtQ/PTh`/V t@ PEPj th]STh/TV U:Ut3u싖4t&B4BjSV u ? @?Eu  @Áu   @ t⋆@ Mu &@ u @t`u t&U179tAw ͠79uM7Љ]E}t1E@@tEvUBp +MIOv}u = @=t pPEPTh/{T u  @؃}Suc @chub @b hPM7h/S tpth/S th /S thB /S t ` /t_ /Phe /nS ttE}tOt1Ɔ=&:E'’Bt֋UP:]SVESVtƀu‘t& Lt&)> tV+"u싖$vB$Bw@ q@ t&u@E(@@EtۋUu» ؋`ȃdt=z t1j j@d)$P`RB Ѓ dEu7SURTh /P V U’MQ]SV-}G@,WV7hjh /jSV<>0tu%u( s@u $2 $2u싖$B$Bt@ u ? @?Eu = @=ȅu > @>Etσp˃tA} BAjxPEPWSUtRDž| }Džpjj jV(ujjjV(H0 uM@p]Cp  /Ёpu_ /PU@Ph /QN jjpQ]SxPWVxDž|0jj jV+(tHjxRjWStQjh!/jtSV;Dž| jjjV't-EMP1XBBB ft&jjjV'tjjjtRVMQ6jjjV^'t6jjjjjjtSV EPV6eDž||}tRU@ tXMAp ) jjS]@$?PxPWVv t&Th'!/L 179EtGw 79Eu}ttRVub&@bȅu!ct&’<@c P47h@!/K tƀVh‡Sv‡;’*WTh!/jK tҋƀH[^_ÐUVSuM Q 0XҍB؃jPSQV= e[^ÉUWVS]EEEEEub@bȃ}uc @c tJ1F9s9sA9r;i}~0Th!/1J Sth!/F &E}z}u"@E}tۋ@u  @EtE$B&E$~’` v ’‡vt@uƀi B`Et1S@ MƀGhLSЃu‡t&t&}ty}uEt&UPuE UPu`t&B`e[^_ÐUSMt(@ u4‘1t& ԉ p"t@ pu'‘$&’tߋƀu‘ [ÐU WVS}CPCPCPCPWh"/ U r Th #/> jSMQE PWE }t We[^_ÍvUWVSu}EE P Ë]XEҍB]tCtS C9E;uπt(UuMPKjhjE p BPMQ賦 PE p UTh`#/I= jSMQ] SEP[E }t URKe[^_ÍvUVSu] uSV٥EPhss CPVe[^ÐU)lj$PQA Ѓ Ev >}$u*‡'‡FEuEtu‡&ttu u+(E&E؋1Et(u'»$׍&ЋM̉ȃ4t4z t(j j@)$PERB Ѓ uL¸It&ƸEЉ\½Ab¾AhEЀeA$ EЅtUЈt&tAtAGE91M؈}uXu$‘!‡* ut׋t&e[^_U WVSMu |@ }uRtIu<u5t&@<t#uav@St&t'u0@#t&u  @!ƃu=@=؃WtA}B &APu>t&@>Pt ؃pvPVu =e[^_ÐUS]7к79s79t9s9u[ÐUWVSuU }MEÉ~ N~FEFBu~NfF[^_ÍvUEU rr RRTh#/r6 UVSuMPӃA tPtA}B &APP?R@tpPSu e[^ÐUSMu4u؉!@؃t؋X[ÉU WVS]}ǃǃ Gu:)lj$PRB Ѓ uu<&@<u t&@U܅u ? @?E؉}*URS}Wh%/. Eu)EPSdh%/- &F@,@tFp h&/Du¸ | Fp h@&/q- 'Fp hc&/Q- Sg E؟t }؀u3jjAS \PjATh&/- :@u $ $St@:}u9EPSƃ ǃ ǃǃUBp }OEPAph&/P, e[^_U,WVS]EEPSu  @wt It&~. uh'/' @)t[NtӋ@ @ƃǃǃZ @+ 0tdtҋ@ @t̋@ @  @R U9uǃS H9ut@ @t@ [tHǃt ǃu  @1EPSƃt(ǃ tS &ub t狃@ u!t&@ u h@'/%% uu*A@tu1tgǃt@ǃu  @B싓B D9u3uB싓B$'t&B$BuB싓B t&B Bt&Pu  @uB싓B$B$BuV@9EPS]uoǃ t\t@䃻uB싓B B Bǃǃt&uB싓B gB BWhd'/z" +  1t>S9t @Q3Q%Qt狃@Qe[^_ÐUWVS}11ɍ&; s}<u<D \D ;Eu%} u}t 9v 9v,<w !t&} u;Eu 9vA{[^_U\WVS]} 1EEG XUЍPUЉU2#R$*/йHWSE(' t7EEEȉEwEPEPEPSẼwVEPEPEPS jjuuuEPWS jjjStE;E@E4ǃǃ uuWS<ǃEEuwEPEPSLjjjSutBM9vwEPww GPTh(/"# E >ǃǃ uWSǃEEjEPEPWSjjuWSS }}ǃǃ WSǃEt&UEEEEu uEEEEEEE}uEwEPEPSwEPEPEPSƃ(wuEPVEPS. jjjStFE;EwE;Eu E;EEEEEE1tww GPTh)/ww GPTh@)/! ǃǃ uuuuWS:ǃE jjuWSa jjuuuVWS}E}t'ǃǃ ƃEt}u ǃ ȍe[^_UWVSuEu» ЋA j] SV#\t&:+/Ѓ"u+/RE pp BPTh+/ jM QVu¸싖¸  Ȉ HX@:Vu8] CGtOH _Z:WO@P@$U BPV2jjjhB$?PtAz} BAP@tpPVe7%vMQ] s CPTh@,/ Ee[^_ÍvU,WVSuu» ЋAUt1z t%j j@];)lj$PRB Ћu< u@< UB@%=}u¤ t'uº /}u¤vȃ}u¥ D σ}ut&D }u§ D ϻ}u  ȃ}u¡ D ȉE}u D M}u£&D ȉt}u  @}u  D}u vD}¤)¥2¦9§B L¡Ut&¢Y£bDCUR0U)Uz,TBEB%E9}t$%9EsZB)$M}Tt&Tt&LTt&Tt&\uº싖º44e[^_ÐUWVS]u»t&ʋV@36@40@5 (@6"@7tƀtDƃ@OBPt&ƃƃ@5ƀtƀLMN@A:T&9@G@LABM@BN8@@2@A*@:JtZHTS;@B9vSw)uQt=u  @ utjdLSЃNȃS1e[^_ÍvU,WVS]EtƃƃDh./T0P(P$PP P8h@0Dta $<E1ҍt&D E}v拓 DEuSuPjAPS貮t#tZjBPS菮u@Th./! Kv<%W(t׋@<tԋ@WEw @ t8u [ @[@tt uZ v@Z@tt @Et=Th//EEu 3 @3u2 @2 ЉEtBu 1 @1u0 @0 E uEEM9MAMvt XUɍAƉ1ft$tF7ЈFFEuU t&UD MfE܋Eu,pE#E ¸u%E.}uUpUDpEu }tMPWSF}u FvFwatXFRvtGp@uE܅Et!EEܺEtRWSkFt F~uF} tFF tFFFFFFUfǂ2Mf4EE9EUfdfǃfSTЍe[^_UVSMu"‡`$} t t򈐇[^ÐU WVS]1~u<‘9‡>‡cv uthLSЃSw>tu‡&ttu u $ $u‘u3S蠢u‘ NtB=u u.Qu @ P+u5u‘ Ph`//e[^_ÐUS]Stau'‘$‡)v utԋvS31]US]jSjSSv1]UWVS]M u"$?#tڋ$?u&ȅt6Du  v D ȉ[^_ÍvUWVS]M uEB$?@Dt&t$?tƄtG&/ !tD t&[^_ÍvUWVS]M uEB$?@EEvt$?tUtEt&/ E tML [^_ÍvU WVS} EEu17VEt уpt A~}BA7F$?1:]t}utE1;Mt}ut/19Et}ut1F9Et }u[^_ÍvU WVS}E Bt pB$?t Az}BAjjjhVPQWe[^_ÍvU WVS]1StVЋA4t1z t%j j@>)lj$PRB Ѓ u VSs@tItEt&+Lt勓BLe[^_U WVS]u }u*tRP9R9@ARPy t+jj@6)Ɖ$PQA Ѓ @z t#jjP RB Ѓ @By t(jj@?)lj$PQA Ѝe[^_ÐUVS]@t?ut&t'3uM HM([^U,WVSEEUUM@tIu]UEt/M]bvuuDMDME2vUы9@ht&]@MEEEEE}$uUuM]t@B9E:E&uU]AEPURMQEPU RSWa t uVW$EM9M>EE]9]jjjuVEPEPU RW2 EEt,M􈈐t&u'»$E֍EЋAUЋt1z t%j j@3)Ɖ$PRB Ѓ u }u(2EPURMQEPu VSW t WE􋇨E9Etnv EPURMQEPE PSW tыC@ux,u U P,Cuh}1/SWL&E뎃MuXu W:bEe[^_ÍvUVSuu싖$B$߈Bu t狆ڀvu‘/jLSЃt΋Vu싖 B Be[^ÍvUlWVSuE EdžjЉURjjjEP tevu‡&tt4u$!‡뛋VBV_ u t&@EAt tEBuT4.@TE:Etԋ4Bt&u85E?$2lp@UtUP}t VVׇt$2&tXEu,)E3$2Y@UtȋUP}t VeV)t$2Ej jhjEPjV4E EtEjjjjEPV]7E U9UwlvXU<tO1;}wHjEPjWUR]SjjjSVe jjjjjjSV背 G;}vEE9Ev}tVWfu+‘(&‡+ ut׋t&Ee[^_ÐUVSu Ati$ucQtFX$NuOtRh1/vу+N0N,y|t&Q%Å}FX(e[^UtThj2/W$ FEt'11ҐEtBA~Mz}t8M% Af% ŠA ‰UAt&% Ff% VЃ Ѓ MEt(ua&h2/nuEane[^_ÐUWVSƅ}t#E U9rh 3/4EURuh3/hWà }u=h3/и)P;PÃWh3/}EDž1;u t&ULE!T9uZ!9tNE43/Ѓu3/Ph!3/и)P;P'ËUD F;u r;u set h&3/ h3/и)P+PÃ}tEPh3/؍[^_ÉU,WVS}u*‡'‡FEuEtu‡&ttu u Eu ? @?Eu b @bȅuc t&@c PEP)pTh@3//}th3/􃿜u R @RPu f @fPue@ePu d @dPh3/{u PuŒt&Ph3/EtIj2EPužPhh4/jj] j2]Su  @Pjh4/jjj2Su’ Phh(4/jjj2Su @Pjh.4/jjj2Su ? @?Pj?h74/jjkj2Su vPjhA4/jj4j2Su  @PjhI4/jjj2Su  @PjhQ4/jjj2Su ` @`Pj`hZ4/jjj2Su < @<Pj}u8U2WGЃE PU2WG0ЃE$0U RWG(Љ؍e[^_ÐU WVS]u}VSCЃVSCЃE PWSC0ЃEPEPSC(Ѝe[^_ÍvUWVS]E@EEU 2BtUB MEUBM @Bu1V ztzuBPBPh/t&b?} G@$tHu @z t#jjP RB Ѓ y t+jj@} 7)Ɖ$PQA Ћ@t<8‡)vtԋu‡ tt1u!L$tًBLuqu<‘9Cv‡+ ut׋t&e[^_UVS]u1uT1z tjjP RB Ѓ <tt Dt&u'‘$’7&tItȋƀvu‘ S=utt&uh~Kǃt8u’@u@t SP1t&ǃtS>fvt4t+u&t VSN?t VS}Te[^ÐU WVS]j@[ffC6tfC8[PCL 7fC:CD47t{Xs0 ffC^jS螽@tjjAS-t}jjBS u7CYjh"ЍC0PSotQjh"ЍCX5t&C1tjh"ЍCXPSojh"ЍC0PSoP<[^_US]y t%j rjQA Ѓ S]ÍvU WVSE pUy t%j rjQA Ѓ M Q tAB] SC Ctg@Ut pt&]øE Pt @B U BA] SCcQEP;FhP_~$tSF tMz tP] C pjPRB Ѓ UM q P@Ѓ] C EtFC@u0H u7кMb)RChPb^[ u~,t U B@, M Ap ?FXPh7/nF,w$8/FXt1 t"t (u;t&] CtGF,EF,£t1v[ÐUEUE4ÉUE UE UE UEÉUEÉUEUE4UEÉUE4ÉUEUE4ÉUEUEUE UEUEUEÍvUE UEUEUEU1ÐUVSuVEt/jjV ~pu VxNFx@N-jjV~pu VxRFx@RÁEPV؍e[^ÉUS]hOh`?/jjS' {puSx? t&Cx@?v1PPSO]ÐUS]SjjS$SS{pu Sx@Cx@@{tuS|7 vC|@7{puSx=Sx=$ SxB=$B={puSx Cxƀ{tuS|< t&C|@<{tu S|9C|@9{tu S|:C|@:{tu S|;C|@;{tuS|? S|B?{pu {tu S|KC|@K$2Sx;Kx{tu S|KC|@K$2A;jjS{pu SxCx@{puSx CxƀS%]UVSu] VESSV_ ~pt!Fx@ZvNpuIVx¦uHYVxZދVx­@VxBVx¦BFxttFxƀt&~ptFxƀ~ptFxƀEPVe[^ÍvU,WVSuV;EjjVV^E~puVxRu>Fx@R0jXV؃SV\ǃ urSVPh?/y뛉WVBhLSЃ Ph@/Tu WVh]%=uhh(V1EPVEPVB@e[^_ÍvUVSu] V ‹@9uGNpuVx|6Fx}#uVx[ Fx@[0u1e[^UWVS]u KpuSx[t&S|¤:Cx@[hSƃ{ttËC|򈐤hSǃ{ptCxƀt&Sx¦xSx¦hSxSxS|ƒhSS|{ptCxƀhSlRPjpS%PjxS{pbCxP{p`Cx@{t_C|VhS6{tEhS#S|t&jhS{pCx@[ UuSx CxYu,Sx¦u+;Sx­-Sx¦/CxttӋCxƀt&{pt͋Cxƀ{puSxSx  SxB BhSƃjhSFǃhS ǃWhS Kpu SxCx@u Sx| Cx@} |u Sx vCx@% ƃVhS|{tt C|ƀOS|ƒAS|„ 0Sx[ kt&u{ttҋS| t&j`SRPhShWhSVhS {ptCx@[ {puSx\Sx\ SxB\ B\{puSx Cx@,muSx¦u&Cxu,Sx¦u+KSx­-Sx¦/Cxt"tӋCxƀt&{pt͋CxƀKpuSx|Cx@uSxu&Cx@hS,EetSURVS0x@EEiS|ƒEnSx¦SxEURVSA11 ωEE{ttS|EEPhS}}M{piCxƀWVjpSEURjxS{pICxUPKpu SxCx@Έt@t~CxP1u Sxu 1Cx@t'{tt_hS!S| SxSx[KxhSS|¤ KSxRhSS|Tt&SxZUt&Cx@tF{ptCxƀ{tthS<S|Ȉ{ptCx@Zve[^_U WVSuth@/nh jVJ;WVu.PWVPh@/0lV蛥 Ct PV PVR@ffufCf;_e[^_U WVS}puWx t&Gx@E11|7ЅEt#7ЃWBPhA/XkFvȃW跤h-A/gU|WVSuNpu-Vx*t&Vx)t&VxUt&Fx@؅tӋFx@ t3V&V+t~ptFx@vVC $E/Ѝt&V|:@fV|;@gV|9gt&hh`?/jjV)VdPV t/~ttF|RP:~ttF|RP;~ttF|@9NpuVxR@uu&Fx@R@`uVx@PFx@@Ct&VwPh@A/iV VÃSV tPVvV'PhkA/@i ShA//iV蚢jjAV V;ÃSVo uDVcShA/hhA/dVxzEt&VxEt&@D1RPjpVqhjxV ~ptFx@z~ptFx@v~pv Fx@ ~pu VxAFx@AÁSVPhA/&h`tNw tGw tA @t7 t*wtL &t j jjAV裑V薽PhB/g0A vVPVǃ h B/wgjjAVJ V|ꀰaV|dV|‚nV|ƒqV|„tV|…{V|–~V|’@V|7V|:@V|;V|9Vx@VxUjjA@P@P@$P]S6EPuuEPVjjjSV/jjjjjSV, ~tF|ƀ~tF|ƀ~tF|ƀ&~tF|ƀ~tF|ƀ~tF|ƀt&~t{F|ƀ`܋H~tlF|R~tnF|@7&~tfF|RP:~tbF|@;~t`F|@9~p_Fx@@G AG WVjW{WRjjV ~p$Fx@U. ~pFx@U Vx@?V|7Dt&VPV ~pt‹Fx@@t&~ttF|@7vƆ dždždž~t!hVSV|$nvV?]V?NM}WVc2~pu VxA t&Fx@AÁt-t%Sh`B/XcVÜV$hVhPV }u,uPWV3dždžV:&hh`?/jjV蹹 ~puVx:Vx:$ VxB:$B:~pu VxI t&Fx@IPjAVXPhB/nb~puVxt&FxPhVսP~tu V|;F|@;P~tuV|: F|@:PhC/ahV{P^tu V|; t&F|@;ȅu V|:F|@:% PV {PVP~tu V|9 vF|@9Ph`C/`a$hVPhVPhVP~puVxI &Fx@IPhC/a,~pu VxAFx@AP~pu VxFFx@FPhD/`~pu Vx<Fx@<Ph&D/`~puVxV|7Zt&FxPh8D/]`VșƆ dždždž ~ttF|@7~paFx@@t&V]SV.SVmH o~tu V|<F|@<ȃ~puVxA t&Fx@APQ~tuV|: F|@:%PjAVFPh`D/\_ ~tu V|<F|@<ȃ~puVxA t&Fx@APQ~tuV|: F|@:%PjAVƴPhD/^ Vn&VPV!ÃSVyjSJS!#EPV;-uuEPVDPhE/Z^$VPVƒ t1B t+jjj@P@PjA@PVP{ ~t_hVaV|$|V PVAà ^SV:@Ph@E/] BHwy$HF/ЉJxjjQWjA@PV譃 zS]SV-jnE/ЃtdE/PjWSV?J0&h{E/XvV|—VPVPà mSVIhE/\ NpuVx:@u ;Fx@:@t0u VxKFx@K@uu VxLFx@L}~t\F|ƀjjj@P@PjA@PVly CPVPhE/VGVxVxUst&hV2V|’$OVx@Ct&hVV|’$SVSPhE/i[VAx[^_ÉUu WxK@u (Gx@K@tuWx: &Gx@:@utMtu W|<<t :G|@<<u0VW/t&WxL5t&Wx1ۃW ƃptʋGx@Lvu,t#puWxWWxW$ WxBW$BW}tEPWuW+ptGx@t WwW]lvWxU^t&WxSEMt&WxQ>t&URWPhH/&TW葍WWe[^_ÍvU,WVSuEjjV(Npu VxQFx@Q?!Džu VxRFx@Ru\tSjjVש~puVxNVxQ>Fx@NЍBv)ujjV蔩~ptƋFxPQ&~tu V|<F|@<ENpu VxA t&Fx@AUuVxNVxL%t&Fx@NEEtًFx@LEtt> t V4V贵PVE t @"tEE}V%PhH/>Rj2]SWjQhH/jj茊j2SEPh<hH/jjoj2SURjAhH/jjUj2SEPjNhH/jj;hI/QV1 t>}WVwPh I/QVx9t&t(~ptFx@9hI/RQt9}uhI/)Q}VPhI/Q thI/PjjAVze0}udU€tL}uR ph J/P ~pu!VxDV|7MVxRFx@D}uE E􈆾}t }uUJ ~ttF|@7~ptFx@vVe[^_ÍvUVS]u jjSM{pt+CxPQSKpuSx@u SxQ҉Cx@@uSx]uCx@]}h$J/O{ptd"@t(h>J/_O{pt"Cx@9@&h`J/KvSx9t&Sx't&Sx9Sv{ptՋCx@Sͦ&vhJ/NSBjjASxe[^ÉUWVS]u hh`?/jjS~ Kpu SxUCx@U.@uVS5PhJ/KNjjS胤j\S̩EPS萵ǃuCh K/ISxU5t&SxU;t&SxK@it&{ptʋCx@Uvt {ptCx@U{puSx:Sx:$ SxB:$B:S{ptCx@K@{puSx9Sx9 t&SxB9 B9h SרS_E ;uEPh Sh"S蜨 9u"EPh"S#VSnhSxƃ EPSNVhS諨 EPS/Lw"G"uWSh@K/eLGLQj WWWSNg1uSxNu+SxL Cx@NttCx@L 1t&uSΡPhK/KSR^SPS9ƃVS=hK/KSjj@P@PjA@PSqe[^_ÐULWVSu^tu V|<F|@<E܅uV|: &F|@:ȅu V|;F|@;E؉MmjjAEPURQEEP0EV PVBà t!~tuV|9|F|@9}1ۋ}ܠEjj jV)ujjjV)uURV0hL/CJH0SV /L/Ѓ u.L/P@Ph4L/J u @EC!@tPU@E؃jjEPURjAEPVpPhQL/Ijj jV )t'jh`L/jjURV6E jjjV(t+u'EPuuEPV诤@@@ _jjjV(tujjjEPVn2t&jjjVd(t1u-jjjjjURVzSVdECtjjjV(dtjjjV'tE}7}t }ܠustjSVZcjSSt,jjh@PjA@PVWn SVDE}1t=@ txSVCjjW@PjAEPVmǃ0VtPhkA/G }tEPVhVPWURephL/EGV谀e[^_ÍvUL>.L/Ѓ|>}UO/PD>%PR1PSh`O/= CE;XHrY&Mq819sFt&T.L/Ѕ}UO/P%P4ށRSh`O/< CE;XHre[^_ÉU WVSU4E Et9tRKPhO/L8jjh(|…u 1it&tLJ1йǀfǀǀfǀ Iy ׉JEЍe[^_U WVSu}M^pu VxJu /Fx@Jt%uVxM &Fx@Mu !U }uU B #zu s %zuB9sЉSQWV e[^_ÍvUM UE9st 9v$9`v9v"uuu 9w u 9 w US] EMu1wEt9v‰t}u C C 9vЉ[ÐUU M9tEtt}uRR9vЉU WVSuU} EuEtBBBB 8Bu)Z:Zu!B:B uJ:J uuuutU Rf U Bf!  9E[^_ÐUWVSu]EEe}EEtu11ۃEPU r 2BPMQrǃ EtW_MOEtW _ MO GWOMMM9u9u E9EWEW_MOSVE p URMPhO/c81ۃ M thP/I8Et (P/Ѕt$P/Ph,P/8CUt 3P/Ѕt/P/Ph,P/7CM@t

uuЀ{ u uuEtE Hu1utqumC EQtCCPEPuSUR2 t uCPuuE PUR0uuE PUR(CPE PURe[^_ÍvUVSM]uuD[^USE]    [ÍvUWVS]M}uw΀uD  E [^_ÐUS]SEjjS ƃǃǃǃǃ Kpu4Sx@u3<&SxL@*t&S|7't&Cx@@t tҋCx@L@{ttՋC|@7{tuS|MS|M$S|BM$BMEPS7]ÉU,WVS]EEPS{tu S|<C|@<{pu!SxR@u ;t&Sx9,t&Cx@R@thR/}'{ptЋCx@9w t#e &u&uh S/"SxL@&t&th{pt֋Cx@L@ƃǃǃVSxL@Dt&SxLEt&S|Ia{ptCx@L@{ptCx@Lvtu {ttS|BIv{tSx@et&SxL@ut&SxLut&S|Itt&9uǃ{ptCx@@H9u{ptCx@L@t&{ptCx@Lv{ttC|PI{tC|@Ht&tHǃuǃ{puSxF t&Cx@F1EPSt1ǃt${pt Cx@@Sx@ t&uSSxLt&{ptCx@Lv{tC|@HS|H{ttC|@Hu h`S/Kpu"SxAu!-t&Sx@:t&Cx@Atu1tUǃ{pt‹Cx@@ǃKpu SxDCx@DSxjjjjjWVaww GPVoPh@X/U@$  uyww GPV@oPhX/VjWVhV ؋V|’V|7Vx@X/Ѓ"uX/Rww GPVnPhY/jWV~tohV V| ؈U Xj jR肒~tSF|@7~pJFx@@U@P@$ GPV/2jjjhU@PjA@PVF5jhjV^tGWVdždžWVdžE+t&EPw GPVhmPh`Y/~Ee[^_ÍvU WVS}WzPW~E tuW|9 uG|@9 EP6=hWj}ƃthWO}RhW}ƃhW}à tj`WuCtmVEPWRpƒJE;P8%9ZchW|W|•4{VEPWoƒJE;P8t0%9s%ZREPWoƃtthW |W|4VhWrShWre[^_ÉUWVS}hh`?/jjWElWxPW|E pGx@ZpuWx] &Gx@]ujdLSЃKt̉u.EPWchY/ pGx@ZWkÃjjWj puWx?u Wx?vWxB?u B?hWW{ƃhWzEhWzÃhWze ] E VURWmƒB% ZȉډÉ+]1PjtW3q vWxZWxZwWxthWxzEuWxyEwWxxEyt&VURW*mƒJ%+EÃptGxHtSjpWpptGxUPzptGxUPyptGxMHxe[^_ÍvU WVSu] ushuCPs V9ǃjjjSVjjjjjSV4 }t-}'Ws CPEPVDhPhY/Ze[^_ÉUEtÍvU WVSuÉ=w =vߍ?w@ 9v>9w.t&ځ%9wuߍ9wuډe[^_ÉUVSu`7 t&t9SV踇~勃0-džd7Љd7Љ0d7Ѝ4e[^ÍvUU`7Ѕt9t u1ÉUEƀƀ1UUE PÍvUS]Lt jPRE L]ÍvUVS]4tCS+t d7ЋP@ЃP@Ѓ P@0ЃPRB(Ѓ SS1 tjPQF~ߋLtjPrQtjPZQDtjPBQjS4Qe[^ÐUS]4P_LPPjS]UWVS]tESzfS}ejjSe{pukSx=hSx SxjjSdSxASx=E DSx=EHCx@=EjUr2Rcǃ@t%PjEp0c{pRSx Bt&SxCx@uhLSЃNt {puЅuScPh Z/  {pSxB@tyWjUr2cjjSIc{pjjSWc‹Cxt&{pSxE B={pCxUP={pu SxJu Cx@Jt} t S1e[^_U WVS]hh`?/jjScE &EPS+pEPhSh =t&|puTxv%TxFOy̓{tuS|’ C|ƀhSr;Eu0jSohSr uE}9Ee[^_ÉUVS]1ftRt&VS>o{tuS|’ C|ƀhhSvgF9|e[^U WVS}LJ[Nyǃǃ ǃǃWf&fuW`Ph`Z/ bW$W$9t f$vf$u 1t&WG`PhZ/`  e[^_ÍvUVS]u t&@9tHR ut#t&ы@9u/I uRu⋓t@9u Ru1[^ÐU WVS}(VEt&@sC Ps3h^jSCKt&uHt&@sC Ps3WP^jSJu@ @ sC Ps3hB^jSJt& ue[^_ÉUS]Sq_EjjS^ {puSxSx Sx {puSxKSxK ` SxBK `BKEPSF_]ÉUVS]S^EjjS^ {puSxJt&SxCx@JjjS]t0{puSxSx$Sx${puSxKSxK$&SxBK$BK{pkCx@t&EPSB^e[^UVS]u MN!B$?Bt)B F tB N Hr V)t&F 0FFAFA0q[^UVSM] c!BR Ѝ9uES t!CBtJHBFSKJStCBCFSCS t CBt&SC [^UVSMu tBR 9u[uዙu1mSQ[vSt CBvSCt8Ct1@!u+Pt @BCP@VsQ4K!؍e[^ÍvUVSu] C @PSfz }iRVfCtSPKSBtSPCCHnB % =u0B t(BR PSVG5CtSP&CSV~e[^UjjjP>Ãt'jjjs>EЃjS@e[^_ÉUUPHPPZ/tZ/P|4l7h [/uu ÉU WVS]h h`?/jjSTSp5@jjP=‰D &@PjRT @t@ 1ǃh[/ЃSSSPPPPPV 1Q0|x4t((tH(Sqt u$Shth`?/jjSiS0OjjSMtS,RPh \/E&EPjSNuZOEtu߅uSQPh`\/&EPjSNt.SQPh\/SQPh@\/jjSL11E$w s t&t-Ft(474 7ЃS=QPh\/SGm~t$SQPS QPh\/! S#S~ ShhLPjsSh`jh@7,z1e[^_UV|?V|9V|M V|KV|XJV|Y RV|Z SV|[TV|\UV|] VV|^WV|_XVxi~p{Fx@0~pxFx@1~puFx@2~psFxƀ~ppFx@@~pnFx@A&jjVHf|j1t&~pu Vx`FxP`~puVxe Fx@e1ۍ&~pu VxfFx@fCvGv1EPWPjAVrME܃jjAjWP]S,EPSVRGv~pFx@S~pFx@~pFx@8fdžfdž~t~F|@=&1ۋDCvjV/Zfdž1ۃfXCvtX11ҋD CvjV ZƆ~tF|@>~tV|B?~tF|@9~tF|@Mhh VLhh"VL1ۃ hWV}LCvhh(V^Lhh*VKLhh,V8Lhh.V%Lhh0VLfdžjh2VKjh4VKSh@V(MShDVMt~tF|HK1E1ۃ EPV+ZC?~EGvك~tF|@X~tF|@Y &~tF|@Z ~tF|@[~tF|@\~tF|@] ~tF|@^~tF|@_jjV E~pFx@fdžjVRjV SjVoSjVSjVyTp(h$VKjhVVVJjhTVFJ `\XVjV4V jjVBDe[^_ÉU,WVS}ƇjAjW(u%WCPh`]/ &EEPEPPjAWHB B ƋMf lEf "f nBBB? @tBBBBBjjAjEPP]SKEf!$jjjSWOjjjjjSW{ E܃}*1e[^_ÐUw<wBBBBD?}B9J@t yB@tJGt BvBEUf!$CCCjjAjMQP]SijjjSVyjjjjjSV襱 E܋E9E$U B @t $M A!t $߉U z } 濉M A fu @U B"@t 1e[^_UVSu] S:u t1e[^ÍvUVSMypuQxIxTvAx@$} t yptAxP[^ÍvU WVSuU ]}vXvv\QRhPV/E~tu V|R V|؈BR~tu V|S V|؈BSe[^_ÐUS]E ⿈t @{puSx  SxB SaS{]ÍvUVS]S?fPh4SKD {tuS|MS|M IS|BM BM]ÐUS]jSjSSi1]U WVSu h|h`?/jjEPR=EPIǃ؃  VEPI]SEPLÃWEPI؍e[^_ÍvU WVSu h|h`?/jjEP<EPHǃ؃  VEPKI]EPSEPAWEP#Ie[^_ÍvUWVSE uC{1ɀAtutE1;Et}ut/19}t}ut1C9Et }u[^_ÍvUVSu] BBjjjhPjAQVSVd_e[^ÐUVS]S;EjjS:1St&H%BPSKƃu VS'PSnHEPSd;e[^ÐUVS]M uup(h$S\AR(P,jQS>ҍ@fQf@(B,jVS=e[^ÉUS]h h`?/jjS_:SH9s )v)ʉЋ]ÍvUVS]S:EjjS\9Sh1tF@ uSW)VhTS>EPS :e[^ÐULWVS}EEW9EjjW8 OpuWx­tcvGxuOuWx­Wx­$vWx$爂pu Wx­ GxuEWFÉ]eEE}$uPSh]/fp(h$W?U9UzuEPWHÃu)UPEPh^/Th%^//vUREPUREPE PSW E؃}$r}$}$SZẼuU RSZSZƃt SC[C!uh-^/C@,tPVEP@Ph`^/u SWL5UPh^/OSEPSURW]EeE9EPW?D}$uh^/jjW)6WCE܃h Wc;EEu&Eԁ}~h^/s&9r5PVWJ5Ph^/`Wh,_/2VWFÃu-VW5Ph7_/hS_/t&VWBhWEƃjhjUURE PSWW uUUt&}$u@Pho_/EE@PEPU$RE PUREPUREPU RWE؋E0;EtVPEPWU%=tU}$uhKP/u%=WURWAEPW5E؍e[^_ÐUWVS}EEhh`?/jjW4EEU(2 9r1PVWV3Ph_/lWh,_/>VWDÃu-VW3Ph_/&h_/t&VW@hWCEEPhUREPE PSWe uuE}$r}$to}$SoVuU RS3VSOVt SVC!uh_/PSWHE,PUREPVW }uEU(Vh `/u}~h`/u%=?}$t}$u hTWQ7+EPhTW7Ee[^_U WVSu} ]h-h`?/jjV[2E% =uk%=uSh VP7#&WV>ShV+7 Wh"V7%=uEPh V6WVg>EPhV6 EPVE>ShV6 uEPh"V6e[^_ÍvU WVS}uhUh`?/jjW*1E% =tEPW=VhW 6 EE%=u&SW5;E uEPSW5E PW e[^_UÍvU,WVSEEEP0EjjEP/ jjEPhEPEEPE PEPEEE } tE E}BuEE@E}uEE@&}?~EEEE@E}E9EEEe};}sf u܃VEPPEP @à t8EPEPEPEPE PSEP tVEPCG;}rEEE9ErEP]Ev EPEPEPEPE PSEP tfSQuE PSQSQt SLRC!uh!`/SEPCEdEPEP.E PEPEPEPEPE PEPRE@Ee[^_ÐUVSuhh`?/jjV. ~puVxWVxW$ VxBW$߈BWNpu)Vx:$Vx: )Vx:Et&FxX:㞅tՋFxڀP:VOjLSЃ ~ptFxX:t&VOjLSЃ  t0jV\jVQhh`?/jjV"- Ve[^ÍvU\WVSuE dž0jEPjjjEP2V-VPjjV,~pt2Fx@:~ptFx@;~pu(Vx?%Vx;t&Vx:ʐt&Fx@?!ljv11ۃSSV+~puVxVx$ VxB$׈B~puVxu !Fx@tj LSЃѐt&jjV?+~pu Vx?FxX?9iV~puVxWVxW$ VxBW$׈BW}t V[VGj jhjURjVE(jV'YjVY EtEEE9EwjUă<tP1;}wIt&jjAjWEP]SAjjjSVQjjjjjSV} G;}vEċU9UvVV u( VNVhj4PKEe[^_ÐUWVSu}WMVSà u*Vh@`/@&SxL Et&uVScLS*S)jjS@) {ptCx@L t&Kpu SxL u BCx@L t8Shh4P'KS*VSLW;LuSxWSxW t&SxBW BW{tuS|KSx;$2t&C|@K{ptSx$2B;S*߃VS{KSLWKe[^_ÐUWVS}uVKWà uWh`/V_K}WSJƒ@x;dv@ ;hs⿃@9t RSd@dh)xShhLPIWSJVJe[^_ÉUVSu] xtSV SVSV=e[^ÐUEP(u1ۃUR0(VEPV KUfPh4Rk,uEP,(F t"$F j VIVURm<j VIGPVI Gtt&"V:JjjABPBPB$PEEPޟEPuuEPUR*E܋^8VEP*FHjVURIPVEP8PSVUR'G0E܀8w@<wGGGVURqIGGGVAIÃVH9ujEPuUREP” E #EftOF %{ @F GVUR'N VEP6h@KLV,G)UR4$Ph`/M VEP:e[^_ÐU WVS}u H$PtVHÃt>VWXI@Pha/VWjV_GV6HjtRh$a/yRVWO'y|Q%Å}F uSVzGt&SV~Ge[^_ÉUt1v[UÉUÍvU WVS]u }h@%h`?/jjSk v&hi/RSx¹ {ptSx &StPSx¸NSx¹ ]Sx¹ l&Sx¹s{ptCxS&{ptSx S&{ptSx S&{ptCxƀS&1e[^_UVS]u hW%h`?/jjS v"h@i/Sx¹ {ptSx &S[uK{puSx¸Sx¹CxE{ptދCxƀS%1e[^ÉUVS]hl%h`?/jjSJ {pu Sx¹ Cx|Nt jLSЃͅt 1 &<e[^U WVS}uEjE$PjU RjhE PWG$ЉÃ tSU,RE(Phi/t&EjURE PU$2E PWG,ЉÃ tSU,RE(Phi/EURVjE PjPWGЉÃ tSU,RE(Phj/TEjjU RE0U2WG ЉÃ uUP E1{t&SE,PU(Rh@j/EPhoj/Ъ}t!}t.>}u8U2WGЃE PU2WG0ЃE$0U RWG(Љ؍e[^_ÐU WVS]u}VSCЃVSCЃE PWSC0ЃEPEPSC(Ѝe[^_ÍvUELÉUEU MÉUE E ÍvUSUME Ã[ÐU WVS]u }9u9t5{puWVSSxWVS‹Cxe[^_ÐUS]{puSxCxEPEPPSQuuS]ÐUÍvUS]t u SS]ÍvUS]EPEPE PSuuS]ÍvUExpuPx &@x@ÉUS]{puSxSxBt&St]ÍvUS]t6t-@t SSKpuSxBSx!Cx@utSxBjjSs]ÉUVSE uUM]@Hȅt FF[^ÉUS] CLC!t PPS/!t @ v@B< v}CDB ]ÉUVSMu t^8SAQC=t&^8BBtC%1ҋ A QCB v@p$[^ÉUU @$@@@ ÉUEu ÐUVS] uuS@)‰)s8e[^ÉUVS] uu+s8)s@e[^ÉUSE] y tuj@S,B)ÉP2QA Ћ]ÐU WVSu] {HtG t;uVCHPVS@)‰PC40G Ѝe[^_UEM z tuhqDA40RB ÐUEU +UMU @$t RQ RQUU @$t RucÐUUM} BuEEɍBÉUWVSu] S~p<8uT0xҋD0x<:u\2xۋD2x [^_U WVS}u ]GpE<uT9x%T9xNE<uL:x؉t&ɋD:x[^_ÉU WVSu} FpE<u T1x%T1xȍW]<u T0x ҋD0x ˍWM<u T0x ҋD0x ٍW]<u T0x ҋD0x [^_ÉU WVS} uEpE<uҋETxɋETxOE<uɋELx&ɋETxOE<uɋELxɋE\xOE<uɋELxɋETx[^_ÐUWVSM EpE<uU ҋ]Tx&E %]TxȋU B]<u ҋ]Tx ҋ]Dx ˋU M<u ҋMTx ҋMDx ًU ]<uҋ]Tx&ҋ]Dx ȉEE] M< uۋE\xۋMD xЉ11 ] u} E<uM| xEMD xЉUEEU1 EU] M< uۋE\xۋMD xЉ11 ] u} E<uM| xMD xЉ1҉1 [^_ÉUWVSu}M EpE<uU ҋ]Tx&E %]Tx ] CE<uۉU\xۋELx ] U<uۉU\xt&ۋELx ] U<u!ۉU\x&ۋELx ] U<u!ۉ}EE\xEt&ۋELx1҈ ] U<uۉ1U\xۋELx1 ] U<uۉ1U\xt&ۋELx1 M ]<uɉ1ELxɋ]Dx1[^_ÉUVS]h)h`?/jjSspuSx¨&CxȅuSx© t&Cx ȍe[^UVSu] h)h`?/jjV#~puVx¨ Fx~puVx© Fxe[^UExpuPxf @x@UEM xpu Pxf@xfHUExpu Px@x@UEM xpuPx @xHUVS]h)h`?/jjS&jSVjS0e[^ÍvUVS]u h)h`?/jjSVjSe[^US]h)h`?/jjS{pu SxCx@]ÉUVS]u h)h`?/jjSc{pu Sx CxPe[^ÐUVS]h)h`?/jjSspu SxCx@ȅu SxCx@ ȍe[^ÍvUVSu] h)h`?/jjV~pu VxFxX~puVx FxXe[^USMU |pu Tx ҋDxtypuQxAx[ÐU WVSu] SVǃCSV lje[^_ÍvU WVSu] SVǃSV lje[^_ÐU WVSu] SVǃSV11҉1 Ӊȉڍe[^_ÉUSMU v1vt j SQ؋]UWVSU EEMM@(]2MA(@(A,}B, EB,A[^_UVS]u VStJȰf=uPhj/茓f Bf~Ht VS VSVSjVSPS{e[^UE @<ÐUE @DÐUUx tu hjP@ UÍvUVS]1z tjjPRB fDf;ue[^ÍvUVS]t?f|Sut{pu SxBCx@u1Sxtv{ptCx@ t2Slt.{pu Sxu Cx@t SS)dhx} S)=tS't VS8*t VS:e[^ÍvUhu u/ÐUExpu Px@@x@@ÍvU WVS}] uh|h`?/jjWW؃  VWV]e[^_ÐUVSuhSVݕShj/cSV ffF6tfF8vPFL@7fF:FDT7ЃjVtjjAVڽjh"ЍF0PVVFXSVA [^ÉUu/ÐUWVSE @EM Q tABU BR EhPGMy$tSA tMz tPM A$pjPRB Ѓ UM q$P@ЃE @ Ut@C@u0H u7кMb)RChP}F[ uU R tj M QN E PUR MAXPEPPPhk/f UB,$(k/ЋMAXt t&Et&"t(u7nt&UB,M A u E@,uUB,iMA,]vE@,Nt&UB,>t&MA,E@,@!&UB,t&MA,UB,uCM A t:׃4E PURƋ}4E@,U B t%B ]SMQd E PURSMQc EHP[!e[^_ÍvUEx<~@<PUWVS}G p W@EEu G,WW EEPV EPEPEPjAVW 0Bt@t B EPVAÃu"EPVd G,{EPVI {BE EBG @BG t&BK JBjjS5t&BSh;ЍGhPCSWVe[^_ÍvUjjASWP]S\,EPSV ]jURuSVkRM0EPV1[UrVUt*MA uhk/ EP  UBtMQV^e[^_ÐUVSu] KtCvhLSЃ~puVxBFx@uKuӅtV1VgPhk/耋e[^UWVSu }FXF(F,FB<vSjW]SEPxWURSEPzNVu&BPvR7^$tlUUFʀtʀRjSv w$EP‹B Ѓ tF,NVG$p PjjWe[^_UVSu ]EPv 6FPutEvf $UFf!$e[^ÉUS]jjjt1 ]UEjÐU1ÐUVS]1CXtu PPPƃh@7( Sxe[^ÉULWVS] C@ pEj@cEȋC@ @fẼEPVWjAMQÃ(jjAjVWuVCYUMl#Ef " ĘtUEf!$UMfnt Ef $Ęt EEjEPjMQHNC9EvE܃jjuVEPQ MtEECECECE؃}uEUEf"t f$uejEPEPEPLju܍EPujMQ?M0}uEE}t C <vCCjjuuuVEPCNMQ;be[^_ÍvUVSu] FuuuV:u7кCRV:e[^ÉUVSu] F@uD@|uVh;ЃhP:u7кCRFhP:e[^ÉUExpuPxB@x@UÍvUS] j@0a]ÐUE 0-aÍvUÍvUÍvUÍvUÍvUÍvUÍvUEU @P,ÍvUEU @PXÍvUE@@u@,ÐUE@@XÐUÍvUE@@$ÉUE@@%ÐUEU @P(ÍvUEU @P(ÍvUE@@(ÉUÉU ÉUÍvUÍvUUB u B ÉUÍvU1ÐU WVS]} uVStuG t =r7uGhP79VSNe[^_ÉUEu p p UEuu p p JUE@ÐUE@ÐUE@ÐUE @p ÍvUE|hk/6UÐUuF(tUJUf!B;uLJƇW VW& sVWESGe[^_ÍvUS]M A(tQuA Qt A B A Q A[U WVS]C@EsDd7thm/Utu$)t&1$}uV F t t3C@SD ut9 B& ~e}u"V ˃ -FC@SD utӊ Bv t&$$}uVFGu<t<u$< ~4u+9tr}uVt&V( F}tF(}uVV "&F}tF Fj}uVuWd7tPWhm/Uru#hCPh n/rhm/my$G P)Ѝ h$to/ЋAG(ƃh & C@SD ut׊ B ( Rd7t Phn/Vq C@SD ut Bt&  t&BƃAAAAA jv CPhn/phn/p d7@t7hm/dlCPhn/kpd7@t hm/:lC@SD uw B |7CPh o/ phl/o d7@tmhm/kPSq \V(et&CPh@o/od7@thm/rkC@SD ut B }tF(}uVvV F}tF F}uVud7tPWhm/ne[^_U WVS]{@sDd7tho/nteFtRF(uj 9uGd7tho/}n  t%F%V(몉V똍)SVƃ ƃ   ʈ   H$o/Ћu%hCPh n/mhm/i@$@ @ ƃ  &ƃ t&ƃ  ~&ƃ n&ƃ WV @t&V t&CPho/#md7@thm/hƃ uV F t tC nF @t&V @.PV@0u utF @t΋P@FI  Ft uVuM F e[^_UWVSE} P@U@DEEEd7tLuƒ uF P}uU &UBPhlp/k}_uF }>E@&}UB}uF.\}uUE&URUE(t؊E K}Em}t@Uff@UfoUfo{UUnU]d7tShwp/wjE]~+}tUff&كσ~E}mE@Ȑ}iU߃}YE@}}}tcUB}u U u uF t}t+E@d7h|p/iUӍvU뙐t&U.eUBt&UU }u UE URUE u3tڃ}uU uǍ&UB tE }u UUBȃ}u]U Zt&U et&UB"g&U/yt&UB x&Uut&uF ~8)M}tE@ }tUB"vd7tQhp/ h}tuF/}tE@ }tUBEe[^_ÐUWVSEP@UpDEd7t6uV F P}uVFPhlp/g}uVF}uVF}uV &F}u V.cF.Z}u VEVUE0tEt>Em}t@V} ffm v@V} fm}uIVFvV} fmVV} lVt&FUU9vE]d7tShp/Gf)]]~*}{V} ffE$E ]~8}`F}_V} ] }SFE uh}}uX}uV F}u V u F t}uVFd7th|p/ee}u V/F/}uV F }uVFEe[^_ÐUWVS]C@ESDUt5Bd7thp/d}uU EUċUR Ud7tEPhp/dE t2CPhp/d U > `UCPhp/Gd}tE@ vuGC@SD ut B >& "C@SD ut݊ B ) }u U E UR Ud7tEPhp/nc&}}*CPhq/Mc} E@ U d7th-q/cd7th:q/bt&u&hCPh n/bhm/^vǃFtp B }u UUBƃ(E@md7thMq/+bt&t;CPh`q/ bhq/a d7@ihm/]u#hCPh n/ahm/]F$H Q)Ѝƃ ~(} ƃ  F(@tƃ 0O(If BGGG G$@u0O, u7кMb)RG$hPƃUUU }Vd7thq/`t;CPhq/`hq/` d7@hm/U\u#hCPh n/M`hm/(\}7E@}4U}/E@ hLSЋG$@,w&UB2t&UUt&U `U UU/,CPhq/V_Phq/A_ d7@hm/ [}6E@2}5UB}4E}4UB `}3E@ }2UB}1E@/ƃƃ&U %t&U}tދE@ &t+tt&Yu#h;CPh n/ ^hm/YuFCPhq/]hr/] d7@t hm/YVSF$@,,u#hmCPh n/]hm/[Y֋FFFtp B ǃu#hxCPh n/\hm/Xut&U t&}tUB vE}uUU!UB$}t܊UB=$@{==tw&=t.dt&<PSƃ <+SVƃd7tHu#hCPh n/[hm/iWƃF HPPhr/i[S9)ƃUt&sd7th-r/ [t&S)ƃvd7th?r/Zt&S)ƃ@vUB(W&u)hCPh n/7Zhm/V}tE@(v}uUUB &UBA}tE@ d7tAPhJr/YƃCPh`r/Yd7@thm/rUS'[t&F$hP VSC.t&U+t&UƃS}tыUBe[^_ÐUVS]u F,N(@;uKC@SD ut B  i& VSFtVP FV u Se[^ÍvU WVS]C$@ x Phr/Xj@2ƃC(@thr/W&hr/WC$@,SW Vo2e[^_ÍvUVSuF$p F$@ uE1;^ }/thr/W3Phr/jWC;^ |уhr/TW hr/EWe[^ÉUS]s(s$Shr/!WCPsshr/ WSG]ÉUVSh7Ћ0hr/VtS[uhr/Vt Pahr/VtS;[ue[^ÉUVSEp@XDuSCPuSCPuSCPuPh s/VuSCPuSCPuS C PuS C PuS C Ph`s/UuSCPuSCPhs/pUuSCPuSCPuSCPhs/0U uSCPuSCPht/Ue[^ÉUVS]Ph#t/TPPh:t/T P P P Ph`t/T1 ss3Vht/gTCPsht/RTF~ɍe[^ÐU WVS]Eu'uS0%C0@t&1x tjjP@ Ѓ }ueS0_Uzu]j2LSЃuS0 C0@x tjjP@ Ѓ EP;()Ѝ4z tjht)PRB Ѓ U$ƒ<UB@B, ,u S0 t&C0@!Nj,uMVS>RCPh v/lRE@u S0C0@!ǃ=@:T  @:TuS0 &C0@t!@:T@:TЃ j LSЃ1e[^_ÍvU,WVSEE@f9v‹M()ЍpǁjEPjuVjhSRB$Ѓ tPEPh`v/8QUjRSuVP@,Ѓ tPEPhv/PMʁRjjjSSP@Ѓ tPEPhv/P{ujjSP@ Ѓ t PPh w/pP8&EUuB  B Cdž004(V ÃuPhLw/OU(9tPSЃPhgw/OM(uVhljh@7EPV]1ۃ Ex t&C| t~E1ۋEx tDD+CE| t~1ҋEx tDD+CBE| t~U1ۋ=7Ѕt"E<7ЅtpuR47ЋEPhw/N} tE PEPhw/NU܊B!@PM(΃Vhw/mN1ۃU܊B!!E)@Phw/INCM܊A!9~Ճhw/(NjhjjEP90tVhw/Ih NLSЋUB4B8$1ۃM܊A!9փHUE)@^fFU܊B"F$B!$f@fFF7ЋM4NEF U(fF jh"VR&(CM܊A!9ue[^_ÍvUS]CPhx/ Mj hjjS!$h@KLLSЃh%x/L]U WVSu] Nu V0u F0@tj2LSЃOu΅FPh@x/yLSV0V0V0V0V0V0V0EV0E} u1ۃpF0Xt&fF0P_F0PXF0X}uQ} u/DF0@&7F0@1F0UP$F0UP1e[^_U WVS}]E EEEtHMuuW0!9tG0@!9u1jdLSЃKue[^_ÐU WVSu} ,t1b0tOuV0u&F0@t V ,uj2LSЃKue[^_ÐU WVSEEUtwB0@hq LSлMu Q0 UB0@@uhLSЃKuɅMuQ0EP0낋UB0@PEPhx/MQ0EuP0UB0@uj@hz/ Shz/>]C,VEP@vUz t(MtPwjW]SC Ѓ Gu'G ffF G$ffF^,19}8&T8 ffD8$ffCA;O|ωE+P B,ffF ffNt&F F&Mz tWjht+PB Ѓ ]x t!jj@ Ѓ }t, ,jh4VEP' t4EPh6z/<UB,VMQ^}u 1RV]S t&V7VS t VVEPe[^_U WVSup@ X P uS0 C0@PuS0t&S0Ut&C0@Ph`z/;j@fNj, t4hz/;tC0@vhq LSahw/;p@,dž0, ,jh4VSr0tCPh6z/2;We[^_ÉUVSuU jVoÃuFPhz/6, ,ǃ0DCC$ЊSS$CC ffC$Scʠ$C(ffC C,ⳈC CCC C,z trjht+PRB Ѓ x tDjjP@ Ѓ x tjj,P@ Ѓ jh4SV tFPhw/i5SVtFPhz/G5<u @t@<FPhz/5x tjj,P@ Ѓ SVe[^ÐUUM }u u8ut Ht&ꀉQ9tH&AÍvUS]tABQu ǃ[UWVSuF8jURj}Wjhh?P@$ЉÃ tSFPh@{/t&F8jVDRh?uWP@,ЉÃ tSFPh{/rF8VC,Ot&PEPhۈ/C,/GPGPGPEPh/C, URMQKSڢe[^_ÉUS]E tt%St`=t4ECPh$/#BCPh`/Sc&CPh/PCPh/]ÐUUM }u u9 u$ t Ht&  Q6$t$H$$A$ÍvUS] tABQ u ǃ$[UWVS} EUUE$/ЅtEE t#u E@wE N}tP Nj2LSЃNt}utڅuPMQh@/~t&}t*t"}u W G}u߉uރmuj2LSЃNt}uu؅u/}EMQh//WMAM}tUGBUmmryuj2LSЃNt}ut؅u$}MQEPh/bM QU }u Wt&Gms}t_}tY Nj2LSЃNt}uW_t؅u$PURh/= }t &1!@t&}t@&e[^_ÍvUVS]E ǃ $ǃЉ@f ǃ7fǃǃǃǃ j@ƃS /P(PCPh&/ S t VgV\jh"ЍPSxe[^ÐUWVS]s0K4uQE t&QU}|1  t Et.EfEfEjjEPjSQVSsUCHS8z tj CvG

C,/&PEPh/C,C(E PURdKSM  t S e[^_ÉUWVS}] u~$aEPjv$v lURB Ѓ t9uj!GPh/t&PGPh/8Ex t5UtPlpjlEP‹B Ѓ ElU;P}VKHUD AAAAl$AAAElU;P|W<+GHB TSCBBBl@SCBBB+t&CC@@@CC@@@cUBCEPC$ЈCW<+GHB 4S$C$BBBC CCCC C @@@W8z tjGhtHt  LuEPEPEPQ~7t&EeUU%E܉E1uE1u܉ME>pE>qEEEjjEPj j V tHf>rEU9U} }"ufF>&xЙfN>Ɠ/f}uœ/PEP^Pvlh/P/Љft/PPft/P^Sh / PPSh`/g$7jh"ЍF4PV(jj^P-‰V\u)h/PFPh`/ ^PRE^tt1ېF\t F\D7ЋF\fDF\D7ЋF\fD V\F`tfDjh"ЉF\PVP(E^9E|MU1e[^_ÉUWVS] u}E =@ YyEыE) =*&[VE)MmU ?[^_ÉUUM }u u9ut Ht&Q6tHAÍvUS]u1+t ABvQu ǃ[ÐU,WVS]S B EJMEC,"w@Mht fzC,KS|jSEPURC,MQvEPG'PEPh/C,ME2j@EU;jSRC,S RU=MUu CuMQ,ЃC5w7$ /ЃSh&C,Ut&C,Et&EfǀK95{uBAQUP U@ EeEytHIM?&QAEB EB EB EQA ‰UE@Ut9Us EE9v6RMQEPEPh/mC,K [sURq ǃMOEG _CGG& O(C85WUMApSRjs$s URqp@ Љƃ thEPh/uhhҔ/ Vh/WMQF C,KSx EPpz t+C tPMqjQEppB Ѓ WURT =MUuCt5wWMQKSfxCEPÃURlEe[^_ÐUWVSE@E@ X @E(7(7Ѕ~ h/ffǃS(ЃUB'ǃfEfEP-wE$/Ѝ&:tƃǃ 1ƃ&ƃUB<tx<5ttUB B rtHǃ1;~}"T0 QD0$G;~|vDŽt&F 1fftW09~7CPh/EPSUB, (71At&EPSЃURS$ЋE@,@( (7иe[^_UMUA$uhЖ/9vЃPq u ÍvUWVS}G p @oW%#$/Ѓj ]SEpEEEEj j:EĉhPo[0rtUĊ0rEEEE jh/ЍEPSh/jEPtjh/ЍEPj:hRLt&j,xSOG@Eƅx"ƅ{oRd2r$zEEEE2p`2t1`d0q`1`EEMd2pEj,sPFPh /yjpSlo@tJpCCStƅt@@@jSWv Ph`/G,1t&G,H[^_ÐUE@,UÍvU1ÐU} u 1,&E\tu t&ÐU,WVS]EE=MUt=LUu1t&j@ڼESЈEu*=MUu EPfǃ\1t&TUEfEEPS ЋEf\uHML=LUtPUETUUt t3vEPSQVCPh@/qEBt,~=MUuGhP膕fF&fEF($EtNG<tE<5tASpz t&G tPFpjPRB Ѓ CpvP@ЃVS}t}u EvWEPEPSE=MUuEP0}t }t"vOWp jWS}t Se[^_ÐUu'+ÐU WVSu} ]ELUVot ;5PUuG';TUu EvjLSЃKuLUt&jLSЃV,ЃuދEe[^_ÍvU WVS]E EEfEhHPC jLSЃjSeƃuCPh/19t&EF&F($ F(S(F'EfǃEtO uqf}u.E EEfP@t&EfE 'E E0E.E/fǃHfǃfǃVSЃVS$ЃjLSЃhVS u1\fuOfe[^_ÍvU WVSuj@Nǃ&vE uJjjh/jP蠁 tӋt CBt&CSW؍e[^_ÐU WVSu] j@ǷǃtX &C;u P葄W荷e[^_ÐUVSu] Sh ЋChPQCVe[^ÐU WVS}vsC(tFhP裐Su8K(Sh|ЋChPˏu7ЍPFhPЏ|t CB CSFuBSh ЋChPqK u7кMb)RFhPc *e[^_ÉUEt PÉU WVS]C@ p Pph/IC@,j@ŵǃSVMWȵe[^_U WVS]C@ p j@艵ǀc(VbW艵e[^_ÐU WVSutNRP@Ѝd9r+&S(tRP@Ѓ9s܃hP@0ЃjPRB(Ѝe[^_ÉU,WVS%UjRj]ÜSjhhP@$Ѓ tPh/Uj”RhSP@,Ѓ t-Ph/UjSP@(иU˜RjjhhhP@Ѓ tPh /EUjjhP@ Ѓ tPh`/ Uǂǂǂǂjjh/j PUx  9) FЉUC(Pjjhj>hRBЃ Es{ CCUCE9^DžDžt&Dž/WUuЋt&Ux u=jdLSЃsDž/\t&E@Ut㋂@&Dž/WEuUxufB<jh"ЉЃ4PR蔔EPh1[^_ÉUVS]sVh)/ЍPSh t,Vh@/^M *@1tۋ &t͋@e[^UVS]j@胫j@vIQtAB AQAQStPCPhn/uu!t&@f@QtABAQAAAAAt#A BuA ܋@f| Qt Vǃjjh/j SXs0TUWVSu>F  F$jRj>V,URjhv@$ЉÃ t4FFV2 jV RvUR@,ЉÃ tRUR@(ЋFFF0 &vv v$,&F$F(EVUBV u jvRUR@ ЉÃ t'uj>h/ vSh/ U=R|$=S Ӄ=c ] =b}1ۅtLUB UfhS81ɃE;H}!UT UD$CA;J|ߋx tLjUrjR@ Ѓ z t$jpjB Ѓ EPVÃUR@Ѓ~$t8vv @0ЃF,PB(ЋFFV2}u 1Ve[^_ÍvU WVSuFE} uGFFF0SUs1F `u  @f}j LSЃsH&tF BFFF01UBPCPh/e[^_ÐU WVSE0@t@<t&1g5u t&@ ҉StCB CSCCSV]u ;]]u  @@]j LSЃ3e[^_ÐU WVSu F~~t(@PEPhۛ/pt&^(t:G<<5Ux txG tRS=St5 =Rtc=bt =ctSUx t.jt&Ux tjsjSP@ Ѓ USP@ЃF$tFvPv Uvv P@0ЃEF,PRB(Ѓj@ÃFFV2tG(OWXSӢ1e[^_ÐUEx<~@<PUMUA$uh/9vЃPq u ÐUWVSEH y Qov<fyE@,UB5$/Ѓj ]S/EpEEEEj j:]SvtMĊUEEE jh/ЍEPVh'/jEPjh9/ЍEPj:SuVt&j,x\PiUB@Eƅx"ƅ{4v>$zEEEET>ș<>ÉMM]TEj,\VEPPGPh@/UB,&jpSvJpCCStƅt@@@jS]SAt&j@躟`DždEH[5xu;AYP @ ÁDžhytZAhNQYB B B QA ‰h[*uAt Dždv9s h9vARhPSGPh/:UB,RT`S`(t t t*t bc@t QtAB AQAu(uF,V T`P2UQB A B$AAAoPf0dPhfpXUBÃuSPQtC`S谝uFtF,@E@,PKS&t&`Rmu1]C,8[^_ÍvU WVSu1uIDt&>h /EX@u @ ҉QtAB AQAAAAGuWXItGt Vhj@蚛@t#Qt AB vAQAt^AY AAA@fR@f@fCCjjQ3f{`P[^_ÐUWVSuF|F|džF8jRjSjhWP@$Ѓ tPFPh/F8jVtRWSP@,Ѓ tPFPh/&F8Vj:]SEEEEE jh/ЍEPh Ft# t4t&tt$t&/////Ѓ\RPhƠ/jEPܵjhנ/ЍEPj:SMQ w\PlRbFj,xSUB@u\Eƅx"ƅ{ƅzEEEEVF EEUFEj,&PlPh/E@,`RW\QlPjpSVF FFJpCCStƅt@@@jSMQlPeUB,&DždMyu0CKP @ {t5{/SKB B B {C VF FF9s9v,RWQlPh /育E@, UB(t t t"4*t-Džh DždvDžh0DždEXPdRQ\Q Wp hPlR tb uMA,`P&t UB,`QOQE@,PA%t&`Ru1MA,`PH[^_UEx0u P4@4@ÍvUVS]u S8z tjC^F$CFEF CFFF 0V _xG|À́E9GWh[Ѝ4P_WG`ЋEEj@E@t,Qt A B t&A Q AA$΋^CCUSjjVUaPP`PW@t(Qt A B A Q AA$΋^CCECjjVLJ|(jLPEPXƇ[j\PEP9ƇkUByxBztpBxlE/Ѓ |@t'QtA B A Q AA$΋^CCECjjV@t'QtA B A Q AA$΋^CCUSjjVtlEP蹃h/W't&Ph/W h/jhUREPwtLJ|UBЃDPPPWBjLPEPzƇPj\PE P[Ƈ`UBxBtB plE/ЃEP谂lx~ LJlh/jhUREPwtN <ML^<@~uTGP7|fG:fG<0jh"ЍG4PWi1e[^_ÍvUExlu Pp 1 @p@ 1ÍvUS]{lu Sp CpH u SxBtZSp Lt&hu RwCtx tjhjP@ ЋK|{ltCpH 1]ÉUVSuNluVp vFpX Fx@u/Vp,*t&Vp,ft&Vp ht&FpX,4ubFtx tjhjP@ Ѓ hvxu 胼~ltFpX,^|~ltFpX 1e[^ÍvUSMY|ylu QpApXylu Qp Ap@ylu QpAp@yluQpQp QpB B1[ÐUS]{lu Spu Cp@t-Sp hu sx脻{lt܋Cp@1]UVS]slu SpCp@usu/Sp*t&Sp*t&Sp:t&CpH@t5tыCpHhsxu {lt‹Cp@t&1e[^ÍvUWVSuEV0UV,~@tu jv(RMQ]st@ ЉÃ tXujhh/Sh/F$FV 2NvU Ex~AN M@G FG1ɋE;X}2t&]ˋBDAE;H|vG UB GMAtx tQj]sjSqt@ Ѓ F@ EPtz t#jpjqtB Ѓ h|ǃ]SVà t!~,t3UBtMQrt@Ѓ}tj Ѓ4PE@4@6@@ @,P#+URvE@,@0t'VtF B F V FF$uUB,@@8t'WtG B G W GG$u@F$FV 2UB,t&UV~B$F(B F,_ECUSj CPEp襰UBCC VGBEPЃPRV t2UBtB,EPsFUB, UBuEPs1URx)EPse[^_ÍvUWVSEp V lNkj@Ns`kl;}ltf~t"MA,IQ(1UB,J5$/Ѓj ]S EpEEEEj SMQ lj:]SEEEEE jh#/ЍEP˵ Wh+/jEP蓘jh=/ЍEP褵j:S]Slt&j,xSoUB@Eƅx"ƅ{ƅzEEEE<l\l1\l\1\EEMlEj,S]SPlPh`/詖E@,vjpSolJpCCStƅt@@@jSUR`QuuEp95xuAAYP @ ÁDždytGId;QYB B B QA ‰dl9s d9vIRdPSlPh/-UB,R%`Q{&l@t-QtA B A lQ AA$u*MA,Q%`SDo vEAAUB$A(B A,QdfBZkZ B]C-w+$/ Ex/u@0u t&SVQtCt UB,`QnX]C,S;$`P/`RXnu!1"t&MA,`S3nH[^_ÍvUWVSu1u 1vj@mxhm| *1ۀ}t"D+PVuCE9|ރEPVFhЃuƒ|PmxPxmX[^_ÐU,WVSuEEw/ЊE$Eh V@Ѓf=SIu:h V@Ѓf= Puh V@Ѓf= tYh0h@`V@fEjEPVzn f}@u EfEfEfjjV@Ѓ/v&fdžfdž fdž fdž$fdž fdž  fdž  fdž h h@`V@Њƒ t(tF0t*@t5:vE|/.&E聭/&E膭/&E苭/Ѓj jV@ЃhhV@ЃjjV@ЃhhV@ЃjjV@ЃOu+E萭/Ɔ/jV_K ch `V@t t&%t'hP/jVKƆ< &cQ*ftff9s A*dždždždžxt V@ЃtPjjV@ЃjdLSЃj h"V@Ѓj hBV@Ѓ ajjV@ЃjdLSЃjh V@Ѓjh@V@Ѓjj`V@Ѓ';jdLSЃKy#x xhc/V@ etjV@Ѓt먃jV@ЃujjV@Ѓ hh@`V@ЃjdLSЃjj V@Њ_(<u jVG PjVGЃ tSh VC Ph VCЃh@VC Ph@VCЃ hh.`=hh0`V@Њ< tfC>B@fC@BBfCBBDfCDBFfCFBHfCHBJfCJBLfCLBNfCNBPfCPBRfCRBTfCT1e[^ÉU VSE U11fEjfEt fEj EPuQf}@M11f1҉1 M1҉1 f1҉1 ֋M1 f1 M1 f1 ։؉e[^ÐUWVSEƅwDžx} 8UlR\MQTwG 9t5PPSPh/j]SˆG$w0GUhRb\EM)MUlChY)É؉B} MBʚ;iEʚ;B‰ uӉS1PiEʚ;hBPiEʚ;lAPxh /j EP u ?Bx@B1)ӉMu5 u,wǁ~Mh =LSЃEuS uJj@2MdUHuddR MX/5\/Ѕ:u (k,MbMu5 u,wǁLSLSЃ] j@LL‹HuUR;LG(kv-xX/Ћ \/ =uu(kw뉅xMbxU 9xGu)fE jMpQ]SMf}@tnt&EGU< t/jW@`E@,fUB,r$BPMQ BPBPBf Ph/j@W_ J1y tjj@PA Ѓ EPPWBЋEfJF@fFgx[^_UWVS}E M w$/Ph/jfEfEt;f@ fEfwfE<t< t< uf]fE 1ۊEƒ €E$ЈEjEPW~&f}@[Sh/jW^1KfE fUfEjEPW&f}@SVh /jW(^Eƒ €E$ЈE1J-Y ]st19}p9 tB9|1fuh`/jW]dt&UBf ÃfEt3@tfufEfEBfE#]]S f CfEfEfMj W_)1tPWtPW7twWqtcW]tOfEbjEPWN$f}@u213t%t!QWt&jQW$1e[^_ÍvU<WVS}E fUfuDžDžfP@  $EDfTDžDž s'ۋRW@ЉTf~fftW 2 tLJ􍇜PE$E5Ph/jWZ&PW  tf@usEucEPPh/jWdZ PWCPPWCЃ hph@`W@Ѓjj W@ t&/vWPWBЉfLf9t6LPPh*/jWY t&Lf<t<01 PWBf PWBЉÃ f;t F~f9t\hph@`W@ЃPPh@/jWX  RW@ffNf9 f/v=jdLSЃ PWBfjj W@ЉÃf9/wEj W@fh W@Љƃ t fPPPPh/j WW fNhph@`W@Ѓjj W@Ѓ Pf^ fLJPDž؉x@?f1y tjj@PQA Ѓ VQWa>CFCfFC fF C fF CfFCfFCfFCF1҃DD2B~1ҍt&D D2 B~&"PPW=vƅ19}0TKfHA9| fHA~1t#pPWxF9|ff9BfBPQRWtNfpVRW<AFAfFA fF A fF AfFAfFAfFAF1҃DD2B~1ҋD D2 B~>PPSPh/jWTf /ЅtPh/jW\TDžƅ1C81PAPhݦ/hP2@ @uƒPSh/jWSƅ @|j@PnDžFt7h/jWSPPWBЃ thɸ/j WLSFth޸/jW3SFth/jWSFtPh /jWRV9wu2j@R nFPPvh`/jWR0yFft$ff9wЋp\us^ j@Pm>tPvh/tPvh/jW2R PPWBЃLftf;wDFt>C,EC ʃ@tʃE$ЈEtC,t F tN F tFCXcSVW {,u {XuC,FC(F t:{Xu4 t/{,uC,F ~ PC4PF PVS~C H@tIL EȋC ʃ@tʃE$?ЈEdt&F@uF tFC(C(F t?{Xu9F t3{,uC,F ~ PC4PF PRN vs$h/j@WP ct&Ft CX(C, {,uh@/jWOC,C$C(#t&Ph/jWO{,uC,{$tztFPSWBЃfu tq{,u{XteF tC6$< 0W .{Xu?s,PCXPs(s$C @PC @PC @f Ph /jW O0FftFHfFBj@Qj@tf9ht\PPWBЃ PWBfH@ ;} f@fLfLJP1;}2t04S@F;|Ѝ[^_ÐU,WVS}] E<t< t< uh W@EESh/j@WM?Z$Խ/ЊEƒM €E$ЈEEPjWGjjWGWjjWGEh/jhк/j RW@uh/jWLEƒM €E$ЈEouh+/jWjLEƒM €E$ЈE*t&hB/vh\/jh/jh/jh W@ЉÃ%=tI =tp=h/jWK``Hqh/jWpKH``Ah /jW@K`H`Ph@/jWKEƒM €E$ЈE&Et&ENt&Et&Et&E|t&1;h`/jWiJ8<Kh W@Љ‹fP `B$ BE$ EWjjWD@11ft(&ptB@,A9|߅Rh/jyE$ E`B$ BWGjjE$ E``WjjE$ E``WӼjjPE$ EB$ BW衼jB$ BW聼jjWPC tBt$ 0$ BWIE$ E`B$ BjjWBh/jvh W@ЉÃW ÍP$Ծ/Ѓh/jthѼ/jhh/\h&/jWGjjW_BWbjjWIB5vh@/ Ph/jWRG jjWBE$ E`B$ BSh/jW GEEE EMt#SW@ЉEMfHAME}~EE9E}:u]PWj Ph/hWuF EM9M|B;E}EfB(,Ee[^_ÉUVS]uE Hw-$$/Ѝh/jSF604Vj S@uPh/jSE1e[^UWVS} uW ƒ+J $/ЍvG u1V BPBPBf Ph/j EP^E G PV BPBPBf Ph/WV BPBPBf Ph/h"/hTS1G tSh+/hS1G tSh6/hS0G tShA/hS0G tShM/hS0G tShZ/hS0G tShe/hS0G @tShp/hSe0Sh}/hSQ0GtSh/hS70GtSh/hS0GtSh/hS0GtSh/hS/GtSh/hS/G tSh/hS/G@tSh/hS/}Sh/hS/Sh/jEPACSV BPBPBf Ph/CV BPBPBf Ph@/jMQBUEF ʃ@tʃME$ЈE~,yF,mV BPBPBf Phi/jEPoBUEF ʃ@tʃME$t&V BPBPBf Ph/jEPBUt,G t&F @@T+@t tL*~,F,GF(V BPBPBf Ph/ft&V BPBPBf Ph/V BPBPBf Ph@/]t&V BPBPBf Ph/V BPBPBf Ph/t&V BPBPBf Ph/V BPBPBf Ph@/vt&V BPBPBf Ph/ V BPBPBf Ph/mt&V BPBPBf Ph/V BPBPBf Ph/t&V BPBPBf Ph@/jV BPBPBf Phf/V BPBPBf Ph/UtEGf ƒtF$9Gv./Ѕt/Pwv$F PR@Ph@/j GF(V BPBPBf Ph /V Bf PBPBPh/jUR>&V BPBPBf Ph/h/jEP>Jt&FXPV BPBPBf Ph /jURO>FX(F,V BPBPBf Ph /jMQ>V BPBPBf Ph`/V Bf PBPBPh/jUR=MtjF @t@@fdߋF @@L UEȋF ʃ@tʃME$?ЈE~,F,V Bf PBPBPh/jEP=UF @t@@fdF @@L MEȋF ʃ@tʃME$?ЈEJt&V Bf PBPBPh /jEPT<(uF @Ph`/jURt&F @Ph/jMQ<U@wfDžDbjDPRME$ EB$ BQ褯jjEPp6F @Ph/jUR;~,uTF,KF @Ph/jMQa;~,u-F,$G Ph/jEP;;~,uF,([^_ÍvU WVS}U ftf;wȋp\uPh/jW:q&ftDC(CX{$txtQSW@ЃFftFHfF8<S-e[^_ÉU$S]d| ~t Tf=@tfǃfhph@`S@Ѓjj S@Ћl dt t 2t )fE XfhfE@fhldfEfHffjEPS 1]ÉUWVSuڀ/Єt/ЋM  M HfM}Lx$<wt?MU$<wt?U11E EsM RURV@Ѓ}uTM ffEGv}u!}fdEDE EhPh@`V@Ѓ}thLSЍe[^_ÉULWVSut /й /й^] ]9r} f@Sh/eMHLH$<wt?Mˈ$<wt t&?MЃ}u$}u] f@}Wh/jVu7c11E t&EsM 9RURV@ЃTMȋE f8fECvUfdMЈDE EhPh@`V@Ѓfft<u 1)ډ)Ѝ\t&EPEPEPVЃt"EPEPEPV-Et&hLSЁ9} EuEdPh`/idžju7Ph/jP> tt΃#u3E$EdždPh/jV5EtE$El11Ґt&EsM } fCv}:}0}EPh/jWU!1ҋM =@tz5=@ =@=@t9t&=@ty=@tA=@tIt&=@tI= @tbw]/zEts/lEtf /_EtW/PvMtE3/>]t5J/.E t'a/ vu/Ph}/j]ST ڃtRWh/jV 4e[^_ÐU$SUt3fEijEPRf}@uUC$ЈC]ÐU WVS}1E؅ts VWFue[^_U,WVSu} Eи!E$?ЈE‰UeEE] u%$WMQh/jV2 `t&tfE(#E&4fE8C€fSfU0t@fUEu fEt&C$fC fUSC% fSERfPEPEPWh /jV.2$ E U fEjEPV}u3Eƒ €E$ЈE>UEfSCf$Ј MMEPjVS, E}iEE &ut,Eи E$?ЈE E}~e[^_UWVS}[U ЍBC CfCfCCCCCkCSC S$f tff#@uWjt@tt9hR/jW%0AQ CSAQt0hl/jW/ C S$A Q$tE @N $C$ pCv C$ C$ CfCfCCC C C 1ED L  My@uuW @uXfE%juVWf}@t 3U U1f$ˆ1f$ˆCPC PC PC PCPPjh'/h`/jW\.(CPCPPPPPh'/h/jW.E0sfFfFffFB<w ZB<w Lvu >&uvuv<:vCu  ˆVNNPFPPEPU Rh'/h/jWE-0 E}%e[^_ÉU WVSuV賅Eth/S tOV’EuE$ EEth/jV,fdžFsftmf9wh׋p\tWft f9wD{$t%xtRSV@ЃC$C( vC(C,SGf9ve[^_ÐUWVSUtDžƅ5t&<wDžƅ&Džƅ1ۃ]PSEPC~fISu PtPUh/jRK+PPPh/jEP +9}#t&WSUR&C9|1;}+C;|t h/8s"Ph /jEP*EB<w2SjUR E u~SjP p uPj% tu&SjEPSjUR-tPEPPUR 1[^_ÉU WVS] UjjR@ЃjLSЃUjjR@ЃjLSЋU t<@ut&<wf] ?ˀf]΅EsUSjR@ЃjLSЃEPjEPBЃjLSЃUSjR@ЃjLSЃ NtEft&Uf"UjjR@ЃjLSЃUjR@ЃtEjLSЃUjjR@ЃjLSЃNyUjjR@ЃjLSЍe[^_ÐUWVSEU B$ЋM A  $ЈEuQC$ЈCU BC BC BC B $SˆSMvƒ Ct SE P $ЈM Q $ЈQ $ЈQ $ЈA CfQ fA  fSfQfA fSA$SˆSCPC PC PC PPPjh1/h`/jEPd&(CPCPPPPPh1/h/jUR&E0M M1E{vUM DQ$WˆWUDQGDQWˆWELAMOMw"}wGW ~~ ʀWfEU DBtfDfLUBt fDMAtLE@ tL UB@tL@My}LfDDPDPDPEPjh1/h/jUR$T$ЈDDDDfD0E EE}e[^_ÐUWVS}E @4UGˆMuG} tF$ЈFG} tF G} tF G} tF _؃} tF$ЈF؃} t$؃} t$ЈW$ЈW$ЈG} tfG} tf fVG } tfG!} tf fVFPF PF PF PFPPE Ph1/h`/jUR"(FPFPPPPPh1/h/jMQ"E0EE^} u UD:+ M9$SˆSU} u MD9) M9D2 M} u UD:+ U:D1$ЈD1U} u MD9* M9D2fC} uUD:(&M9tKK} u UD:( M9tK} u UD:( M9tK} uUD:(M9 tK } u UD:( M9@tK@} u UD:( M98}KfCCPCPCPEPU Rh1/h/jMQ S$ЈCCCCf0E E E}e[^_UWVS}E @4UGˆMuG} tF$ЈFG} tF G} tF G} tF _؃} tF$ЈF؃} t$؃} t$ЈW$ЈW$ЈG} tfG} tf fVG } tfG!} tf fVFPF PF PF PFPPE Ph1/h`/jUR(FPFPPPPPh1/h/jMQoE0EE^t&} u UD:+ M9$SˆSU} u MD9) M9D2 M} u UD:+ U:D1$ЈD1U} u MD9* M9D2fC} u UD:( M9tKK} uUD:(t&M9tK} u UD:( M9tK} u UD:( M9 tK } u UD:( M9@tK@} u UD:( M98}KfCCPCPCPEPU Rh1/h/jMQS$ЈCCCCf0E E E}e[^_U WVSEM A11A1҉1 A1҉1 A1҉1 A1 A1 A1 A1 ։ t9S1Ph@/jEP؉1 u / 5/Љ_ w$U< tJUWVSUB X t-=r7uǃЃMQ&x}@f ƒUэ1}GuEMs}W=r7u߹E@ E@ttߨt}fLL EиM E$?ЈE}f >EP e[^_ÐUWVS}G X ShЍGhEPiG @;rG,j@4 ‹Hu R# EjjS@ЃSwE tit jhjS@Ѓwǃ G,eE$ EtjhjS@ЃGt=G,wǃ svu S6 tkt 8 vwǃq hw/jSb1GtEE WSƊE$ˆwWkƃfeNNgth;1Ot1Mb)Bu7PMQ襮O F9FFPh/jSX ?ˆh/jS"t 81[1G PR@Ph/j SWhЋEP諭5u7ЋMQ赭O  t&wǃn e[^_UWVS}u EV譧ftet*-gt0hu#~,uF,&^uEvhLSKu}t<EPEPEPWЃtEPEPEPWpFtFu)VjWt WM~,uF,e[^_ÍvUVS]SSC p tChP趬c C tC h/jp c S谈<u"?h/jV Ve[^ÐU\WVS]C p j@x ‹Hut&B/R^ t19}p9tB9|1ECtEPh /j V tURh`/j V c CEPEPEPVЃtEPEPEPV胯Ct)MQh/jV c S3 RvSjV{$txtURSV@ЃMQh/jV2 Eftf;wЋpDC,c St&}EPh/jV c KMb)Bu7PChP賩K  EPEPEPVt2ndžZ QK j@W%GEfG C @$G ]SWVGCGCG C G fC G fC GfCGfC1ɍD9D A ~1ҹD: D D:$D$IyJ1y tjj@PA Ѓ EPPVBЋEfJth/j V4 wdž e[^_US]j@ ‹Hu R jjS@Ѓwǃ} ]U WVSuF x j@D ‹Hu R3 V菡fe(<gth)F PR@Ph/j W ~WhЍ^hS謦NMb)Bu7P&h;/jW ?ˆt 0eV BPBPhX/hd/jWVhЍ^hS5u7SN  ~,uF,V~wLJ e[^_ÉU WVS]j@n ‹Hu R] $uvtr1ǃwǃ 6P{uGuWhq/jS/wǃ e[^_ÍvU WVS}uCt?1LJ؋PuFuVhq/jW>e[^_ÉUWVSE }$/Аt&E`P?vMʉU}eETUULUtftbUD tXBu < t|5 t t t$t&P,(%!ؙ1ۋM( t t'(t////Ѕt0QEMD PSWVh/jEPt&QWVh*/jURt&1t7VhH/"E ?‹Mhc/jE$?ЋUu#RhЉPMjEP hm/j6Utlt`I(Err rr/B@t/PB407rBPQh/jUR}luh/jMQ`Oh/jUU1t]tF t8vt;i=tI=t9W&=t9G&+/>5/7?/.I/'S/\/f/K/ЃwPh/jMQ EuGU9BfBEuEuU9}N REL(Bv&ˋG9CuG9CuG9Cu G 9C IB9|9UB9}BvRM\(C Cu9uh/jEPWC$ЈCGW CS GWCSGCKlUh R@ЉËM<t< t< uUh R@Љƒ1҃PPh/jMQ 1e[^_ÉUMU tft-APh4/!EPu~h9/ÐUVSu1ۍvu 0 @0|@79}أ@71jdLSЃCߓ~e[^ÉUVSu1ۍ&u 0 @0tD79}أD71jdLSЃCߓ~e[^ÉUS]u %=t=@u#jStCPh@/]ÐU WVSu} 1ۍvu %9uH79}أH71jdLSЃCߓ~e[^_US]{0thb/S>;u %= t h/u  t!h/o&@t싃@Sth/.hSu 1&h /Sj:]U WVSu~0thP/V@:t& t& t&X@R@ K@C@7@ +@h'LSЃ@t&0t VЃ,t0tP0Ѓ(tr1u XSh[/V)8thLSЃG~Vǃ}Wh/e[^_UVSuVpÃt.VZhVà th/V7؍e[^UVSuM t9th/.y uSh/VC7)A$AA At&e[^ÐUS]M t9th/&A$AA A]ÍvUS]tC9t h /Lyt h`/9AA ȋ]ÉU WVSu} G$~0~_wPh/V6s ss3h/V5(ssssh/V5s,s(s$s h/V5sjuPG$PVWV>17hw/V."@Ph/V.G$PVPe[^_ÍvU WVSEPËshV4 FUF~fM NC耉F F щF FURSMQE hLSЃEPM-E }{ t̋S$҉ЋM+@t/@Ph/Q-C$PEP<RUR%Ff=tf=tf=uL4f=u" &vh/ЋMQ'-.f=uWEPCPSURh1e[^_ÉU WVS}W'Ƌ^j(S UBU t" tPh)/W,X$UBCCSE CF耉C C ՉC CCf=tf=tf=uLf=u vf=uRFPUREUBWVW1ۃhLSЃW0+C t<~ t֋V$҉+@u:RWDVW1IEUBhG/Wa+)&@Ph/WE+F$PWe[^_ÐU,WVS]CPEPjjjSb V{0~%CSPCRPCQPCPPh/S* S\URjjjS  {0~%C_PC^PC]PC\Ph/S* ChEPjjjS {0~%C_PC^PC]PC\Ph@/S;* 1tUEEVWjjSe Y{0~9UPPPPWh/S) EPWjjS {0~9UwPvPuPtPWh/Sf) EE E G2EPjSt h/{0~sXsTh /S)URjS{th`/{0~sds`h/S(EPjS;t h/S(Z)v{0~Gspslh/S(11DvPD3uPD3tPWh /SW( G~1tUEEt&VWStWh`/Jv{0~#EWh/S' URWSMtWh/S'){0~#ExWh /S' EE E GL1e[^_ÉU,WVSuNL fdžfdžF`9tsSPh`/V)'F\EFdE]}WjV# u(WjVtuU9th/V&EF\V`EFdEE&CECEEE~0~jjEPh/Vr& }WEPVvwWEPV^ECECECE~0~&E00xEPh /V% EE};1e[^_ÐU WVS}WƋ^j SC CE CWi0~E PhM/Wz%VW!1ۃhLSЃW$C t~ tփVW1h^/W"%e[^_ÐU WVS}WSƋ^j SC CE W0~"w/Ѓ} tt/Ph{/W$VWQ1e[^_ÍvUEu4 @4ÐUEu4 @4 ÐU|WVS]ǃ11PS(F{4t ~ v~̃{0~2u P Ph/S# u %t=@uSt 0E&u %=t*SIth'LSdEPSt h/7{0~ EPEPEPh/S" EfC<EfC>E$CBECDEPSt h/{0~%EPEPEPEPh /S[" E<t<E<u C4C4EfCLE PSt h/S{0~h/S!h Sth/{0~h/S!19sRSBFCB%)ĉe~Dt (t1zWvDV0ÃtSh/V9x~h/V&EEF>PjUR}E@@ƒ @ BB BBBFDB E}E~0~ph/V1ɋ;Z}IBH9uMT W$ E ‰EA;J|vDURh/VMQEPVà URjVAÃuJMy~0~Wh/VDuFDU9Btvu Ɔ!h4/VV0dž(؍e[^_ÍvUWVS]E(sDhI/S,t(he/P{Du t&(hs/St(uuwG45Gtvh/и ;T)PSNÃ>}ٸ:TЍe[^_UUtvh/и }ٸ;TЍe[^_UU/Ѓ=/|t&9u @&&8}Rh/j@h t&P.t&Pt&Pt&P ÐUS]SCPPh/CPh/CPh/۽sh/˽]ÉULWVS}uăjh/.h/h/h/7h/*v(h/v,h/ FPh/ 1ۀ~tD3Ph/ڻCF9|h/G0Pye[^_ÐUExu P PaÍvUEtrt%t'& ///$//ÐU WVS}E1 v}h,/ 0ttVg0t)`RwWh@/պhg/Ⱥ 9PGPGPwWh/褺1 Wh/菺11t/h,/shg/fh/Y t2uh,/8hg/(h/C t2uh,/hg/h/C }2uh,/ƹhg/趹h/詹C @t2uh,/茹hg/|h/oC t2uh,/Uhg/Eh/8C th/#Me[^_ÐUlWVS]} {0~h$/S {4%Of GtOf!vOf WtE䋌xM苄|E싄EGt t& MeGuCCUKV1҃}t ~}t    UuVGPSth1/VGPSUt h`/bWE䉄tE艄xE쉄|E{0~2GGxGPh/Sa uEPWbFtGPh/G@UUEEPGPSwt h/{0~uuGPh /S Uu}u{0~ThL/SD< v }u{0~/h\/S~t&EtEPGPh/S]1%w$$ /Аt&P(t& ЃPPP%P tPP/Єt/PGPh/Se[^_ÉU WVS=hVЅt&E9G$fEEfuG4txE PjSEP<tEtfpQt&E PjSEPtEtfp%E PjSEPtEtfpEfEf;Ef7e[^_ÍvU VS]C8ǃlQǃQЉǃ`7Ѝfǃƃ{4tfǃfǃfǃCLfN{4t  t&ЙfF EPjjjS_ t h@/?UЃCH{0~7EPEPEPEPRh}/SsHh/Sjh"VS`v{4u jSe[^ÐUVà ue[^_ÍvUS] EPhB/έEPS-hG/购]ÍvU WVS}u ]t-WFt1hLSЃKuոe[^_U WVS}GX s hI/VMSBj@趇 E_$ V t&9_$t!h`/V EP蓇 w$Ph/VVu Pu4 @4Pu 0 @0Ph/Vsw Ph/VY ~0~wm11t&(B~4t ~ 9uG RVEP臆 e[^_ÍvUWVS1ۃ} |Eu E EeU)UMM}0~rUBPh/WMq qq1h/Wf(}wwwwh/ЋEPFw,w(w$w h/ЋUR) Mq}4}t} WEPURR t&Vh@/ЋMZ|}4t  ~Vh/ЋEP^M‰E9tVh/Q1}z t-j hMy)ljPERB Ѓ MQB<u}0h/W<vt!Ex0eVBPh/ЋURMYq$Ph@/Ћ}WEp +Ph/W(hs/WUr }t"h/WMQ } Wh/ЋEP[ChPw]s {$tUMz t+C tP}GpjwRB Ѓ UMqP@Ѓ} u C, }uC,CXC(UB CXBL$/ЉMA{$)lj{(A CXt/ tW&t+(t6Dt&C(~&C,n&C,^&C,CKt&VS=CXPh/ЋEPC, t&C,&C,UB t{4Mq t {XuC,}t }|EPUR}te M Q}W$t KS7e[^_U,WVSE p j@证 ÃURyE u%M A,IQ`7S菁 7S聁 E }GWUjR9UEU B$MA(EB tE]0}G>1}jSUMA CA$  U}G>9uʀ щ MFEUB>H9r+EMA}߃EP>9EvHEBGUB>$MMGEf+EUBGG01;u}jSUMA CA$% UEH9u ʀuA MFE;u|3}z M A tP}GpjwU B$MA(EB tE]01}G;p}_jSMA CA$  U܋}GH9u щ FUB;p|Mz tK} G tPMApjqRB Ѓ E0jP[}O3уEx0~URj@| ÃMQh8AЋu hVU } Gu#WMbu7RVUURMQ貽S| } Gu1+E pPURt MQOe[^_ÉU WVS}U uBt/ txtRWZ0~Sh/WH|i4t ~ YQD >B%x44t=~%t&=@ p$$VW舽BPh /We[^_ÐU WVS} WB $/Љwh@/ЋEPth_/ЋEPc 1f?tZuEPhw/+څ}S)к u RG4h|/C9|hG/ԟW%PRh/GPh/h/GPh//Ѐu/PG!Ph /{WGw t%PRG!Ph@/ЋEP# WG=t =t3a%=uh}/t&Ph/%=uh/t&Ph /%PRh`/&%PRG!Ph/I%PRG!Ph/)%P%PRG!Ph /ЋEP $wG!Ph`/ Rh/ЋEPtdEP1ƃu h/蛙^jSCGC GC CEPfVEP9e[^_ÐUSUM ]z4u(A<tt<tQ RrK[ÉUEP Pr ÉUEx<~@<PU WVSujRUR WjhU RP@$ЉÃ tSh /Vj(RU RWP@,ЉÃ tSh`/VmRjjU RURU RP@ЉÃ tSh/V*TjjU R(P@ ЉÃ u1tSh/VP@ЃP@Ѓ U R(P@0Ѓ WP@(dž(؍e[^_US]P@ЃP@ЃsD(P@0Ѓ SP@(Ћ]ÐUE tPh$0ٚÉUS]SCLЃǃfǃp7ǃ7fǃjhSЍPS7]]ÉU WVSu] j@t ǃǃ`LtLP LPLu P|AWxt e[^_U WVSu} j@?t Et&t7LtPP PPLjjhhÃuFPh10+hhS %ځ ЉX|NPTǃ`6u/jjhH0jP< `EP)s ؍e[^_ÍvUM |UP &Tt9XuU WVSE \`u!EPh`0h0{,U zt/B=uC,PEPh0^M ytfAt t'5t&{4u ,C,;vC,/&PEPh0_C,C(E PURKS'e[^_ÍvUEx<~@<PU,WVSEp V U@EPRÃuUB,E\UBdRhlZЉЃhP-JEt $ D"$ BCPCPUrm $LjC€SV$ЈCV$ЈCuFC, % ЉC C CCF$S$UUE~ ρ% EutH%E)Љ9vƉE)%t ρ;UtuEpEEt$} ~j!EPh05E %e ECUB$C ECCCG CCC j@Xo ƃSURBDЃVXo uu1ldEPURBHЃtJSPduVEP‹BHЃ t"S(uF,SEPe[^_ÉU WVS]\@ p P_)h 0j@n ǃ`th0Փ8h0Ó\@,ǃd`SVFDЃ W7n e[^_ÐUEU M@t9u9Ht @u1ÐUVS]ShԫЍsHVFujjjujjj t uhu0ݒt& ~PCPh0跒47h0蕒gfff)ˆЃ<uƃ)ʉ)Ѝ ЙC @ƃjSJfCfE C|ECtfCjjh"ЍC`PSTu7+u7PVsEe[^US]􋃈S@ Ѓ7thjh0ƃjjS@Ѓ7thjh0BƃjjS@ЃhLSЃ 3$,0Ѓ Pj SBЃPj SBЃ Rj S@ЃRj S@ЃH ƃƃhj S@ƃjj S@Ѓ PjSBЃPj SBЃjjS@ЃPjSBЃ rCPh0PjSBЃPj SBЃjjS@ЃPjSBЃuRj S@Ћ]US]􋃈S@ЃCPhT0 7thbjh0&ƃjjS@Ћ]ÐUWVSu7tPE Phl0薎=7u)jh0jjjjLh`t&7thjBh0WƇBjBjW@Ѝe[^_ÉUVS] j@_ C Sh`t C,0vU BH$><uBDC(REPU BDC(K7tGC(tPh)0{C,uC4Ph40&PhB0{E PURU E;u&ǀtƀP{,uH~uB~u<}E UVt F B vV FjV sE PURES] e[^_ÐU WVSu FP BMJ1ۅuw ʍG u SQW9pu @@~ItVJH< t  HF t&$F tFB FUVe[^_US]7thL0z7thjh0yƃjjS@Ѓtu jLSЋ]ÍvU WVSu} t } t*Edž ‰U hY0GujVп!ǃ ux19}jVЋUC9| tmjjV@ЃjVЋUCjVЃV %19}jVЋUC9|⋆؉7tgPy0Ѓ} us0АPh~0ix7t;1;s$Ph0;xC;r܃h0"xe[^_U WVS}u7tVh0w&7t419}U Ph0wC9|h0w19}@M  RjW@Ѓ ujjW@ЃC9|e[^_ÐUWVS}E uD"ЍBtRGPh0wu@Ȋ] Ew Ӄ u1RPEP/t8Ptxt U&} tƇ1)UE}u*EPURPVGPh0Pv t&ƇEE PU@PUXÉEMbE)Ɖ)9}Ft!Ex2wEu  EuUu EtURj W@ЃEPjWBЃPjWBЃ Ex }q7thLjhK0u7thLjh0tƇjjW@Ѐ@~UB @to7thNj hK0t&7thNjh0wtƇjjW@Ѐ@ UB<BD17thWjhK0t7thWjh0sƇjjW@Ѐ@j7th[j hK0s7th[jh0sƇjjW@Ѐ@ e[^_ÍvU,WVS}7th0$suGPh0s t4t+PRGPh0rLJ7tPh70rtc7thjh0zrvƇjjW@ЃPhH0ixUB @B EBJMZÉEܾMbE)Ɖ)9}Ft#My2wE䃿u t& E䃿uEu &EtURj W@ЃEPjWBЃPjWBЃ UBMa@t&UBp [ h 0>t&7thO0g&MAp  h`0g 7thjhK0g7thjh0vgƇjjW@Ѓ@j: u fuPGPh0\BPP/x|@PGPh 02f@fjjPW|GPh@ 0f7thjhK0ft&7thjh0wfƇjjW@Ѓ@nv7thj hK0'f7thjh0fƇjjW@Ѓ@ ft=7thjh0eƇjjW@Ѓ7thjh0ueƇjjW@ЀLJe[^_ÍvUWVS}7t#Ph 0 et&@tg7thjh0dƇjjW@ЃfLJLJt&u~7thPhK0hd7thjh0GdƇjjW@Ѓ@f hGPh@ 0c!ff !fLJ31(@ &=t=A@ @E@@MABABLJ}A A QUIMEXӉUMbE)Ɖ)9}Ft&My2wEu  & EuEu &EtURj W@ЃEPjWBЃPjWBЃ ut&A@ H@@BLJ!thGPhm 0UaQR RʀthGPhm 0aAIAJBLJ A@ @E@€MQuQQI >,!t& u`WW 7th_jh0`ƇjjW@J9vЉE􋗈EPjPPWBЃEPjWBЃEPjWBЃ @u  u:URjW@Ѓ ujjW@Ѓ7thhhh0 _t&ƇhjW@Ѓ7thihh0^ƇhjW@ЃW@Ѝe[^_ÐU,WVSu7tPh 0b^􋆈V@Ѓu1jVЈjV$  uj VЈjVЈx$t V@$Ѓ u$ t&7t0PPPPh0c] F<jVЃtM7thjh0]t&ƆjjV@ЃjLSЃ tFPh 0\jvFPh 0XUf@X@jVЃtM7thjh0K\t&ƆjjV@ЃjLSЃ<t<u3MA@,QV@}$PPFPh 0[jVЃ7thjh0k[t&ƆjjV@ЃjLSЃP􋆈V@ Ѓ􋆈V@ЃuFPh 0ZjV 􋆈V@ Ѓu:tyjPPPFPh@ 0Cvu?}tMADPRPPPFPh 0Z FPh 0Yun7th3jhK0Y7th3jh0YƆjjV@Ѓ@l7th5jhK0gY7th5jh0GYƆjjV@Ѓ@ Lfdž7t&PPPh 0XjVЃt=7th=jh0XƆjjV@Ѓ7thDjDh0cXƆDjDjV@Ѓp$(0Аt&UB@,BX COt&yuJyuDAu9w D8 QtA B Q AjQ襙OIut&tI}tMAp hC 0dWUB@ @uXFPh] 0(WMA t hy 0h 0WEP7 EPVnUB@,džBN $@0ЉFPh 0VtFPh 0h 0gV  jVЉÃSFPh 0jVPh. 0V KM䊆fdžfdžfdžƆ7th4 0UEP EPV UtPt&M䉎E䉆PH džƆtFPh 0/jVYÃ~~Ft=PPPSFPh` 0T t&7tPh 0Tt&V/tF7th jh0OTƆjjV@Ѓtu<GPPFPh 0SjV$<}uh 0OvMAX C)$d0Љ7th1 jh0gSƆjGuUzIuFPh 04 tFPh0 }k7th@ j@hK0R7th@ jh0RƆjjV@Ѓ@@GGGMyItz7thH hhK0\Rt&7thH jh07RƆjjV@Ѓ@f7thJ hhK0Q7thJ jh0QƆjjV@Ѓ@n7thM hhK0rQ7thM jh0RQƆjjV@Ѓ@džtjVЃ}PPPjVЃPCPCPFPh 0P 7thm jh0zPvƆjjV@Ѓ7thn j hK0:Pv7thn jh0PƆjjV@Ѐ@ v7thr jh0OƆjjV@ЃAt7t-PPPRCPCPFPh0gO džUB<BDƆt&PPPFPh0 O 7th jh0Nt&ƆjjV@ЃjLSt&g$u,PPPFPh@0lN jVwPFPh0>NDMAH\7@tPAHPh0Mu,UB 1uMQDuAP(ƆPFPh0Mdž7th jh0MƆjjV@ЃRFPh0MMV eu}u h0 ItS t=7@th0LVodž7@th 0L u |=7th jh0FLƆjjV@Ѓ 7th jh0LƆjjV@Ѓte u,PPPFPh 0K ߃9PVV,+PPPFPh`0KK dž|t&7@tEp@B/Ph0KjVЃt@7th jh0JvƆjjV@ЃHMA@E/􋖈EPjPPVBЃEPjVBЃEPjVBЃ @u  u8URjV@Ѓ ujjV@Ѓ7th hh0IƆhjV@Ѓ7th hh0IƆhjV@ЃV@PEp@/PV;7th jh0/IƆjjV@dž)7@th0H7th# jh0HƆjjV@Ѓ9vЉE􋖈EPjPPVBdž7@th0JHvuD7th, jh0H&ƆjjV@Ѓ9vЉE􋖈EPjPPVBdž Ub EPjVBЃEPjVBЃ @u u>URjV@Ѓ ujjV@Ѓ7th9 hh0 Gt&ƆhjV@Ѓ7t&hC }uPh0FUuuPjVAЃV@7@th0ZFv7thI jh00FƆjjV@ЃdžGFPh0E&MQVƆV~]SPSЉ߸2GG=@B~ EGv􋆈V@Ѓ(]SPSЃE9EsG9C~fe[^_U WVSu} GO @;uk7th j hK0D7th jh0DƆjjV@Ѓ@ @B~Mb)u7i u7Mb)ÃSGPu Ve[^_ÉUWVSuFEx _ GEWN 􋃈S@ Ѓ0Ѕtx0RPPjSЃPPFHPvDv VCPh0qC4j@ EF @th$0NCjShh,04CE@,VS ;u?E@t6u-WR h.0BGH EPr e[^_ÉUWVS}UEj@- EEKtnE9A}ayu[yuUAu 9w&0Qt A B &Q AjQK또t&I뎃@@MyEP u7+u7PGHPe[^_ÉUS]jSЈjS$  uj SЈjSЈx$t S@$Ѓ u $7t4PPPPh0@&]ÐUWVSuFY@jURj}WjhhP@$ЉÃ tSFPh`0jRhuWP@,ЉÃ tSFPh0yRjjhjhP@ЉÃ tSFPh0;jjhP@ ЉÃ tSFPh 0?<@ F\vPFXtfF8u  @ffF6ftf;F8rfF61ҍt&B~FxF|FpFt11ɋ`09Flud09Fx}Fx9Fp~Fp B vց~xt~puh`0:&11ɋ09Flu09F|}F|9Ft~Ft Bvց~|t~tuh`0r:1e[^_ÉUWS]@@hLSЃ@&Sʃ-@vChB&@@9w@@O@A%@N@O@H C6 @BtuK6BJuCY t!;CY t!B;CY GIOCK6J뉋C6 @Wt&H &ONA@9Z0Ch&B@>M@O M @Ot@MCYt:uRt&@R u"j LSЃȉjdLSЃd BO&V@M tPOJvO9M)¼tӋ@MCYt1u"싓" B" B"CYt/uG싓G$BG$BGCXtZƀuRB@R%CY@t(C\}t&t1SЍe[_ÐU,WVSE0PUB PUHEXUR @B(UB @@@ zuB ʀʀ0t&FZtU@uUB ʀʀ UB ʀUB @PUEUR BuUu FXt u FZt u$QEPV?Gt1u%UvdvtjuV t%UjjuVq kt&t-UFd~PvpjuV6UEPVut UztJuF @ E@ u~uOhUB hP6g1ۋu)EH T$ThUJ ֋V TlCV;Z|ύe[^_ÉU WVSE0X@@ @EUz ;'Gtt8cU` Ct CUH ccC CEPV GPURFPh0X6GPFt& @ .U @G(tЋ R PCt*Fd~PvpjEPvURV% vt0Ct) CUH & @ BcU` U @G(t R PC CEPV CPjURe[^_ÉUWVSEUXPR RUp E;cVNM~t}WEPh0vME;Hd ;Pt|;P|~"R}WEPEPh 0b4E1ɋ0Ћ}9Glu90u}{S 0ЉEK E}vȋC uRUREPh0~FPMQEPh03cCC |>}@ t&EUM@E}M¼@t& Cu}Ǭ>H >` >eU P>` >C? B>@>HMQEPO U>R P&M}@Bt&EM@'}WEPh@0E2FPe[^_ÉU,WVSE0PU@@ @EEMI MFd~]{SUM9a9;~p;~x1E&]䋃`09Fl9d0u}UEPx M` E䋐h0 PFXu H ` U `  e?e] X @E B [EE@PU `  `  `  @UB B[ @ t&M@};~x9E~EFp9}1E`0Љ]9Fl9{uUEPx M` EP PFXu H ` U `  E? C @URWjMQQE B `]C CU `  `  `  @jjjEPEU:u MQVU @]C(k R Pt&cM@B}ue[^_ÉUSUM ]B B DB DB \B ]\B HP[ÍvUSUM ]B B DB DB \B HP[ÐUSUM ]B B DB DB \B DB ]\B DB DB HP[ÍvUEx<~@<PxUWVSExG u 5 @5Ѓ~RCPh0p-&MA ThUu$ H$G J{Xt,uf xt&u @ Et>u"&@" E%)Ee ȃ)EeMu @  tA@tCZuAUB@t,u  @ tA@tCZuAu싓 B BUB)ȉB e[^_ÉUVS]1u "@t Bt&uum&@tYjLSF~h0"+tB$Bt&싓$e[^ÍvUVSu1ۍvhLSЃu B @Bu C @C0u R @R%uN @N؋=tH @t=tTFPh0* BNFPh0)tE#vFPh$0)t6$߈BN?PFPh?0LN$N$N CqFPh`04)1e[^ÍvUVSuu/B.t&B 2BDt&@؅tЋ BvjdLSЃtXe[^ÐUVSuM CtP0ЉC t0PCt0PQFPh0A( {uh0&C B$0Ѓh0xh0nh0^h0Nh0>h0.h0h0h0'sh0w'h 0j'FZt Cu$Ce[^ÐUS]S]ǃǃ ǃǃǃǃCLD7CDX7fC:S,S`Sjh"ЍC0PSF]ÐU WVS]SCY@ 0йh891u7 7ЋFvCYxh0Љu9r~󥋻 utN9r:󥍴&0йts9r~gt&0ЃÍvu뱐0Ѝxluf0Ёǜ0ЃWCPh!0$t&,1 0ЉFgv1v7Ћ FvCYtZ10ЋDhFv1 Fv10ЉFvǃhC\}ǃ 3t&t AB AQjQeuǃ1f{8tG4t1jv8;eS-F8 iWSB/GC89|CY@u$x tjhjP@ Ѓ;B,&e[^_ULWVS]EEEu @EEu*1ZvCUh7ЋUt#h%!0)"t@E%=ut@uHtwGP 9rc9sY)щ%4(0RW4NF,@@ V)‰Ћz t'j hPF,pB Ѓ ?uu1t4FEV U@ PU@EԋF(EЋEUԋE%EEEE؉EԉEEUUăeu @ EEt$SUu  @Pu , @,)Ph@!09 EwEu;싓; B; B;Es CPhc!0Uthp!0E th!0U@th!0}}h!0i vS u  @Pu , @,)Ph!0tFp F@Ph!0 t&h!0EE:}tj LSЃuBf @BEu  @EUtS<SK4Et9tUr 胳 t&CPh!0h!0R}}u t&F!@ Et݋FBu 4 @4Et$tS ,Bl7Ѐ}| Swtȋ x7t>FPB?4$H,(}| St$B4NF,@@ V)‰Ћz tjhPF,pB Ѓp(9PCPh "0 CPh`"0.EEt9tUr c t&CPh!0h"02 EtC}u=tF UB,ECPh"0EEt$tF@ CPh"0 UteSy}}t Eu,틓,B,u , @,)Pu  @PUREPCPh #0 t F Y E}tSQbEE U9 u0 t&@0E}|HuURCPh#0e t&F t"tPEPCPh#0E} wG}/w} f }D}A }w}t^}tf }u } u, @,)Ph$0 CPh $0Y |7Ћu 4 @4ƒU؅u 5 @5Eԅu 6 @6EЍU؋EuRCPh`$0 EUԋEuREPCPh$0 vUЋE Ѕu7RUREPCPh$0- ,F΅t拓FB,t&YA,@@ Q)‰Ћz  jhPA,pB CPh %0u@+F8} x@8@EuZ}tEp 蒬 t&CPh?%0#h`%0b, }UBuTEPS)t ,x UsdspjFPNF,@@ V)‰Ћz tjhPF,pB Ѓ{ t&, }ujE@@ URSt &,h }uZE@@ `׃t , Gw8V utt&}tUr  CPh?%0u1EPh%0,,ft&Wh%0ftˋ2v}t*Ur 舩 +,CPh?%0F@Ph &0FF@PNF,@@ V)‰Ћz tjhPF,pB Ѓeh,QFxv@PCPh@&0DVBHBHNF,@@ V)‰Ћz tjhPF,pB Ѓqt&VB<FPt.,xv S NF,@@ V)‰Ћz tjhPF,pB Ѓt&,v S tˋt&h&0 v<FPtt4,Xv StNF,@@ V)‰Ћz tjhPF,pB Ѓt&,v Stˋt&h&0 v<8FPt4,8v STNF,@@ V)‰Ћz tjhPF,pB Ѓt&,v Stˋtt&h&0_ v,HF@PNF,@@ V)‰Ћz tjhPF,pB Ѓtp7Ѓu 5 @5Ѓ~5RCPh'0%v,pzc)PFhPFDhPq%NF,@@ V)‰Ћz tjhPF,pB Ѓ Sjt&,ph$'0 Stt&,p}u2vCPh@'0 F StPt7Ѓ~ u F {F rEPhe'0C }UB,F'0Ѕuy'0PEPUREPUREPURCPh'0 0bF@ UBXuPtpB,:v,p",pxEEЋUVc}tE8uUREPS)S9 }t!tpB,e[^_ÐUWVSE@EUz@ XH MEhPMAXt]t7tb/=.(~=u~ UJ,uF,Ex uh8(0. UB,MA 7ЋuE@ EPUZJ,A@ ֋V)‹x tjhRq@ ЋEUBjMA, uF,Ex taUBtVy t-tRuFpjPA Ѓ Ur@ЃMA Cq^,jS9UB@XF,MA @CCCC Cb$jjj ȃ4PuvB Ѓ0t!PGPh`(0k E@,z tjMApjPB Ѓ EPu^N,A@ V)‹x tjhRq@ ЋUt P Mu~uHz tjMApjPB Ѓ uv@ЃEUJMA AB(R臘 ve[^_U WVSuNF@ PUXFxt#r SEPAPh(00F(@tqP^AY@t t ^N,A@ V)‹x tjhRq@ 1e[^_ÍvU,WVSEPh(0EP EUUREMfy8.1EE}U¬UM4EEUE܋tDUBCBZCp 蔛 MQSh)0* vEEUM@t }~}~E}EU¬8t1`@@ EPUREMA89EEt]3tCF CUSUBCBZCp 螚 Sh@)08 uMt^3tCF CU SUBCBZCp 4 Sh)0 u]t&3C$K$KtQ,C@XCp ֙ s Sh)0mC w C  C Cp,s h)07t CBCESS Me[^_ÐU,WVSUB H MPU@Ej@[ EMuE@,URtGB GMGWh ЋEhPEEeU¬UM Mjjjt&Pf?WfYt&Vfw&VLtPf@dž(LPtf_WQ.)XLPtf^VQ)e[^_ÉUVS]sL@tjj P6 j P蒁VoVP1e[^ÍvUWVSELP EEtfFu+VffE(Vft&V fVfU7EE#tCjss EP ~}th/0sh/0S UMyUETP ueefF EP uDuV fF f4h-0h/0N@.0ЋUR}e[^_UWVSELP EtfAuQft&Qft&AuQEPf!AEULt֋Pf@pE`-0EvE#t@}th/0Zvh/0GF Ejvv URD| MyUETh-0 t&/0Ѓ;/0Ѕt//0RPhE@dCUu ǂCESn}Y}u5U f9|4AUU̐f4t&UB 9}c}t̍AU̐UfBvEHEt&Uf1UfUf}tɋUfBE_CUu ǂCE}u/} FUfU̘f&}FUf̘UfBUB4t SP+h0 EEf}Uf4}EfUM]xK v)}usUosUs t'}usUnsUhe Cf E&VЃCtjS'CtpS89tCcC0EPh (VVį ] ;t&]+t&K v*}usUfosUffS t$}uCMD CDUh Cf E&VЃCtjSۀCtdS89tCEe[^_ÍvU WVSELEUPփLufu8fUfu8fD@u%PEP8ÃuF\FXF4t SPK$SV^RURf }uUfu8fUfu8fUEP&W@ft&}tfG@t&1Ƀ}u Wfu MGtDA?~1ۃ}uWfu'Gtj LSЃC'~Ǎe[^_ÍvU,WVSELEUPUuLMxXMu.jjtÃu~1&U@f}x9|uj4PcExQЅ}A$)‹Mx{${fCS{C sE C=vjStCtCEUUh謧 EMfE} }}xUu9jjrÃuFMQT ub1}xQЅ}A$)‹Mx}t"} vjSsCt;M vM ΋}tI~$}tr{UU}tj{UUt&~ }tR{UUffYK}uEUUE{UUm4{UUl{UUfm U}s )u E]} Z}bUfB@&1Ƀ}uUfuR}GtFA?~1ۉ}uUfu$UBtj LSЃC'~ǃMQg Ee[^_UWVS] E0jP) EURSFLEPUR}Hǃ e2i w(1i  i t8i 3v5i tXw i tn6i(tA UJDUxV=EPUR) t&S PEPURaǃEPB=E9PLPLEPDЃAf@uVUbDft`VR1i uEPURRvEPUR,Tǃ4uV)1 EP諣 e[^_ÐUVS]jPs ƃSVw e[^USECPh/0jAS]ÐU WVSELP@t P UfuZLuЋPft&UPf@u S1f t&fCu S1ffCuSf &fCu S@ffC@1ɉu Sfu ECtt" Qf%t&Pf#$߅tfAt&Lt׋Pf@[^ÍvU WVS}u 1ۍvu Vfu !Ftj LSЃC'~ύe[^_ÐU,WVSu} dž0VfEfEURV@ЉÃ th307jSEP'VCSDPh30F0EjFPPFPv0UfBDG$G G(BTjh30ЍPLjh30ЍPLjh30ЍPLfdž8fdž6fdž>fdž<+ fdž@fdž: fdžBfdžFfdžJdfdžNfdžLfdžRdž8fEfE]SV@ЃuEfD&fdžDtc t(ƒ@(_~ `(e~(dž(@' dž0 dž0~(j)~)džB(€ʀ(N~ (a~(džfEOfESV@Ѓuf}t(Vw,PojTPGfEfESV@Ѓt fdžP EfPhyhxjSQjjhSR jjhSQ(tjjhSQ(tjjhSQ)tjjhSQPtrjjhSQjjhSQ (tjjhShQ(tjjhSMQ)tjjhS2QPtrjjhSQjjhSQ (tjjhSP(tjjhSP)tjjhSPPtxjjhSPjjhSP (tjjhSlP(tjjhSQP)tjjhS6PPjjhSPjjhSP (tjjhSO(tjjhSO)tjjhSOjjhSOhP PEP| UR0?h30O( Vhsjh@77V@ЃVy<1e[^_ÍvUSM] )u?u P2tPdvf B2tBdf[ÍvUSM] )uAu P4tPhft& B4tBhf[ÐU WVS]C0E(t @Du P2tPd1f B2tBdfu' P4tPhf!& B4tBhf1u P2tPd1f B2tBdfu P0tP`f B0tB`0u P4tPhpf B4tBhfptXSu) P4tPht&f!& B4tBhftXPSu% P4tPhf!& B4tBhfu P"tPDf& B"tBDu! Q4tQhfv Q4tQhf; uPS)}RSu# P4tPhft& B4tBhftXPSu% P4tPhf!& B4tBhf tHu% P4tPh f!& B4tBhf u P2tPd f B2tBdf Et P2e[^_ÍvUSU] u tY f tX[ÐUWVSu0Uj R@ЉxMf4uffjjYÃfjSYCEsUjDsjxQR@Ѓ S taulB t$ t*t&u 9Džt<J,YDžt<1KEPh40諱DžtDJ, PEPh@40|svtύG=ZEAPtCPtQxPMQBЃ { {jvUjDMpQjxRMQ@Ѓ EEʃ f~jjSWÃjSWCCPz{)¹)щsf~Uf6}G>9~EPWЃPh4090jDspQ,EGPCu P8tPpf B8tBpfEEf=vfEEUF9pUBhe[^_ÉU WVS]u0OtBu ff|*t& f}hLSЃs}+CtCPh50 E fu PtPf BtBf0u PtPEf BtBUfu PtP Ef BtB Uf% U ft&u P0tP`f B0tB`ƃu PtPf BtBu) P4tPht&f!& B4tBhft&I&jLSЃ }$CttVE PCPh50迨<t&1e[^_ÉUVS]u-(&hLSЃrjjjjSЃ u̅}CPh60+Mt&(jS hST fEfEfEURS@Ѝe[^ÐUVSuu>< AZtـɀ hLSЃthLSЍe[^ÉUWVSu] tK]C= t=t4t&fE(EfxvZt&fE#fE]jjSRj!VЃ j8jCPVu P8tPpfv B8tBp9~t&u P8tPpfv B8tBpC9t ivf fS{fv[u) P8tPp Efm) E P8tPpfff{u!f6uC;u fCUB=t/= tx=*=~=DSBw=$$60иe^VOF ?6.EfCtf@UfBEfCUfB1e[^_ÉULWVS}] Cf=uf{ufEfEjC=t0= =C=vfEfECH $`60АfE(fECtNfLuu8t tt&f6u ʐfU;&fE,f{v&fE#fECfE]t&<DEEt&j&uVb}~ fEfEE$fE҃EPEPSMVW@Ѓ FẼ}~13j8jCPW,u# P8t Pp&f P8tPpfu P8tPpCf P8tPpCfsf;v^u, P8tPpt& Efo) E P8tPpffjjSRh!WЅe[^_U WVS]M }E6t 8t#v4t&$t&PCPh60肠 t&u tPv‰f t Pt&fu" tpft& tpf8u' tpvfu$6t& tptjLSЃs| 1 <e[^_ÍvU WVSu}]j8uu Vlt Xt&u' P8tPpfm' P8tPpff1e[^_ÐU WVS]}j6EPu VSu" P6tPlufo$ P6tPluffu" P6tPl4ft& B6tBlf4u P6tPlxVf B6tBlfxVj6EPE PSt u P6tPlf B6tBlf=4u P6tPlf B6tBlf=xVg1e[^_ÉU WVS]} jjWj SЃ tWCPh60 ft&u P0tP`f B0tB`ujLSЃs} <u P"tPDf B"tBDUu% P4tPhf!& B4tBhfj6jE0StY1Dvu P6tPl1f B6tBlfF)9|1e[^_ÍvU|WVSEE0EjdUUR.fEfE1E@Et'UURUR@EHEЋU߅t{URUtB4jCPS軰ujVS̱Et{t}~ƒjdEPUR@fEEEPEPBЍx[^_U WVSuM 1V0A= =:==(=== =(== =Ro=C=-=%=*:=C===tp=u==j,BDPYSjPS@PAVAEAf:Af<wAf>gAfB@P6PV <t&AfD'APAP&APAPAPAPP`'AfFAfHAfJAfLAfNAfRA4tA0hA<[t&jD@PQ莮CAttdž8(dž8t&PFPh70Be[^_ÍvU|WVS] k_Љhq U(uPq  t&MQS0V}W~􋅤P i t(wit9i tDt&i8ti u0jR+t􋍤QK vi 2i w<1i z i wi i 7 i w9i  i i8' i wfEȃEPWBЃfEfE FfEEPWBЃfEfE JfEEPWBЃ)t-fEfEC4fEEPWBЃ(@t0fEfE-NfEEPWBЃv(}-fEfERfEEPWBЃCj&tV.ftfDžvffxPzPPVW@Ѓx6ftfBtafu[Cj&LV荷fLfDžNffPPRPR^Cj&$V2f$fDž&ff(P*PPt& VW@ЃfDžfDžDf PWBЃCj&V胶ffDžffPPPaVW@ЃfEfEj]EPP*SW@Ѓ f6t=@Et1fDžfDžfDž5t&fDžfDžfDžRW@Ѓ(9fDžfDž 0fPWBЃfDžfDž<fPWBЃfLJ@#fLJB@PWBЋ0u@!4fDžfDžfDžRW@ЃfDžfDž*LfPWBЃWjjj8 PWЃ,Sh:W@ ЃtGPh@70 Sh:W@ ЃtGPh70諃$h WWR^ BD @fBDu7+u7PP6[^_ÍvUWVSuu t&v%=u j}W贲EUE<2DSEPFR葙 vPWW讁] EECEC<C1҃;Us23470B;Ur֋EPSSWʁ]CCCjSSW衁[^_ÉU,WVS} J] jEP膱ECECECЃEDVEPEFRc vPPPtWSSPـ1҃ 9s&23470B9rjSSP虀9taS9tTS9tGS9t:E@tVPCPCPCPEPh;0s1[^_ÐU\WVSEE0(@EUGu ǂGEjDUURׯfE E_f6uXEPSPu=UBDu1tS PFPh <0 WiAC t=t=5t =jEPSO6fuFfEMjEPP jEPCP 0twEnfuS0tJ8tAfEMjEPP•jEPS賕E &jEPCP莕jEPS|jEPCPjGfE fEfEGffEC fE}M@jXPEP`PGPjW<EPTSVfEjDURjURV@Ѓ$GPSj<vTSGPjWjDURjURV@Ѓ$GPSjDqGfEf6u0tFPh`<02}MTSwjWcjDURjURV@Ѓ$GPSj.EPVBЃ UB4t WPWEHEf@BjjURh VЃ0tFPh<0|e[^_U\WVS}(ut&E EjDuV)$jEPE P1fEEfEfEjDVjSW@ЃEPEPj0fǃ2fǃ$qfǃfǃfǃqyfǃffqfǃfvfǃfǃfǃfǃfǃfǃfǃfǃfǃfǃfǃ@fǃ5qfǃfqyffu&Q8jPPRSЍe[^_ÐUÍvUÍvUÍvU1ÐUÉU1ÐU WVSuF4EdžƆ$ ,tg0f@2,t@0f@4vV jjV* t5E Ph>004f뽋021ffdž6fdž44PV u{fdžfdžPV uRfdžZfdžXjXPV u)fdžfdž$PVy tE Ph>0Jl?jSP4SPh>0l,jE PFP E0@Lf@DǀǀHǀ@TjS裛jh?0S裉j ^W肛j h?0W肉If\fdž8džh P7dž dž0 h`hjSjjhS! jjhSjjhS jjhS. u!jjhSjjhS /u!jjhSjjhS jjhSjjhSyhSEP_EPVhЍP Vh4jh@7aVV1e[^_ÐU\WVS}4E,u 0 f U0@ Ej4EPjEPUR! jEPj4EPUR f}EE=jjƃtzjVkFt]~E F F^SUVjREPjCPEPEPSjDUREPT tVG\4GXG4t VP蟽EPVUREPMVWe[^_ÍvU WVS}O4fABfaD,u 0$f 0@$ЋE t Ad A`  9tRPA Ph ?0h f QЅ}A$)‰ e[^_ÐU WVS]hKB Ǎs4fǃ Pfǃ PS t ƃ$ ƃ$ FEu%fǃ fǃ h PSdWA 5u7ЍPe[^_ÍvU WVS]t,1t&04f.021fԍ{4GDu<,t͋0f@4,tɋ0f@2랋021f,t苃0f@2t&,u:00f5&04pf.04f<0p0t΋0f@4pt,t0f@4v,u0ff=t &0@f=ƃ$ 04f04f04f04f04f02fƃ$ ,\0f@4t(S,D0f@4vt)PS;,+0f@4t)PS ,0f@4t, 0f@4,0f@2t&t We[^_ÐU WVS]u },uv0ff|wv04@f0f01f&01f0f0f}1CPhF?0dc,p0f@4@t&,h0fx,c0f@,c0f@&j LSЃ,F0f0j LSЃ&,u 00f 0@0utu'0f9t(G0f5t&09u!j LSЃ,tȋ0f0j LSЃg,u 0f 0@u30ff|4B04@f004f30f}tʋ0f@4@,tNj0f@4<u1e[^_ÍvUS]u]jjS0jjS#jjSjjS qh4jjX j$PWqMGAjjVWVrjjVt&PFPh(@0YE@Dt Ve[^_ÉUWVS]u jjSat!:u‰f:f:`4(fDž`fDžb`PStCPh@@0X jjSH[^_ÍvUWVS} k_Љh=3 U2tP53 EPWV4REPgÃ2i w%1i + i tNi 5i w}i 3~|i 6i(aEHDUxu$VEPR> /VEPDtd%@f=@u ujV3&@f@u tjVV VS@t VUBD1t&WPEPUR hWEpnÃ>f=udžL@džP(t&džLdžP PhA0FPIPhA0J PLWhB0JVhjh@78 u h@B0XFdžddžh L lPщp@ te[^_ÉUVS]h$ ƃS%V$ e[^ÐUCdVe[^ÐU,WVSE8BD%@f@)\MUB4t VP{M I tME&s h ECf E&VЃCtjSCtfS89tCEt/FUu ǂFME\e[^_UWVS] E8h EURSG0EPURBƃ /2i w!1i  i t*i tU5i 6i(UJDUxuMWEPUR% EPDЃAf@uWUbDW|1i uEPUREPURLƃ4u@W!10tSPEPURƃEP e[^_UuÐU WVS}u GEuwfFfFfFf?jCPSRuBjSOf V]tCEufgD t&OEfFfFfFfe[^_ÐUSE] MU@EREPSS]ÍvUSEM ]U@ERQEPR]ÍvUEM U@EREPkÐU WVS]u h ǃtVJ?tVVb. W e[^_ÉUS]1Ƀluhfut&h@t A~ȁuCPhC0:]ÉUSMluhfhf@luhf틑h fhB fBluhf틑h fhB fBluhf틑h ft&hB fBluhf틑h fhB fBluhf틑h$fhB$fBlu!hf틑h f&hB fBluhf틑h fhB fBK[ÍvUWVS]} luhf hf@luhf틓h$fhB$fBMI&t1luhf틓h fAhB /luhf틓h$fhB$fBluhf틓h$ft&hB$fBluhf틓h fhB fB%[^_U WVS]u h( EFFfFlhf@t&lzhf@&luhf틓h fhB fBS?fB a>?h fKv>%? Ћh f'lt֋h>%? fA SsEu>lu h f h@ }tfUfEF;u'}e[^_ÐUVSMqLlt&hf@t&luhhf؋h@FEt tA~/ -vfh̀f-fh̀f$thf̀fB[^ÍvUWVSu~LElt!hf@lu*h'hfٍOEh@EGEtMle1ɃluhȀfhȀfBA~͋YjCPSh8@ Kh@0 tmlthf@0WlthR P8l8hf@0e[^_U WVS]CLEf@Bvz t&j h)PRB Ѓ luh$ vh@$GE@`w~t3x tjvjVP@ Ѓ VP@ЃGtPtGGuUfbDǃluh h@ uUuDh$Av6)Ɖh$B Mh0fPh@$uClth6)ƉB A$&lthf@0e[^_ÍvU WVS}1GLEFtP0FFxt:z tjFpjvRB Ѓ vP@ЃE@`SЅ}C $)ËEf@B;t[ǔ@^t Ef`De[^_ÍvUVSuhXfNh$@E2G}tEPFPhG0=lthf@XV}@Ɣlth@B$lth@-@h-@&)É؋h$B h/h̘fh`fhHft&t+lih)ÉB A$ldh@/t&Etf=w tʋhf@Hltǐt&hf@0lth@lu h h@E}Ee[^ÐUWVSuEFLE hh؉f"fEt׋hhfXt VЃt9EXXVU;ZXu VVut }u Vj VgtE@dV%tVYV }ƆV_Ɔluhf hxUt RЋEe[^_ÐU,WVS]EjuVC{L|t (Eu샻lhf@1ɋuFE샻lu h hA~EG\EUUGhlt(hf@luSh P&hfҋhf^hfG&h@ }tuEP> lthf@t&u5u7ЍC4Pme[^_ÐU WVSEjURVP@Ѓt7w1EN9M}b M+~̉^$UU T0 U GN9}E )Ѓ~?u9t)jj艸u URʧMx tjvjVP@ Ѓ E Pzt>Mx tjrjRP@ Ѓ UM qP@ЃUE PM AUq LMHU Mx tjh@hP@ 1e[^_ÍvUWVSE1EuDS;SZ u&UJELh0ft&Mvt&RVStSFF}t}w>)ljB uUB4tvPet9Mt,Bu ǁB}MgHlhf@0SktBUPEM9)ljB M` }lu`h$]t&M1)Ɖh$B \h0f_hffh@$u%thu>)ljB A$lthf@0lthf@t&Ef@BS^e[^_ÉUWVS}EE7WDA[M􍎘M< +fWDBu LJBEE[ƔERPVt UUK}t MMAEEG4tUrPEbSЅ}C $)[M<u +6OE}t"UHMA AfGBe[^_ÉUWVS]{LEhQ ES |t (E}u%l9hf@(SHlhf@XS#h'LSЃ lhf@t&1ɃluhvhA~1ɃluhTH1f hfDHA~ԃS7upCPhG0 SyEP1 {hfKhXfh(f}uXSEV&h/WhEEOyh@P,e[^_ÐUVS]sLfFBluhf hf@luhfhf@luhpf hf@pluh@fhf@@S/luhPf hf@Pluhfhf@h LSЃluhhf&hf@hluhxf hf@xluhpfhf@pt SЃC4P蝮SffDe[^ÍvU,WVSuFLEE&h ÃVS jjj ]SV0tFPhH0jURSjRjSjhhEP~PhI0{ `t{lt‹hf@lu'h f"&h ؉f/hX  t@t@t͋hfX vjjjPV% ft Ɔ}Ɔ}VhpЍF4P?E0@Lf@DǀǀlЃ}u#ǀ<$t&hf^UǂЋEǀ\@TǀjE PVUR lthf@vlu hf h@fjjj]SVfCVqBuhhj(SOƆ|EDdž\|dž`мdžd ЃVjjjjSV Lujjj"S&j"S賌 j S裌$hhj S贋Ɔ|߃u/jV h; ÃVTS? t9jjj#W蓋jjh# W脋 tjjh#Wi tP}u8f=u2jjj-W=jjh- W. tjjh-jjj%W tjjj$WtUBTjjj'Wъ$I0E#j#V}u"fuE-j-VE%j%Vx&E$j$VZxE'j'VFdh"I0hVI0hflh fqPEPhG0E#|uUR PE}-lthf@t&lthf EPhZURy Vhjh@7qVhre[^_ÐUVS]sLC4P:S |tjj(PN j(P誋V1yVZh@7EqSr1e[^ÉUS]SSD]ÐUVSu'F8@t#Kt$jLSЃ~4uދV8u݅uFPhI0e[^ÐU WVSuMIt&} t~4u V8fF8fXjLSЃ~4uV8 ft&F8ڃfPjLSЃ~4uV8f vF8fXjLSЃbe[^_ÉUVS]u{4uS8ft&C8f@jjSxPHPS {4u S81f C8f@jLSЃ{4uS8f C8f@jjSxu SqjPSb{4u S81f C8f@jLSЃ{4uS8f vC8f@jLS1{4u S8fC8@uj2LSЃF~̓{4u S81f C8f@jLSЃ{4uS8f C8f@jjStxjSc {4uS81f C8f@jLSЍe[^U WVS}u19} U ZP;PEPC9|e[^_ÍvUju=ÍvU WVS]u hD ǃt jVt VW( e[^_U,WVS}4G8@t&j LSЋWi ,5i wi tJ6i(UJDUxuXWEPUR蠴 EPB=E9PLPLt&UBDtWt&@}jWim1i uEPURVEPURWƃ4u9W31)t&SPEPURdƃ t&EP+ e[^_ÐUWVSU DM@UfǀDfǀFǀHEBEuoEޅts} jWSEt:st3}O~ UJEjCPStMIEE} URMfA UB8tMy4uQ8uEP'UBUR1ۃ+VEPEPUReRÃEP ؍e[^_ÐU WVSuh轔 ǃV^ 84@84@f0ui8u4틓4v4BB8u4틓4 4B BFEt^8u4틓4 st&4B ^v4<48u4틓4$&4B$BFDt.8u4틓4 @<4B @,8u4틓4$4B$BSS CPhL0EW ivT40@ T4,@ 48<&444$S8o4TR P08h4TR P,8`4@8<8a4@4t&8u4틓4 4B B8"4@$FD @fFDWv e[^_ÉU WVS}Ht-OEOE&4 @E*EPVSuG4t VP> EDu7t-Fu LJF뗍&E;@t+@8R4@ t&fGBe[^_ÉUWVSEf@Bf`D8u4틓4%4B%B8u481 4@88u4,1t&4@,8u401 4@0E?vE@~t=Px tjvjVP@ Ѓ PVP@ЃDU2tPzJE0EOyh<SEt&U@~t=Px tjvjVP@ Ѓ PVP@ЃDU2tPIE0EOyh<Pe[^_ÐUVSuFdCPhL0藳VSV4 t Ve[^UWVSuF0EE@D@ue8u44<u4@4<t EPD1E48148<8tҋ4@844Et狆4x4t?EXXVE;XXu%&VV_u"tE@\t V tVEPU 8u44 4x4<64@8<Et PEe[^_UWVSE0EUL<kMPx tj jRTP@ Ѓ u<0ED MtHE@\QWURtWЅ}G@$)MQuPy tj2@pjPQA Ѓ jEPjCPUBP$TÃMQWuV9WЅ}G@$)ǃuE@\8jSLUBXB4t SP/SMQ?3u<<ELe[^_ÍvU WVSuL1SЅ}C@$)G?8Pz tj jPTRB Ѓ <8|@t L#1e[^_UWVSEu0fFBEDEU;@MPz t"j jEPTRB Ѓ EM<EQ4E@ uEH U8uЋ4uO&U4@t5NhuE4H&U4@H%ȉFhf}FdtFhtFhNhF`}M@{t6Px tjsjSP@ Ѓ UPSP@Ѓ]DtPCMHUByE$)‰UUE;@[}t(ffDEMDUM4 AEM<<4u#fFB8t4@ e[^_ÐU WVS]M u Axs${8uS4PS4P /S4BP "{8uS4PS4P$ S4BP$BPjdLSЃ{8uS4PS4P S4BP BPhLSЃ{8uS4PS4P$ S4BP$BPjdLSЃ+e[^_ÍvU WVS]fE{8u S4PC4@Puu S{8u S4PC4@Pv{8uS4PS4P  S4BP BPjdLSЃs8u S4Pu C4@PtOf EuS4PS4P$ S4BP$BPjdLSЃOi{8u S4PC4@PEUfe[^_ÍvU WVS}fE19}C] EPEPEPEP}tEf EfF9|e[^_ÐUVS]{8uS4ZS4Z t&S4BZ BZ{8uS4ZS4Z  S4BZ BZjLSЃ{8uS4ZS4Z$S4BZ$BZjLSЃNye[^U WVS]} {8uS4ZS4Z$t&S4BZ$BZMIt,{8uS4ZS4Z 7t&S4BZ &{8uS4ZS4Z$ S4BZ$BZjLSЃ{8uS4ZS4Z$S4BZ$BZjLSЃ{8uS4ZS4Z  S4BZ BZ;e[^_ÍvUWVS]} hH EGGfG{8C4f@Z{8uS4ZS4Z S4BZ BZSjPSajGPSQjGPSAjGPS1{8uS4ZS4Z$ S4BZ$BZjLSЃ{8uS4ZS4Z  S4BZ BZjLSЃ{8uS4ZS4Z$ S4BZ$BZ{8uS4ZS4Z$ S4BZ$BZjLSЃ{8uS4ZS4Z &S4BZ BZjLSЃ{8u S4ZfS4Z1fwC4@ZƒU}t}{8uS4ZS4Z$ S4BZ$BZjLSЃ{8uS4ZS4Z S4BZ BZjLSЃNy{8uS4ZS4Z$ S4BZ$BZjLSЃ}u2{8uS4Zfu C4@Ztf wjLSЃ{8uS4ZS4Z S4BZ BZjLSЃU{8uS4ZS4Z$S4BZ$BZjLSЃ{8uS4ZS4Z  S4BZ BZjLSЃEP }u1e[^_ÍvU WVS]u h FF{8uS4ZS4Z S4BZ BZS@jPSjFPSjFPSjFPSjFPSjFPS{8uS4ZS4Z  S4BZ BZjLSЃ{8uS4ZS4Z$ S4BZ$BZjLSЃ{8uS4ZS4Z$ S4BZ$BZW~ 1e[^_UWVSuEEF@EE~8u?V4D:t&V4DEt&V4BUJE &F4xDE@Eta~8tF4xD~8tF4@~8F4@ 7&V41%t&V4 1%t&~8tڋF4@~8tڋF4@ U􋚸tbCEtZjCPS訸1EjS*  EAEE]tSUu}tKIV4 bV4D5t&V4E4t&V4 E4t&~8tNjF4xD~8tʋF4UP~8tʋF4UP e[^_UVS]{8u S47C4@71vj LSЃ{8u S47u C4@7t F~ˁuCPh M0ve[^ÍvUWVSMX11t&D> y8uQ4 1t&A4D C~ƁuƁt1[^_ÍvUWVSfEE@EUZ8uЋP48fȍAfEUB4@8HfMu'EP4:f$vUB\EPUB4@:f+EfEEx8u EP47 UB4@7]E\ fptƍFfEUf9UQC%9uʍ)9~ijEPjGPBPaCà t4jS1<E\)PWS:jS<ÃuUB\)fEZjEPjFPBPBà u#UB\)&EP48EffV4>fF4X>ft tF4fX>ftYt Vt V t V.f}VV Ei~8uV4<f t&F4f@<t WEe[^_ÉU WVS}u jjBÃu ~v$jSnCCuS2bsvjV[6FC CV1S ;%<)PCCPC<C <ud1e[^_ÍvU WVSEE8u1X %W4 uP 8dw4 KȉEMQ4tu4R8mu_4p % D 8mu_4P d4 FDvuJ%(uud<uLEt?BMu ǁBERW}tu<tUJEMfABe[^_ÐU WVS]s@htt ǃS1Ƀ {8uS4 S4A~؃{8K4\ % ЉA0S{8tWC4@7 {8t:C4@@{8tC4@DK8uiS4DfS4DS4@‰S47 륐t&\ %K40 ЉZvC4@DEMFEtM&K4DEetC4UPDFDtYMWvK4DEUS4<faS4L1ut&S47 ut&S4R`e{8tC4UPDS8{8tC4f@<ǃP`{8tC4@L{8tC4@7 vPe {8tC4@R`FD @fFDWCr Sh `ЁxSK5u7S+Ke[^_ÍvUEP 1ÍvUVSEu PI ,F0Fe[^UWVS] E8hq EURSG@EPURƃ r2i w%1i  i tBi @5i wi t_%t&6i(UJDUxu!WXEPUR} W7EPB=E9PLPLvUBDt W @t W1{1i uEPURXEPUR ƃ4u;W1+SPEPURg-ƃ t&EPo e[^_ÐUVS]3FPh8t4@H t)7&SEPSEPSEP_$\FG9|e[^_UWVS] LH w~$O0Ѝ&jjj8EPSjjEEPQjjjFjPljPPpvjjj PSf j Rj Vjhh)P@$Ѓ th O0=Yt& j Rh) VP@,Ѓ th!O0X_v Rjjh)jh)P@Ѓ th7O0X jjh) P@ Ѓ thOO0|Xv th)PF1x VjjhjhP@Ѓ G?~̃ RjjhjhP@Ѓ th}O0WD1x VjjhhhP@Ѓ G~ƃ RjjhhhP@Ѓ thO0]Wt&PPhO0:W{4[4GLfGDǃ ܵǃlǃǃ̷GTǃ(jCTPCEPmL<t< ujSaMEƃMǃ(pǃ,Tsǃ0uhh,jVIjjjjVS~ L0<t< u]uMEME<tƃMddtƃMjjjjVSw~ eu0jjj"Vj"VyEPhO0UqL uWj#UhfO0UhO0U4x o4x&j VLu /vjjj1P6L uQ8t4@x j LSЃ8u4@xvj LSЃWмW Shtjh@7@e[^_UVS]s4tjjP~ ltjPF􍃐 PVV@h@71e[^ÉUWVSMxEt11U P u DŽDŽ  G~ǁ ǁ ǁ 1[^_ÉUWVSuxEtU1E1vjSVX7u 7?t& @ ?tD MUD U C?~Mǁ 1e[^_ÉUWVS}EU UeMMtUjj<ƃuGPh@P0R7LjVFuGPh@P06FF  jV P@Ѓt$GPhnP0#RV7E x  FF F$FjV?d@tv v衁 z t jxM pjPRB Ѓ E 8|8x@ UBB x tjj MQ P@ 1e[^_UWVSu ETuetUXhS߀#EPWURWЅ}G@$)ǃUtE|EhSpg9tEtu?;uK;ttK)UX9sÃEPWURfVEpSBgEUe[^_ÍvU WVS} EVЅ}F@$)E}?4 x tj j S P@ Ѓ t<|}@t #1e[^_U,WVSE4EU t&}eM|MEE?M z tjExpjPRB Ѓ Ud@tD%=t6tTt_WMQE0?UMf}[E@\@t@hURWMQtWЅ}G@$)EP MUJjQjCPBPÃEPWUROWЅ}G@$)ǃuMA\;jSsE@XUB4t SP֢SMQU x tj j S P@ Ѓ ]MtME0U e[^_ÍvUWVS}EG4Ef@B| U;x EE x tj j MQ P@ Ѓ EEtUMzA%H=@tA A7L uf} WZ|UL<wMu{tMu stf},MAdtAhtE@huW xMQhA`u>x{t3 x tjsjSP@ Ѓ SP@Ѓ|tP x tj j UR P@ Ѓ UBy0)‰UM;x 6E| }t UfbDe[^_ÉUWVSuh% EF4Edtu8u4` 4X`G0utƆNWyv G0utƆNWVv N`8u4( 4X(u uLt W?v G,uƆNt&Wv Nu;WBv G,t)G0tNEt Pet(Nu u7кgfff)R 5u7Ѝ PbEPJ$ e[^_ÉUWVSuEF4E@Due8u4(u4@(t V1Q48148t&8t΋4@8t&4(34Etȋ4x(@t8UZXVE;XXu VVZut VtcV tN8u40틖40 4B0 B08 4@v ;L<t<t< u VU8u40 4H0?h=uFu!40틖40 v4B0 40/e@h8tы4H0t&8u'h40틎40 ؉&4B0 hB08u40틖40%4B0%B0ǀt=EXXVU;ZXu#t&VVOu tVV 8u4( 4x(N4@8t&Ut REe[^_UWVS]E jU RWP@Ѓt-7v WP@и7M MEE;Gvdtx U9t }tU )Ѓ~EtEL8$΁r}u!JD8 BuVЅ}0)‰UEEE;GUU M |x <tL@d tutLettLdt @~tL x tjwjWP@ Ѓ Et z t'jeMQuP RB ЋUE1e[^_ÍvU WVS}E 0jjÃt&~v9jSCu%S<GPhP0?C7+t&svjVnFC CVE 1e[^_ÐUWVSuENbFEXx E|<dtHEt'@u džE@EPSutEPuSou]du4Et'@u džE@F4tuPfd} NE"t&E<8uEE;x tdždžxdžfFD"VɚV耹 hhDjVm1ۃjj4,Q0VCv#}t%PVe[^_UEPUVSEU t|% tkQfӃtuޅtfAt&u f u vf tfh NLS1e[^U WVSEu u&F"FJGEȋUf tfGu f t F%F#[^_ÍvUWVSuF0EjPl Eu1f f@u SffCjdLSЃu S1ffChLSЃu1ffuf f@Et&uEL0U2DE}~҅uS ffC uf f@u@ft&f@t ufuuS C pV4u1f f@UBEtuSffCuffuf f@u S 3 t&C 3UBD @fBDREPS e[^_ÍvU,WVSEEUMAD%@f@E1ҍvS uUeM=EPhdQ0.E@dt*CUu ǂCMSt&EfI ؉fN;w E<)UuΉMȃEtf@}t ft&}uW G ujLSЃKuۃ}uWG|}u W G G UfBBJE!WzW@f~W1fWvEWWHvW1fIt&fb}tG&}tfG@t&}xfG}vG}uEGMt'Cu ǁCE]ty}usK Wfo&sK WffS t}uCOD CDGu}u W1ffGE}}t}G}fG}u W G G }ft&MfABA4tURPMA`EP}uWfGfke[^_ÐUWVS}G0EUu1&Sft&}tfCt&}u S ES U}uS C MM Eu13S S }tC Et}tC UB\MtS}u SfCf}/GPhQ0)%t&fGt&S ^WMt5et}ufu}tfMfaDfABEq}tC }u$Sf!S'&S`f$t&C}tֈC}tfC`t&}u SfstvGPhQ0(f1ffffS 1fMAdtE@htf@t&}wfsf@ t&t}ufu}VfMfABE}AC e9f@}uSff/CƒMQh‰Qhtˋf@Ef@BU tWWL MQM}uS ȈES ES ʈU}tMK e[^_ÉUWVSE0EUU}}tfF}uVfVfN}u VffEVfUfEŬt }G\$tfEjjÃECUUS SjStCuCS}G\EPhR0& EfȍV}fm&vCE}t܋EfȍV}ffEt.eUU}uVfft&F}E@XUB4t SPrzEC CS}Wxt}ufu}tf}u VfFfNe[^_ÍvUWVS}u EjP E2i w(1i  i t4i tsg&5i 56i()CvSE0ODUxuoSqEPC0P  WDЃAf@uSqgDSx t-@u(SESSu Eq1i uC0PURRC0PEP蜮E}4u;SKE&VPURWiE t&EEP Ee[^_ÉUVS]jP ƃSPSV e[^ÍvUSECPh0R0jS]ÐU WVSuuGEȋUffGuG EȋU G uE1ɉȋUf f@uGE1ɉȋUffGu1fffFr[^_ÐUS]u5t+SЃtCPhDR0!ǃ1]ÍvUS]ttSǃ]ÐU ÍvUEPi? 1ÐUVS]u P? $F(Fe[^ÉUS]S%S ? ]ÐUEP? ÍvUE8u < <@%ÐUVS]u 8u)<$$<+<H8tً<$ȈB&[^UUR0ЃuS0uu PRqÐUUR0ЃuS0Ѓuuu PR)sÍvUSEu5*8u<ȉ<H[ÐUVS]C8ǃ,,ǃ0Hǃ4lhAhAjV薨jjjjVS$: 0ujjj"V褨j"V1 j V$e[^ÐUjjEP; ÍvUEP< 1ÐUVS]u P3= $F(Fe[^ÉUEP< ÍvUEP%= ÍvUEut&@ÉUEM u HÐUuu h$S0uoÐUuuu h$S0uqÍvUÐUVSu] EE&u &ujLSи&Iu1u1vE tEe[^ÍvU WVS}}u tIjLSЃ}uU U }t t}u }t  t&Nue[^_U WVS];CEsj VWt&sjVEPWCtCt&1e[^_ÉU WVS}7GE_j`SVtCt&u &ujLSи'&Iu1u1(vGU&tGUt&e[^_ÍvU WVSEUU0xX} uhSVtCt&u &ujLSи&Iu1u1vE tEe[^_ÉU=@=Tt&=UuE9`UuE 9lUu1ÉUU MB t ;At1QRu@UWVSUu Z0]EphXhxPRt6<u*jjhpLu1 Pe[^_ÐUWVSEEX0;SUs=@=TuShЍC$PjjVEPWSuhHS0% jURtEhVWu hcS0DvuujLSи t&Iu1uhzS0 Qt&ZU tEZjjVURW t CjEPGtMUSSu hHS0% e[^_ÐU} uE@7hS0 1USMAAAA A AQvABAQ,Ky[ÐUEpu pp0ÍvU WVSuFU &SE PW{ thS0tCBCFSCtSs*G$PFCF^&^u-vCD PU RWju hT0je[^_ÉU WVS}EM 4^CK9}ett1t&u+CChT0C t}t V.~VSV^uE PUR>tE}X}tZj5u7h1T0jSE t0t CBCFSUR"t&C E5u7ЋE$PK}t1} tURE PCPFCF^UR Ee[^_ÉUVSEu X ~Vh@T0VSCLЉED4EDe[^_ÐU WVS}t1t&tes-K9UŒn} ts-K9UŒjEPE PWtx|CEPE PWT IEPE PW0lftjEPE PWEPE PWWve[^_ÐU WVSu}C%={$|$@Y0CtS|C(WE PVWCWE PVd Ct'C$C(jWE PVtXQvjWE PVW3t&hhWE PS1&Vge[^_ÉU WVS} ]Eu u u txUtF(uu9)u uuEu?lx}u  Au uu>t&t"tƃu tu/Uu#jSWR)vEu tƃuF$t&^$)ˉN$UB8x tjhjv P@ Ѓ FtuJT@Hf9JsvB)y,)؉BMA8x t;jhjv P@ $JAfJf@f;HrKe[^_U WVS]} uwc$`Y0Ѝ&VWSe>v@VWS $jVWS VWSb VWS5uSRe[^_ÐU WVSu} Eƀ &jSV:Pl []1 &E8Cu(CtujSV SVgGpvĀjEPE PV9u"vUŒ OVVe[^_ÐU WVS]} uC%;EtC$vtC$vCuZCS$K )H E}ujE!d&^&Vt&ETt&C J@ H)E}uEtttEuC}uÍC}uÈC1[^_ÉU WVS} ]EFtF(lx}2tǃ2"tǃhSWEPLtMu3u눍wt&t&tƃt&e[^_ÍvU WVS} ]EFtF(lx}BtǃB2"%t&tǃtƃt&jSWEPOu>!#vZtƃtƃe[^_ÍvU WVS}]hSE PW5} u F)uGu'} t ƃ( } tƃ vj} u tEjSE PW0tu t&} tƃ vjCu.F)$<uA' } tƃ<wF)$<ujSE PW We[^_ÉUVSu] Mt_ƁtDƁÅt)ƁtRxu@jPV>Րt&븐t&띐t&jPVe[^ÐU WVS}j@蚹 Ew4w0 &Ctu jSW#t&SWpNyʍPS NyEP% e[^_ÐU WVS}u ]txu PW(LJu Eu-*t&A:t&A7t&$EE@tÊAtƊAEAtjSVW} (ttǃhSVW> u <jSVW trtǃhSVW t~u @)E E8BuE8BuztEPSVW=)jSVW\ t SVW%e[^_ÐU WVS}u ]u,u+4)t&%t tƃtǃhSVW u #$Y0Ѝ&jSVW t WjSVWb jhSV.lfujhSV jSVW nSVWaSVWiRvt& tƃjSVWtWSVWue[^_ÐU WVS}u ]jSVW|u[hSVWgtFtƃu芃u jSVWe[^_ÐUWVSu} ]EjSWVt1ǃ&hSWVu҉u U ;Et E}mVNuSWVjSWV&#t&jhSW jSWV ttƃt&SWV%lfE t Ɔ_<vSWV<u Ɔ7vSWV9EujhSW' jSWV::jhSW jSWV  tSWVG SWVe[^_ÉUSUlȃT0Ѐu1L1tƂ@v Ƃ8s :v Ƃ[ÍvUVSu ]Eu jSVuDe[^ÐU WVS]} uEEjhVW jVWS t5u'EPVWSttS Se[^_U WVS}u ]jhSV jSVW t jSVW e[^_ÐU WVS}]} u ƃ} uHn t&HjSE PWƃ} u ƃjhSE Pe[^_ÉUSU] MlHƂƂƂQSR]ÍvUSU] MlT0ƂƂƂQSR]ÉU WVSUu ]lAtAA$LjAfu u A A[^_ÉUWVSMu ]lGuxt-G18 T0s@w8T0rGOOuG GuGt&G[^_ÉU WVSM} utjƆvu vtjjVWhLSЃKyu땐t&e[^_ÉU WVS}]EEtct,;&1&C*t&} tC*} tZs-K9C&C*Tt&C+Tt&C,Tt&s-K9n^E} tC*} tC+} tC,} ts-K9&CSEPCE} wEe[^_UVS]u MEEt t7u }܅uEÉu &$tSWF}QVS2t&@t&s d hZ0C, C, vC,KS^ E PURMe[^_ÐUSEX}u VT VTFT$}tFTEf8%u@>9t h`\0xe[^_U WVSu E PVEPfEt&}tRF] jLSЃ}t+F]&jLSЃ}uV]vV]؍V] 밊^]jLSÉfEOy}uV]F]jLSEe[^_ÍvU WVSu EE }uV]F] jLSЃ}uV] ^]jLSЃ}} }uV]^]jLSЃ}uV] t&^]jLSЃeOy}uV] &F]jLSЍe[^_UEU f @P@@ÐUS]tt AB AQ[ÍvUVSu] j@Ģ C)t$$C)t CB CSC)t)$C)tCBCSfCC-CK)tX &ƜsQ. e[^ÍvU WVSuj@ ǃuytoFEuiÉSVuEc)tCB CSK)CuW臡 e[^_ÍvUWVS}G HPp v#jPFPh\0G,vv jPFPh\0{G,2UuG,t&GEtVG,pUtWG,GXG(j@芠 EVjà u!G,MQz t&O$F8URjQw sv8@ Ѓ tPPFPh\0G,t XƌsvV8z t,MtPCpjsv8B Ѓ 1"&T T4S$T8AS;J|݋G$CC@C*EC04GC'CwwPURJ Sh-ЍOhMQ%xj@ EK) CVEu:O u7кMb)RURwMQ軞 1`GPW&VUhLSЃ GHOȅ~GtЃu SEP\ e[^_ÍvU WVS}11GB9t2@u  @@P4W F~e[^_ÐU WVS}U EEG@UZ B% fBBB BD3 BJ t  B EuB t GD tJEuBtD3 $7ЈBEu B$<uJ jRW"e[^_ÉUS]Ra)tAB AAI)t HAu[U WVSEX0x4j@蔜 Eu ƃu t&ƃEPt&hLSЃNyu ƃu ƃu ƃuf fǃEPEP#Eǀ@EPEP襛 e[^_ÐU WVS}4tNF X P'V F @PF @PFPCPh ]0O)(WSSe[^_UWVS}_0G4EU r0F@tUGBNF QFTt&F Tt&f}tGB}tF }tF}tF F xt8Pu/fPF @@PF 4WAE @(}QfǃGFF GGU 4@u B<t<ugGE`E f@@F tEU fBGG@} tyE x,uHu U B,Ҁwu ЉE H,vN@GFGFOG GFWFUU B,U GFEd}uf| ^}SE f@GGYt&wHGFHnnfrEuU B(VFtA}tGGFv(jLSЃ}twHGFHGF}tfǃ}tE1e[^_ÐUWVS}j@ EuO0_4uf t&E}u 0tW0t&tWontW\tBt>ZC(`7ЃuVSWЊE$C(E$7ЃVSWЃ EPP 1EP@ e[^_ÍvUE @=t=uEU WVS]{0C4Et9fLJFtD$ fFF $CGCHCICJ~|CKfCKCF$ fFCFFu F $CGCFCFKGCFCFCFCFCFSFF CF~tCCFAsGKFnW&fcet&CFCF{Ft2}tsGKF{Gu E f@CF}tfLJ}tƇ[^_ÍvUWVSEX0x4uffǃuu E H'nu U J'E f@ uffǃu ƃ[^_UWVSE} Up0@4E1ɋG0EfftO)%u%}u E@tɃ}uvf!u1Ƀ}tfdžu<}t t&}u tGLRG9t8)ˉOG+T4O+ t&:O*sB9r))؉BO+}tƆt&[^_ÍvUhu uÐUWVSEu UH0x4ff~tN)u u(t&uu򍑣tF=V9t6)ÉFF+T4N+v:N*sB9r))؉BN+[^_Uhu uÐUWVSU} EfEZ0R4UW0G*8G+fG}ǃ}O+Wʉt&}tjW*UW+)UeE􉃨}t=W}t Uff}*#EfݍGG*W+)ЍW+w։b14tGBt2}t ǃ0"}tǃf}u}t"fǃN&}u:f71f+t&f99t&fGf}u}tfǃ}tˆ[^_ÍvUVSEu H0X4u/,f35t&F-fFEtfǁtƁ؍v[^USEH0X4ufu rtgut&f@u tfǁu fftKƁuff| tƁuEBHf8fAEt&@u tfǁE f@tfǁvtƁt&[ÐUWVSuM ~0F4EUu fyH"$X]0Аt&fAt&fAjFGP^GFF}UBtUA0EB$ fBtfA}CfLJ<}=fLJ$&I0MaE@@ }fLJ}tLJ}u FF\0GFFFG" }~FsfAFHFF t*U9Q0u8A,utfyuEHfA-fAUJj V_ FI<~FfAE`~HuuFJt! t1Ut&uKUz}FJSEx|FJDUJfAEH xu*@@ EUB$ fBFFFG}fLJN<E~F;fAE`~Hu~Jt FKUBB ffȉffUBx&UB rfUB ^J:7vw :7wEH}tUB}tUB UB%PRVE}dfLJ}cƇ؍e[^_ÐUWVSEp0X4uȉf fdžuȉ džuȉf fdžu Ɔ[^_UÍvU WVS}M q 1ۍ&8t ABABABA B AfBC~ǃ}t QW'e[^_ÍvUWVS}w0G4EEuJt&jLSЃK}fdžt&f$EXLJC(}tfdžjdLSЃC=tM@tH=t=u{fCsti3E9C0uK)SW>uF4@uSW+vf%C-E@SWW4e[^_UWVSEx0P4UtvP1}uf Ef<wwE1uPEPEPh^0UF t^^t f{MfC^jQm&Ett&MABsFut&F tt&fqfCC(}tE&}tUBB}tF}tF }tfLJjLSЃ}zƇ؍ve[^_U WVSE 4P0UbuPMQChP_U B-CX,<t|=ti(tT0"(===M AU B)tC,t${4u 8CXC,C,vE @)ufU RMQEH@U RMQt&C,.&CXCXC,CXC,C,S rzCtFC8u>C {,u$`<`u'jEPUDŽMQE PURKS : e[^_ÐU WVS}] 4j@ E{,tS0K,!C,tVFhP]~$tAW8z t&F tPCpjPRB Ѓ G8sP@ЃC)t#$C)tCB CSC)t#$C)tCB CShC4P~j CPpj 8P_CC*C+C)fCCC-C(ǃ4C0;tCEP谂 e[^_US]H)PSu]U WVS]s0{4j@H KEuffdž uu񍖄ftQ e[^_ÐU WVS}_0G4EhLSЃNu}t5ƃ}tfǃGEt( GEOf␍ǐt& GEW2WELJGEW:e[^_ÉU WVSu] K)CC-XC4C8 C C*C+j CPPC4A @CC C't3Au-yMb)u7RAhPYSVzt SVe[^_ÐUUE BGBFz4uR0ꀸf B0fǀÐUWVSuj@. EE1F<@ C V<B 4CV<B 8XV8CPjjhj hRBЃ t FPh@^0#EP C}~C\E}OEPz e[^_ÉUEx<~@<PUWVSu} N0V4UFD u u tND CKtNDdždždždžf~@CJFBKMFCFEV2EEFB9EtUE}jjjoÉ7t!jSEC EC CE}~E E}~FP'FTIЉfFBfFjfFnFxH7ЍFPFD ufFlVe[^_ÐU WVSu ]}u  hjSVu ƃSV?Et&PEPSVhEG}}jjSVTu ƃSVu $$e[^_ÐUWVS}u EEEPjVWE}} u VWdu VW<eMyu ƆVWu ƆVWu ƆVWt&tMƆt&VWt%ƆVWu'u&뺍׍봍t&tu&Ɔe[^_ÐU WVS} ]uu  EEPSW5EF}}u $$e[^_U WVSu] EEPjSVt;ƃt&SVztƃu$!荓Őt&etMSV)Oyu ƃEe[^_ÐUS]M uvƁ&|u}[UWVS}u EEEEEEt u VWdu VW<eMyEE@t u VWu VWeMyu ƆVWe[^_ÐU WVSu^ EPE PVB11f@f?vf4FFFFFFFFF 1w@v1&@ vfF~11ҍ&f@f>v4)fEPE PVe[^_U WVSu~0^4aFDtq,ƇƇƇƇt_fLJvNBt?vt#Ƈt&fȉڍȉ뽍EȋUf떍EȋUjEȋUDt&EȋUEȋUt&ˆft&tfuff̀tfu&!ȉ!tƇtƇt&[^_ÍvUWVS]s0s4E UPS8jEPjuVjhWRB$Ѓ0tPCPh^0&C8jRWuVP@,Ѓ tPCPh^0C8SGE t3j@]Z ËU VFPP3VbSOZ F8Tu =k_u ha0h{j@Z ËE FFPP3UB t`@uSY jG0zj@Y ÃEPWSY j@Y ÃV bSY e[^_ÍvUEPpD2ÐUS]S)cu p]UVSu@ t .V+u=t VSue[^ÐUS]Sbu p]UWVSE8G0]h t EPEPEt)~$1}T8D8A<1tލM[^_ÉU WVS]E u t&t du!hft&hf!h%Dt݋hfhSiduhfhf h%DtދhfjdLSЃdu!hft&h f"h%Dt݋h f j2Siduhf&hta t;t h%N?h%Nf2%Dh futߋh%D fOc~ ƃ 1e[^_ÉUS]SPu p]UWVSU@0EE t U%JB MZB zB DžtMAhf-h fhf h$fEMA1UBj@=> ÃMQFS>> e[^_ÐUÍvUÍvUVSu@ Pǃ 9p$u@$FV@Fe[^ÐUS]SGu p]U WVS}B0 uhBH u7кMb)‰ SWhh_S- S:  t& e[^_ÍvUSE@ Pǃ ]ÍvUEU 9Pt @9PuÐUS]U 1t t'-xt RB*ƃ|]ÉUS]1xtu Rj(u@`PDRHh@7#h,S1]1]ÉUWVSEu^UURjhPCVt 1{&1MEPAAP SUC Oy̋ECUCCC C؍e[^_UMU BÉUWVSEu}UURjhPsUt1j@: E1MEPAAP SUC0OỹEP: j@: EUCCCC CC$SREPD: ؍e[^_ÉU WVSu] j@: ǃSVCW9 e[^_ÍvU,WVSE@fEUU]MA<@q@p D2%E}tEMUt EƉM QHǃ%;Et ;EuM.% )UBP@ ‰Uș}))MEs{GC1PS fK(fC*MK$}cEtcUBP@ ‹EљuBE PDžt7UC{GCC fC(fC*MK$E 1e[^_ÍvU,WVSuEEPj hVRt 1t&j@ 8 E1E?&M}WA؉EAP ڋEP(UB @MyŃMQ7 j@7 E}G ]1҉߉EP P4PVURs7 Ee[^_U WVSu] j@77 ǃSVC W+7 e[^_ÍvUWVSuhb0_\duhhb0tb0RǃWShb0\ut%FPhb0[dž\dž\KyKydž pURhhVPE$ptxxE@dž[Vu EH@VuEt&H@Vu ETH@1ۍt&V_u.Kx|4VKyE&|} I@tSA@A C>~1ۿ| 7ЋM@xC~ދduh&h@E}uFhAvh؉=h1h1hXthX1ۅtLjV?Uduh&h@ECcUuMu~VVVMQVJEe[^_ÉUu juu6IUu uHJÉUWMtBHu jjej|苓…t 1Ћ}ÉUMU BHu BH UEduh1 h@U WVSu] j@- ǃ&xo=duh hp?LuALdu#h &h)h@Pdtҋhpj2S^Np@htp t&h @h(@hȉ&=dthpPtB AdshRP dkhRP(PtdYhHLtEdu3h.t&h2hRhp@dtˋhphSL?΀dthpj2SLǃPǃL=W[+ e[^_ÍvUEt|u=r7u =t1 PÐU WVSuxt@t[duh h@ 1vduh hx tǁu1h dt዆hx t&#u*h1hCTXtCTXP6t$TFPhGW4U(t|_8Pu FaA$0Ft4Ft'~"1}T8D8A<1tލM[^_US]S!u p]ULWVSU@EE|t U%JB MzB JB }tuFh.hhhF=duh t&hjSsdu hH h@HEčU؉U׸ 7Љ 󥊃EڋEu 4$EEEmUĈU݃duhLt&h@LE1~UĈT/߃m M;EvẺEȃPuVEPMt&}jjURDE&;}duhTPE hLPMĊUĈUԋMāE%Uā Ёe% EĉEԸ;EvẺÍEԃSPMQL]ȃ@;4Pt> tt\dhdhhdt狃h1hS0|uVduhuchtVG~Ndt'h6h% )hhuȋMq1UBj@ ÃMQJS e[^_UÍvUÍvUS]Squ p]UU@|u $ ÉUVS]9X$u@$Cj@ ƃSV" e[^ÍvUE@ǀ$ÐUS]Su p]UVSu@|t .Vu=t VSe[^ÐUjuUÍvUVS]C0Ss8Ve[^ÉUE@4`ÐUÍvUS]Su p]UWVSECUp|t TvEH CP{4S@K<$ s8EPVEPRQURS‹E`EH EH*E@E tt&Eh^@$UrLj@ E;EtUP$@;EuE@GEC8gEdth@UztUE=uIӃPSSURhثSEPu7йMbRSvURp e[^_ÍvUju9ÍvUVS]C0Ss8Ve[^ÉUS]Su p]UWVS}E@UR4U|t O MUZ8Pmƃu }t&F$0Gt4Gt)7&E7&E'&E&Phf0~WÃMF$ E @VF  у}t}uKC@C CCCMY8E~tot/tZbt&E@PjjWu]E@07 MA07Ѓj@< ƃSCV: E@07иMA071SWee[^_UMU BDADJDIL UM U RDt 9JDuuhf0vADBDu/ÐUSUM Z@ZB A8BJH㿉Z[U WVS]05k_jjVNj@ ǃ du%ph틓ph @&hp @ j5u7hf0jP.W 5k_jjVQNe[^_ÐUWVS] uu1gэMUu?}G1ɀ>t'~"1}T8D8A<1tލM[^_US]Su p]U\WVSU@EEE0t  U%JB MZB É]zB lj}ątMAU ## # n #e >0 B1.~  m} UMЈE ]C1$f0Ѝ&};EvẺE](7Ћ)7Ѓ}Wh 7ЋEP:t&};EvẺEPh27 } ;EvẺEPh<7ЋMQ+}Ј_Elj})Ẽ ;EvẺ]ShE7ЋUR\+])]̃;EvẺ]ShN7ЋMQ|&}}]EE%t tYEtP}WEPhf0ЋURMQyE!}]E}}GE}E@E}GUȋMv})]ȋ}t&} EċU;Mč4@]duphUh]pՋEH$g0Ѕ}hpUhpMhp}hp?UhpcMhpA}hp Eƀ}U؉Uо`7Љ UEڋduыphMhp\كu%u]h }h@EۀEu$Edu h Uh@EE1ɋ}~D) M;EvẺEPEPUR'}jjMQEt&}Y]ċ};G}=EdupMč]h@#eUpUċMhMċ}ċ_@tAt}tttMԁE0 ȉEԉt tUt ȉEԸ;EvẺÍEԃSPMQe&]}9]ċ};'Eč4@Udu]ph&Uh]pՋEH$\g0Љ}hpUhpˀ% =u.jMQ]S#}ph؀&vtڋUhpڀhMQ }0t# uvEph UdtދhMpj]S< 0u}duphMhptEPhf0 uj]S}WEƀ5Uhpr3MhpP}ph؉4Mph؉Mph?؉t&Mph؉t&Mph؉t&Mph ؉t&Mph؉~&Mphˀ؉^&Mph؉>&Mph؉&Mph؉]MY1}Gj@ ÃW;S e[^_ÐUWVS]U J@du%ph%ph +hp2$ՅtՋhp [^_ÍvUÍvUÍvUE@LÐUS]Su p]UU@0u  ÉUVS]9X$u@$Cj@ ƃSV e[^ÍvUE@ǀÐUE@LÐUWVSuujEEPhhVt1wE1ۍvM}WA؉EAP ڋEPLUBD`E})vMAD]1҉߉EPDEe[^_ÐUMU BDÉUWVSEUURhhPt 1j@* E1ۋM}WA؉EAP ڋEP8UMA4`E})vV j@ Ƌ}}G4U]1҉߉ EP4PURÃu E F8EUVHHFP@  U MEH}tNF4EPEPUREPUREPVE܃ EX4UC8Bt&]F@HVDE E@D GF@PFDB G G EG4E@8GUW4UЉ~jVjG9|e[^_ÉUS] Psǃ7ЍCC\0S]ÍvUÉUVSU%ց Ɖ;U}HUЅt=t4S+9}A(  1e[^ÍvUSU% ‰; U}0UЅt%tPQt1]U1ÐUu h9hujhBÐUu h9jujhBUWVS}WD% É4UЅtT|GUBtP B{ujp t&Ct*jr 2js2$E@SC9s,PCS9rԋE@toCkjr jp 2js2vjr 1js1]CC U2SN|@HS 1|J KUBC1X[^_ÐU,WVS}G@EjjP /GURP- utEwEM;OsI1ۃjjj.F UVFMGD‰UAM;Or/&EEEwjjGPU.F E_]W9s.t&C;Ev}tM;As]M9r׃}kEFEFE_ڋG9sPt&MA9Cr.N )Ѝ@ЉЉUBUGW9rMEH+EEE1wEMe[^_UWVSuE% Ɖ;7| @UЍƒSvǃEEeCtuEPt*CtU9} u =} t }`tM E Se[^_ÉU WVSU}%ց Ɖ;7|s@UЍƒSeuT t `t v!! SP1e[^_ÉU WVSuVD% @UЍ<‹GuF4FT|RFHu(7Ѓjjhh0j5P>T ~HtdžEE@F0jjh&ÃhSjjhd&]ߋU2#} tudžt&EǀUBCDC\CpMI)ʉUR‰‰S|u^EE@TM=7t75P>T軋CTu/Eu)jjjhEPEP5P8DP>TЃ Eԃ0MԉAdȃ8PyURMQE@URgƃЋMԅut#tEPgt&1ۋU;ZsB1t&MQA0jUԋB40軌jMԋAt0  CE;XrċUԋB8t211t&jMԋAt0 h UԋB<8u׃jMqC jEp3 UԀbjUЋ]]t jUt jUSMQEԃ8P譬hd ÃEP:hUR ST jvMA}EԋeAE@UԋMÔY t&E@UROƃMԀIjEP| ƃuMgduEUhЁeE U% EMQw} ƃEԀ`PtMKUԋBu8u )M9t UԉB$MԉA t&1e[^_ÍvU WVS}ۉ% É;7}t@UЍ4Ft_5k_h`jWJuE؃t t&5k_h`jWue[^_ÐUÉUWVSE} EE@EE}jjEPDžƃ]ȃ{@v$WjS豕WG0jS |WG0TPS&ƃt!WjSqWG0jSˈBvTuWjSGE1!WjS0WG0jS芈8[^_ÉUWVSuE% vUЍ‰EE} hS h@UR UB CQQ8π볐QQ8 뒉QQ8 "A8Q tCtߋQ8A y4uQQ849Q8A4&hao0hho0ho0&e[^ÐUVS]u {4t4S8C &jS{4u,SS8,vS S81Րt&S S82S8CFFF{4t͋S8C jS={4uSS8S8CFFe[^ÍvUVS]u jS{4u SS8 S8CFFFe[^U WVS]} hSjSu*{4u SS8 S8C)=u9e[^_ÍvUS]{4t0S8C vjS{4uSS8S S8҉S8C]ÉU,WVS}GhE{ CEEEu MmEtURo0Ѓo0Ѓ$9sƋSfMM %f Ef C@CCEfEU %fEE EUMfC@CVs#CUUM!KtC@WpуH@ WpP@ Wp‰уH@ WpP @$XCW$W8 CaCW(W8 Cg&CP@BBBBBP j=RWC 4tO8W$C C 4tO8W(C C e[^_UVS]KlQ;VQ ;Vu hp0h7ho0ho0&Vzthq0h:ho0ho0^zuCpt$CpRS2VBVF@FF ~t0S5SvS$S8 F(FS(S8 F.{4t؋S8K$ F{4tӋK8S(^ ^ e[^ÐU WVS}GlE@;Ft&^ ^{uWCSm04Cj0wth'q0{us hEq0h_o0~F@FFMQ9u^^ ^ F4uFW0W8 Ét&O8W0F É e[^_ÍvU,WVSE pP UM;u]]]uhJq0hho0ho0xEP B%`t#w@t+Pt=t =A={v%A=jSqb1ɃHQU MjjsÃtjSTtCtA 1Ʌv] ;}jjzsÃt%jStCt4A 1Ʌu-EURbSa1Ƀύ7#E]]UU G;}oM1E#E7#U] Gv܋E@@ }u UP E ])ËMY EPURMQN] CEE!E!ƃȃt6t1B PB PB PB PB PBPUrth`q0 1M]U B MuIA$ AaafA%fA] C UP % ЉAC @#EC EM!MF!Gc] sC;Cv1U B #EM4uRjj9qÃt$jSqCtPF &] C #EU4M A #E] Åu"IA$ ASC_벉aafA%fAV % ЉAGv&U B #EB BBv ;Be[^_ÍvU,WVS]ôE@hEEu1MCS TFOU MI ME@E%)…t}tyM9vыUUȀfEB%f EfBE %EE% EBfb?)MMOF}tuUUtuM}tg hq0hgho0ho0M  ƋI UJ8 Ɖt&(шLMI@E @CuU M HE CUz4hZ8J  ֋ Ћ Љe[^_ÍvUWVSuFlEVhU@LMEuhq0hho0ho0M<G%U@uhq0hho0ho0tBu CvBRVM҃MA9Q9tVq~4u2  ËN N8 É؉.^8N   Ћ Љe[^_ÍvU WVSu~lt)BuCBtR[ǃfGG~4u8  ËN N8 É؉4^8N   Ћ Љe[^_ÉUVS]K4u6SS86S S8IS8NS81eS8CtK8S  {4tS8jdLSЃ{4tS8ȯt&NhLSЃ{4u SS8 S8Ctuƃh'LSЃ{4uSS8t&S8CthMr0hho0ho0賿vhkr0hho0ho0蓿ve[^ÐU WVSuE~4uVV8 t&V8Ft}VK~4u VV8 V8FtLhMr0hho0ho0V<VP1ht&V@VPhV<VPF\PVFdPVVlFX~Tu&~LtVPF<~LtVPF@􍆴P/fpߋ1ۃtPXCvdž1ۍ&tPPXC?vdž?FlfFlf@Fl@Fl@Fl@Fl@ dždždždždždždždždždždždždždždž~Tu~L7VPF<VI~T~X~4tV8FVV8VV8V V8VV81Vl %N N8 Љt&VV81Vh % ЋV V8 ~4WV8F~4QV8F jV~4;V8F~42^8N Vl % Љj@V~4$V8F&~4^8N Vh % hV91~4u VV8 V8Fu} E|t[hLSЃG~hsr0htho0ho0跺&VV8%VV81+t&~4tڋV8F~4t׋V8F$Fpt VeFptb1hLSЃGVL9u˃~4uVV8V8F؍e[^_UVSuN4uVV8t&V8Fuhr0hho0ho0胹vuhr0hho0ho0cvuhr0hho0ho0Buhr0hho0ho0"hr0hho0ho0VV8VV8  ËN N8 É؉&V,V8 t&._V8F~4YV8FVxhFlPvhPVJ0~4%^8N   Ћ ЉvFptJj?Fl@PFhPPV ~4N8V,  vdžFpt džV}V,V8 cdžFpt džFptCj?Fl@PFhPPV: ~4tN8V,  VVe[^U WVSuDž~TN~L7V@VP3  ËN N8 É؉V,V8 Dž}bhFlPvhPV< ~4s^8N   Ћ Љt& tHj?Fl@PFhPPV ~4>N8V,  @t V't Vt VoN4uVV8V8F<u VV8 V8F4j0vths0ufpt&uNp Viud~4uVV8t&V8F%4@i0Ph s0豸PVV FVV8$h_o0w~4tۋV8FtEVtFpt VVV8bV@VPotHvth$s0fp߃VhV~4tV8F&~Tu~Ltt&VPF@~4u VV8 V8F<[^_ÉU WVSjjhÃu1^hS ECTEC|ECxECtCpjh05P8 ƃ ~ ρ% 7 ρ% )9uM~Ёt )ȉCht&sh Cht u1th0V5P8%jS71Tt&Slh P{TuPE PURSq{TujE PURCǃzǃ;ЃVVA j j V|SMe[^ÐUShAhAj]S~Ejjj!SEj!S7F]ÉU WVSu~8Eu džUЋ=?~F4t fdž"=_fdž&fdžf@ffȉىVЃV>jG P^S7LJDGLJPЃ u LJBfGD"P3PSh`s0GVЃWFW3EEe[^_ÍvUEu t&PÉUEU uB"Bt RPÐUVS]jP ƃSSV e[^ÍvU WVSM8<uH #H d|Ntud}싁tQЍe[^_USECPhps0jaS]ÐU,WVS]8<C8Ef@Bfǃfǃfǃt2H 2st! 0sH ̉PH@pHtJx L|NlYT\t&L\P_hdjH Ard1H 6xH|PH j0Hp0t0x0 |0tl0T2L2P20&d0H A2t&1EEuEHE苔H2EEA~EPUR 1ɃE E uEHD)t&EHD)2EEA~Bfd2H 2 ȋE@Etx 0|0t SЃH 2t&UBD @fBDR e[^_ÍvU WVSEBD%@f@|f9u EHE`UOGu ǂGEGuhs0订UB4t WP@ PWSH  @X \`fH PWSsƃW;<9sfABff@f;u fǃBff]8<C8E AH 2XR0\ 0`f 0&H 2&Bff@f;u fǃEf@Be[^_ÐU,WVS]8E<U}t&H BM }u:Ud:UH BڍUH Cu[^_ÐUU B$fBxU WVS}u _G|{t_ tlPSujlPxGtdPSHAlQpAdQhGtPSt_tlPSZjlPGtdPS-AlQpAdQhGttPSAlQpAtQxfe[^_ÐUE j0uPÉUVSMu QYB B B ÍQ I B B B u % ؁ ȉf[^ÍvUMU A #BB@u RQÉUVS]u KSA A A ‰VK S A A A ‰V VKSA A A ‰V[^ÍvUÉUVS]u {uaC t uS uj hDv0ЍCPu4{ u2j hNv0ЃSƁtj hYv0S证t1 fe[^ÍvUWVSEUB \!uCEPM A`SE!PK}u6MEPA A A ‹M A;LtU BX\ދMEt&E @bt&~uA]t&{t!8uC8FuU RVC EM yEFv ƍF9sU ztrBtkrz;~}`J ZF9Ku9wEEPjvNWv q u!EM q pHye느t&Et Pt]{t(t&EC uU RMQCЃ{u܋Ee[^_ÐU8ME UEЉUEԃh7ЍEPQU@VSuE MU]EMfEU]ExfEP`F D!PF!PX7Ѓ}wEPVXeh7ЃPEPVbe[^ÍvUDS]U EMUEffEEMEh7ЍEPS]ÐUt?h7ЅtA Pӈe[^ÉU,WVS]u]E E};]9"UUREPWV`ƊE<;utC<;E;]t"< EDPЉEC;]u19t(t&UREPWVƃE\P9u)]EU8t9<w&EE 9t E<v|+U}E)‰pC;]9t`]SURWVƃE.t ;t><9t&SEPWVZ};t$Ct& )ʉv1e[^_ÉUWVS}]EEu }t=CEECEE9t)EPE PVWǃ}uր};uЀ}.uMEUfe[^_ÐUVS5k_ЃhU5S`Ãuh\U59TDÃthv0nevEPhv0hv0ÃEEPVu5\UÃt*E@ HVu}junt&E/VЋU/VЉB=/V/VuE/V/VЋEU/VЃVBHPR2 Vu j|1x[^UWVS}uEjpEEPuw|ÃG@u t)U}uEPЃ PW蓽F$F(@FEEF,VÃov~8tVtSF|@ ;S|VR1UBxtPRhVGEP‹B0hVUà tV路EPjVGBuUREPWVt&U;r tV賯tV裯uVjYPu S|UZ)PR螒 VjYPu!|E)SPsjpPPEP~yEPGHPW1h[^_Ugt#EPj}tPURtj9W$E ǀ؍e[^_ÐUWVS]uEhjlj_DEEGTG<G01v8G@WE ЃWo 6_Hjhv0ЍCPxq=tE}c~ =BjC(PFPijC8PFPi 1vDŽ0DŽ0IydžF<Ɔ džƆ fdždž džWEVdžWEVV=&fEG0 G0W2eEe[^_ÍvU1ÐU WVS}EPjW\ƃuHC @|@ujjs ƃs 褦j9SٛLJgAe[^_ÐU WVS}(SVjƒVTPE PRWGe[^_ÍvU-ÉU WVS}] FCCFC CCCCGH9tEjZCTPP pjZPPpjpPPPoC81e[^_ÐU1ÐUVSM] uQEPsQBЃt /t&Ufx|t1RFe[^ÍvUjjuu uÍvUWVS}EEpU RVM>EP50UЋ]Sj{ÃtEjj:hEhR蜇jjh w0jE4P"EM쉈EAq] YQ~Ãt%u&EH] ;X|u荣Sh w0u U#r~!;z~ucWh`w0t&EPjMqȋHSp >^à t+uuwaShw0VExHU;B~LuڢEt P/aPVPhw0CVFqt&E]MYC A @@}tXKU EP`Et P`EPjjjMQà tu6ExHWOB B B ]KX_ W C C C ‹]S\GȉC`E@8ETtzt5Wt-EPj]KډЙRPEP &EuURWuMQW Et#P_t&]SEPWEt P_UMA|f @7ЉB8$w0ЋU4UЉB4U,UЉB4]SEu距Ãt\EEǀU0VЉB4u̠u ]UZMA\RPuo]LU9BXuEH<EM1e[^_UEU f ABA`B1UUu  PRQtA0UE41 ÐUEP@xDuEx u?xu9x(u3x0u-xu'xux t(B8Hw$x0Ѝt& 1ÐU1ÐU1ÐUUBr r@|PլÍvULWVSE@EċUZFCFCF|SCC CFdVhC(S,FlVpC0S4FtVxC8S<CHF\CC ~\Eăx8jjh蟑EEȍEȿxEEEEEEUBE}EЉEBEB EEP u+ECC jURVCDC@F@C$F\CLCPUċB81e[^_ÐU<WVSEPx }evR[RN F_w I؉ tW#PH)ЋW9v‰@\) uw19u 9vF@;1ۉ;};3T(Q(C3J;A\|ōPjSPEPVPR3W'PjQVPVà +r@;vWVBHP.Ë2;AtB\9Gu9W uB0 B0mYut؍[^_ÍvUUzzft&B jPj0r ÐUEp p@@|p ȋÉUÉU1ÐU WVS]M u}ADfA$fA09Br@t)Dǃ<50@D0APQu481e[^_ÉU WVS]1~ =tJAsCuH~v9uPQVbt`t- $RPPSƃ{t$RPSSCf$ft?(, $PPPYc7&(,PSP c1e[^_ÉULWVSEEPU@EEEEEHMY]܃jjhHjƆFƆƆFE0Uzu dž@0MY]ԃjjP EЉ@Ddž<EPH (,]܉]䋆(!Et"EPjQRURE؃ (MI\MMEE1#(#, uHEt PUEPj(,QRMQ\E؃ :EU]ZH;u3E1#(#,]Kډ(, IEE̋M;A5C !9CtQSBT E䉆(,E胸TuDPWEPPSE (,QRWhhx0ЍWUg<u{!uƆ(,SQ|<u{!u Ɔ[U`CPTPEPWPC!PE M胹Tu V_(,RPPVE؃}uZỦUMMMȋ,9MuE;(}u"U胺TuƆVE؃}}EMAt/}tj]S U+DMA]ЉEt PR48MAQ ]S<jV豉E؍e[^_ÉUWVSUBEpzTt?&EPjvNUBPv Nà MUB#FYH;FvQsuxv Et&jh-V2EVEPEPSu7u xwURh-V?6u}QfukQu zw/WEPEPÃURh-V5E)GEE)B1e[^_US]s ss}]ÍvUS]s ssM]ÍvUUJr Pr4P{ÉUUJr PB P4P{ÍvU WVSu^K\EA8whx0-ACP9CTuijCTPjsPQǃ t.{4C0C0j@ ƃSzYV m{Tusuh'Lw>V% Ajh87M$7Ѕtft hjy0%/VЀHA@/VЋPhT-VPB Ѓth|y0CT-VЉPC@@@SjR{C@ UЋUУUЉUСUЋUУUЉ UЋK􋃔4P ǃǃ EPjhjjjjSO t hy0+hy0jjh8\Ut hy0hy0jjh5Uthy0hy0jjh Ut hy0hy0jjhxTthy0hy0jjh$Tt hy0eU]SPSЃE3CP0U UXEEE@EE:z0ЉEEP0Xt)uh`z0 t&Phz0 ulÍvUTT>T UЅuu7Ѓ=UuUСUЉљUÐUjjuێÐUjjuÎÐU WVS}k_Сk_ЅXG<uBu t05u7ЍPujPu t05u7ЍPgujP[=Uu W6FpPVpЅ VUЋ u7С UЅt\>TУ\>TЋU9|A)У\>TЋUЅtU)‰UкUЋBȉB=?B~BU@UкUЋBȉB=?B~BU@UСUУUСUУUЃ= i_t1bWЉbW>tj h e[^_ÍvUWVSu]SE)Cv)yI@B|u1yc2)ȉ)T u7ʉ1A;t&u7ЉUؙ}9Mu7ЍT31ÍD ؅}e[^_ÐU WVSEp|u1xc1)ȉ)T u7ʉ1A:t&u7ЉUؙ}9Mu7ЍT31ÍD ؅}[^_USUB, uU B, UЍP UЅu>=Ut5háUУX>TУT>TЃ5USr]ÐUSUB, tP$߉B, UuC=Ut:h X>TT>T5U蔋S ]ÉU WVS}4k_Ћk_СT>T9FDt(FDF@u 5U 5U>G<uTC, tw8Sn&F@PV@Ѕ~ FVsFViF@PV@ЅG<% utF(V,)tF V$ t&F0V4T>TЉF@t)Cd=Uu@k_ЍP@k_ЉШu Se[^_ÍvU(u7ЉEu7ЉEu7ЉUUЉEUЅuЉEjEPju u荦ÍvUS]h5UЋUЉSQ2]ÐUVSu]SPSЋES)ЍFe[^UVSu]SyES)ЍFe[^ÉUVSu]SYES)ЍFe[^ÉUVSu]SmES)ЍFe[^ÉUVSu]SPSСUЋU)‰ UЋ[)É؉F} J@BFe[^ÉUS]hUЋUЉSQ]ÐUh`7h{0jjjj0h Uh`7h{0jjjh$h@UUÐUVSEu @Vx<u Ix <t}1&A9|Ѕ~<ut&H~<t[^ÐUEU ;Pst@(t1ÍvUWVSE URUEEPURÃu C,}(W[EPjEP ƃ t:K,C(tC,Pau9UR W[ vuuEPSURƃ W[e[^_ÐUWVSE UxE@EUREPÃt&Ur1ҋ9w u9v;=u7r 9}uUE1C,E(EPZU;z|nEPWEP ƃtBK,C(tC,PAuRURy EPZ *t&;}t h#{0JURWEPSURtƃ EPKZe[^_ÐULWVSE E܋URUE@1MQEPÃu C,U B $4{0Ѝ&M yEp1ҋ9w9;=u7U؃(URYEPWMQqƃ tDu;EP; K,C(tC,P׹UR8YuMQuEPSUR,ƃ K,C(tC,P船MQXU؋BM܊$U E @tU؋BM܀ t&U؋BM܀$SCH ‹MeS3fSM A% fCƒUCMQ}Wh~fS@ЉƃC@ƒ@UCMQWh}fS@ЉƃcECURWh~fS@Ѓvf{ uC$@t&~ c~9jj'PPC؉FGEXFF)jj'SCFjj'SBF ~P6E0-WvEp}]SvEpSvEp ~,tJ1;~%tfx u WVG;~~F0F,F8F41;~-tP uWVBP G;~~Ӊe[^_ÐU WVSEXC&JfS&f;s|)vt@,URPNyڋE@{~j'3CC~j'sCj'sC Ct PFNC t P3N{0tjs0]C{8tjs8GCSh@Ue[^_ÉU VS]u u1c&tLF,tFf{ u?fEEEEEfEj@EPjVs$O S(tK,C,PM1C HK ȅ~K,1&S({,~$t&jjha{0jC,Pi {,C%@=@u?fEEEEEfEj EPjSs$葻 CtVS@Љƃ1tCBSs[ UЃSh UBe[^ÐU$SUE X0r/ƒu fz t -J$fEEEEEtfEfbj EPj3tfEu5fEJ @tj EPjRQzj0EPjRQf]ÐUEM% ЉA\ÍvU WVS}]uEPW-u lXA 9t Cy u /U W]] A ] WM  GމuEEU;B,|UB4t`EtTUB8U4t3;E;Cu!C8S@ЃShUr> މuEUB4@9ErEPhUCUB$1e[^_ÍvUS]Ct$CS%Ct$CC Pb+Ct jP]UVSEu t3C8VS@ ЃtC( C(u S[u͍e[^ÉU WVS}u C8S@ЃwWS uލe[^_ÐUMQE B0PQÍvU WVS} UB88u54uG4Pjjj@@kG8MA3A#G4W8vG,MQ9wfƐ9vjjP+ÃG,PSw0W,)PRG0t jP-w,_0EX_0UB(e[^_ÐUS]MC88t SQ0C3C#A4Q89u9t 9uC(t SC88tC4@,u s4vShU]ÐUVS]shƒCFC FCFK(FRV+e[^UVS]sh=St C B t&C FS Cc(NQe[^ÍvUEtH(fH@uÐUWVS} GE@$@(DP7"Ã+URUB8u umMQA0EPÃUBT@@u;t `MQA0j@EP茞Ã@Iu mURB0jMQ՝ÃLEPjUR֣MQEPA0jjjjwwEPjMÃ@EW)‰W 1;57}dEh7ЍvMt@WURЉƒu4@8utu(tE F;57}uuF$v w1ҋMqN$9wu ;F v u1]GPȾEP‹B0jMQEp4h-V!Ur4h-VyMQQ4؍e[^_ÍvULWVSUBJ. DžDžDžtM pjj?58U/'8UЉDžpEEDžDž UE@7EQuVÃOh5@SRDžEtP];t4t&:t BF:uFj?3}(;uЃj?u_(eE xu Et50PVRÃ)‰jQW ÃuDžE x~?PVR$Ãt?`V)‰jQWsÃu=P7tU@P7J!ЍUB D +$;Ev E؃hjuV覊~ EE EȉE E EЉEԉPVPà 9Džϋ)E싕RQSV@$Ѓjh߿SBEPURMQM9vЉP]Su>t P0E@@EUB,@B,t$B,rH輊MAQ;Pu;Pu Q;P u;Pt uN.E`. UR.?MI,V>‹MAtABtuFBDžDžPUrtPPMQÃPyP*ÃEP‹B0P4Ã>t @Dfpf@ @L7ЋB$`(H,@(t,P t&Ma-uV@BV@BF.h}ÃPdždždždž1Ƀ 1҉ЋuFǀǀFǀǀAvƒS hP5@SPIh-V URQjuEth PEx,tVUR@,ЃJEuQSuV@(ЃuV F-tjjVPj?t!UtxHt;Et R@HЃEx@t SMQ@@ЋEuP賵Et$EuEPEtjP EtjP URQju迌h-V4hV5@SGj?w E`.߉ UrMQ**t&uvLV hjWEtjPEtjPh-VFEPRju詋hQ5@SFj?tjuVf.1[^_ÐUWVS]EU BEr jSEPU E4@ DE}E BE…|QjSEPCEPhuWbEEEPUЅ}jSEEPucU ZNx@vjSEPu>EPhuWu%EENyÃjSEPu1e[^_ÍvU WVSu F0~4)ǃ~<jWFS$p 9^un~taF 9p|u?xxtjjF pxIv tF~t#jvΐFt P;&FFj$Sa)C1S8tCk_s=C xHt S@HЃS[e[^_ÍvUVS]hT7d7Сd7ЉC8t d7ЍS8P<d7ЉsuU$@؉Ft V1EXTK,t9S4t$9PVt {(u {(GC1< C4UVt$<EjREPF tjHP@CXt]P"ƃtKCXVSrS(tjC,uPVdFV|/vC`UB`$9v‹EP`fǃ<@UBHP 9SL&<uLC,uDut:C,C4UVt[< EjREPFt:C,t0%C,C4UFtEjP1T[Lu 8Fu'jjh{0h EPw  U1e[^_ÉUSM] 9YHtE;XUuA(QLtAPBPAPQLCTALt CTQLPPKTCTAPYH[ÐUS]@hUS~" StC B S CSLt CPBPt&SPCLjCpPCPJHu C0.sh`UC t P]Sh U h7Ћ]ÐUujjjjjjuÐUujjjjj jusÐUE t$t tvu/$@t@ tɀujjjjQjuUWVS}Gp u7ЍAh79|u9|(hl7h`>T轃tKh{0MC1SV蠧ShЋCPySh(ЋCPbWЃ }tWЀ}}WЍtC4 @PR7}t'C,t!t&jjh{0j Wlp C,u}$tC4U$B1e[^_US]Su*SuUЅt!v9Z4t $9Xu Ru1]ÐUVSuEPu ujjhjhU u1uÁK,EPujPt1e[^ÍvUS]tSk_p4Ph|0AS5k_hUSjjj Ãu h0|0j SECE Cx7Љx7Ћ]ÉUVSt72t7Ћt7Ѕu 5x7ЍvsCЃjS t7Ѕuče[^ÐUVSu]j$VG%ppF@tFFE FEF EFe[^UVS]11C@th肤f{t {tC@t Pove[^ÍvUWVS]u E1C@thEC EeppE@u E@4EC tC%C| C CC%@ =@ uh`|0&F$(~0ЋC@tCut&C;EEt Cp E@tWC @C CpttEP?1uhEÍvC HC 1Pt&1 E Cpt-C @C SC PCPCPS=lNjC HC tC@CC@CC@t CuC;Eu Cfuh|0SҋCЉCfCfCCtCHCL&C@t CtC;EtCh|0MCHCEtCuCCCCE@tsC @C &CttEP襡1uhsE뻍&C HC 1St&MGCh1E uCt-C @C SC PCPCPSjNjC HC tƋCCC@CC@uECCfh|0CuC@uC t SmC@tCtx&C;EuiE@u1Cfu(E t yt&h }0vC@fCENCfACfC4EtCpCu@tVC @C C`ttEPޟ1uh讟EÉC HC R&1 E C`t-C @C SC PCPCPShNjC HC tjC CtxC @C CuCttEP)1ڍuhE붍&C HC 1\t&MPCq14C @C SC PCPCPShNjC HC uE uCuŋCuC߉CC@CC@uECCf"h|0葿t&CfC@t Cu @C;Et8C@tCPjh@}0GCPEPh}02SCf9ufCCHfCCfu)C俉CCCCtCHCC@C Stj}C@tCtt&C;Eu h}0臾Et"CpCC E@thvCpuCuC ttEP1Ӎvuh賜E믍&1`Csv16C̀CSC PCPCPCPeǃ E uvCpu‹CuC uuaC @CC@uECfCEt5fC-C@tEPVh~0=MC%@=u.Cpu&CuC uCCCPhC@t EP褛e[^_ÉUS]CtCPCPh`~0QC@tACPCPh~0C@tCPh~0CPh~0 h~0wC@uC ~C Ph~0R]ÐUWVSuv h0 www7 w@w ~ wq jt&w0 w wI B@w5.www)UЉEh讙EUǃU v&捆 EUUREe MQ5,W5|7M&Ãu#}u h 0uEP)1m+U UЍf8 ~ UfP8EU)U)9wMyuAEUMQ躘؍e[^_UWVS}+U UЍ Ee)UЉEhKE} ~(C PW5|7m&EP14vUuUUЉ8ExEPe[^_ÍvU=7u,HYWЅ}=@~@=7ÉUP8ЋBLEh>Tjj7 PEPEPR"|7ЋEUЋEUЃj7P5P8&UÐULWVSU} ttt =7us7hhU!1۾&PhA0и)PUWټэ\ F~ątUhUЋMQEPMQIj8]SB=o=5 UЃUUЃ@PU=U=UxhU=f0U_=-= U=EU>HU=@2U+=U=U(U=UREEj8SEPMQEPI-e[^_ÍvUE= v%t&=wy=w: w t&@@=w={=woh&=w-= w =wG@=@w4@-=w=w=wÐUS]t&j5k_Su]ÉUVSuk_t&jSV|ue[^US] ʃ)Љt QS]ÉUEt RPÉUEÉU WVS]U EtuZE$GE $9u+h`0M Ejjh0WSV\ uݍe[^_ÐUu_ÐU,WVS] =k_EE%EEtÃj@pE&t&C0 C0jjh0jS[ C0u׋C0 C0UR?ECDC4{,CpEUM4ȃ~E  C0MAQ  CTFC<CHSEЋSÃjtS-C!Ce؋]ÍvUS]{\t SSh +V莤]ÐUEx<~@<ÐUUUhUjj)u7Ѕ}Pw3Uh,Ujj)u7Ѕ}PT3UЃ h Ujj)u7Ѕ}P.30UЃh`7h0jjjhHh Uc,h`7h0jjjjHhUDh`7h0jjjjPhU%h`7h0jjjjhUh`7h0jjjj0h@Uh`7h0jjjjh`UțÉU WVS}u # UЋ0UЍ t& tP9yutGA A ~}h0.t ABt&Qj)Q1Gu1=h0vjj)jtHv Yyq e[^_ÍvUEk_9tx4u1 @H9uUM#UЋUЋtt&9H4t @8u1UM#,UЋUЋtt&9Htu1ÐU WVS}E PÃw4pt9t FjhUÃ}tQjh@UƝƉ~FF j FP$@ Pg,s $@ C U SCU #,UЋ UЋt X&E #,UЋUЉCC;$tpjSWj$W W@tGDBDWDG@$xu P}$CG@t CW@PDt&{_D1e[^_ÐUS]S@t CDBDt&SDC@$xu Pǃ$1]ÉUS]C @ t 9Xxu@xt CBt&SC us h@U螟ShU荟]U WVS]u ~ CH$9t*9z u%}tFFPVu VV[TtD$9t39z u.C1<v%}tBBHJu R[Lue[^_USEX؅t:{1u-Åt.jjS jjS [@u[@uƋ]ÐUEU@41ÉUEU@H@41ÍvUEU$@1US]E ًt7;A4t2Pu,$$R 9P t$PE1]ÍvUS]E ًt3;A4t.Pt?$$R 9P t )t&$@ @tP4E1 t&]ÉUEU@@1ÍvUEU@@1ÐUEU@.t1ÍvUEU@@ 1ÍvUEU@@1ÐU WVSEu }Pu @ .X 9sPvPu1e[^_ÍvUS]$S49PtRotjs4SS4E1]ÍvU WVS}E p} tO;W4tJRÃtSux$$R 9P uMC-@t W$@ 9Xt0us42;s4t+Vƒt$@ 9B t t&jVSe[^_UWVSUE ZEEEpxtjRCPEtjVPEtjWCPEEu EuEe[^_ÉU WVSE UZ0x@Et;su"t;xu}E;Ct*;st%;pt;stjURt*;{t%;xt;{tjEP}t)U;St!;Pt;StjEPUu\t#;stjsjVs t;xtPx}t U;StSEH-1e[^_ÉUWVSUE ZEEEpxtjRC P6EtjVPEtjWCPEEu EuEe[^_ÉU WVSE UZ0x@Et;s u"t;xu}E;Ct*;s t%;pt;stjURt&;{ t!;xt;{tjEPu`}t)U;S t!;Pt;StjEPu1ts t3x}tUSEH-1e[^_ÐU VSuE VM@Et+;J uZu;Xu t&9t M&EuEPVe[^ÉU VSuE VM@Et;JuZu ;Xu 9tMEuEPVae[^ÉU WVS}E _09pu 9su9sts;st;st;pt+jW=uT;ptjW$u&;stjsjV ss3pO-1e[^_ÉU WVS}E _09pt/;st;stjWu3/pO-1e[^_U WVS}E _09pu 9s u9stS;s t;st;pt+jWEu4;ptjW,us s3pO-1e[^_ÉU WVS}E _09pt/;s t;stjWu3WpO-1e[^_U WVS}E EwjWuGEv66PPEp蚽u fX O-1e[^_ÉUME P T9s9u t&9r1ÐUUBxuE u>1ÐUExt t&1USjhU躐ÃjPS؋]UEuPhUÍvU WVSE8t+ËuEPEe[^_ÐUWVuX^_UE x v@ p0E$@ PYÍvUVSu] jVu"jj $@ P38?ue[^ÍvUE@-u@fx&w1ÐUVSE] )t< ttlSt RSu$ RtnHtg&9}ƋI@uJ{u @@C UЅt/AC9Bu 9}ƋIu t&)t E01e[^ÍvUWVS}u EEt^ tFu t&PwÃvSWEEFu$PftvXtovSW{EE[@uP~u G@FUЅt5CF9BuvSW4EE[u }tEe[^_ÐU WVS}u ]WHt"RtF@9t9t mt&~}9}jWt .t&hA{ÃV^SE{1e[^_ÍvU VSu j]Sv蘸uS6ue[^U WVS}} v ] ދEpGV 9wuF9wG 9w u!F9GvjURVMA~'uJqUB4} t/w } tEt&} t2} t$27Ћ7.v7Ћ7vu7Йu7Й 0Ћ0ЋO 9wu 9GvGW WG 9w uG9v GW W} un9uF9Gt^WF9wu9vE)Ⱥ)E)غ)ʁ%jMQPREp /4GFGFG F 1e[^_ÍvUE wjpEPRѵvÐU,WVS]hxUMUMPxEUM]ӉM܉] E uB] CE@}UBvUЉEu u7ЉU)ȉ)EEEM]SQWV謳Ɖjh@BWV藳]jh@BWV5CEU+M]ȉ)EUM]SQRP2EUjh@BRPM jh@BEURP賲M A}EU+M]ȉ)EUM]SQRP裲EUjh@BRP茲Mjh@BEURP$MAe[^_ÉUVSUu tuZjCPSRoZHjHvSe[^ÍvUSE] SPP?B~ APKHHS P P ?B~AHP t&S9P}PP |Iy[US=4?Tu/h`7h0jjjhhU 4?T jhU趆ÃhSu迱ǃǃ؋]UUHȅRhUÐUWVSUu M]>9zu$$R 9P taA-t/w]$0ЋA^P9tBO9t;@9t29t.3ANp9tX9tW9t9t @9t9u1[^_ÉUh`7h0jjjh<hU贁ÉU WVS]jhU]Njs$Oǀ8e[^_ÉUMU A$B$A$8ÉUVSuF$8tVÃV ^$e[^ÍvUSMQ$8X8؅A$RhUI]UWVSE EUR$U8wwxt tu ]MyMUCCU셂tCM셁uKU셂tKM셁 tK@uUB,tKMA.tK CuK!Cj EpS3u-UBt!j SPүuSWMQ 1e[^_ÍvU WVSu^$M IhqEU MAu yEH} u/@tN,f,~4tE@ u8uN.f.MAt  !E@@t  ! MAu t&!E@t t&!Mt 7t#u!} t! &!U:u!  MQpe[^_ÉUS]17ttJ B~[ÍvU WVSuV^$ tZ uQU!Љ E7t}t ! uǃ ǃǃǃf.{PuCPe[^_U WVSu] U1hoƒt& t;t.C% #C![RIoe[^_ÍvUEU1ÍvUSEM X$ &jjh0h(S98 t]U VSEu X$u Vt5EE Ej REP2u1vj EPRɫubEt' tL&)&}~'EEE 1 e[^U VSEu X$u Ftj PPfuxu1nj EPRu[Et tE)&}v'EEE 1 e[^U WVS}] GESv ~NPƃuesVEPWu ICt jPVm10ttjjR&jjR jPsW e[^_ÐUWVS}u EWUE}tPUЅ{4~3C-u-9t)VSEPWtEtjVS[uptPu b$XtHv{4~8C-u2VSURWtEtC1<vjVSU[@u1}ue[^_ÉU WVSE}u}m؃P-X&t&CH9tP9t@9t 9t9t9ujE PS[@uKPÃt9t&CH9tP9t@9t 9t9t9ujU RS`e[^_UEtPbtju PÍvU WVSE} ut'Xt tC,tjWS[@ue[^_ÍvU WVS}]Uw$M IEeG-uE ttulG@<RSURU R43@ Ћ3 UtU! } t7t 3-E $E(,0jU RW e[^_ÍvUWVS]C- HtE PRM IE 7C-tEg&t ECvE u1Et~ƃt$x׃ t̃Ut c. }ui{1_}thhEC1<t <t~{,C,t }}}!E f<CH@,ujjPpSC,} t}t9 C,sHj4}u!}tO{ltYC1_v}t !L{ltF{,}@S22;k_u-l_!t&2vƃ2SI}t EPfe[^_ÉU WVSuЋ!؉EV,t%E}u1ExEeE!ÉE#ttf<h*fÃF.t h0jjjvHVB FGSfF-,f<<GEeE!7ЋF$t~4tpF-$xu f<FH@,ujjPh#eÃV` dFSeOF( ;F-1h0DM e[^_ÐUE@1`-pH1ÉU,WVS5k_Ћ^$MIEeEEUU!} ME9$tEUU(M,E苓0U}uMQV2hdtM U Ut%M! }t7t PcF@<E9$u(ǃ$ǃ(ǃ,ǃ0URMQURMQURMQ@ Ѝe[^_ÐUVS]u Vs4h0jVs4hǀ0Ejj Se[^ÐUVSu] N- >7tF$$VuˀSVCe[^UWVSUBJ B-t4jRÃE@-t=47t UZ  KD9wu9C@wP UB@AB@ ARh0jhH,<PRM,PQDžjPP蛣Dž MQ$$$((Dž, 0 4 8VQPURVà ,u Dž, MQjPj j,1RP4Qj2Ã0EPjRj j4,1RP8 )PEvVRQEPlÃu4URjQj jjjPVPjL2Ã0URjQ>EPRjQ1ƃP u؍[^_ÐUjj uNU WVSu} ]hVl>^uEFGw$0ЋEF EFe[^_UE k_ЉH4H P1ÉUMQ49u A9JtR9JuB@BÉUUE t %9BuB z ÐU WVS}1} 7^u 7O;] v] Wt tLxPSVWE HPEPxUЅEP҃uvuSVWi=Ut[hP7PSVWZ uH=P7d~ P7d=P7} P7t5P7СU v1-e[^_ÍvUVSUM ]u1t9w Dt }t-tjRVut jVS蚌e[^ÍvUUM 1t 9w &}ttjREP萋ÉU}v2E | Eu -vPu uuuÐUVSUM ]u1t9w @t }t-tjRVut jVS蚋e[^ÍvUUM 1t 9w &}ttjREP萊ÉUjuuuuu u&Ujuuuuu uU WVSu] 1҉у}t} 9stu }tE;Er yv}tJt.U 9s%\D2MQV‹} \E QURV衉ƒu }tMQV}W=‹E0Ѝe[^_ÉU WVSU] 1}хt 9 s )}t v tQREPƉe[^_U WVSUM u}]1t9s >&t 9]v'tSRW軈ut SWVae[^_ÐUSME U1ۅt 9s &}t tRQuYÉ؋]U WVS]]E 8uUЃ @U }w E ljShUtU&+]U  ?5UЅt$/vۃj0SV軇uЃ06u+]E 1e[^_ÉU<WVSUE }Džt M DžuTtBt uBDžt RDžDž=6J +B ZRUDž{1$0Ћ9S4t&$9H$@ @{9P4lxC,]$@ @ I9Hl:IC9P$3vC9H C-MuwvZVS/hHWSx hHPVXtt&9|U~LVS= =PvPPWVu|)[ uUDž݃}t+E]9v E1[^_ÉU WVS] EU$@ C{rB{ 0B1<t<wQǃ$ǃ,ǃ0ǃ4h HPUǃTvEp HUuB,u R@,$,04HEpCǃTUBHt @4X ǃXM$@\$@f`A,t7CP t-BldBxtHhB|lt&ǃdCxЉM$@ 9Hu jUu0PpPyƃwfǃ|ǃxfǃfǃ~jCPP~yƃjMP]yƃEH11҅tAPQTe[^_ÉUWVS}u hPV/~FGF F$WV(F,GF0F4W V8F<G$F@FD$@ FHFLFPFT@VXF\F`G(FdG,FhG4FlGHt@4FpFp$@ @t@4FtFt$@FxF|G@G@G@G@ G@0G@4Gj@PRQG@ f$@fG,t?$@ P t/BlBxtHN|R|VPFTt&džG`GdGh dž $( ,G103<f4>f6j8PqjP8PYj$@ P`P vG1<t<w-dždždždžW @,FGFF ,VFG10dž12tjPPP9GlXdž\$@ xtN`$@ 9xuN`GtPT@P@DG1<wdždžvdždžPuG,u W^GGj]SEEPWEMAECG@G@G@G@G@ G@$G@(G@,G@0G@4G@8G@< G@@G@DWBPBHEBTBLA=?B~ EAvE UB$džHdžLe[^_ÐUlWVSUE }v&vor} -P跰EtRu)tuE t&U1=MA1<vA,t  t  t UB jjh肢EMMȍE@EEE߿EEEEEEEPUr à \uujMQW>t&uujEPW!&uUUMM EEUUMHE}UDEč;EjMQEP*yÃEEȍUȉUBUEMMEEEEEEUЉURMq ÃI}E%)NjEEȋUzUEMME}EEEEURMq 5Ã19sE8tF9s U<uM@;EVuċEPxÃU2EĉE9u u5t&MjPQwÃuTU@EăEEM}~ ;E`EM9r EjUREPrwÃMq jEP؍e[^_ÍvUWVSE PjjhU =VVEtt&{,MuET7Ѕtj P]X7Ѕtj PFX7T7jj VЍR؞X7Ѓjj EPÞT7V1 EC,u0Ph0ЋE)PT7P_=T7аэt}=X7Ѓjs,W|C4GC8SjS:~S: t&Phn0h h8?TF u#u1~]S4>EU)‰UUB[)É؉B} MBʚ;EM)M؍M؋B)ljA}M؁Aʚ;&}}AEjvQke[^_ÉUVSu 1>t"]SPSЃj6Sk uVtjRh u7ke[^ÉU$S] jutjEPR!ludStjEPRluG;t)EEMU)ЍAQku{tEU u7Љu71]ÐUWVSE EjuHjUURE0skM)ʉ)ЍUZ;d7~ u7Ѝ45u7Љؙt؅}ރh|-=UЉUЉ5UЃPy- EXtDC)щM)ʉ)Ѝ)NjUzjSRiu1e[^_ÉU,WVS]} ?v h,EuVo:EE􋃠EMut~U9u;N|9}EE\E)Љ‰UEM)ȉE};JU@B-K E E E EEP,jwEPhe[^_ÐU,WVS}u >w|^tjEPSRi:Vt#EUuEPW]EEP+uSt >􍟨SuVB: }u}t;EP5PS)UUUFEE=?B~ BUEE艇E쉇EE􉇤?SOE艄 E쉄 E E 1e[^_ÐU VS]jjS4u(uǃǃ=?B~BvuV8E9uF9 뗍&9~EUE)EUEJ)ȉB}MB@BR4HPPre[^ÍvUMwA|=?B~ut u79}Q1ÉUU:u u79B}BÉUSM] A 9}Qu)(@BA JQA )؉A 1ۃyut:9uyt%QAQ A )؉A y@BA I vA 1[UWVSu} E]S7U)‰UMF[)É؉A} MA@BU9uG9A} &9} >u~uEUVEEe[^_UWVSu} ]S6U)‰UUF[)É؉B} MB@B>u~t}~EUV"&}} vE9ȋP9~ȍe[^_U VУ VУ$V1ҹ UЍ& UЉ ЉLB~ÉUEU MPH @ÐU WVSuhh7|^=UЋM NFƒVt))9}5FBV vV$VЉF VС$VЉ05$VЃhh7|e[^_ÉUS]hh7!|CtCBSct&chh77|]ÉUVShh7{ Uо UЍ UЋ9t,$VЉΡ$VЉBD VЋD$VЉΉ\=U Uо VЍ VЋ9t3$VЉΡ$VЉBD VЋD$VЉΉ\&UЉɾ VЍ VЋ9t2$VЉΡ$VЉBD VЋD$VЉΉ\UЀ=UuD VЍ VЋ9t,$VЉΡ$VЉBD VЋD$VЉΉ\hh7z= V Ve[^ÉUVS VЋABQA+UЅy+% U6t&% V" % V  VЋ@AA+UЁ&% U1% V" % V  VЉA+UЁ*% U5t&% V" % V  VЋ@A+UЁ'% U2% V" % V  VЉH6A$ AqY hh7xSփ hh7wx= V Vhh7xe[^US] ju蕢u 3`]ÐUhC-t!f<t<H SC1C,t S\v SǃC,uhU,vk_Ѕt:Jls R3]ÉUSMA`DP 9v‰ЈËk_Ѕt:Zls R ]ÍvUVS]S`B$9vЉC`hƃSsV1v e[^ÐUpVtVpVhVlVhVxV|VxV77`V`V|7dVЀ7ÍvU WVS}] tSwCE]=7t|,U 9B uSEPGf>}ԃ${uu=7t4Et Ã}t[ CphD0> hV0>Ee[^_ÍvU WVSE} tU B @x E=`VЅ}{tnC ftYffvOsf>|FvU 9B u'}tSR؃PE PU҃f>}${uue[^_ÐU,WVSE} UEEEUEE7f=7|B|7ЃW |7pPuVEPf;}Ee[^_U WVS}u ]VWutSVPWqvtGPV47<1e[^_UVSu] SVjuVh0<1 jSPj e[^ÍvUWVS}U tG @x t֋^ ӃSW"ƃCEUV4f{ uC9FufC t&fC FlVЉFlVЉ0N lVЃV~uFPh0;,GPFPhɅ0;}tjEPU҃`VЅtH{t9&M9Ku!C;Fuf{ ufC f{ ufC${u΋RuEPVWUBЃVae[^_ÍvUWVSu FE;/w h҅06jj3zǃuh063WjUBw G(f~ uIV WF9}AMyt8<t0GPWVH9}Ext<u FGwUrh60jOMQ&; vh@0!6t&EG$GUr9ۅu 9~MYjjPyEu"o0Ѕth0Ph05)SEPit$SEPU2PjM1{{ UEWM<tEPh0A5t&G,e[^_ÍvU WVSu1N y{t Vu!{ tE PVC Ѓ-tU PFPh04|7Ѓyt@t&9yu-fy uA;FufA fy uQF@9ufI$yuŋVtFBFlVЋVFVVE uFPh048V1O9}:u @9}<t;Guj7yG1e[^_ÐUVSuF 1^(zu-u F(jVBЅt^(e[^ÐUVSuF 1^(zu - t$F(jVBЅt^(e[^ÍvUS]{$u h 03jjjvƒuh`02&ZE B tVЉBtVЋ]U WVS}pVЅtJ3C9x$u4tCFCtVЋCsC ЃjSx ue[^_U WVS}u 1hVЅtZ9z$uVR uڅue[^_ÉU WVS}u 1hV &څtCZ9z$utt'&R RC-te[^_ÍvUSEU 1ۅ| ;P}u 1&C(u1ۅt S؋]UE@,ÐUS]C,PS,u"C xt S@ЃjS*w]ÐUSEU ]CjRCPS|VЉC|VЉ|VЋ]ÐUVSUu B$uF$|t&‹^@;Z@saz$taJ$B@9A@s%t&J$A@9rGuAT9FT|=ʃz$u3ʃz$u'J$A@;B@r9ruAT9FT|ʃz$uߋB$F$r$[^ÉU1ɋU9s vf3 9rÐUWVS}MuGD% ЉEmE]at!h0Q_0EЃ&EЃG00Щt0RuPEPU Rh0ЋUҋ_T < Sh‡0<}|]ShŇ0ЋU҃W=V 31VЅtVs, EtӋu1e[^ÉUS]j@ju hCPgK01]ÍvUS]{0us,Sjjhqjjh@uq tuh0}-hRrah@_aC`PVЉCVЉVVV]ÍvUS]jsjs t CB t&CVЋSV Vyh20,]ÍvUUB4HJ4u BhPUWVSu} F4PV4uv,hN0l0]SFhU)‰UMFl[)É؉A} MA@BUVpVpAFtFt=?B~ BVpFtEUFhVl~,}tFPVTF8V<FXV\F@VDFHVL3yWj֡e[^_ÉU5k_jjEPeÉU5k_jjEPeÉUVS]j@ C8C<CPCTC@CDCXC\CHCLC`PcCtCpV e[^ÐUWVS9TЉddP\hۉ 9TЉʁ% Ѓ % VhPQh0m. C5k_h jVSЃtPhP59Th0*5k_jlWhedAVSЃ tPhP59Th0)5k_h jVSЋd(u h,0)8 t#t!u3P5,&Ј8Ph`0g-P5ЃЍH[^_ÉUWSjjhhlÉ1҉ZCCЉ؍e[_ÉUjunÍvUSM] C,t A uSP]UVSE1X S$uH0؃ttFËtt B$C$1[^ÐUhT?ThphT?T5u7hT?T l?Tp?Tl?Tjjh0hVU WVS]=7u71҉ E CEC7ЉC 7ЋECCp?TЉC p?TЉp?T[^_UM9 t?TuAt?TЋQtA B &A p?TЋQ AÉU WVSE}}t t+} t@} 1l?TЅt){Vu t[t{VuF9ut, tt=tMtt&VjWEP+ft>hP  S0tsjWEP[.tCu&0jWURʵ-e[^_ÍvUVSuhÃ=t?Tu l?TУt?TЃ5t?T.t?TЋ@t?TЃSx5u7Vue[^ÉUEPP@ÐUU=x?Tu?Tx?T?TЉBt?TЍJH?TB?TÐU=|?Tu&jh0jjjjhVA|?TÐUVSu?TЅt vV3;u [u1e[^ÉU WVS}uEi}tSVWXK,ԉ[$EC(C vMʍJG tG PW G Bw$E 4PEPj gÃu1HCEE CEC ECC}tCE tKSV؍e[^_UVSu^t(ًtABQQVqu؋Vt FBt&VFFu vVrie[^ÍvU WVS} u]EuSE@uPtM9;Buz{UD:C MAtAXEXCUBV B9u UV EtTU:;AuI}t1A F tABQQMQc ySEPH4}tSUR3{MD9C tXse[^_ÉU WVS]E U|;Cr;{ vEPSƃu |1ҋCSU 9P rGE t0Kjjh0иEtPS t7VSi#&‹t9xvVREPURE PS 1e[^_UA9u;Y rs9v.A 9t`s%C_A G UQ tx9OY tQ 9rA9qSVh0V!h01t&EA CYtWURUBt$BR1e[^_ÉUVSu] Ftl~ uBu_tVNjjh0иtPF P u&~ t^ tCBSC&1:hƃShVN ÃVtC؍e[^ÍvU WVS}u GFtXt$FG tG pw G FXvhwÃVhV_Sv$t&FG tG pw G FGt8gG P/&hÃVhVSe[^_ÐUVS]U vSVЍr;a0u9s uC|9} C|9|RSNa0s VVe[^ÍvU=VuV1 ÐUVV1ÐU WVSV1hƃY&EtV #& Vjjh0hSBǃ t VxC9CtV%V6E PVCP:ǃu;CCx;C |CE HtSC)yC )Љ9vƅue[^_U WVS] 1hƉكAt&VЋB9BthVu [Ve[^_ÉUS] f{t@C87СVЉCt VI%V>&VЋB@VЋB@VVЉ 1e[^UVSu] >uCCQSVKB9rBCC@BCC@1e[^ÐU WVSu} >tDWVFOB9r+w)Bu BvZWVX1e[^_ÉUm]U WVS}hÍu VjjjW$S =VuVjjjW 1e[^_ÍvU WVS}u ]=Vt StuSЅtÃt/t+SW}t;Su Stite t`t[=VtRVЋBLBZCB 9vىJJ|9|BB;BuHJ;B |Bt=Sut W7Ѝe[^_ÐUk_B,t.$@ xtE Pj$@ p ju@ÉUUB,t$@ xt $@ 1UEtuPh@UÍvU WVS]1jwt"{tjs vts EPjVWu  e[^_ÍvUEPjuju dÉUVS]h7d0577E PjjjS%Ã0=VuR57Ѓh7c0؍e[^ÉU WVSu] h7/=77SjjjVÃ0=Vu=7Ѓh7/؍e[^_USU] DEuUEPREPj(uW…tEЋ]USU] DEuUuREPj(u…tEЋ]ÐU\WVSEEEEE t}tUUMMEt&U<%th MAMEE t,}tU9UuE  &MAMt&URM QPU<%tuM9 AMEEEEEEEEEX$$0ЃEUZ1UJM<uVSh_0%v< u VShd0<VShi0jEP E}}tOt&GEE t%}tU9Uu E  MAMURM QP?u {EE8@EO‰!! <}t,EԋU Uet$}tM9Mu 1 oUBUdMQU RPN&Eԃ}t'}tE9Eu E !MAMEPU RWEM9 Et&E8 ~ EU: M9AM}Q>EԋU t1}tM9Mu Q%t&UBUMQE Pj>"}E ~Mut&EURUЅ\ډUЀMNE+Et&M ME*u"EEx}̃E1EU|BЋM MEȃЃ v}̃EM؀1U|BЋM MEȃЃ v}t&M@&E8lu @EM lMcUU܃EMAEMEب tEUZr0MuM@tEEXEUBÉ} ۃE-t&M tEUBMԉHMuEب@tEUBMfEUBMԉMEب tEUZr2MuU@tEMY vEEX11_EUZ1En0ЀMEx7t&EMIM܅uE0Ѓ}|BEPjURt+E܉EM9&ẺEt&}ܰIMMU tEMYq)EبuM@tEEX EUZ1oE0 t&En0ЋM tEEXp.UuEب@tEUZt&EMY1Eبt tMEM̉Mą|eEE܉ u }t{rM܈$P0M܈ uEب0IM0t&Mjj VS 0M܈jj VSM Éօwu wM܀0E܈>M܉؃UM܈ uEܗ0Ћ}ܰIM1EE%t&}'UU܊MMEEu;u}uĀ}tF EبtE؄uZ})Lt& EE t%}tU9Uu E  MAMEPU Rj O}t@EEԋM t }t U9UMAMURM QPEب0Eԋ] t0}tU9UuM -)t&UBUt&MQE Pj0Eԅt4}tU9UuM v ,t&EUBUMQE PURE%=uY})Kv0EE t%}tM9Mu E q UBUMQE Pj0OO}+}N0EE t+}tU9Uu E &MAMt&EPU Rj0OmrXMAMEE t+}tU9Uu E %MAMt&URM QPmsEب[})OK EE t-}tU9UuE tP,&MAMt&EPU Rj "OM t}tUEEԍe[^_ÐU WVS} G =v evtPEphgEGCG C GCEP~EPJ EP1e[^_ÉUVSu] NQ9r&)a $;AsYN-l_[^ÍvUWVS}u G, tu}to_A9r_)Ɖa EUE$;AsAƃj]SV uUfUjVS. t We[^_ÐU WVS1ۃ=|7toE |7Љ7Љ7Ћty7f<0t"709~Af<0u7ЃE$$C|7ЋM<u؃<u$&ڃ$Z|7t7 7[^_ÉUVS17ЃtH;7u+h07h07ЀqtQue[^ÐUU7У7;7} V@7ÉUWSuh0j(h@ V@ VЉ߰ы7ЍD ;7s=߰эAP VPS߰ 7I 7Ѝe[_U塼7;7}ƀ V P7ЉУ7ÍvUUBv'7Ѓ t+u&Rh0|$Rh0fRh0VUVS]|7Ѓ |7ph0&|7Ѓw9$ԍ0ЃFPh0+h0hȍ0 hʍ0e[^ÉUWVSu֋79~;7Rh0;7~8 7Љ$79&)H4,747Rh 0\Bv9~ShA0?%|7ЉEVh\0Vha0E |7Ѓf;u:he0(EPhk0PgE| f;uҋUB f|f~ f hn0hw0Ex pfty7t=ty7ty74y7h|0DF7 f<uăUrh0e[^_ÐUWVSM11 9-uGA90uTAh0.h0h@0h07h0*ߋ8e[^_ÉUS17vPC$779 t7]ÐUS17v4y7ChL0;7 t7]UWVSEfEUU1E7;7E |7ЋEx0Uf9ty7} uEP0tU 9ulE}et}dt!?}st)7&S7t&S't&PEPhP0}u-Ffty7@}uE$C;77e[^_ÉUWVSfEfEfE] t&CfE< t< t< tu&C< t< t< t1;7S&4y7ЉэQE9uRVEPRuEfEfEE;7~f}uhf0tA;u jsjuVSKujsVEP h01e[^_ÐUWVSEfEUfU]1ct 7=|79E |7EMzэA;E M QrEP[f}tSf}uU|7ftFt$V$fFh$Vsi6"tXh:ƃ{l$Vu({1uS~ t&SgC,@t$C,Ve[^UWVSu E@E1E;}s~} fFaPUR賫Ãu fF @C,CURVRS@ fFK,C(tC,Pphf~tGEE9ErE8e[^_ÉU\WVSEEEU RUM IMUBu79v9Ev MMe} vjjEPEURMQE 0GǃC1;}sUfD@;Er}MbEU)щM؉)ʍU)‰)ЍuFVpt ]S8EE؋CFF=?B~!E؁F&EE1ۋ $VЉMEH,@URMQEPURM9 }]S貨UЋE؃9uE9C9E؋U܉EȉŰE)EȍUȋEԋJ)ȉB} MȁB@Bv}ȀQ~u7Ѝ)R轣ÃhƋUB,@t M9 $VtV$UB,jSh0hh$V6bǃVǘMa,#t3t t(&EPU 2MQ@ǃE9EtjURe[^_ÐU,WVSE@E(EP'jh$VdƃVÃYjh$V=ǃWà &UUREPEPƶÃEf@Ef@ Ep$E@D7ЋEUEPEPUR{ÃEf@Ef@ Ex$E@D7ЋEUB~W9u0E u)tfWGPD3P uAWS#EtWj #GtPGP.fLJgqUB9zE%EWSV wV2à t݃ t؃WS% Vp2à w t` t[%0$@EWSV02à 7 t t}t%0$@;EtVS[.&UB9u%ztEtW!UB9uEzt?Et7}jjwxUW#zG(G=~CE t#9GHTWjAjW.t&wVSo-Uu W"WS! t& t*U9tB9tB9u4Et,t$fLJG(PV1W! $BffufGp t߉GpWj/WS U9u8:t3Et,)vƅ~WjCNGqtUuUB 8B gqWe[^_ÉU WVS]} u8%V%VGdUGHPS+;ۃ u})t1Ajp|EGHPSh03-)ؙ%V%V_dEP|f u uMtI%V%VGduGHPj *t UfLJt& ut Cw~tuލCw2$̘0Ѝ'!^()\t Cv9t(%V%VGdGHPj\'*uE@t u ftz%V%VGduGHPS)tP0$?w-$H0Ѕ~"It1 vAfe[^_ÍvU|WVSu }tw3{t wzt ^t rttygttkwttaettYt,w~t,rvAz jjRjh7hhHVЋEP&"Ã0$MA|9B u"G,t;Qxtu  u  tt,@ot  wJ^t w t vt :_at #nt Bst@$w"f@t@zt&wt@ht@ivbt)wD~fwrt}ftpttgtHw et,vtsvt,dt,XSvjpzxE}?t EHp<Ubp0jpJxE}W+ U jp$xE}OqUuPMQ E8SЅt;Et@p((u EE@EEd0Љ}EP!ÃfWhuOWG0huQÃWju\WuqtUS M; SS}W> Åvj,EPEPYt&UBhM}MQv$MA|9B uG,ujW}GxtPE:jpTvEUbq!}GHUjp*vEw>MQEÃt}W{t&t,ujEPUBMtRQЉÃt }W(UBpu(f}Mfy|$߀BpR}GUG$G((uB|txtjjp MQt,}W E%9tmt UR=L](SMMQ'Eu}߉}߃UMBtJ }g U% M A jPȃP衰}W1tE0URlU;57r MAh9jpsE}GhURW7Ѓ7ЋMQUR8ЉÃt(MAhQUR8ЃMQs.UBhEt&jpZsE}Gpu tUBpR7MQ0sGxt,E^$MA|9B uG,u }GhWMR7jprE}Gpu"GpGmPjWSЃEPrB$P 9zzu My|t)MA|9tuEp|h@U$@ $@ UB|$Bx$@ P O,M1‹$@ M;A|uG,u u 9B t vt&}WxhEPZjUREP迬tjUR9Ee[^_ÉUS]Cp@t]t1z t+CHPB P6ucpSvttjSЅtcp]U WVS]jp/dE} tk_Ћ1SH9~Z9~VS} t k_9tEPc18Kpj5u7hq0jCHP/- 9sHEPce[^_ÉU|WVSuEEU RU1EjpWcËFpu^f|T tSLc EtS,c#+jh7hFSbk_Ћ$F|9A B,;Nx@   yu jj$jh7hhHVVP ǃ0ESE9FHQ}E Pd9vЉEUUE PUREPǃutfj?h0ЋUREP誘])ÃuIfdžVUP!EME9FHY]fdžFHPSUR)f])]ؙ%V%V^dNuE9FH }/V U z}UE PFHHEVjp`à U9VHS`6vEt)S`EU BB1;Eu#Ht&Npjh7hFHPVOǃST`RE @1x[^_ÐUWVSu] %%Ift\v50$? $0Ѓj@=jSD-;C}SnjpZ_EKqfEEPCEP ƃ t*t&Su EPVEPgƃuڀcqEP^)f~OxevSj9OyOPVh0> t(Cp u CpSj\SVISP6fe[^_ÍvUVSu] $VjVj VjKՍe[^ÉUWVSutVPVj Xjp]EEEP~(WVu| EPSWÃu݃EEP~WVVuD EPSWÃu݀fq߃EPQ]Fffdže[^_ÐUVS]u Fquu tS uNuI@t% t uu Vj^Oۃu?@VS0e[^ÐUS]􍃀PCptjjsxCPh)t jP`]ÍvUUE 8t9u @&8uÐUVS]gfff) = } f= w hs h P3ONRf[^ÍvUWVSjEPWЍ  Q))QRhę0ЋURcEx|u hә0/UBxuh0R5Xuh 0ЋEPd1SWotߋ[@uG1<t <tu@0t&G0P0Pw4PhX0ЋUR juV]SW`ڋBB=?B~ EBKh )Ruhj0ЋURSFF=?B~ EFN )Ruhv0ЋURWh)Ѝ G1<t<vG @, &1PQ)Rh0ЋUR~Efǀe[^_ÍvUS]M C1E<ҊA1E<w~uQ`C`9wZ9wjntOE<ҊE<wt/t<t;9w%9w C,}y,|vy,} |1C49A4[ÐU WVS}] jp[XƋCp((tVZX8& uSj SWSVX1e[^_ÍvUVSujuuuu L!u1f9te[^ÐU%V%V%V%VÐUSjj>h褼ÃhSĬjhCPIjhC(P6jhCHP#%VЉC%V%VЃSh^ЍP0؋]US] %VЋt CB C%VЋSCPIC(P=CHP1j>S]ÐUjj %VЍP螻%VЋ%VЉtiBlBAB(ABHA fAfAfABpAB|ABxt@A A BhA$(u1U WVS}u} t EH$0Ѓ%VЋ%V.%VЋ%V%VЋ%V%VЋ%VRPVWURwFÅu;%VЍP5%VVWEP Ãj 5%V蜼-e[^_ÐUÐUÍvU WVS}]jj>E PGU RP9 t2jj>] KyE pVGVP GG GE GGU W1e[^_US]CtsP诩j>s讻 Kt(SB}B@PQ}j>s|CC]ÐU WVS]jpSE;tSs>St#+KyA)sFC;CuCC uC CEPSe[^_ÐUWVSu}E EjpQSEIt&F V)9r^)9~SEPR虏)])F؉F;FuFF~>>uF FEPRE )EEe[^_ÍvUWVS}EjpRE7} uGW )‰U|)lj}rt&GE_)ËU t?N~TUCE uG؅}CG )r&E;_uN~UCE uE;_uEPREe[^_ÍvU WVS]u jpQNj9uH~?~;t&C K)9rS)9~)) C;CuCC~;Ƀ;uC CWyQe[^_ÐU WVS] jpBQNj;Ct.uG{u8h0vjhS tWQCC CC UCK )stDEtȅ}A)Ѻ0ȅ}A)Ѻ 0C PS ;CuCC WP1e[^_ÐU WVSM ]u$ȅ}A)ҋM ȅ}A)ƍ Ѕ}BE);}u#)HЋUM C‰ʋM ؋UM G9}&U@;E|[^_ÉUWVS} uEE1jpfOE;F~u$h0tjhV u}FF Fgt&F ^)ËV9v)9~SPMQiVtSFN )PRj])F ؉F ;FuFF ~F9|EPNe[^_UWVSu] 9^udCTСdCTЅt tHdCTu1BC;^u^;E8Vt(+NyA)s E8[^_UWVS]} dCTЅu17C07St%+KyA)s7C[^_ÐU WVS]jpMǃ;tTC ;CuCHC C 0St#+KyA)s;uC CWVMe[^_U,WVS]jpMƒ;t8E 8u;@9Cu3}ߋu } uRL+RLU RP_Sue[^_ÐU WVS}G,t$@ X1ۅt-WhS$Wju S;&ƃWjSM,e[^_U WVS} wF,t$@ X1ۅt-VhS@$juWS'ǃVjS+e[^_ÐU WVS} wF,t$@ X1ۅt3VhS#juWS&ǃVjS+ e[^_ÍvUSM UZ,t$@ @1uCat u4qt u$@ 9PtZ,1RjuuQP&]UM UB,t$@ @1tRQP&t&RQuíÐUVS%VУ77Р7SЀ77S%V7о7Ѕt)FtЋ^;^sC tЃ4;^rvu׃=(V (V%V(VУ(Vк)‰(VЃhhCThhhCT"hCThXhCT"jhhCT"jhCT"e[^ÐUSU] %VЅt19t @u$"PH9sf:t9t49r1[ÍvUWVSU} u1ۅt%VЅt9t@u1AcC03Sh (VYWDe[^_ÐU WVSuhDFf E&VЃFtjVEFtnV89tF0cMA 9EsэuEUBPMQ É}tdEPVfSMACACACA C CQSC$C}ʚ;uU )SMKEEP +U;UvUS MA}u\EAC{$΃$hzAƒMA f CA8C8Ku2FPjM 9vP 6^ 9] 6t&>u*FPj,tWvP 6~=F +E 9v‰ӃSE FPEPG{])] E ]uUBt M9J}Je[^_ÉUVS]u ;tT;uKt&CuC CN ȍ9r3,QC CPvzF C Vƃ ue[^ÉUVSuM ˉ|5~"P 9w )@ )ʉP H1Ʌuډ@tg))X`ًP 8t P 8uX 9r)ˉX Ft8)N3)y1҉@t P+P t9P rP @ u[^U WVSuFu6E F9s&t U 9V r!ƋG )E nt&} FPjǃG Ft2%VfGFGFGFGF G fFW$WG G})Evtc%V;E sE U9v‹^ 9vӃSG GPvx)] _ F )؉F )]t^Vƃ} } 7WVx)V1e[^_U WVS]} wE PS~>Ct:CM 9s(t"9K r ߉ËG )E } CPjǃjWGG Ct4%V fGCGCGCGC G cCtPs ;u vu VG GPs~w)u w C )C t st&ScÃ} } WCS )V1e[^_ÍvUVS]U u|.K 9v v)ʋu u Å}1[^ÉU WVSuEU ])‹C 9wt{ )ubt|Btt09R8u+B$J)t B vB)9}B<r E@tp)pMQWRSEu 1yjEPu}tكMQːt&q E@tp){ }tʃ9t:uE:u ȍe[^_ÐUWVSuE EuF 9Ev)EUUB 9Ew}MA +EEFFPURÃNVfKFCFCFCF C CVS C$CU )S~VMA}v8CEPURQS~17t&}u MUBPMQ8Ãt+E$CE@t]{$ƃ$h7ƒMA f CA8C8KGLPWtjWЃG6PE f C؍e[^_ÉUUM EQu fB0 t&fB2 QA(QBA,BA(HÉUMQ} uB9AufJ0&B 9At1;t&fJ2Q(tA,B, QA,BQ,A(AAÍvUEHP|RPUS]K CLPStjSЋ]ÐUMQ,fQ,jA.Ph0и@tPQ#ÐUS]5t& fC,jjh0к@tRC,P uC,uǀK,1]UVSu] C PkC,€fS,t$fC,S#FtvDv@jv<袜C$t jP@e[^ÉUVS]u s|VjtWuCLPTt8{\uC\u ǃ9v1V7e[^UVSu] t 79v 1.&^ 9vЉF 9^v^[^ÐUE 9EvL)V9H)Vv 7v1US]SC C]ÉUS]M t1Ct@t QSDtKPQS:]ÐUS]su SCC]US]M tYA CCAtA0CCtHKKtQt fQHQPS]ÐU WVSuM ~^_DžtPftfuuA FFAtA0FA;uN tQt fQHQPV e[^_ÍvU WVS}E }tuFu h0f&EP]tS ;uO)Gw )Ɖ9~9E 8wjj>ƃu 1U F PvRAtEUUEt#C GGCtC0G;u݋C GGCtC0GGtpww_e[^_ÉU WVSM}u hȜ0T%Z :t Z :uUU t Z uQ)‹Aq )Ɖ9~9~1pU E:t$B AABtB0A:u݋B AABtB0AAt xt&yyQe[^_ÉU WVS}u ]EF EN u:}tu څFf9Bu9wuGV\ƃ명Czwrtt+9[8u&C0C$+C+C S S)9v?u;Ff9Cu1QC CPv>F C F VѼƃ t3vwwF GGFtF0Gc3}tt Ef C h؜0O'e[^_ÍvUS]{t3S{u]ÍvUWVS} EXE)NjU)BBCt+C0BhWECf E&VЃCtjSCtqS89tC1ÃuuuwEP7u#à E9t jVZ؍e[^_ÉU ftfuah00t&F uGTV,)‰GTF,GLN()GLF(C|PS2h70Ov}tSEP Eff}t2~ t E8SURWE~ u E9F F7ЅtPMQEPR{LWtAWStjSЃEE t&E7}VGt E F u h>0}t$URMQCLPtEEPCLPF @,ST)‰)V CTB,F @(KL))V CLB(CLPStjSЃE5t&hE0Ovj5V EPHf?uF t SLMQHE~u*VЉF*VЋF0V4MA0Q4MA(Q,MA Q$FA1FtG@ UB PrFp[F t(@t!@ UB PrF @p2MA Dt&Ft E@ jpF PoUB hL0-}tMQ}t EP Ee[^_ÉUVSut~PuVft ft15$75 75,75(7Vrt&h0vuAjjj8NFÃt%j8Sj63^C0P1 t&7e[^US]Ct@|sRC{ t!Sj6s{u3L@s̛ =*Vt 3jSG  jSG]UWVSE PMyup=v KVBPhS'DžxDž|DžXTEETP:= dtIxPhh9u SQ P?QSQ0}`.VEUB@$%EjB0Rh躺EPxPdPh] u:dMC|Yjhʚ;jE P裛UBMQjS达1H[^_ÐU\WVSE PEEDEJMMMX 9u|t(t&EP;Ã}ȃ8t &EP‹B0hWvÃ_|t<Mf9t )UB @ tfCtjSƃu =WvC^xtjhʚ;jpoCMA@C A@C$KSEPÃW3O؍e[^_ÐUVS]u Kf9t)OVQ ftfu+BAJS$J SV h071e[^ÉUSUZ tyB ftMfuaC9uBC%Åuh̝0t&C9uBCB`t&Q#C 3]ÐUUf8uB tt PÍvUVSuE fC8V'{t&CS肱v3jV4Ce[^ÐU,WVSk_ЉEURUE: Ujj}eEP@EUB(P}G}t4u 0EuOKu u19}jEPVUPjEPoE t_Kx U4EplKy}uUREE(UB(PGUBU EC9Sutt&EH *VKuEPUREPE UE UB UB(PFjEPjAEe[^_ÍvUWVS]E @Es~u~u;C t nE}S B)CfEtt#9[8uC0C$S S)9\~XEt &jSCu 76Vssh&G lj{ \01;u}vjEPWjuEPE tOx t xu et&jSEP!E@ E@*VЃF;u|15 (jEPSEH EH *VЃNԉe[^_ÉU WVS=*Vd*V*VUЅt fcϋuUЅtnC tfC *VS tCu>;St9K f{ u.S$t'B x7u@ tjhr`u=*V{jj&UP*Ve[^_ÉUEtjh<PÐU WVS}tkt^fxuKx vEPzu9zu3Z t*Ƌ}tPE ЃNuuue[^_ÐUUBu ufz u *VЀ fBÍvUEt@,H *VЃjPÐUSM1ۃyu>*VЁ+VsA9Ct+Vs9Cu+Vuh0t&Q8 +V-A0@u$ )+VЋA0|)+V) ,VЋQt AB t&ACQA]ÐUWVSjh0jjjjth +Vs*VЃ +Vs&R+Vrh,Vjj5(Sx+VЋ ,SЋ(SЉșEU191E]DUЃjtS)CDC!Ce UKHCp;u}E@E C8C0 C8t*V +V+V *V+VЋCt KHCBS,VЉt,VЉX,VC,VЁEtF;5(S, ,SЉȅ}A*V+Vкgfff)‰+VЃ +V 9+V~+VЁ=+V~ +Ve[^_ÉUSjjuu upËC0 u"C0 C0S1k_Ћ@@,ES) ]U WVS}jjuu W ƋF0 u"F0 F0Vδk_Ћ@@,E$01;]}vt&E4WiuVjjE4E4W‹B0 u"B0 B0R^k_Ћ@@, R/C;]|VI e[^_ÐUu ujEPEPuu uÉU WVSu~0u"F\t@Tt@@@tVF\t!x8u@|@@Tt t@x@t^0F0%F0j@,EtVY k_Ћ@@0F\@pEPF0 F0V? uVC ÃV 1e[^_ÉUVS]C0|4C0 C0j@ƃS YVk_Ћ@@0SE;S}")Ѓ<|SuS, C0$C0C0C0Sne[^ÍvUUB0 B0R蒲UUB0|B0 B0RgXÐUUB0}B0$B0RCXÐUVS]j@ƋC0%H=Hu C0C0C0Ĉt C0 C0S8~C0 tz{pt +VЅt SЃC0}C0$C0{\tSWSkV C8 *V+V*V +V+VЋCuO\C0@t*V. +VЋC0| +Vк*V  ,Vк*VЋC0t(CtKH t&CBSvCBCBKJC0%C0=+Vth+V[+V,VЅt&+V9+V~J,VЃjh,VAVC0tC0%C0Se[^ÐUS]M S#,VЋ+VЋt"9JPu9Z\uB0 u u1[ÐU WVSESEM #,VЋ+VЍwh-V"MqDEpUBe[^_ÉU,WVSE]$CE܋CEeEe u MQ$t }t tE%EuFc~FEPhWvCE8/ufMQUy/t+Cu)FS8t Eayu*Exu}t E?UzKpEC uKt&A9t9/utSU+CC=~E?M)AQ:/u2Epux/tUE@)EuM)qQK EcE8u}tK@cKC@C{uCx.u 8.uK cC t^/}GTxuG@EPhWuU;z t;=T-VuMyyG@G<tCtu~Fc߃SPWuEu^G<tXGT@@ tO}xC tutuG@EPhWetst&}6Kt E}uuVBT@@t EEPB@&C ~1;E|cC +EU)BC +EBC B8uKMyfEPjjVuQURjWX{FURV@ ЉEMQV}WB }u~8u w|tCtG8u C@tUEP)PK1&tCt Ef{|!MACq t&w-}uGT@@u}tuF@T@@t ERUBt#CtB@@}uMq[ CLuVjWz8EC% =uEPjUryMq }t W W uFEe[^_ÐUWVSE@EUBEeǁ%BuEPhVqUB8uhl0蝺E@ t h0膺URE PVIrÃt2u FT@@t UBF@zE 0Uw,uFT@@u}tUBT@@t FE@tUB@}uEP UBuEPjVpx1JUB%=uEPjURHxEPY V U ؍e[^_ÐUh`7h0jjjhh/Vt /VCT/V/V/V/V0V0VЬ0V0V/VУ/VУ/V/V'"ÐUE Ut u  t uRPEPu1Uu jjEPÐUEPGÐU WVS]k_ЉE57v$S~WujjhÃhSjjh0jCPq EPjjSCs CC@CFF% C@jWP`ƃ/jjYPu E1e[^_US0:TЅt<187Ѕt)C tЅtPCPh0#[$u׸]ÍvUM/VЁ/Vt!t&9Bhu A9Blu /Vu1ÍvUVSuF HSVhNlf=CTu fCTCT CT% ‰U]K=/V/Vt vEfCTЃSEuEFhe[^ÐUU1ɀ:t1B:uÐUE@@ @L@P@@@D@<@8@4@0@,@(@H@$@@@@ @@@\ÍvU WVSk_ЉE5CTu790V~ CTj@͓ơu7Ѓ90V|%0VЃ=0VuY/VЃ=/Vt =CTtBV襓jh/VޤÃhSǃ0V[Xu)VXhȠ0oEC= tSlu{@t ShΠ0 h٠0At&SXt C\B\C\GS\CXcHVђ{8tEPS3C<C|C8Sbǃjjh0jPZEEC4(u S'EC@ǃ1e[^_ÐUSM] yTtQ`tAdBdQdA`YTtCA`t CQ`PdKYd[ÐUju uUju uU WVS}u uOEP50Vjjit/]EC8jWS%Et S]1e[^_ÍvU WVS=k_ЋUB8v1;WSE E ?41VЋtU&S|M ;J u)C8M9A8u{@tWhSuZuŅtu{8tWjjj‹EP|M J 2BBBE:H=K=S$WjS+pWjSǃjjh0jPUB4C4B8uS؍e[^_ÐUVS]u uC<tHtC<􍃀Pjh0hSXt&{@ubCHt\j@>{LtSXuC\/VSXt&C\B\C\0VЋS\CXcHQC@t1uVSgƃtC@PS@u S1e[^ÍvUVS]j@菎KH0VЃ{Lt/VЃ{8u CXt sXp\CXBS\CXBC\BXZt&QCe[^UVS]5k_ЋC@PS@tVjSnvSGVSMme[^ÉUVS]5k_ЋC@PS@u)S VhSe u VSle[^ÐUMAHtIyLuCy@u=QXtA\B\A\0VЋQ\AXAX/VЉA\/VЉAX/VALÉU WVSu}1Vڅt9rTuZ`WRU ҃te[^_ÐUS]U k_;tuBtC<uht {Dt^{8uX{@uQS8Ft=C8vQS)t&QjS`0VЉC4jSIB1]ÐUME UEEUEPh8<Q}u1ÐU WVS]{@tGC@C<th0BCDà SVzt&SC0 C0C0} }C0 C0S豪][E uuth0萛t&VCz1e[^_ÐU WVS}j@ zƋ_ltpSC0u`C0| h708S#C0 C0Vy 9{\t} uS菩떍S낉Ӆu} u VyBjhL0jWlt!VtyWhV0 2VSye[^_ÍvUVS]u ~\t hg0gS~^\C8w C|@ FDFDChFt ChVP shh^ e[^ÍvUS]K\u hx0S!CettC B S CC!CeAHt ylu$AHQttAxBxQxAtC\ALPQLAHtMuHy@uBQXt A\B\ vA\/VЋQ\AXAX0VЉA\0VЉX 0VА]ÍvU WVS]} s\tS C0uGpVBSWqStC B S CC!Cee[^_ÐU WVS]K\S!Cett C B t&S CC!CeC0|:qhAHyl$AHQttAxBxQxAtgqlAHuXA8tt977,t&A|xt=7кVUUU)7ЃRQCtSP s e[^_ÐUVSu7Ћ7Ѕt0FPCP舮u 8S$[$u֋F;7~7F$2x(t V@(1e[^ÍvU WVS}7Ћ7 &s$[$tGPCPu ?{t ,vC$1ҋ7ЅtC9~‹[$u71e[^_ÍvUE@8w t&1ÐUhCTjj57fCTСCT@7UVSuE 7Ѓ9~Ћ7#CTЃj@tFHtVtt FxBx&VxFtNHCTЋFtt VtPxCTЉ4FxQte[^ÐU WVSk_У0VСUЉEj@[tơ7ЋCTЍ<@7Ѓ;77vURjSYLt jVtEPj‹B0SPEPjSSj@sƃ 9uY{luA{8t;Sh0HCTtPh0h0ה57SX?Vrs7Ѓ~ H7U;Ejjh0j(hHV< UShsÃ0VЅtxlHVu PUSr7779|1B77и]ÐUS]EP50VSjxt CE@DE@8 CTЉCTУCTt;7~MCTCTCTЉCTЅu7ЉCTЉCTСCTУCTЃ5CTuEC1]ÐU WVS}GpT u[57Pwh/VjV1 u5F@Ã@$F@FwwjV@ЃtN@@wVA1e[^_ÍvUSEX{@upjS7QNCT@j@qStt CxBxvSxCtcHQqCDS1]USEXh£0.t P(hϣ01]ÐU<WVSE Dž=D7ujURÃmjjZuVqÃJDž DžDDžERhÃAG<uWwTV@t % F@MA@9Fpt"jQÃtW!jUBxt6AJt AEPjjVÃuURjWNMQA00PWcIÃ`UB@9t&jjhoƃhVjjhѣ0jFP EPjjVÃ*FV B% F@jQP ~UB@FpAt N@vF@t F@V@V@A%~ ‰V@FURQr rVЉÃ uUЉF|FBtyW\F@t$F@f@t N@F@u~u*V]ÃFt PVFEPVw|W蘫B/VС/VЉF=/V/Vu5/V/VЉ05/VЃWMQjWeK F@u VEPVVMQFHPVBЃFURjV@ЉÃt6W++F@|MQVjVGW؍[^_ÐU WVS}@W|JEPRA Ѓth٣0&5UЅtJ^9{uWE@@EC9{ uWnE@@EC vuT-V9uPFE@@ET-VЃue[^_ÉU\WVSE EEEDE‹EEEEPGÃuȋ~TUB@9Gpt$jRÃtVWYvGA@uF<uV;:t&V'EPjjW uVUREpWe[^_ÉU WVS]}Ec@SACtEPKCC@u$CWW2jS@Љƃt E tCWU RS@ЉƃtEC@u}t SWh/VhCP/V0&/Vu C/VCBS/VtˋCt@|P,C H{th0@t&Wh/VhCPjS-1e[^_ÍvU WVS}5/VЁ/VtjWh/VjV(t^FF@u/Ã@$F@VZVWG0jVBЃ tN@@^WV%ށ/Vu1e[^_ÉU\WVS}u EE@EE}EP|u%EȋXTPCWv vvS@Ѝe[^_UWVS}E EE@E‹E}EPEȋXTsHPCWVS@Ѓ ubC@%CHjWyt.hSV葢Dž4Dž0ރh rV轢[^_ÉUWVSE PTPP2EpZ3ÃTB$pTu%J,T@(t ,P~2~HFURWV@ЉÃTH,T@(t,P:2vteF@%FHjURKt.hXSWcDž|Džx߃hPpW菡8[^_UWVS] CHK9&LTDžP5/VЁ/Vt&EPh/VjVtTL9P~HHwFURWV@ЉÃu|V@jEPt.hXSW6Dž|Džx߃hTRWdÃuOTPEPVHށ/VTt'L9PvURV PE1([^_ÍvUWVSU E@EEP2UR0ÃEx$G@EH,E@(t,P/EPhW:8tt&URB0j@W< WB}umw|t;EPjjVuFURV@ ЉÃURV tu'EPjWBUr!Ex1 W؍e[^_UTSUE ZEEDEEUREPusEȉC1]ÍvU\WVS]} sjSu`EEDEE]SEP>u/F t PCv8E@@EȉFEȉF 1e[^_U WVSu} VhÃu@v~8tWG0j@V;Ãt V WjV@؍e[^_ÍvUWVSu E@0Dž(($Pe8P4PUROǃ yFPà Ӌ0Q$#V Dž`Džd@Dž@VEPj4,R`?ǃ0t/80QvEP4t URh,Q\64H @(jUB0R,Q94@u ,BT@@t st&,y8u\,P0ǃuD}`.VEEEP4pEP,R68ǃtAMQj,P8=80RuMQ4ESvEPj,R<8M4`(4H,4@(t,P)$P"[^_ÐU|WVS]E EjSƃEEDEUE]ȃEPʹƃuc]j}W耱CTPl@hEUCTPEPSB$ЉƃSujEpW跘 &x[^_ÍvUWVS} E@XDž\UBTjRÃVWB ‰Pt Pt(&X(LP@dP`PUR*zà tDž`}jhV7uÃWV/uF;t&Q\PpPQB ЉÃtDž\\x8u -Pt#URTQhP4ÃPtT\x8u P/-ÃEPTRh\S4ÃaPEPj\9jTRMQ\K5EPh\1}`.VEEEPTREP\<4à MQTPPR\3ÃPt \@D`PfP`f@ `@L7Ћ`\B$P0fEEEEEP t fE t&fE Pu0URj\^8SEPj`\39Ã0t.dXQpEP`G|URh\10`H @MQj\7dE``(`H,`@(t,P$LP1Z`t@dXRoMQ`{ \t PLP؍8[^_UWVS} jEPCÃjtV7oÃ~V)uFeQpP|PQB ЉÃuAEPuVp,ÃpG ujpwV.؍X[^_ÐUWVSu} jVojvC@<t1v]ÉUEpt hE0>ÐUS]sstC7Ћ@4S ]ÉUÉUVS]C@\tPu3SB0B0j@!ƃsVV# sUe[^ÉUVS]sCt%CCuVu17ЋF4SЍe[^ÍvUS]sctsss ss]ÐUhV0@1ÐU ÉUhn0yEPVRHU܋UR"Ãu= h 0.Rz=؍e[^_UEpjp1ÍvUu4Ft-$@ ;XuSzF$@ @S~C=tzE%PSк vhSjjvv jSWǃ,vjSotUS~ C=u1:U҉)ЋhSк`hk0n(vRvURЍe[^_ÍvUEHA|P % RA|@ Ph05,1ÐUEPJwM$0Ѝ@ 18v@ 1(v@ 1v@ 1vÐUEPppp pjjB|PYÍvU ÉUh0e'UWVS u7+ u7U2)ƃ952V52VЉ=0Љ))Ӊ))ى%0Љv) f 2VЉ;2V~2Vо)Fntm9s0Ѕt019rK)A wK9s!f2VЁvD f2VЃ}t  2VЋUf}t7Eȍ4UZk_k)ىȋU 2VЋE f[^_ÍvUWVSu] uE@Jكځ) Hځ )QE< 2V9f52V1ۉ% 19st mnB9rE0ШtE0Љ%ujh 0 )1ҍH9sEPB9r\)2V=2VС u7+ u7ЍUQEM))ʉ)ЍUBe[^_ÉUWVSUM :uE0 `0ЉA}t `0ЈB: t1&`0BA}t `0ЈGC: uփ)ڀ: t6.AG1ۀ: t*`0BA}t `0ЈGC: u[^_UWVS}E E HKyE @ <.u:}uU ..u&}u M .A.} &]K AK< t<.t11O]x(&A t.uu t1Ky߅tpt) v)U)‰U1ۺ;]}J3`0ЋM  83t }tEE <u E JCB;]} ~ENqAvN< t<.tF19sG`0ЋM  8t }tEE <u E JBG9s ~EuU _M 9u}t}wOEuM9v5}t<`0ЍIE)EE0U9vu݃}t1VvU z u KE < tA)ƍV)9~)U ~ vU AC9r[^_UWVSuM }T1vIJ< t<.tEH@)щBKyEG G EG fGW&IxMFBBKyWIx5FBBKyWIxFBBKyu@t&B@1[^_ÍvUWVS}u E@t P UUB 9EtE}ȃ?H@)ޅ~ @t ~ MANyAu9`0GA8`0uŠAuKyˋMNyAu9tx`0GA8`0uA{KyˋMNyA_9t4U&`0GA8`04A)KyE[^_U WVS}uE Eʀ?B<@tw @E P G 9t$?H@TM эWBAuU B(؈B/tvBusKyԍWt&BAuU B(؈B`/t;;Mw6Bu3Ky̍Wt&BAt/tCU (BvAt&BuKyƉ[^_ÍvUU BIyÉUE UvH~ J t.t=H ON)‰1ÐUh2Vjj;u7u7P;2V1ÉU WVS} 5k_ЋEU#2VЋ2VЋt:;{uE;C uE;Cu{,t߃Vhskuv1e[^_ÉUWVSMAEy}q #2VЋ2VЍЅt6};xu!;p u};xux,t&uхtJY 1[^_ÐUEHttJ@ÍvUWVS} k_ЉEUztuuzURMQEPURSMQEPURMQEPWURWe[^_ÍvUWVS} EEU؉1ÃEPEPEPSQ E;EtVEtURPMQnEPjuuEpà tumUUMAP!UBt=tnw =t=uFH]D t  vρFH EPHELEpHU2D2<2EPHEDaEXHuDDD<EPHEDEPHEDEXHU$DMQt!׉ v ׃v E;xL!EtuPUR1e[^_ÐUWVS}EEGL 9Es!UBUGL 9rGPEE11whօt}uYEt PjEPEPSWEPjuuw à tuGtE=u(EXHDDDE@HDЁ}u UtEuGPEM!EE;GLu+1e[^_ÐUWVS}w0tu#Ghth0$,2VЃt 2VЃjEPjhW/à t&juVvtu E @EEPEPjU RuVdà uM)M }tEUEtuEGtE-ujVjeà \AMUMD EHEMGht0jjv`EV\NT)FDPEvà jjjv`F\NT)EPEwÃjjCTPF\NT)CPPW tCT{TuhЬ01t&sf}}7EPhURfÃtEpGfߋE@M؉}E9xtu}tUB@M؉bEPEPuURÃt\u뜍v}tf}|MQjEP荵N E@U؉F@tVM1EP1x[^_ÉUu;1R.e[^_ÐUWVSU EEUBh}E@httBtM;AtuE2E%t&r0~t;F<EXH C tj h 0S t ESC<NtuSC ׋E;xtau;~ÃutUB@t-u^}{ttUBxt_wRhV胢EP‹B0hV葤à tEPjVURjV}u!EPPEPHt&UB$B(@BEEB,R$'ÃoUr~8tV;PF|@ ;S|V|;.UBxtdE@@u뀃URhVWEP‹B0SVià tV:EPjVݨUBBuxPUREPV;wtV:tV:uUEG EGEGE t t tu tt&EPEP ÃtURhEPEڃtڃu9|VjYEPu |Z)PER VjYEPuE|)SUPj|EPPEP1X[^_ÐU~U;\Ut EPhURݞjjEP‹B0jEP\JÃ,URjEPpDU B@EURj}tPEPà E1UBxtZEPjjuVhhdURݡà TFH EPU@(E= t vEEPjhjURà UB0 B0EXHs jj;h*ǃhWE VUfS fFf_fVfFfWFGfVfFfW fVfF fW"V F ‰W4fV fF fO(fVfFfW*F G$ E@xu(fh}^fSf?If"uFVFFF‰W,VFFF‰W0FVЉG,G"G0GfȺ1A9G0f uf"4VF uxGtLJLJVFFF‰W4~}VFƒ UBxtu }]CW;UBG0E؅Й}U؋E;EfGW0G,G,GfGG"fG"G4G4و]__8tuAV!F"F#F$‰W<GG4É_DV%F&‰Wx,OO4ىO<W _T1É_@ىODGDO0)]1ƉwHNOLGG4GpE@xt"wJ} t"}u>G*fHfv0tuEw"GtLJLJ t&GtLJLJtu G@GhGhOWh1OlGuW\WӉW`BGXuOT9tOt&umExURjhwxEPà ZEXHjh`0S0jhe0ЍPuljhj0ЍPuOjhj0ЍPu2‰W| GxuvEjjUBE.E@EUBEE@E wv jj`C+USvjSbaCu7js EWVsU7ǃuLVVsu9rE9C s)}tUREPsE)C C1 SOe[^_ÐUME APHPÐUVSu^~8t/F8js6ttt h0)S9stt&u h09u{u F@Fe[^ÐU2VÐUU% RO…u ';u7ЉBBHBX1 ÐUVSU% RÃhƃ {t SSnSVВ1e[^ÍvU WVSU% R`Ã{u CU 9Bt hQCX{ tO{$uIUЉC$SW61:vScWt&C$&{:t SC u C$;Usjs h0hS$[ƃ #tuS#u{uES>{u2{xS=CCSC CCC WCE Pss3ƃh NjCC CCSC We[^_ÐUWVSU] % RƃFu xGDu 2{u1v,PPFp Sà u_GL9BvRK(Av~@tƅj0 jPWЉÃV؍[^_ÍvUEPt P @@@@0@4ÍvU WVSU] }E% RGƃ~;jWtB@w6sB@s|fB@ttwhB tjvB tbVjB@tXqB@tPDoB@w nB@s>f@t6wt@t."pBtw kB @tmBt UoB@`qB@nwJvB whB iB fB@tjB@IxB@Tw"sB@tB@t&wt@wf@nB@un~fwbrBJw#kB @pB5yBwuB}fmBw!vtgBt&lB jwwBfBtHvhNj^~t^WEFz&~UU79v ЋUw U F;vjEPt&jURV%EhpǃV @~hIǃ~8ujFp/EuF8W/F@ ~pEPFporURVE]t&Eu7Ћx=u7ЉǍF 0Ex#F N =u7Љ1ËEV 1u7ЋEPF0UF4BUF:Eff@F@vE8ƒV@F;F<}E8F8hÃ}tE@,E@(xE 8jjSƃSVE pS ujWVntYh蚉Ã}t Ep, vEp(EPS聉 }tjEP1jVe[^_ÉU WVS}12VЅt2Ct%U R P9utC 9F vދu΅tbuWuQhÈËG9tt WVWmWS蠈1e[^_ÍvUju E PU WVSUu Au1q% RÃhǃ {u4{:t{u(1{ t{$uUЉC$C\PuWe[^_ÍvU WVS}u ҉% RsVftfu X`F87(~BZE BEB 2VЉ2VF$)Be[^ÉU WVSE2VЋ2VЅ;E9CuyE81S9}Q=Sа5tE1&,F9}4Sа5u&2Vv@lt9ujrhrhVSuӃjSn]pE@4e[^_ÉUVSu]MU} t Ett}tjCPE&jCPEP FfE܋^hrJǃU9|VE7WSE)VD~ VmS S"t~ tE8t&GF ~ t|C SUR@ЉEEF VSS1`1qFu ELSwvF u E9-Swv g_ vh(0_Lv}t EPNEe[^_ÐUVSu%VЅt#{ ts$PC Ѓ[uݍe[^ÐUjh0jjjjlh4V8 Fh3VÍvUS]t x<t@4uu jCP+]UE t uEu v1U\WVS}G3VEjP)E1ESWCЉÃtoC ui]} t[C5tUus4gt@EPjjjWj kƃ t]C8%EtE@5t?E t&C8-3VЃ} t!j@]S~}VjSEP! EP.)Ee[^_ÍvUS]t x<t@4ujCP ]ÍvU\WVSuF3VEj0(E1ESVCЉÃC ]} C5EPjjjVj 4ǃ t ]C8vv]tC5t E ]j@uVl}C EċCE̋C0EȃCC89~t3VЃ} t'~t!j@]S}uWjSEP EP'Ee[^_ÐUS]u h0HC8PS8ЅC4C t h0H 2VЅ}#Sh0L[vPW"SC@t P tJP ChPjs 2Sh4V;]ÍvUUuh0GB u j RHB ÉU\WVSu11ۃE PpEu3it&jURb‰U@uBt>B0M8u"Pr0Q^au EU9P@tM QtAEt5Pt:vP4uptht Pj@]SzEEċU UȋMM̋EEuEEPSjRǃ Etp43V)H4 3VЃU REp PAEt}t uM Pjt 3V vtj@]SzEEċU UȋMM̋EEWVSje[^_ÉUPVSj@]SyUB EċBE̋B0EȋB4EEPSj`ƃ VuSjuUB8@B8ue[^ÉUUB6tE 9B`u Rd1UEu h P@(U-ÉUVSEu ]u#1ɨtVLubS買 S/uES荸u3jStI8A4t Q F8BtI@u1"F8Bt˃s Viuىȍe[^ULWVS} uj@]SSxu}ċEEȋEẼEPSEPe[^_UVS]1{8u#CtxuP跷t@ C8{4upCtP蜶C4{4uTCuCuCtS8t RP蒸)KtSt RQ vtPPs0WC4C4t{8u@ C8 &3e[^ÉUWVSj0!EEU B@3VЉEu E//M A0tA }t&}t&} &EPU r rA ЉƃtVEPU r rAЉƃuEC5tSEPC t"hɷ0QBt&SoC\tËC8~HC8F\F`t H8F`f4V@UtztM QVjBЃ2VЃ}tE0&F8@F8Vv}tUtC4u EK@M€E P0C0M ACDA u1Q0)E x4uP!E^U R4Ujh4V'1Ãu E71jlSuM A0 C4CdqqStSh4Vf4E7S UM A t4PRq=G6t$WSEPU r MQ‹B Љƃ G8HG8t&ulMA HA C6tC`t PC\t Pyjs MSh4V2E J&ExtU RSMQ‹BЃ}tMC8C5tSEPUREe[^_ÉU WVSE 8tH @E&EU:tH p MA0t8t H @9wOvJEx jjEPÃu UZ &P?bMY 1VUMA0PEPYtURSM QXjW׃ UB\tP8~JP8MA\E@4t/jUR_MA\tALuQPt @P9vAP1e[^_U WVSMU u<ABAB9v "FAB9r9s )SRqe[^_ÉU\WVSuEEEEet~>} }uC~t=jjyEu7vt&EXvSW)߃jWMÃtEK89s@t=}t EP3}AP'j@]S!puE FE}ċEȋFẼEPSE Pǃ } u0u,]t%SjVjC8@C8S} u|]tuK8C@9t]PVh0?C@xtjSj@ЃC@P #JP s@F C' 2VhDThhDT5u7hDT7ÍvUS=7ujjji~Ãu1KjSnECCCC 2VЉCt SP2VC2VЉ؋]UUE ÍvU WVSu} StC B S Ct CB t&CF St2{tSsCЃjjjjCp j@ Sh3V;-FtHFh 0=^\Vt FB&VFe[^_UE@ÐUVSun&St C B vS CtCB SCB SSBtHBh`0<Sh3Vh,^due[^ÍvU WVSu}UЉE^dU 9SukStC B S Ct CBt&SCB SSBtHBh0G<Sh3V+[ujh3V (Ãu7\&j SksECU S{FdCt FdSP ^dds G CG _ C@1e[^_ÍvUWVSEE=UЃj0E52VЃStC B S Ct CB t&CF S{tSsCЃjjjjCp j Sh3V*Ft HFvh0:^t C9TvuEPU5u7ЋEPOe[^_ÍvU WVS17Ѕt#CPEP(Muߡ7ЅtF(fux6t F(f9tfPwjjj0yÃu 1jj0Sij EPCPWf{(C,tFC3F^&C,7ЉC7Љ7C(e[^_UU7Ѕtt&f9P(u  t&u1ÉUSEftY 7ЅtOf;Y(uAA,XY,u9tAB&A7ЋQjQ{ t&хu]ÐU WVSu}^} u!jjjxÉ^jSh } uBt>Cu l5V'u p5Vu t5V u x5V |5VЃj0E} u!=k_u *WVǃuWuE PVǃ ^} untjCt jSyUul5V+u p5Vvu t5Vvux5VC 7|5VЃVN@EPHe[^_ÉUWVS}1EEEEEEE Et w%jWbǃu7&Gu h02_Kv G9tEEjjSvƃuEE7VVSjW~tEE+0k_Ћ@4Fj@U|RjfF E|P3PFLPiFE EąUxKEȅt x:EЅtRjjPnÃBMЋS 82PЃPAPKC EЀ~t#j5k_蛐t E CFH.$0Ѝ&}EP|RFPEELPF$Pv EH8UEЉBDEP|PFPEUUB8&UB3VЅuE/iPuR@ ЉÃt)C u#]C8~t(Ex}1ШtEt&Ft'o&UB EċB0EȋBE̋BDEfzht>j"]SdE"UBhPx tj PEPQ]EEF 0tFE@uG4#Fu1j@]SYG EċG0EȋGE̋GDEЃWuF<@HGF<@@fGTjjj`cÉ^Hu$h0j! &PW5V5VЃjSISsN55VЉt5VЉX5VC5VЋ4:VЅN< [<9K uV CH9BuFTGjGDPF<P9=\7t2VЉFƃt ^tu h0jGUR菶S0KTt U9v-zu'zt!BPWBDPt7ExDF t P-UV STtbc4~t U9tOUЉCTX7ЋFF9}$EPEPC@PEPK4<7CTF1e[^_ÐUVS=@7h2‹@7Ѓt#C@7Ѕu D7C H7ЃRtCu hù05{ wjS`ÃssffuQFVЍE9C sPS#Ã6Ff=t=u S S豴e[^ÉULWVSE@EEURUBfEHojMMQURn5jEP]]SV5 4:VЉ˃ t"U I9u2G5VЋGtGG x5VЋE@DMQ%=uE;Pt5VЃURt&My u34:VЅt*U9P t@G xu jj jjWG&5Vt؋xtX#FV CtC>#FV SP C>#FV C>#FF C S(ffCf #FVt #NFXS(ffCf#VFS(ffCf#VVSEP&_ǃG @8uChǃ1e[^_ÍvU,WVSu E@@EURUU k_ЉMfEEHρP B8uVEPf=4:Vt~Efx>u1x8u+uB tuE ^~ t 9SfUS%=t(t.fCjs)u1tf}Ef=jMQNEt9jEPCPjh6VЋUR t@@M9u2EPEPCPjh6VЋUR t@@@u 05CMA8f} fEEUBht7=7av tLjMQNt X/}E!v]Ev7=7f9}uf]b)1))ƋUfN }tQMf f9wf9sEfUffUMA @PUPuMQEPE8Pjh6VЋEP[ x}uf]$b)1)ƋUfN}MBff@f9rf9vMfEffEUB @PMPuEPEPE8Pjh6VЋUR oEMfA>Q71e[^_ÐU WVSuU 1ZF@@ @8uRV8&Fit h0z t {t /f{4:VЅt CuBHuB @DtBXC~8uAEPF@@PFHPS:ǃ u}uE1E~&F>PF8uGPCPsvY t0F~8u'f~>ujV1u1GF8CF(CfFfCF8Ce[^ÐUVSuU F@@ @8u RV*B ZjSCFf1ECiP{,u{0u {4u{8t5?uu u t5jWC,P?uu u t{u{ u {$u{(tLU :uzuzu z jE PCPUf9S<kE 8uaxu[xuUx tPMt&Ciu]C(t}t;EuKUf9S#FV CtC>#FV SP C>#FV C>#FF C tCBSCiK3K(ffCf#VFt ffU #FVXS3S(ffCf#VFS3S(ffCfK(ffCf#VFt$ffU #FVXt&S(ffCf#VFS(ffCf#VVSEPe[^_ÍvUWVSM}uU fff‰f#QA ȅtVAiuJU 9Q(uBf9yu6U9Q8u.9t0tABAtH Y v u[^_ÍvU WVSM} EfEEfE3W ffEf‹Ef#QA4&CitqjWCPu[Ef9CuHjEPC,Pu/;t1tCBCt Xt&su؍e[^_ÐUWVSM}}tE6VЍE Et&U UE6VЋ56VЉfff‹AE!‹IM t-Aiuf9y>ufy<uU9A8uy(t uׅuYEE9tIfff#EM tUAiuf9y>ufy<u 9Q8uy(t u܅t-; t)tABAt Ht& Y[^_UWVSE }}tEWЉE vEEWСW3WfffЋU#BR4tUvCit>f9{>u8f{<u1jMQC,Pu{u{ u {$u{(tujEPURh}W3WfffЋM#AQ4twCit>f9{>u8f{<u1jEPC,Pu{u{ u {$u{(tut);t%tCBCtXs؍e[^_ÐU7ЅtP̣7ÐU WVS}GEŠ$} t7VЋMAdy uD} t>C9G r6 t/<t+< t'< t#< t<t<t<t<t<t 7VGEPU RE P MAfv41҉t9s&S t9r9vЉƍF=vjjFvÃF=v"jS蔈CuS:w1ۃMVS Cu )$CS} (v h 0E 7VЈ} u EBFt&B} uMJE%t&} u}u}tMALffBEBBPVjWzCuSC$9s h+0eSJKC C CGCB$ BBC ffBfBBMA BABjj W֌ƃtVW/VS Wu Wu1e[^_ÐUuuuu u/ t PCÐUWVS}GE] @f)؉ET8V&$;EvE9G sPWz|ǃHWU)_ މwuMQWtX8Vv_ )_>(vh8V^(\$40Ѓ=$ؽ0ЃHAt&6 /  GtjW}#v@NB9E|,v'F%=~)u\}CvB09E} \8VM$D0PW.{ǃu T8V{GEŠ$EMA7A 9VЍ@7Ѕ%ȃPh7S P8V=7uGu$=7=7uGt d8V} F Fv=7} UBtuMA 7ЋGiPh7MƒNBhFEx u$B @Dt BXUB t BXMA GtjW `8V7VЃW GtjW׈=7}#vV9E|w \8VUB 7ЋF7ЋF7EEPh7jjh7h7 Et3=7t57hhPEt P踎h7jnW9 Wgqe[^_ÍvU,WVSExE$Ew ru tURqwG G4:V[1EET.D.ظ 6VЃEf<učuf}t71ۍ&;;ʺ @6VЃf<u҃jh0h:Vjh0h:Vjhɾ0h :Ve[^_ÉUSt&hG‹:VЃt#C:VЅu :VC :VЃR$tS룍v]ÍvUWVS]=4:V@:VЃ{ wjSPlÃ={$<@t:VCvЃEwP:V%t&U;S v!RSkÃu P:V{GfftG ffuC@Du:V&C u9t:VD:Vt&EPSvtD:Vq$C :VGf;E} T:VJS9} H:V89~#9S uC C&)PSHj\7}vSX Swt @ @DO%=u=4:VЅtS9P t @v ]t FBVVh ;V 7ЃK}u&U B MtB HUE P BMUtPEMHEEU r t2t&VBf;ErBfEu6uҋExN΋VU$M=~:VЃE P+V USRxb>Vh ;V 7Љ t/_ ?Vh ;Vҵ 7ЃSMQ3b uыEfUfBM AB ABtABE PjU RM$UB $)BBt1]t C uMAE0t&\:VЃEP~[URh ;V 71e[^_ÐU WVSu^ t@;s <[tCBSSh ;V贴 7ЃutFBVjVe[^_ÍvUVSj0rƃhc=:Vu :VP\;VЅt+vBɈJ<u`:VЃRڅu؃h:VPVe[^Uhɞ=:Vt P̞1:VP赞tM=;Vt$t&\:VЃ5;Vp=;VuhW:VP\ÉUS2\:VЃR#;VЅt7Ѝ@}97~KuNj]ULWVSE@EE EPUĉǃ$EЅq~u E%}GEԃU9D't =7?_M؋Ad7Ѓh`7*1ƒuXKC;EvEp Wvjhd7S>u%h`7N1ƒu*h`715d7@ƒd7ЋM؉AjSBHPGU؋B%=Et&}_KC;Ejhd7ЋE؃Pvh`7 0ƒ u5d7ƒEj;PBHP3Gn+]؃j uVW}!}EU9v%MˆMjMMQED8PE$t!taEU9Eģd7ЃUrh`71ƒjMQBHP3EKEU9/jhd7ЋEPh`7. t7E +u؍^NE܃jED8PEPEU)U׃}~ 7}t=7tjMQs1&jEpP]S@SUr Ph0j轻E 8E؃,E"E؃E EH)ÃjjSMQEP:Vиe[^_UVSu;VС;VЅt!;st3P8~:JP8;VCsh;Vo;VЅt@@P_q‰1e[^ÍvUSEX+w"ShDTP"C\7ЋE DTЋ]ÉUWVSEEEEfEjEPoÃC4%=C0xtSp=2VЅttw t`S0R8PuLjS0BDPBDP7u$C8~ HC83S?p퐍t&vuuC8gHC81e[^_ÉUVS=\7tjjQƃu1m\7BF NDTЉDTDTDTjFPhDTVDTrDTsDTЉe[^ÉU WVSu~$WF )؃PRR/)^ Ft)^$ e[^_ÍvUWVSExEEE@uwuh:VЃURQG<w'jjjj EPSn/ȈG;VЋ;VЅt%F9GtetC8~HC8v;VFGFh;Vl;VЅu jjjjUR0n&jGfD9~RjEPFRƃt$PVWƃUB9Ct&jh :VQSVWAE%~-QSVWE PEPh7Ce[^_ÐULWVS}EEEU EE؋MMԋEEЅtEPRRm NjMMwEԨu5$ @ff@ffFE€$Јx:V $E~ Ut Et&ROjRE}uMM؃jQE؃E܋M؋t1B4t FM9AtB8~HB8vEU؃:uMAFAEԨt@UR%ƒuMQ?&ƒZ CLEFV%=tu4}t.UЋt%ËKLMȋ4:VЅtb9Z t]R9ut6}t EЀxt'G tWg URWSZ~tCDt{WDu`SEp?tJCDuE1 U u E Ff;CLv E(OfgMt}tU؋t @LuN@G tt{8t2Wg tt{8tWg Ff;Ewst{8u O :VfF MQWZfF G tV&t WЋE0URWSЉEF@t2E(M؋B4tBLu CL9BPvBP:Vt&EPSWEtWEP;dsWUG}uM1EPWSЉEt&WF}u}u:VЍE9EuUuEt P8~JP8EMQFǍe[^_UJvEH3$0Ѓjj@>NjE8t @ G PwpqG jj=NjM9G E$p0smzsttt&shsh t&shUt&EPMQ2Elt&jjt=NjE8G ChtG00G G&E-&E*Ee[^_ÉU WVSUt P]=E} U J uR4=vE XT9΍FU B {VWSjU r C<u EvWUv{9w=t=u?}v`E @ EUWjp_S[FPSGPI +u}~ sE x ,w U1E P <e[^_ÍvU,WVS]EE 8u,jj5jXNjU :GGfGE$0Ѝ{ Cu 4:VRjPGPtPhd W@3jj]S(>PGPEphd WE}u VXUrDJf~dMllu_L㉝| G|UR@UBjMԉhQj]S ptpt4`EEUB EfEEEBET&EEtAE܋A EAEAEfEEEAEAEċA EȋA$EGfEE@thVdfUpt1puNj(h`VЋtQjhV#jh VЋEPͦjh4VW车 UBEMtWShS%*EEURMQuxPWShR,$E MIMqD]sPVHtt8= Su/tPEptt1f9GuZpt;puHjtPtP`u#VUB 9Bu VMA4f9A2EPEPURMQEPxRWShQM+0E~TVЉ0f~d~'u7u7` WPF4PrA}t,EPxSEPWURMQV|  f~dE7MtP])É؅cW;T|G|;5 9#t+XTVЉTEPMW++ 9$f~jVЃ}tETV)‰@*t&4t%8O)ȅ~TV)PV(_)É]VЉ؉ VVЅt(Fxt!@itxHtjjFxpHYUR]|SdGMQ!  9uFP@2&F0u(Fhu7u7PFP=?Et SP]Uz|<f&9GU>L]CLSP)‰dCTSX)‰;d~d9VVЉș V$VЅt(Fxt!@itxHtjjFxpHMA t]S ,xEPEP&URELP^ ELPMQ\]tjSЃFpu= 7tUt v Fpu Fp5P WЍF|P=FpxMM]CLSP)‹CTKX)9~Љ…}1ҋ)É9}ЉFdftOf}Erlt VW++ 8]t!W+l+ ^Utj=V@ lztW)yFP=GEPV~ f~f~ Fl$@Np)ȅVЃ]SUfFdu7u7` WPF4P;Fp` `uOLNMhbVpu VpPbEPjjVhNbfrPYb 4tTV)‰PV`Fl$fFdGU9v:)ÃPMQ#Ee`VЉؙdVhVЃ_KG+t&}tdEu]PtSU)‰Ѕ}HT TV)=H?'Fl$Vu&9|fFj Fj;7|(9$v$fFjW+ ~ xV+UVЉщ VVЃ}tE TV)@*t&4t%8_)É؅~TV)PV  9GuFPr5E,F0u(Fhu7u7PFP4$Fl;(v1Lȉ9v‰$t(Fxt!@itxHtjjFxpH]C|9Ev$)s|؃|PYY$EPE|P9YU)1ۃMtȃ|PQhRW)yFdft~ ft&ff &]C t0SNu7u7X WPFLPJ3 fFd t&fFd VAu7u7)RFLP2EPMGtBV77ƃu7u7)RFLP2UW)x.9uG)ȅ|G9uf|;vX}uG9u|;vVЋ|GG;DvDEM ff~d WЋ]CL; 7vfG߉MW+~9+EPLBUBHuJ@MQRHHEf9Gw9]Cu0EPURGPS+~}u Mf~d hWVpu VpPW9GJ>Af~d6hWfrPW Fpu= 7t]t Fpu Fp5P WЍF|Pf0EG $EVЋE V$VЅt-Fxt&@it xHtjjFxpH谥t&E@ tUR+)MQ]SSELP4P ELPEP>NUtpjRWt&MQ]S4EPSWVEh8VfrPCV NpEPreUFdff MQLNpFdft( ftf tf t_fFd|fFdrfFd VE=u7u7)RFLP.]S"I+t&u7u7)RFLPQ.E@tf)f>f#fǃ>f<f>ǃ4fCf@ƃN9~@<f>fChf9}fKh f=~fChfǃJ[^ÍvUWVSExx7ЉUӃW pu+U PRClP#uEPEuURE1e[^_UWVSu j0EÃEPVEPE uStE1iU@M9Au Q})ȅ~ G@@)…~E PUR S!EMtAB}GD@WVЋEPUǂMt }GD@f VЃP7 $VЃSDEEjR8E MYChڋ}_% ChChtBsCsUBfC>MAt!uJFC,F C0FC4FC80FC8au}LJSExu{Hu {Hu }G jjƃUF PvRMAtt;&CiuVS@w VS蘋tV|V[D}G@DHpKpE$<t?O}NLM`KpMtKpSCtu%j7SvE} WUM BfCdTVЉ0u7u77PC4PVЃ}PS ft SEft Cl$UA@ Shu7u7RCPG}G@~‰+~XVVUtPTt&MA tP8P-JP8}Wh@VUEvjEpjU Rrj }tMQ}tPt&UB tP8PJP8MQh@VTV Ve[^_U WVSu] j0?ǃEPSVà tEH)x A)Ѕ~W?t&t CBCD@SVЋSǃt CD@f VЃCP $VЃW?VVt PjC tP8PKJP8Sh@VSe[^_U WVSu] j0>ǃEPSVà t7E@ff;ut fw fWN>tCBCD@SVЋSǃt CD@f VЃCPx $VЃW= VVt PC tP8PJP8Sh@VWRe[^_ÍvU|WVSM UB@DBLӋSP)‹CTsX)Ɖ9~Љǁ~tUdE1=7t](SuuVEPu$QP t1DžUzu t&1P] SEPÃt^$V(Vtt PECLURS VVt&jh@VeMÃu9Vs+hS2jCP$UPCPPR0xU PClPRxfǃuF "U(B fCQP1uFtFP5f{@ECL%=u``uQEU;rPs?$$ˆ$< wȉU;BPrƃEPS~uVSUctPC tP8PvJP8Sh@V:O,V0Vx[^_U,WVS}u EEGQt t#vEG E(E(W Ut V#/t$<tUtE EEfEt Vjjvƃt.f}v"jVFuV1u 7(VFEEFF FPjvlGQt t2VUGTBGpB B ӃGRfCGnfB^FEGXUBG\BG`B GdB$GtBGxB G|BBBӃ(GRfCGnfB(t&1ۋffC@ffCEC $ЈC C G@ffCCCfCCS$<t ffCSt* TVffBGLffBGQt t/_E+EfUfBfCEPV+E+EfUfBfCE)EURPjVNfCGQtt)H&EfUfB7ЈB(&U$ `Ef)EUfEfP1҅tPxGQtt2fRj=7 PURVB&U1҅tPCt h_0L@9}Cf@7Ѓ  x~xu7u7RCPCff @fCf]ÐUjhp0jjjhhhV7jhx0jjjjhW7 jj5<7hWA5,7hd W5W QTVЃ=%V;w %V<(VЃ<=vh0K&hЭyÍvU WVSExxptjj~ƃu1Udtt tF &F (F F (VЃ(=v$jVFuVm1Udt th^j S~C fC W8S O(K^ʉvfSc^G,CG0C G4CG8CGCG CG$C G(C$Gl% `CfCjWC^(fCG>fGfC UBffBjjjEP}tUBx &1PEP;j UR!zEfUfB fCEPURfCEfUfB7ЈB1}tUBxPj=7 PEPjUR趑e[^_ÉU WVSjhV5Ãu 1't&hhSby7fClfǃ,ShxЍC|P1sS40VG~1=7tCpECxfǃ<7f>fǃ@fChffCh f=~fChǃ$?ǃ(?E@iuǃdt&ǃdUBit SЈBsv7ЋUBtEXD؍e[^_ÐU WVS]u Cxx@f{d~fCdSVЃVЃ&}t}u1'USAtFN MVU 11E 0ЅE9Cj}W tWjMQSXEPEPEPE Phd W]à }uPVJt&tLMff{@SDt~+xt+ ylUSPSMVt&=$VtHUS@9sFf @7fNh@9} @fFh f~fFhFhu7u7PFPN=7~xf~df~fG@x|t}WOQÃt C4tCLu_1ۃdu*j]SlEEG(ESdà t&CLu CLjWNSf~f~)vxEN<ff>fdž<dž4$9vNl1Ãw$Fl؉(fFjVЃVEPe[^_ÍvUVS]j0V<f>@9sf{f u90 TV);\ Ws t79rVЃjCnSCn V1e[^ÉUVS]j0VSdfCx@@@trflX WЅ~0 TV)` W9sxVЃjHPjCtpSu7u7T Wt&u7u7` WPC4PdVOVЃju)CitjSUjSAǃ(fFdMQB<Bzuxuxu x 88uBxuujSTǃ~EPSeYc<udB$%=jr;f{>ujS@ǃURSDǃVFtuSE'MIqPV]SVfFdu7u77PF4P' &-VVCit EPUR MAQFV-ƃ V+ǃ]CV EPE|PVǃ j5Vƃt&UMAH]S1ExHu@@tUBu Ht 2u #"MA QI]HvUB|ы)‹)É9~=}EP7URE|PMA|FnVFn mCitEPSZUt&URSD>CitMQSZ&EPSDh0.t$UBtjM QjVEPj˗ ]SX e[^_ÉU WVS}1j0 EU Bu8EP }uUt Pm6Z&XD}thU B @t'uBEPWURE PUR4 &EPWURE PUR_ƃ /EP}|}U tt"Jt=y v7A8tKp7cp/ty vA~Cl9fSl*t\QjNjjEA tt A[pvQCl t&*UR e[^_ÐU WVS}tPu5757Wluqhd WW[9u\wVu%GÃ$fGV@f _7&f@dFit ǀd ǀd1e[^_UVS]Cxp@f{d S'O~}f~ujS3vVFLPSÃt S ؍e[^ÍvUS]Cdw/$0fCdSÃt&fCdfCdtCf{d~jBPPhd WHt&jGPwhd WdGƃt#F@@tEF@EvEEQ/E hURPCÍ[^_ÐU WVS}u]M} t EB$0Ѝ&jSVW螷j@h6VQSVWMjQSVWt&jQSVWy<7ЉEEPQSVW̶ uZE;<7tjjPhWu}t:{,u{0u {4u{8t5jEPC,P<bC8t M;AM}t:{u{ u {$u{(tEjEPCPd<C(tM;A Uf9C<}jhʚ;jMQ蘽ƃE}tCh? tVEPEPS~URV^uVEP}LW. u'V趻Et P裻 W5WMQEtjP‹ЃEK@MfAt[ W$}E}tCh? tEPUREPSMQEP~uUREP]LSK NSMQESjPt&}t*MAPEPPEPh W3>#UBPMqPq h Wj=à  WЃ}t7jjEPPUBPEPh W?4jjMQPUBPMqh Wr>Ãux WЋE@t W#&}tMUfJjjjEP}uUEfPjjjjMQCE}tCh? tEPUREPS}t$Ch7ttjjEPEMQEPhuUREPC@LP5 tux~trwm7ЍBvLtLtUtD$ЍPq BPqh W7 t$x@tSPbWSVh Wj01e[^_U,WVS}GEEEU UMMEEE=v (2}teURhUMI8MEx(t 8j0jEURMQs,à t-EPZUz(u 9GttA98ufFAffCE<u>EPjjV脫C CPjjVr Cf%fCffCJ<tVUoEPjjV+EffEC )fCEEPEPjh-EC-uuu t-%u$,u/0u&4u8u WЃV-NQЀf=t fufA QЀf=t fufAFttB9v8u=F$V)‰ tF)'w&F)'v F؃F (jj(Vxƃu WЋE7FtF(^$ `FffC7ЈCjj$PCPwjjPCPwE <uEPjj)VWCC<tVUjEPjj(V&EffEC)EEPEPji+Eff #vVwE Wи/~ WЋU2 u/Gf8uFF WЃ W u/Gf8uFF WЃ W1e[^_ÍvU} t .t&E8t*h8uuuu˘ÐU\WVS]E E4 WЃ=8uC u , WCu9ss W/}WjEPS虧U$<u ut0 WЃSN9s sVS9Ãu 0 W+jEPUBBuPh 0ȵCPh0誵t UB0VEPWÃjjv,+Lv,LDE }u)EPEDPURà E@$@(@@EUEB,R ÃhUz8t IG|@ ;S| 0UBxtQE@@u뀃URhWWgEP‹B0SWiiÃEPjWnUBBtyEP9tG|R|R 9P tWEPjYEPu}UZ)PER ~uVjYEPU R?UZ)PER VjYEPuE)SUPWEPURWBÃjlEPPEPBEPEPEHPEPBЃ } UBBtyEp9Et:U}t }tjL}uE@Ct jUR1 W3؍h[^_ÉUWVS} Ex@uwPk1&whURt1jjwwjMQz thf0ޭuEPjp0C71U΋‹B!JrME1qxq`EEE7NdPw ƃ uJ7K1vxMqH CuuV1EPe[^_ÉUMu*h0h0h0h0ʓ_ ]Ex |xQ1ɉUĉMȉ‹BR EUEUEUȋ49wGu;0w=Mq]{8u8t4EUEUȋ^K9wu;CvjjV E@E̋UMMЉMeE1ۃ}]CS ]KP tEEP#8U܋S0+u܋@9s9~ M t&eURMQ]sVMQI QRW@ЉÃ }]CS 9w u,;v$RPEP脱EUREH@1ۉM]} !E@]KP9wu;wUB02M#8#<@DIL!+E9}ƃ]SVUEBHPÃtVUEBHPx}tu`MU܍2M;A0u2=8tRPG$PuOu覟 uutOUzE̋M;AvKUBtxt fE̋M;Av'Et}tRPjtBUtaMqRUMQRWЋE̋M+A)BZ M̉J'ŰE;PvMtjjjW@ЉÉ؍e[^_UWVS}w~8uF|@t@Ct VE Ej@nE^ltC0%C0[u^lvCEC0C0| h0脏}t {P tB{ptMI &E@@t}tPU2Wn}u8-VЋGTxD C &C$D1ҋ9w uV;vNhn0VeGTxDCC$DdžNu̍E%ft}u}fEpURhW7Ãu Fx+EЉFx9FuG@M9GTPEPwTBЉÃZt6EPt,;t$M9tQsEU}MQjWtK)9)D C t&C$9r~h06;t19} |t@9||u1&h0~e[^_ÉUVSuU ]FBCB@PCPr褕F@TxD~ f CCCe[^ÉU,WVSEP U@E]CTxDUB t&]C$EGxt h0yURjURhQRW@ЉÃ ORP]SИEf@CT@PH#URUBHP]Ssux:ËjjjW@Ѕ!&9w u;v EPEPSQWBЉÃ u>t UBTxDFF$X1FE)]E;Gx}cUUf^JM:uM16t&]CTxDBB$X)MSVRRE;Gx|t&uLUBPЃPFPu+E;Esh0wt&UڋEfP'E9E} h0wEUfBf^ރURV]S躒u8ÃOuuG|tn9w ua9vY} tEPjU R5]SjW|QRWЉÃ } tEPhU R-؍e[^_ÍvUWVS} EUUtCEPEPSQVBЃ EE@XEPEPFx)ȉSQVBЃ u{~xuE&UfBtOfO}t u,UBT@@@t~xtu1 uNe[^_ÐUWVS}u GEEPEPSQWBЉÃ uWEUUBTxD~ UEBNfNUBT@@@t uJ u6ÀO؍e[^_ÐU,WVS]EEEt&jEPURjjE܋URPj SUrj#'0uY}uSf{tLvLMA@TxD~ C &C {.uuE;Pt{ .uU 9t1'vCE܃U;}\u ;uQe[^_U,WVSuU }BEB;Fu$Et&1ۃqvUBTxD~EEuf}..t xE;FtteR*UBTHEPurTAЉÃ rUz8ujjWjjjjjEPRj%Ã0^uh@0PwEt P؍e[^_ÐU1ÐU1ÐU1ÐU1ÐU1ÐU1ÐU1ÐU-ÉUÍvU1ÐU1ÐUUJEPjRAЅu UE 1ÐUUu DPRUtA0UE41v ÐU=DTuDTzM1ÐUVSMu ]QEPvQBЃt8Uft F9tRFF1e[^ÐUS]s ssC7 PP(uCt jP1]ÐU WVS]{ss Vs7 GPk(uWCtjPˇHWHt6`@861e[^_ÐUUBtB u B tI1ÐUSE@x@EP\CuKC Ct ECtECHSLCtRUЉEt&Ct> Ct ECtECHSLCt UЉc1]U WVSuF~ UtRP8w*$`0Ѝv@T@@tPSKu@}tt'&v W Phe[^_UWVSExpEPL[CuHC Ct ECtECHSLCtOUЉBCt> Ct ECtECHSLCt UЉcCFCF%FCFF FFHFV F(F,F0F4F8F<FDF@G8u F$t&u F$ GT@PF$ FLVPG8CHSLFTVX1e[^_U,WVSEpPUH M@EE>u*~u$~u~u~$u~Hu ~Lu~@t ~DUBT@@6M9AtQÃKExut =dUZFD/uAFD;FDu8FD ‰OFDt1t v~ u~t7UBT@@tMQEPvv URbà ~u ~ EUUB8twt(&t 8MAT@@URjVN QRWЉÃ F 9Ew u M;NvM~(u ~0UBT@@M9At;QAÃt)F\EPURhMQ $Ãu~~(tO~0tOjF0PF(PWBЉÃuM1ۃ~t,UBT@@t2MQEPvUR)ÃEt MQP=؍e[^_ÍvU WVS} uE9FtVX~tDEx8ttOd&V ut8 fKE@<tu P艈1e[^_ÍvUWVSE]E} u E u UB;u9E u; t*RSuEPRǃ UEUU 9uM9]uMVǃgEPUREPVUREPVV U Vǃ EPUREPVqǃUREPVcǃtUREPURV@m&Vth0hvE 9Eu9]tNU 9UtExt f9]tUzt f1YVE UV u,]SEPURVSEPVVge[^_ÐUÉUE@EÉU1ÐU WVSUZr{8tutEjB pQVǍtjP}tjP}9u V苷 S4V+e[^_ÐUWVSEPPx Gz8uWR=$vBT9BTtWR$u9t0RjPÃtWP#7f=v!WP#&tWRt#F@fNjjjV@ЉÃu4SWVjWSPRÃ0tNfNwh-VXtjP{tjP{9tRjP_#P!؍[^_UWVSExp@ t7 ttwGTxD~1-DžFF@PPv0ƅjVSjWÃ0(vfjvjWà h0cFtvh-VQWf؍[^_ULWVSEPHËCK[I YDžDžDžAT;CTu;BTPR ;u Q蠳PAt P+RQr POA ut 89y8u t&PRQ{m諲C$ C u h0aPPR藦QT u  SPPt&Rj!Ã(fvSjRu t"PjRlv%f=@qq hRÃu*tss hPeÃt$Pj (zuB8.t#9tA uC uGt%Pj GvDžtjPdvDžt GfOjjjW@ЉÃtQjss hÃPjF 9tt'r VWMÃAu h0g^SPPNÃbDžt 8G9Fth0]vtgt^f=v&F@fNjjjV@ЉÃtNfNyvSQWjPSjRÃ0tE.!NfNjjjV@ЃvtjPsQ#C;Fu;Gt h0\G9Buh 0\t&t7A @t';t9tM&%f=@uXzq vRu Bu Snzt&t ttPf PwPVà ztuuNJu fNfIs jjjЉÃ tjPqP\tjPq.B$ Bu h0ZQPPlR) t 6t h 0Zsժ19th 0Yt=t48ЉjjPVWRxjqSPzËbtj PptQ轩t裩p۩trpvbQ蜩tgPju$OfG $G<؍[^_ÍvULWVSEP@I fv ^p@Rr VQ@ЉÃA @  RoÃu#jp RdÃtOqh-VJVrR@ Ѓ袧QvHf@8BfǂAt@fHjjjR@ЉÃAT08ЃxD~8Ѝ󥋕BAЋPjq hjjPBЉÃ ǂǂJjhujpHQp jjjR@ЉÃt^ÃuySQPRSQÃ0u0tjPkPAJfJAfǁI4ph-V7HR ؍[^_ÍvUWVSEPUx@ E9uWz|tW豤MQ襤3Ct E{uEp vSu EBu t ENKjUrSWEt FC{vtjP?jWqfNfKMAT@@@Mq PjjSЉEEPqEtjPiWwURkEe[^_U WVS]ss VsC@̠P ECtjP\i6SװэyFT;xD}/WPRmK%jjC p jjjjWRVjuE0V蚢Ee[^_ÍvUlWVSEEԋPUЉ׋w u}BE‹MA%)Euc&+UUȋ}uЉ~xEԋPBTxD~Mq jVRZ EUEЉ׉E؉EEEUU܃jjREE؋Mq jEPq Ẽ uZ}+}uuċM;Ms+QAAQfytAE&EPWUR/ẼjMQǖ} uԃ~}Ѓuth;0Pt&EЋx+E)‰UUMUMMEt&AEUEAuЋF ;Eu ;}vfyuӋ}ЋG+EEȋEUAQ jjEPƓNjuԋFUF8EUEUMvAEUEAUЋB ;Euu9rwҋEȋ}GUԋZ1BG 9wu G9w3E̍e[^_UVSUZCT@D9| u$urVPx1t&r jrSe[^ÍvUUJr PrTP,ÉUUJr PB PTPÍvUE@TP~U WVSu^K\EA8w hV0ENCP9CTuojCTPjsPQ ǃ t4{4C0C0j@,ƃSfV,v{Tus,1e[^_UVSEpS% RCPsh0SQPssh0;QRP Ph0 Q ~8u VCTPh)0P1e[^ÐUMAH7С0VQUMAH@7С0VQUVSuFx@EP8CuGC Ct ECtECHSLCtNUЉACt> Ct ECtECHSLCt UЉc7С0VVЍe[^UMAH7С0VQUMAH@7С0VQUVSuFx@EP^7CuGC Ct ECtECHSLCtNUЉACt> Ct ECtECHSLCt UЉc7С0VVЍe[^UEPJwQ$,0Ћ@ 1B@ 15@ 1(v@ 1v@ 1vÐUEPppp pRPQPR({ÉUWVSE0f @7ЉF8wq$L0Ѝt&E F4uVԖÃtEdž0VЉF4VV7މw t&EF4uN<]S6WHMWHOL[؍C)؉҉WHOLE01e[^_ÉUWVS]E UuπRUr SR@ЉǃtEph-V;U R  UB @VǃujEp VǃtBUrh-Vk;SvV@ Ѓ.E P^Nf @7ЉB8Ffdžt9Ur uEp St fUBtjjjV@ЉǃupSEPV8jURSE P{ǃ0u:UBurh-VM:E P"U1VvEph-V:U RFfdžN @8迖[^_ÉUEHPBftft"0fu*B8H8(B8X8&B8h8&J<B1t&ÉUMQ<9u A9Jt&R9JuB@BÐUUB<} @u fJ4B4@)ȉB uB,t J z UE} @t @ fHÉUEU P,t P@t x HÐU WVSu}E^ C t~t;CtsU;SrE}uFH1s(vE+C1s$hURPVƒ ~# NE11&h0wS/ Ph0Fe[^_ÉU WVSEUzr ~7E %=@uVWÃEHI1v(ÉF(@h(ЋU RPSEPà GT@URSwT@ЉǃtE PSUR5Uft>ft4PsPPh0Gh 0BhPvH WЍPH WЉЋU9s UУH WСH WЉ13h$0ЋEpVPh@0lEe[^_ÍvUWVSUB1EE19}61ۋE,D;E|t D ;E~ T U F9|̉[^_ÐUWVS]u{ t@9E uA-tM|t&uIyCH1w(G G@[^_U WVS] ]Ex URuSPU҃}!9|)ËEPjSURU҃uW9|ՋMșӾ;}+EPjSURU҃uC9u1F9|1e[^_ÐUWVSUuz ,M Me]f| tAEPj,]PB p L tufO1&E@HEGE+E_$1;E t1t>+E1օ}VU )sgt+E11ɍC)ȉ9}]<t5B9|19}E<t!B9|VURWƃ} @}F)M O ,]fL Ƈu^ME G$E e[^_ÐUWVSU]Kz ,M Meuf|0u 1vEPj,uD0PB pJ tuM1{&E@HEt,1w(Ӊ؅}Cu 0)؅}CEG()؍pEEPVhPƒuOuFEEPVhPƒu)PSU Rhl07Bh0>E)ЋMt+C=~Ph0Ah0=؅}C)u2O,UfLƇe}@u ,fDuSKM O(D e[^_UWVSu EX +K1s$;sr2EpVh0/Ah0ЋUPSEPj,MUPUB pUH tuKE@HE+s1s$օ}VE)r(PVUrh@0t@ha0Oh0C:&3)‹E  t,@~Ph0>h@09e[^_ÉUuEPu hc0jx:ÐUWVSE@EEU} } MI M} ] }<;tCEP]SE PURDƃ tuHKEt&EPEPWU RRMQ PE PUR%ƃ  E ME;IjjUM Q]SIEU]XT EtEpEH(U:u1e[^_ÐUWVSEpxE=7t~@tVh0ĆfuEfuYFT@@uPtjjjjSE EPEKPsS CtjjjS2WjVt WjV跂Ee[^_UWVS]C@T@@uV\CtO CtE uCtEuECHSLCt UЉcC$Cs EPjCH1v(1$,L ȋPC pq9ǃ tuu5REP`]ǃKjjjS kU1҉HLM 9u"E9uUJjjjR-vMI \L9E9UH9M u N\#E U׋E U t48E UtWlPURFP4Q]S qU EM ]SQdSJSoJ tl~8l9EHjjjP&u \#u] M\NjU MЉʉ t48tWlPURV4Q]S iU E\E URPdRIdQUI)PlpHVj^Sl= tl>7l8\E U tH`ƒU)‰U)‰U XU<׋]8E<}Oy޻ ;`~EK;`]KjjjS jǃ t!UR-5Mt&E@HE}|xjjUiEMEPURXAMH+EPjUMDPc8EP2ǃ t}ԋUUMpEH)É];u~mEtW}~;EPEHPjUPMQEPǃ t}ԋUU؃SMQEE؃NUU;u}~O}|IE}Mt8EPEHPRESURMQǃ t}ԋEE؃}tjURjMA0 A0Q3U؋EEԍe[^_ÐU WVSU] މ1BBCCPRCP!7fC$fCe[^_UlWVSEPXH BR DžDžDž{8t _GJ!)uDžNj󥍽DžDžjjSgxtEjjPfA8SjPe5q jWqo +iPPWƣt& ~G󋅼9s5s`WSi;BRAQ jWgX1@1ҋO 9 u;Gw3Bt@t)jB0TgAA+8[^_ÍvUlWVSUBEJ Mq uAE MuvuB@ EEEERU􋒰UMMăeMeuvEPj@URÃ4}ftMAT@@tuSEPURMQm9ÃEEEE}t}uftEuF $E܋UBT@PHEȃ}uMt;vEudžEDUMȉM!Et(EPjRPuV!à EEEЋUHE1uEEEM;EEuBEt P-EPjuRPVà E}uEHEuEEE]XHf{t!=8tREPSURQt:h 0ЋMQ蟢UJ#UE)ЋuEv}tuKʃ;t C $)…~[;U|EEE>}u5U}u UUu9u|EEU)щMtKu;NuF{EECU‹MCE;tŰu;ER}u"EEǀUEt P,}t }f}MfuFT@@tt&EpURhMQÃ}u%uHE1uEFxUEMHx9E}E̋űUD2}EMA|IuN}uEPjURN MA@t}tQu6EP8MCu*C $Eu;v-h.0VC $ENUft}uE؋M#}fuvEPhURRÃEHMu Ax +UЋuVxU9BuMA@uUBTPEPMuvTBЉÃEttf^ &AX Q)SQVq0;Ax|>uft&ff^ލRPV$0NjI u(A|t!;s}w jA|RPQlj[^_ÉUSE{xu>EPEPRPS ubEuIKHvEPEPCx)‰ЙRPS uUfBuK]ÉUVSu] EPEPRPV\ UCC xLta@`t[f H w=$0к1*" 1ҋEPE@u=Ne[^ÉU,WVS]11M1҅vjEPEPjjWVj SMqj0u2}u,f{t%t#C{.ut{ .u;U t1#CƃM19u9we[^_ÐU,WVS}U BEB;Gu'vEt&1Rv}uf}..tq];_ttduCbUBTHEPSrTAЉƃ uUz8ujjEPjjjjjEPRjƃ0zuh0lh0GEt Pae[^_ÐULWVSEPUM@EY ]䋃ÉEĉ‰UȋEċUȃ]K 9wu9Cv Exu1EEM싁1ҋ]IUBR M䊉 tEC]E䋰UJ#M܉)ϋB9slj;Uu;Ev}̋]䋋EU;rEPjVMQ]SCEHU;B$u$uEPjjEPEPVMQ]SEPjVEPURIE؃ }]MY$E+p@9}tnURW@HE܋MQِE؃uKuLE]{t-M싁1+CS ẺUЅ}uEt PUBTfx@|MIE؍e[^_ÐUlWVSEEP U؋xHM􋙰]u1sUB8tXwtltyet&Mt]_G E tK19Gu9W t9Uu'h 0h0?vh 0h,0*MI M G1҉ẺUЋWO UĉMUMЉUMM싁ÉE‰UEU9UwAu9Ew:wUz8u8t4EċUEUЋ^K9wu;CvjjV+OMԋU1҉EUM؉MeE1ۃ}kGW ]슋 t‹G#E)ƋG9s9~ M &eMQEP]sEPREP à O_ ӉM]]19Uu.9v*WEM1RP]S+EP3+UB@M싙)É؃9}ƃWVEBHP蒍Ã}t u)U2M;u u uutEHU;WvMAtxt Eft=UtVMqREURPURE+G)G_ MԉO#E;GvUtjjjMQÉ؍e[^_ÐU WVSE}Xp E U tMMQjPSà tutUE #BHEU1e[^_ÐUuWÐU WVS=k_ЃhU5SNWuh\U59T4Wt h0H EPh0h0QÃu@Wu5\U Ãt:E@ HWuQjuO 5\UZE/VЋU/VЉB=/V/Vu E/V /VЋEE/VЋphS~=jhSEP' ~Lt'j@SN=jj?SEP[' WUBHPR WuPv0| 1e[^_ÉUWVSEjlEPu%ÃUB@UzuttptEPRUR ÃjEPuG:ufG:jUR[ƇE@Bt#UREp0URÃE@CUBxtZEpRhV踾URB0hVà tEPjVPURjV:Ƈf:u fG: t&fG:Ƈ}uEPEDPEPdRUB$B(@BEEB,RDCÃUr~8tVWF|@ ;S|VWUBxtdE@@u뀃URhVwEP‹B0SV艿à tVVEPjVUBBuEPRV/vU;rtVVtVV^EExuVhURu n#U)PR9 Lt-Vj?SEP#@+EPS9 jZEPEP VjY]Su"UZ)PER;9t>Ƈf:uUЉG0&Sh0 jURe1h[^_UWVS} Ex@uwPX1whURSt1jjwwjMQg t h0juEPjKIȋ71v(EU,Ee1$MuLȉE7euVw ƃ uIKI71$MqH uuV9T1t&EP$Te[^_ÉUuVjjEPhhd}W诽 t  t&E@(UURjhRPjhPMQmà u"EpH]C@PV#Ãtu}@E؉E؋PPH ʉ1ƋU؉JyEeԋEԉ EH׉ EԉEmUЍL21uЉu؉ U$F(1(19t&EPjU F &FPMQ! à ]؋ЃM,PqHRu: F; ruu} }E؉EUUEPhЋMQRÍe[^_ÍvU,WVSUB|@ E}t MAEEEP[ƃURW~M; \Ut&jjEPURjMQbƃ E P@UMQjtPEP˸ƃwURMQjEPhhdEP蟺 EEUURMQhjEPt ƃ EURpH- ƃkjjhwCEljajjh0WCNjExEUzpHu>EEXU舓@ }uf{:u fC:fC:ƃSSK ʉ1ƉKQ牻 GЉ }mU܍L21u܉Ɖ $C(1(jj P5B,1; EPjGGPUR ƃ ЃM,PqHRPu E G; xEM UQhA @AlAD<IAEPUPH$UB(B,MA|U P1j,\CEt P% MQhEP URMQ}tPEPϵURjMQ蝻}t+jEpBjURBM ǁe[^_ÍvU WVSEURPEPƃU{u,jSuG:ufG:jSOCx8t @|@EPhsURjtPs迴ƃsfLj,AjWAjSAEǀ`Ae[^_ÐU WVSE}u jPMÃu1WhvOWjG0vӶÃWjv؍e[^_ÐUWVSUPfz8Sth0(MZzL~Bdtx1EE9E}m&vOE9M~9~94;Mt,9t(9t$E@E4)9M~9~9~EA;M|MM @EËM AAB)؉A B A+BAABAEH9t8jZȃTPEP&jZE PEP  jUB PE DP 1e[^_ÉUVSu] ~8tK@u~lt?{t9shVgHu!sss VtVI1e[^ÉUWVSU}E^t(Ph%0(h.0&}EEEE EEPhRPJEtE} t=Whv蜯WE PEPv tEWjv7t#ƃUЉC0E PVtEEe[^_ÐU,WVSEEPUE PURoU@EEP50 WЋURjBÃtEt&jjHh;ƃhV+jjh?0jFTPH1EEFUV z~ EFU VdždžVoÃtuHjEPjE HE1w(1$,L ȋPEpà tu_GuhP]E1$SHRFuy tdždžfdžUR5, W54 WЋEP裬ÃtuFU[F @@@u?H WЍPH WЉЋU9s UУH WСH WЉE@T@@uNEU1e[^_ÍvU WVS]} u@O wufP(9wVCURQS@ЃtDMftu G9tQEFv1e[^_UEU f ABB1ÐU-ÉU WVSEX1jjhjpǃhwHS} u W We[^_ÐUWVSEXEE PEPvEE; jj Et&E@PEp*ƋE$,RPvHS} uVE t&VKEE; gu }t}e[^_ÍvUEfx8SuPLwxv ZtRxT ufxXth`0t&@`th0Nv} u@dt1ÐUEp ppP7 BPÐUVSEpXp Sp7 FPu?HVHt3 C@83F1e[^ÍvUUB tB u1ÉUUBB}t$r PPPP3PÐUWVSExpEPCt> Ct ECtECHSLCt UЉcCFCFVFF FFHFF F(F,F0F4F8F< FDt FDF@G8u F$u F$ GT@PF$1 FLVPG8CHSLFTVX1e[^_ÐUWVSEXxP U@E;u*{u${u{u{$u{Hu {Lu{@t&{DtkGT@@U9BtRN$ωSDu t  NCDt1p0t ]{ u{t/GT@@%EPURss W "{u{ tUG8tw t"t&t GT@@EPjCS RPV {(u {0GT@@U9Bt0RMt C\tEPURhW觧ue{(tGTfx@|N{0tNjC0PC(PV調u01{t(GT@@t&EPURsW e[^_ÍvU WVS} uE9FtVM~tFEx8ttOfVPuLut?& fKE@<tu P> 1e[^_U WVSE} uuuMQ9u 9u9t!QVKuEP LuVff9u9tK9tMyt f9tExt f1e[^_ÐU WVSUrz~8t0u t E"r WEu fK9u W< V<W}t}u fK]S4UIf}t<Ãfft h`0 Ep jjjUR胶ƃ MȀIu`4]̋C$ Cu h0EPEPUR(EtEȋMԋ,}t hy0u]s741t&9}t}hy0@t&}}fKjjEp jjjjjUURujEƃ0uZ}uf}..th0j Wg7MMjjEp j jjjjURuj$MQEPUR"ƃuMfIEȀ`tUR2}tu2Mq2l}tEp2s2}tgURjuؘufOuS2 u2e[^_ÍvUfNjjjV'Eԃ  j}WCEfE EC xLt @`tEE.FEM܋@ fEEC xLt @`tEE.E.jjEp j jjjjWuj舒Eԃ0uWU܋P M܋AT;PL~ h0KEPURSaEԃt.fN}tfǃKu20 MQEEph-V+UR0Eԍe[^_UWVSEPUx@ E9uW0EP/fuUr sVu EB u 0t Eht&EPWoEuMfKW9W,/1fUr jjjVEvt W.EP.Ee[^_ÐU WVS]{s WsC@̠P/ƃu?}SװэyMAT;xD}&WPR K'jjC p jjjjWREPjƃ0MQ).e[^_ÍvUVSUZCT@D9| u$urVP^1t&r jrSe[^ÍvUUBrrr r1RPPQ|ÉUWVS]E EUuπEPEp SURǘǃtEph-VCU R7EUfUB @fNfU @7ЉB8fdžt;Ep P:uUr +;t fjjjV;ǃuNEPU RVYǃu4E@uph-VWU R,,EU1CEph-V)U R,fdžNE@8u+e[^_ÐUS]{ Ps?{ PjjCX]ÍvUVSEp=7t~@tVh0!2SSVJC @t P|+jH dž1e[^ÉUS]SS`]ÐUNÐUEHU ;Q| h0&A ÉUSEMXU D;C|h@0C QPu@]ÍvUVSEXu 0;s| hb0}t2C u h0@t?Ct9P9.vC <t h0VSCSC4CS Ee[^ÐUVSEHU ;Q| h0A <uh0AqF9tQDAAIe[^ÐU WVS]}uCtK{$uu;{t S {$t.{$t(tjsjS# t&jWu S e[^_U WVS]}uCuSd&PSu Ct$C{$uu;{t SE {$t%{$ttjsjS jWu S e[^_ÍvUh`7h0jjjj(h@ WÐU WVS} u }Ph@ WUÃu1>P CCC$C {CURjbVCtREPjbVCt)URjbVC u3jbsjbsSh@ W!1ۃtC Pjs ؍e[^_ÉUS]jbsQjbsDjbs 7C$ttjbPSh@ W]ÍvU,WVSUZLB J$) MM RHUEȉES9|&C$rijQMQSkWE9C |XC$tFtA9U}jC+EPMQS:KE)ȋS$ut&DECEPEmEC$t9t4jjbEPEujbs$C$jjbuVEjjbVE܃jjbVwNju+sKMCPQEPMKC ECPMQWVjCP{ CECPMQEPVjCEPM܉K{$ }twCPWEP[VjCEPzMK$ E;C}jC+EPMQSSE)Ѓu EMDECMK jbEPjbMQtjbEPftt jbWOe[^_ÍvU WVS}wLG W$)‰ OHUV9}P;]F t2@t+E u%E tjjP t&PC;]|V19}PF;WH|9;U}4F @t'E u!E tjjPF P3C;^|e[^_ÉUVS]1;s}ACC tuh0#&Ju P F;s|CCSe[^ÍvU WVS}u]U BL}tYR M A$) =vD9vVQEPS9rU ;Z$sSRMQTE @HWjU B J$)PU BLb4xu M a4U B J$) MPh@ WÃEPHCCC$C USCWjbVfCtLWjbVPCt&WjbV:C u3jbs_jbsOSh@ W1ۃM yLua4KSt&1;u};K U BHW C tSCSC4CF;u|ŋC )PjC P@GHOu Gt$GG$t!tjU B J$) PrHW+E @HXL`4e[^_ÉUWVSE @LEEUBUEUB UExuPh 0E80G(t/ fG(EPjhQ0hWv st&[ƅtjjjVjjjءà 1ۅtu!VZhX0SW蠕U UB U4c(S辔 EEU;Be[^_ÐU WVSu} ] uh0t&VJ))؅h0z$u RFG@e[^_US]jjbC PO‰S$u C$1C PjRC$SKu B t&҉H]U,WVSE EUUMY$E19}h~ Pҋ|7;E ~=E )uJ щ D)u B}  ҋ} Llju;u |t(U~ HEEЉEMLMEE;u h0Pt&~ Pҋ|7;E~EE)uJ щ D)lj}u J} ы} MLUy h 0EE9u1;Uu,EEu BM,ЋMEDuJ Љ|uWVUR;ue[^_ÐUWVSUMA9}E] ډUE1ۉEU U}tCuF <tuUB;U |;U|C[MMA <A EpF9tEPDUBuF EHu W;]me[^_ÐUWЉ…}P)WDTPU WVS\WE\WЉ+XWЅjV5P87ǃuSh`0h0jjbj Xx DTЉtBDT@DTЃVjW4XW`WЅ~*ٍt&GWЉBWBIu1e[^_U\W+E\WÉUWЅt"BW `WB BÐUVSu^tO{0tVÃt7{t K0C%C(t fC(2S{SڟVWЉF5W`WЍe[^ÍvUS]C tjPC {u PWЋ]UE@t#H0txuP.u fP.IH0ÉU WVSDTЅt:1;s}-1C P ;U|;U }P!uF;s|Ջu1e[^_ÐUVSuVjjt@>u:^jv F c(j jSBS1SP1e[^ÐU WVSEM #P(@$<ˉt9Zu9r tUu}u 1Gjh W‹tPzZr Bz1Ѝe[^_ÍvU WVSUu }Btt=Rh0h0yz@~~PVRu 1i&Q<t uGABtIyu3t AB&QQh W藹 B <؍e[^_ÉUWVS}G@~tG(@EE9E}WG$U4t?1ۍFtjP PWЃC~܋Vh WޅuEE9E|jcw$819}*G tjP PWЃC;_|܃jcw + WhW譸e[^_ÐU WVS} u t:=8th0DTЉsCC8Tt'DTЃ=8t h@08%jhWtÉsCCt {@~5C(PRjcS9vPFC$uCh0RjcVC uh0Vjs ntcEC8CCC CDTЉC,t DTЍS,P0DTC0DTЉ؍e[^_ÐU=DTu\DTDTDTh`7h0jjjjTh Whh`7h0jjjj4hWIÍvUuÐUMQBvBQÐUuÐU WVSuVBBFu~V,t F0B0t&V0F,1^tHC(t fC(,S%C S$ PVzSm [utN V@e[^_UWVSEEEt%E EUB EEe eEUeeUB 9Uu'9Ev"h0UB EEEUBƉEU+E U EUӋE9 u9wEE }tUZ&&E UEURPUR袅Ã1@}t5sC$9E)u U ;S 9EVE;C wHEUU9U9Eu!U9UvEURPUR%ƃE tQ {0f{,SSjExŃ{0uUf{,uNC(t fC(>S西C S$ PURS h70訿}t E9E9Uu E9Ee[^_ÉU,WVSE UM MM(@)EE1EU;}E<UMQRMQ赃Ãu~EU ƋMAu5My@~jPQt t&UB u-jjjjEURPURà tc(K. tC(!t;}tE(tE fC(MEGEU;}UE}1EU;}M<;}t E(EU E=C(!t( fC(EPjhZ0hSe t& fC(UM<6EURPUR/ÃujjjjEURPUR趐à uhN0럍vK. M<E@uFUz@~-jMQRƒt%E&UB MuSWjPSƃt@C(t S`hjEPURjPc(S諓1c(j@jS6MGEU;}=1e[^_ÉU WVSu} ^VF V$ PS>tV&Ct{u S1e[^_ÐUju ut jPÉU WVS} 5DTЅtCVWEPV7à tV^,Vޅu1e[^_ÐU WVSu}F@~ZN(|F$tB1ۍB;E |#9}BPVUtCt&C~̋uIy,19}&F ;E |9}SVuC;^|1e[^_ÐUVSu] EEjjjjEPEP RPV0tJ~tCjSVjPE`(j juuعu1e[^UETETÍvU WVSE]uU@PE$uU9Uu؋EUU WVS}u ,}uF VW Hw JF j PS5P8tPh01t&0FhjP賰GjDPReu uuuVWǻe[^_ÍvUVS],s pIc, PV5P8>h V5P8~ ǃ,e[^ÐUUB@0@@4B@8@<B@ @$B@(@@,RW BPBTÍvUVSuh{ËF,tS{& F,S{,j PR5P8 tPh0蛜h6{Ã~1u V2F, %F,S!{džWЍe[^ÉUVS1۾ UЅt:vy1u*A,u$`)9~ˉ֋IuɅujjh0jhUC 딃=WvSzh0QeUWVS1EEE1UЅtlC,%"uXuOC1<u;Ev=]E5<|1<-;X8rSIF&9v]Nj[uu =Ww]u]t Se[^_UVS]hpyƋC,uVsygt&$C,{1u S|VLyǃWЃSO, RP5P8C 0e[^ÐUW=Wuh0v@W1&WEPEPauu4 ̃nu%Xjjh/ }ÐUWVSU Bt'EM IMD9s }߿v1=߿v E߿)EueU%9v‰E);]v]M QSuVSE)]}P8Ѓud0 􍃤Pjh0jP@ u5k_ЍPh"CPuEPUPR5P8i%P8u5k_jjPEtjP>'}uW1}tOjEP5P8WEPUR()E  uvw멋Ee[^_ÐUVSu] EWW jh/kWЃETETFTETETETETET,WETjSuh ET}  ET dWЋE9t2h'jjjj)VEPh ET  t h@0˖P8 ETЍe[^ÉU WVS} ]u }t 'PjjjjSWEP th0]UE0Hu+URE07U2P ƃu(h0EPU27Vq UVE07UR".t h0֕e[^_U WVS}u E) 9GvY;u1RPWEZÃt+C(t fC( PWSl ;urj_tcCE1ҋK$9Ju;C wCE19u8;C v3C(t fC(#C S$ PW1S$l ]ue[^_ÉU WVSu} E) 9Fv6;]sm1RPV[Yt Pk;]r>Ft7p1ɋX$9#u;P wU19u;P v Pkuɍe[^_ÐU WVS]UBLEE% #PjjjE PSEPR, t 1Ut(vUPREP,1t&P8ЋE+rLDžjjjj1RPU Rf uEuh*0y뿀`(U zujp4Wyjjp4WE0 pEe[^_ÐUU E%PRuIÍvUVS]u u^* 􍃤Pjh0jP: u5k_ЍPh"CPuEPE0%PVSZS= u5k_jjCPvEt jP.!e[^ÍvUWVS} UBLEh'jjj5WWEPR t1P8ЋEERL)UE]1VS5W3Vt@P( u h@0ffP(5Wjha0hPh9jjjjjVS5Wd uhj0vh`(jjp4EPU2蠖EE 0t&}tE)EURjPQEe[^_ÉUju uUS]MU CLEh'Qjj5WREPS{uE1]ÍvUVSu] FLVP)‰9v1Mt&FLEh'jEURP5WSEPV tjjhu0jV7 뺋Ee[^Ujju ukÐU WVSu ]h0nǃPhVEP'ÃW n؍e[^_ÉU WVSu] hmǃhSVWme[^_ÉUS=Wu%HYWЅ}WЃ WЀ1(jh5P8¡WЉWЃCW9|̉WЁ=W~ Wjh\l]ÍvUh0jjh$\ÐU WVSvW9W|jjh0jhWK6 1jh5P8Ãu߉];F|Ӄhl¡WЋMW5WЃRlhWl9`U WVS}h;lƃjjh0jhW5 WЅtW WuȃV lWЃ9W} hW8؍e[^_US]hk¡WЉWWЃRk]ÐUVSujjtPVuu SE؍e[^ÐUVSuU M]F(F,FDFHdždždžVLNPdžjjh0jFP dždždžtPhjƒWЉtWЍt&5WdžWЃRcje[^US]u^* 􍃤Pjh0jP3 u5k_ЍPh"CPuEPuu S+u5k_jjCP\Et jP ]ÉUEÉUS]PЅ$sPsLS3jS]U WVS} =FE9UZt#{ uC F B }9~unFtpVFFGtF;0tx E87~WG_tSCF UB CtCPEPMUBBCt B;tXEUSÅt({ u"C F E@ }9>urGtGpVFFGtF;0u8x t&U:w~WG_tSCF E@ XUBt Pt&EPDUBBCtB;t X t&EUZS C[tSCwt ~ U@ e[^_ÐU WVS} Ett&9_{ uvC G _GtxWuGGCt G;8tXE;_SFC[tS0C_tz uCx Ct x օtF C 3FtFXSCCFtC;u0p &U2^sVF^tSvC_G C G Ct@ _GtxW7GGCt G;8tXE;Ӄz uyB G CtCxWGGCtG;8t XvE{_SC[tSCtz u"Ctx uC x$t&t z stF C sCtXS#CCFtC;u0 pvU2sVF^tSCG C G t@ Ct Cxt&WGGCt G;8tXE{_SgC[t SQCU&tx u U;{t@ e[^_UWVSE Eu PUMAuUƋtދuFE~V Utxt&97uMEGWG t&MU E9FuUBFBFB F Bt.9u 0 pMYS>C E0UpBtptmvSC[uPMyA E}tUzt,M9uEUWWG&EM}uURWMQEe[^_ÉU WVS] 11Et,֋C J 9s 獶9~9sU E$PUM QRsWMQ]Si E9x}UB$E M$QEU RPUrW] SMQ t uE9xs`@vBEUt9xs9zrB$E U$REU RPEpWSUR tuRt&֋F$E }$tE$HU tM$D1E E ];KPw*9r&V؃,9t9J rEE U0}$M(QjEU RPuURWMQ]Se[^_ÉUWVS}u GL9sƋGP9EvE;uvuEPVWu)];s vVSW9uCEX9p r CEEW,U9bM9K VE;C$sPSWuSUC$+s {DtCDPs WC4C(PBu5Vs XP8ЋBLK$)PBLS )‰Ps(:s$s h dWnP8ЋBLK$)PBLS )‰Ps( c4C(s$s 7m9u CSCBSCBSW)EC]]M9t E9C EUe[^_U WVSu} tn~LtWF V$)‰ PvHvLqF4tv(tF(Pzt PBЃ^Vރue[^_ÍvUVSu]M FL9sh jE1RPjQSV>u1e[^ÉU WVS}u ]EPVW<tU9r uE9B$u z(uzLt 1t|K9u t&E@AHuWE@CXHE1;u}rSWb[F;u}ZuTt&B9u @t&EP@BEP@BuWVvu=e[^_UxLu8P4 u0P4EUP(E@,@0R1ۃu5k_jjFPנ؍e[^_ÐUWVSu] Eu^* 􍆤Pjh0jPH u5k_ЍPh"FP\uFL9sËFP9EvE;]v]EPSV%t2E;X v3SPV#EDE 8E@E]ٍV,C4u͋E#C<;Eu΋[9tE9C rˍF,E9E;C$sPSV}C8E}t EC<#EEC8C8;Et`UB4t uu zDtKDK8Eʃ@4tʃ>K C$ut RPQWh PQWat6ExDu-}u'}t!jjp$p V tE [;]t E9C u5k_jjFP蚞Ee[^_ÍvU WVSu} }}} u^* 􍆤Pjh0jP u5k_ЍPh"FP uFL9sNjFP9EvE;}v}EPWVt];{ vWSVEX~,E;C$sPSVEC@[9tE9C ru5k_jjFPe1e[^_ÍvU WVS}u u`, 􍇤Pjh0jP u5k_ЍPh"GPuGL9sƋGP9EvE;uvuEPVWt];s vVSWEXw,PE;C$sPSWe}}}%u5k_jjGPN3ECP[9tE9C ru5k_jjGP1e[^_ÉU,WVSu}Eugu^* 􍆤Pjh0jP u5k_ЍPh"FP蘛uFL9E sE t&FP9v9} v} EPU RVZu7Eu u5k_jjFP0t&Z]}U ;S vRSVF,.{D;S$9sC9)9P  [9t9{ rϋ]F,E9tD9{ s?;{$sWSV{DtCDs$s V[;]t9{ rU5k_jjFP>o{Du-C4u&t"C8u{(uWE PjjSVō U ;S vRSV;{$sWSVCD{8tK$9sRF,S9t9J vCF,KD[9tU 9S$wEuu5k_jjFP腙[F,9t 9{ /5k_jjFEPKE][V,U9t$9{ s{Dus8s$s VEtσ}5k_jjEPƒ牖t􍆠P ] vKD[;]t9{ r];]t/CDPSDuCDs$s V[;]uыEu"u5k_jjURREEu<ƒ牖t􍆠Pt 5k_jjEP:5k_jjURƒ牖t􍆠P" 1e[^_UWVSu] u^* 􍆤Pjh0jPC u5k_ЍPh"FPWuua^H~,9t&{DtCDs$s V註[9uڋƒd5k_jjFPLtu(.5k_jjFP贖v1ҋ^H]N,9t {8t{Du C {$)lj‹[9u W;(Wv0u5k_jjFPPt& ]~,9tJS8t6{Du-C4u&t"u{(us$s jjSV豉 CD[9u5k_jjFEP˕E^H[~,9t{Dus8s$s VyEt׃}5k_jjURvƒ牖t􍆠P]9t{8tKD[9u^H;]t6{8t'CDx{DtCDs$s V芹[;]uu5k_jjEP۔E?ƒ牖t􍆠P v5k_jj}W虔1e[^_ÍvU,WVS]5k_jjCEPjCL9E sE CP9EvEU9U vU EPE PS5u25k_jjURT5k_jjEP 'vu=F4uӋN$9Mv,C,V9t;J t5k_jjEPœvU9V rEVLUV(U}E =T8U U)EF$;EvE+E EvEPVHUR~ǃ_E t= s|n ug{0uqf{,ujC.tdSOXSnMExf{,u=UREP)?u#W>t&h0/XvEE}(U UF )EV,UF$;EvE+E E}tHEtE@<t9@4u3EHUREE1RPERPEPAЃ uEUU vF ;ER5k_jjEPۑEe[^_U WVS] u}EPSEPu10U9s$E,9t;Z r#B89uۋZ$R9r޸e[^_ÐU WVSu ]jhWFǃSVEPjW e[^_ÐU WVSu U}1ۉ6}PREPMQt VMzKƋE0ǀe[^_ÐUMU A B A ÉU WVS}_ t)SƃWpMw W MSe[^_ÍvU WVS}u_ Uu^* 􍃤Pjh0jP u5k_ЍPh"CPuƒu5k_jjCP貏vsPsLSua-v 􍃤Pjh0jP) u5k_ЍPh"CP=uE CLsPC,SD9t RSuR5k_jjCP=PVU RiƃWKw WjKS e[^_ÐUS]Pua-v 􍃤Pjh0jP u5k_ЍPh"CP-ut(EPsPsLSEtjP3IShWG]UWVSEEuuUt8 MPjh0jPC }u5k_ЋEPh"EPOuEUPrPrLE´Ej$PRnM M}_H ,}9S4th0qRt&Ѓ u h0URC@IAtjjjjSEP= UREމE@DxLt!jUB J$) PrHrLy}G(tPzt PBЃEPDMQ}GD@AJAHQW}EP2EމExLt j‹B J$) PrHrLx}G(tPzt PBЃE@DH4 UMQDPAD@}GzGxWQCLt*@u {DtCvjjjjEPUR~ {Dt{LMQ}WA{LtBC4uvC<t0C8ƒM9s K$t RQVW^T QVWLK4:C<t4}G8ƒw O$tRQVEP!TQVURmL[;]hM}u5k_jjȃPEe[^_ÐU Uкgfff)9uhW*X8X89PUv hU UWVS1UЅt2B1<t<|<tw wGRu1۾\8ЉʋE)  ENy[^_ÍvULWVSE}uUE߿ϋ} t H $@0ЃjhWI]Sj0SVWURChPhW57jt&jEPVWEP q&8WЉEȃEPRVWUR9GUȉ<W@WЃ_8WЉQ)‰,W1<WЉEȃEPRVWURUȉ8W@WЃ_g|c<WЉQ)‰0W1@WЉEȃEPRVWURaus<W8WЋUЃ_}S@WЉQ)‰4W1+5X8VWURwh VWEPe-e[^_ÉUWVS]1҉ UЅtdB,uUJ1wL$l0Аt"wfC1X89s$fCX89s tffCRuWЉC,WЋW)‰LWЉC LWWЉCWЋ W)KWЉCCC C$C([^_ÐUNÉUNÉU,WVSu EE~FEV9t DF tE|7EPRUrÃE@$EFVEUEEEE}uWURuE]MMA 9v@9s}uK@%EEPjUMQRMQEPEPuUr i0u }t1*uM1MA 9v @9r1ۋE0EtH,E@(t ,P؍e[^_ÐULWVSE EUr @Myu%U9w  EjPWMQ觪E5k_jjFEPEPSV t'F,E؋E1t&P$;Us@;Et9P v E UJ$Mȋu9vuB4t1UVSEX4 1h8Ѕt5 0;Wr;WsqJu˸W[^ÉU,WVSE1ۉE@WЉډ@W4tE}~ރE}~`WdW`WhWlWhWpWtWpWxW|WWWWUU UUWh8Ѕu h0+71E9U}1ɋWЋW)ljÃ$E9U|K %80Љ )S0ESjQgIE };=h8EEWЍt&EX)9v")Sh0:h)0q6t&EWЋ})E)ȋMA E9]s]EWЋMU|4 M;Ar%;A w WЃEWЋMP E8E9]rE$E$E};=h8UЁEE UЁWWW W8W @W <W,W4W0W l8УWWe[^_ÍvUS=Wu WWЍBWЅt h@04Wt1ۉCH9uWЋ]ÉU WVSu=p8u=hUhUE,U%UЁ%Up8=UСU9t)9s h0(4>9Ws"S=WЃ9s h035UЍ9sB&EPu h03juSF9rʼne[^_ÍvU,WVSh8ЉEIWЉUUUU荶=Wu h@0F3] 9_ ^W;W;G uWЍXWWЉ;h8Ѓuh02t&Hh8ЉM9U$E썶WЍW $$E];h8|v WлWЋ2;9WH }2x<2 ;W8h8Ѓuh002t&Hh8ЉM9 U$EWЍW $$E];h8|v܃܃E܃E܃E܃EIcMIWЉ‰Ӊ]W;G uWЍpWЉW;u[h8Ѓuh0S1&Hh8ЉM9}0U$؍WЍW $$E];h8|ظ܃܃܃EIX1e[^_ÉUVSu1ۃSV=u C~1e[^ÐUWVS=Wuh00}vEPh0u0U 9Urh@0`0t&h8Ѓu:h`0]4E 1RPERPjh0B4$h054'E9E}$=Wu1Ґt&$E9E} Wth89UEu h0/E19}#E;Wr1$E9U} M;WsUҍWЉEh8;U~0H܉MøWЍ<u E܃J;UދUEM HEUBEB }t BMAAUEPh8Ѓ}u e[^_ÐUWVS1ɡh8Ѕ~ 1҉ƍt&WЋ W)É$Nu9}9|WЉEWЉU]%jP5P8gÃuh@0i219}DF9|퐍t&h EWЉ=WO=W1;usStC B C UDS CCK K#WЋWЋDC # WСWЋDC C#WЋWЃ\EuF;u|UR* }Ut]SEP5P88e[^_UVSj5h8h0;11;5h8};WАt&C 1RPCRPCRPRPh010$F;5h8|σh00h005Wh00e[^ÍvUWVSu] E EW;W|; W}$W9W}hW1u}tMAwW; W;W!k_;Wt ;0Vut1 1}t |X}R)@WлPWЍ2uNȋ2uE9~t@WЍ2u&ȋ2u}N밃EPh@0d+tFAFBV WF)t WЃ}t"F)tWE WEURE UF V$MNEFfF(IfF*tpfF.}tz^ ]#WСWЍ؃hJ ƒFCF C0NKR< FVB FB 0FVP N(F@t&fF.}tf(}t V"MQ1e[^_ÍvU WVSu} VF #WЋWЍƒhzVt F B F CV FQeVtFB&VFB VFf(FHFfF*~EUF V$fF*^ #WСWЍ؃hƒFCF C0FCRFVB FB 0FVP N(F@e[^_ÉU WVSu~0F(t$fF(F F#WЋWЍƒh.VtF B F CV FQVtFB&VFB VFf(FHFfF*/ tF.t$fF.FF.t'tFBFdWЋVf. WF.tD0tuFlW&t FB FtWЋVf. Wf~,t fF, Wff(V@WDFVD0VtfF.WЍPWЉ9W} l8УWЃW{e[^_ÍvU WVS} 19}qEt\tWC(t SVC( t7StBjS@$Ѓ#$fC(s`] &$fC(F9|e[^_ÐUVSt&W9W|W@WЋ@WЅu.PWЍ&9Ƌtu Wit CBCFS WЃQLs4 u5tX^sWWЃQNK)Ft FX^ ^sWWЃQ=DVe[^ÐUWVSEPuh dWWu }Eh8ЅtIMW9r ;Wst)މ7&AMJutU+UWЍ1e[^_USjjjhhWhW5P8~WЃ WWh5P8cUUWWW1ۍvt8ЋtCv]ÉUWVS}uEtE] EhjjjjSEP5W蝧 W9k_u==UthWjhd0hhUMUUЉEFt&u1ut&WhWjhl0h5W @ut6URURp4VW0e( uʋEe[^_ÍvU WVSu} ;5Uu*UhUE&Wu^* 􍃤Pjh0jP8 u5k_ЍPh"CPL\uEP7PV5Wۮ=WtW5W_Wu5k_jjP[&7PVh dWEt jPve[^_ÉU,WVS]u UBMMQ}WMQ I$QRUR@Ѓ Mu5G9u ;]v]u]C;E( uE$9Ev U$M(UMu}EU) ] 9u9vUE ME R]C S$) U EMEE}tEEÉMA Q$Ɖ9uWV]SÃC.u5E C(u# fuj@S!tc(K(C( uv fC(jjS~"}u EE UM]E߃}uE9$J9uAE92#E}Ee[^_ÍvUWVS} EU M1}tW][]{ t/M$](SQRP]SWEPVURMA ЉƋ]30 >EEt&E}tUBMQ]3VR@EPU2VMQ<&Ãtu>}E8hURVWMQE8hURVWMQ }u=t91҃uUG.t GP !t&RG W$ Pw"WuF}u,tUHPE@t&M1EP$t'>U}uM1EP$؍e[^_ÍvU WVS}1E;0] ;M }uEA.tt7A@ +t&tjA Q$ Pq9V@(t PB( tBB.t&$fB(3zpSKt&B@jR@$Ѓ1$fB(t%j j3<j@j3.H( FE;0e[^_ÉUMAX|AWЋBABJhWUWVSEP8 U%?)ĉeUB0tB4EuEEUr01;}}(1ۃ؋UBHP|UG;}|ڃEPUrH1;}}a]u}t H( C@(@u t1} t+j j3j@j3H(`( G;}|EPURtUB0tB\t P}EPh +VQe[^_ÐUE$w1$x01+ÐUVS1ۃj@ơWЃ9k_uh 0Au7hWhWSuhhWVe[^ÐUVS Wк)‰Wи9sУWк9v‰WС W@9}WЋ WЉVUUU)‰ W9A WЋ WЉ)‰(W[^ÍvUSk_УWЃjW:hWjh@0hhW! WЃjWЃ9t W WкVUUU)‰$WС W9@$WС W9W| $W9W} W9W =WRhW=vU WVSvj@ǻWЃ=Wu#hWjhI0hhW5 5WЅt W[WWЉE?F0t F8 )WЋ^j@aǃVFXЃWeރuE; W%ǃhW5W hW vUWVSDžlDž`DždDž|DžXE1ۅWЋpj StSu WЃXK.ȃuSu {fu K0fK.C(uW#hC(tWWC(t;C.0tPWЃS#SWЃG5WС W9S.0tHW9PWuXS9LWuMt&Cx tjCp C@ C. tC S$ PsYC.0\K(jjSFWЃ\Gt  t:jw G !t&C S$ PhRSY`uADž|j|P`uc(oDždEdt `ЉG -`dPC S$ PhRMdt&Dž\\tPtd;|dxEt`|9}*)PPrUtDžx1WЃjj1RPhxPtPS1\uhPƃ0\t Dž`u=xWWЅtC.  DžpC(t S C(€fS( tWt5GW%JSpS@zhBpRS@$Ѓ\pt#t Slj jS-j jS~j@jSqK( Džppt@.u Uppu `tdDžh15WЃPWЋ W9} X Džl`l8[^_ÍvU WVSWXWЃPa; W} W v1WWt=DWthhW4u6hpW u"Wu=DWthhWW)؉áWЋ=$W)1 WЋ W9}LW;HWu9PW}u)΋`WEC(C.u{u K0 fC.C(~lC.t+Cx t"jCp C@ c(NC. t5jC S$ PsItjPc(N~SS5WO]t1)e[^_UPhPh0C%h 0>u6PhSR$8v1ɉEEDMEEEEPBUȉDž[&tAy8tDž&B|@ 9Tdvjj\jIƃjQ\à tPVSnDžj\VKvjRÃjj\hDIÃjj\j4IƉߋ3C@ x8uB|@ y8uUB0dQVSjj\H jP"th(0SEPjRdy8ucj\8Jj\S-J fjPwÃuDž@Cu Dž(SURu Dž􋍰Q'TEPjjhW=[^_ÐU|WVSE @0;=\UtURB0jW߻ÃSG8uuEP‹B0EPWuà EU ƃGTPEPGTHPwTBЉÃGT@PU LǂP9u*҉)ЋxSЅtVЉƃu E p  E8uNE t&E 9588h90j ] 4Sjjjj\EHPjSWU 00}t"jURjPt hD0;=\UT-VЋPTHB B  9~ h`0jSEPU 0Xth0pt&)ރSh0tVh0f G@V 7EPU RE U B$ B5HW1 v;=\UtEP‹B0jW؍x[^_UVSu] c(,PREu(,PR8tK @x8u_@+Q@;\UtVF0jR 6)HWЃj@ u h0j,(5U0j\SE1e[^ÍvUu h9hujhKÐUu h9jujhbKU WVSUBT  ÃPǃu@E@4UB0B0j@EEPUR+(  @@8tWtPh80t&j@ZE@EPYeUZTEPKUR胿SEPW e[^_ÉU,WVSj@ÃjhWHESE@@@ U MHBFEC@S<)‰)G@N C4tF{\t S`ShW;~tG0G0FG4Fu.~ u( @u FuVhWW EPe[^_ÐU WVS=DWD5UЅt&^~9CE ;EPjjjjR0p 0p0T0ND9u HF HHH9tWDDDFH9Nu^ FD^U LWЋ(EJDF몐t&D9v E8~} t 1e[^_Uu{…t E $ÉU WVS]} tASKjW+(S0P tWh0{) )=LWЍe[^_ÍvUEPuuu RUM TWЃu2 PWкEuRjQEPt tPWÐUWVSE UUmueUmeƉ  E4}u PEPuEtNj@E1}uW9k_Ph +V@ÃUR u ieMEC0C,UC!CeUSHsTCpj@EC\5US]EPxE C]US]Ct$CKHjjjjjSKSjh0hCP̕ {uڋK{t $C4t h 0ztS(tC,B,S,C(C t S]ÉU WVSu} ^VtVECtQ{t h`0{u8tS(t C,B,t&S,C(C t S}C1e[^_ÐU|WVSEEEEEt Ere eEUeeEEUBƉEU+E U EUӋE9 u9wEUUBx }tDZt&}u!C$9EuU ;S w9E u E;C vc([ufE UEUU9U9EuKU9UvCEURPURÃtc(EUE9Ẻ9UuE9Ew}tUZE UEURPUR躯ÃEE"}t:}ukC$9Eu U ;S 9ELE;C w>EUu(U9U9EU9UEtC(t1C(tcEuXEOt6UtC.t SC(tj@Stc(C( fC(f҃}tCE1U9U9Eu"U9UvEURPURjEEt'C,S_S~UC(t fC(S&SzK(jjS C*fEUUEEURPE URPE PEPEPSURǃ0uM븃uwE uq}t+Ef9C*u[]URUE9E9UE9EEURPUR)EE~t&9U}EU9agރ}t(Ef9C*uSUGE@E6t&U9U9Eu"U9UvEURPUR葬EuE9F`F(t VqF(€fV( t jVVFfV(Euj@jV;EtC,utVV7]EtZuF(tM fF(Et,C S$RPsh0)h0E VVEUB9Ew]}t#t&U9U9Eu U9U}tU)UJRjh0hЃP藎 t&Exu΋UBtЃPE`Ex[^_UVS]E UMuQS$A9u9C w h 0QVC S$%N9u 9vVe[^ÍvUjuuu u ÉUWVSE UM(@EE1É֋E;8}cUP(!t'fP(URjhM0hP觌 fP(ME<VSUREujjjjVSMQ萷E uhA0멋E<uujjjEPURE t3E@(t P蕏E`(uE@&E`(j@juvEMGE;81e[^_ÍvULWVSE4EЋU p x$My}7}twEHPjhU0hEPG Uz|ˋMA$9u9q w }ۃSEPU REԃu}u MA}uSEPU REԃMԉM؋] ]̉؃MI$M9 uM;A v EP )U̍E؋M̉HEEu}EEEMk_ЉE1UB@uPh Rƃ}uk_Ћ@0jEPMQ辛k_Ћ@0jEPEPƃUB@u5k_jRdu5E+E}t u9s}u)SjEPMQEPؾUBHJz}uЃPt1e[^_ÍvUS]SЃtPS{uBC@C5k_jS蓟S"5k_hS貗v1]ÐU WVS}] uGt)G$9u9_ vjG W$RPVSW_ w$e[^_ÍvUVSu5k_jjhW(U,U(UЋ UЅt@t9sTu0Cu*{uC@t&C(UЉC0uC0,UЉ(UЋ[(u(UЅtQj1jjjjS {u CtS(tC,B,S,C(cS[0u5k_jjhWe[^ÐUU }u)8С8ЉBBh jh`0PÉUÐUSE] Mtu h0t~u$<u ]ÐUEU Mtu h0t~*u%$<ut $<u1 t&ÐUS] Etuh0bffEEPEPu Eff ‰]ÐUSE ]tuh@0ffEffEEEPEPuu1-E8Et Eff ‰]ÐU,WVSuM ~@FEk_ЉEfEEW%E=5Wf~>um~,ug~0ua~4u[~8uUuG @ tuE>Yy u'{t /VjVSCEPsIt 5CCfECu{ u {tQ{uGtOEFu{ u {u{t0fCCSOt t 1f}teEf=jEP:EPEPEPjhWЋEP t@@@Eu0ICF,C F0CF4CF8f}uEPVF,P"tEfF>Vc1e[^_ÐU,WVSE @@EU RUfEUEEPu@ @ tuEM Aht77fEj tTju9t fEX5vUfUE"]Et&7 7fMf;]}uf]NU)1)E)NjUft&O}t1RMf f9wf;EsEfU2fMA @PP^uEPPE ,PjhWЋUR zt&}uf]Mu)1})NjUfO}1t&MBff@f9rf;EvMfE0fUB @PMPuEPPE ,PjhWЋUR0 iM fq>Q1e[^_ÍvUP{,u{0u {4u{8tEPFPFPs0t 0{,u>{0u8{4u2{8u,f{>ujSC,GC0GC4G C8FCF C FC$FC(FfCu[}u}u }u}tjEPF,Pu*f}t Mf9NfCF,CF0C F4CF8Cj,VSA1e[^ÉUVSuE @ XjSCF7Ћu 0t&B+H tvzu Bf=tۋIuÐU WVSU1] t )ЃvZU9s:uGE9]sE8t19]s_M€tF u9]sDIi wGi s*%i t"(Mi trTi wOi rU1҅txzurBf=uMfz tMA@ff9B tv]C@ffB Jt]C@9uBBPEPÃ1ہ"i wF!i i twixt\ i ti ri t7Ii tXw %i tNQi tARi tIt&t0Ufzt/&uduT1ttMQtUЋU9Q tUЋU9%i w:i wixP!i tc"i tqRi w"Ii Qi t&Si tTi &}s(E@D}s`w&}s|Z]CI}h}W+U0(v}ih}W]pDUBBBBt#)9s ыEHUruu)9s щNR~HMAAQAtUЉ ǃtUЉǃE@dl&SURMQEP]SÃj`E8PsUUjMP4QE <H}uUBPEȋBTE̋BXEЋB\E14 !L@~UMAd$ˆUApE؋AtE܃8P:<uD} t8E@DtU B-<tt / vM AH<w }uu t,U BHDHPЃPPÃ!ˍ&jEPÃM䉍ϋu ,E@DtE}u?}u9E$jjPVt*=@St(E0PPh0j Ub}`U BhMBlE PpM AtMtUЉ EǀMtUЉEǀRE PMQEP, ]U BdMBdtǁUЉEu BUR7t MEfxDjEPEEfEUB@ffEEEM A$EE P]SRƒuI=@S E PSPh0jPoyMBtJHvEBjUREE0С0ЉEBEBEB Ej]SEE0С0ЉEЋBEԋBE؋B E܃ MA@ffE҃jSLwt+uЋx tP8JP81umj@PS9EȉTE(X\hEjSj} P x P8~JP8EQ]SEP:ƒMBt JHEJEȉP5`UhUЋUR= QSEPƒuH=@Stm E PSPh0j ?PwMBt JHEJE@Do0С0ЉEЋBEԋBE؋B E܃jRNut-uЋx tP8\JP81upj@S9E(U(Dž@jSj{ Pv P8~JP8 P]SMQ?ƒu>=@S E PS Ph0j$ MBtJHt&EBtSURNt@M Ad u7jEP'tURMQ EP [^_ÉUVS]s SCtG{`tAjjS蕀t)PF PC0PPh 0j cS(QtABQAQ# uԃVSe[^ÐU WVS]u jP諛ǃSt CB vCFSCދ5W9u5W;t9u샻th0t VP@tIu&Vh0j%V7t&H\dž#3F tHF WϚe[^_ÍvUVSuV t#Zxu R څuVe[^ÍvU<WVS}t}u h0薻} it%w} it"} if}4u$ut<u t<t G=w} i1w} it} i1f}FjEP ƃ@G@wGxxxt mjxuVjVWGPEPGPt CEC Et.PEPPct CEċC EEPEPm }EPEPVhix&jxSf}uwS jXV_ Sx!X|!\E!`E!djSVz1DžL&} iu Dž0hS jXPG PHDž Ep `vjhSPx!h|!lE!pE!tjXPS tvtxuuu 16} iuwF(PGPF(PE@DtF`PPF`PnhP8jPGG1t&jxSjSWF(PPF(PE@DtF`P PF`Pt&j P F|P PF|PDEPEPShi EP-[^_ÍvUWVS] uEEhƕEUB tt zuE@u{(}1Ut$Sh i RЉEtMQv~EPhUBPC$jP6 =u!{aujjSmyEu4K}tC!ЃSMfyD} QS2Ee[^_ÍvU WVSMQ r vt txutqv;CP uPm JP F st XCu5U6t 9Vuu h@0htQ;CP uP;m JP CF t F X^ F Cue[^_ÐUVS]E UЅtYv9AuKQ t9t&2ZC t PvBuA  u[^ÉUVSuUЅt 9stKujj6j6ÃjSYC sUЉtUЉXUCUЍe[^USEUЅtJt&9Cu; PC utCBSj6S u]ÐU<WVS}j0OEU B @t tzu1t$6t)jWFPVutF &jj6j,ƃuP֑U71FGF GFG FE FF X [t txuu*j6VRkE11,^C t pt&VjPTƅƅGGG U uE+SiQRh1i U RЋUE8tEtFBVj6VC tHC RV1#VKP1[^_U,WVSuj0NjF PV VtFBVFtP uPhJP jPƅƅFF FFFSh2i PЃj6VW@[^_ÐUVSujj6j /Ãu7)Vuu {tj6S11e[^US]t Pj6S1]ÉUEM P Rt!txu@f=uu؉ÉUVSEu X [t$txujPVuuՉ؍e[^ÐUWVS]1S@SЍ@@U1uf;uuvpf;u(uf{uu:A:AKt&0<SЊA$ACAC$A:AFmASЍ@@U[^_US]jW?}F)19} 8@9|tD :e[^_U,WVSE P[EEEE}uh0կ1D=2VЅU RWÃE PUR 9cw X&Ex3PE }U+Uy +EM+Myڃt= SEEtteE+Et1u 9}tRv~ ~@} 2l|&U RPE+E|A9}utJjGPGG$ GGu#4Gu!jh SЍG Pzu v1e[^_ÉU WVS}] uVWPu!=@S$G Ph@0vt0VSu=@SC PG Ph02VЅt@9t3VSu"Ft=@SC PG Ph0E[uƒVS8tG Ph@0蔧k=@St`G Ph0j =@StAFPFPF PF PF PF PF PFPG Ph0j£1e[^_ÉUWVS}jx]Sjw VS踵EE fEG@ffEEGDu1EPu W:t(=@SVh0jrEEEE0ЉEء0ЉEܡ0ЉE0ЉEEEM jSW9t&/t=@StPVh0j貢jWƃW tGDu$ j`(S(jEPHEE؉PE܉TEXE䉅\4u1 &0!<@~쀍tDž`DždSujjS8u1[^_ÍvUWVSjxuVj} WV贳EE0С0ЉE؋BE܋BEB EEE0Ћ0Љ]HMPUċ@ EEE]MUEEEM jVEP`t =@StPWh@0jޠ1h[^_UWVSM ]}t2t.ʊt<.t~Btt <.t)9|)ȃ?v&(ȈWPQXV育W0XtB<w A9ujX]SgSjWPS0WPVSS]SjW"G fGE@@ffG GjGPS18[^_ÍvU$S]CH=5t<=5=|.jC Ph0訿uC']Ct?97v 7Ѓ<uEV4=Dž>uK1}t]ufu2VЅt'VPDžWE1^t&tPA tIjjPÃyVs<Dž{@[PK<}];tBjV؃ PetP8~JP8t&EUtx<ugj]S'CE@CFC FCF CUBC>ujSI]EPpIUtV@@p Džu]x@u EAG0&U11e[^_ÐUEU t }uS @@ÍvU WVSuU }EBB FBFBF Z}t EЀf=tftVt#PtJt7Ћ MBfRt%>u ttE@@f,vt)97v 7ЋuEffF}tEU1[^_ÉUSMU ]ABA BAB AAЀf=t fuBA fЅt397v7Ѓ<t tC@9t t&fA Q1[ÉUMЀf=t fufAÐUWVSEEE CU9B sOEPjSR"=ƒt MA9B sh0=r 1Eu,#&ދEp捶Ur_F<EU9B s׍EPWSR<ƒt"M9B s h0趐r v1E^~qt&;t ~ C9~P)WT)W[tt*C؋U+BPRS'Yt+)ÅUE &EP*e[^_ÐUWУWУWULWVSEEU :E@EWUЋE9P s[EPjWUR[;ƒt"MA9B s h0vJMEE}u,&EE䍶P_FREUСUЅtN@4tjEPhUt"UЋP8~JP8&U=Uu0jSCUBCBC B CB$ChU,DUЅt @@t@ E؋UBfu;WjjEP }U؋t&UBtGf)t:jjjEP }U؋vX)W\)W}tU؋@xP|hPl=Uu UPIl SЅ| 9,W5Wv8WtHFU9BujFPEP>u΃jF(PEP"uESЅ| 9(Wa(WЃjjjHƃ@jHVhWVv vUBFFFxUBFB FBF BF$BF(BF,B F0B$F4F@FD UBfE̅uEЃЉF@FUBfE܋EЃ)E܋F@|&EE=~EEЃPjjEPy EE=~EЃPjjURS r}~9GEGF@G=~jWUȋ_W?jWEȋPFBFB F BF$BF(BF,BF0B F4B$ SjjUR}9ujjj$Ãxj$S UBfCBCBCEPfS ẺCU܉SEЉCUS}t Uff$E׋Nff$}u tX<t0}uuE~9tC9Gt&9t9G~W 9t BB+C9t CC+G~jS ow S,WFDEFEĉǃ9tU9WsG‰U9uG fx VUċRUӋEċxPI9tKWUW-;t;uGw3)jWa} 9uEċxjPCURUEffBFBFB F BF$BF(BF,BF0B F4B$FEU;z s$WEPEPUBB cjWEPE.Ãu0VFD),WЃjV (WЃ t&jS(SURh( WEP(UUV"FD),WЃjV2 (WЃE@t1]t C uUB)W)W}tU؋UEE 8hYfUP^fEa}tU؋`)Wd)WEPd!heUPee[^_U WVSu^9t{CES{uEWFBFB F BF$BF(BF,BF0B F4B$jjjW> t&W jS]9uVFD),WЃjV (WЍe[^_ÍvUMU Q BABH JÍvUEH PQP@ B ÉUMU Q~  U D9G sEPSEPWpƒt'M܍ 9B s h@0jJM&E1}v vSUR VI1}t}t#TSeTSU}t }tgUv}t }tDE<I&EPEPWUR8Eȃ=~EfEE<EăGPj;ƃuW}G%VfFGFGFGFG F FWVV$V}v%}ejV`FMEȉF Fj(vwVUӃ(jSEP E΃t. ttKCfCCfCEjE8PEP蘃vCFfC@8UR5`UhUz8uu@ F]CF 8F8Ftt#9v8uV0V$F8)F8)1RuSEP:8F FWWt V1e[^_ÍvUWVS}t] Cjjƃ vjVFt,^ FU E PF@PUR<t&F ^Ftt9v8uF0V$ЉEE]} ut1MU  9s9.uGAEE 9rEEM;]U  91MEE E9sGEU9Us Ut<.uD;EG>CB<v B<T9B<vYB<vRB< EB<vB<v B< v-u|B<w]CPw UA t&ACOM;Ms9.uA;]s ;MU;Es(JU~CEM+^^ t V[1e[^_ÐUWVSu}E9E uPWV*%u}} #}E | E|M M1;E ;EvuE)EE@;E +]C;E??u E H9EtxuEH9tltvtr8unZE;E ^+E;ERRGPFP-~u:߉+E;E }+E;E>+u;u u+};}u &1e[^_ÉUWVSEUEEEx}eu#xuu1U E0E52VЅE^ x}u#jC0PEPB}uEC0P蘴t$t Gt&@t&t4t$ tt@tE[\}%EEv/Ee[^_ÍvU,WVSuu52VEEE} E@E}h_1^ Dx-t}u}u v}C0EPct/ tvt+Et&Et&E t E@}uE-U9~U)ffUEjWEPZ|jWEPH|C0 f=ufGEE[}u v}u}tuEvE HEe[^_ÉULWVSEE؋@E1EE U9B s^EPjM QR> t%UB9A s h@0Y`QUt&EE}u&EE E㐍t&jUUREEMqEԃEPURTWЃ TWCi|{r:r{,u{0u {4u{8t jEԃPC,Py:{u{ u {$u{(tjMQCPVyt(EЊEăUąjhʚ;jMQƃGh? tVEPEPWr(U RVRuVMQG@LP"8 u#VE܅tMP?t&G@LPw@4W@tjG@w@ЃEߋ[TWkGh? tEPUREPW'M QEPu܋UREPG@LPV7 u'MQE܅tkP`G@LPw@4W@t9jG@w@t&EPt)W)We[^_ÐUWVS}E Dž`Džh'w1=@Sfhh`0j(Ph0j] B(vgX؍uVj(jWBSW`  /wj0Wǃ j(wVw6P& /wj0WǃG؉\wF:V(dF(XRTFEFEF EF$EFFF FFF FF$jEԉPPEEFE܋FEF EF$Ew^SPR| jjPPSlj]S規EEEEEEċEEȋEẼwULRS$jjSLP5WЃ t&t6jC0PLR-uuuыL`vEf=uG@t U``j pS׎lPjSjjPPz`0ptP8JP8&`u7=@SlEPPh0j[`FBF BFB F$ `F:Gt@@SЈFdf@\Rj(j:W觾dfBfghPjjjjW?Ot+h@h@XH=$@0Љht@Tqhc@Gh9@h@t&h@h@h@ehQ@5h!@h@ h@h@xhtn@UhtE@,ht"@ W8[^_ÉUutÍvUVSu] uPS PVPhd1hh U8[ UЍe[^UWVSU E@MYCf DžDžCEC ECECE[=S=@S 9A sZPVRQdƒt"9B s h@0|Uz 1Eu`WdWExߋGEG EGEGEGEЋGEԋG E؋G$E܋Ef=uB@ffEEЀf=uA@ffEҋEf=t'=@S6EPVPh1Cv{t:=@S CPEP$Ph1j(U&j]SbEEjEPEЉPbojS ÃC0txt-=@SEPREPePh1apjVMQm=@St>EPPRPV8Ph`1Ѝ&j5T C8HC8=@SEPQEPPh1S_ C8~HC8t&}u/=@SyEPPR_Ph1{Ef=؃jQEPluKuG=@SRQPPh@1Ѝ&jS  ؃]SVG(PZuSv }F=@S{RQPxPh1jR I&EtP@t~AI $;tg=@S PRQPPBIPQPh1jR04PhPRQP6 Dž5tSxSЃ|9cjpW̄jTV軄j8S誄ƅ9ƅUƅqƅ8ƅTƅpj\PRkjxPQpkj@PPXkPSjjVWN t%5tShH PI jS߃ƅƅj$PEPjSj5UR&S (W$(WMQz[^_ÍvU t (7Ct uj Pdv*t\SQuGu<&jjDËEC j sd*e[^_ÐU5PSh`Sh UUVSujVÃtuC4uGEPjjs0Vj} uIUCLBLCPBPCTBTCXBXS]5hSh Su S1e[^ÍvUUu h@1jHJ4ȃujQrr0r j BLuBPÉUUu h1HJ4ȃujQrr0r jÐU WVS]MUu} t o}uhh@WRQSH||VRQSP*~ *t&VRQSE P}WhSWe[^_ÐUWVSEEu1E 1҉EUE tzUt0EӋEËEËE1RPSQ%aEUEUEUӉËE1RPSQ`Ɖ׋E EuEe[^_ÐUWVSu蟺1vV4蒺¿!+!‰V8t‰+!‰V<`¿ +! FDv?+!$PvF@^D=1ЉR9uKˉR9tND^8EV EF}t*ȉ1uFU<tA1ѿuvQv 7FHF,UFFL~0u I1F0e[^_ÍvUWVS]C9C,s U;CL~ S5ƃC,;Cr Sm190C@ES4{D}CENU}1uIuNS4K,sC4C e=Su7)W)WE@@@8P<+CfE{EPEPEPEP EXf{uk}ue)W)W@t0@8P<E@t@P jjjuj@(Nt&x )wEPjj(uƒt!MA9B s h1t&)W)WBxtBuSjjRRw]ÐU,WVS}uGhtj)jjFPU tE Gjtnj]SFPAQUu E$1RQS650RQS:%)~ -t&uRQSVWhS[e[^_ÐUWVSEpE@u*~t$~~ ~~uz)W)WS0SЋU9UУ0SЃUB PFPFPcPFPSPh`1jW0 IvF<w)jjjEPt&PTȈFjMQ9~PjEPEE6WЃ} uy6WЅt@4u&P8~JP86Wh6W=6W)W)W}jjjnt&PB=6Wtjh 6WЍFPH6WЅtP8~JP8t&6WjEPhbUBFBFB F BF$Bh6W =6Wu=)W)W}tjjjMQ肫EPC6WЃVURMqǃEPs< 9)W)W)W)WCtx [vp< 'tx wp-]ÉUhS9E t 6jjA‹E}ktR- RÐUEU =ku$t=juPuRR t&ÐU WVSuj0EF3F 3F3F3F$3F(3F,3F0%`OW1NWNW t=jFPCPBu݃jF$PC$PBuău߅uNWNWEPu&G\W`F8V&E@$P(EÉEX4p8uEPEPEP!E\fGf;=tS1e[^_ÐUWVSE xj0Ejhʚ;jEP趫ƃ t+Ft t 9v8u~ 'wj(VGƃuURmt&NExu9}UBEEjEPjh@UjV;EPk"G t&@t tzu1ۅt*tfjEPCP`)uޅtFDUEUUBLUЋBPUЋB TUЋB$XUЃhDUЋEPW#Bt;GLrB@t;GLrGL9Fv=wDDUEUUBLUЋBPUЋB TUЋB$XUjhDUVW V蔨EPDe[^_U WVS} EpUUjjÃ(VCC (jhʚ;jUR袩uSCtt49[8u/C$K)t C t&C)غ)9~RSÃt(sSЋMASЋA BABAB SB7Wiǧ7fBNWNWhSS5hS|1@OWDOW7e[^_ÐUWVSEUE 0`UdUщËy)ǃ'hUlUQ٦8t&ZY/~039B sEPSVRfƒt$M 9B shm1 t&Z 1EuhUlU$< txU|Uu6uPVjguptpUtUuT$<5UUvSf;tSsfuu赥KCff@//hUlUUUuhvSA$<`t$UUu;;ztUUusjF0Pju{Ãu uMFPu^jhSuvSЍR)47W!] uE PEPDe[^_ÐUWVS} EEEE1jỦ|RG>Wt'BPREP E_ Wt'BPREP E1 Wt)BPREP\ E Wt)7&bh&Bh$ Bh{t&Bh$ Bhkt&E^&JhQJhKt&JhAJj;t&Jj1Jj+t&Jj!Jjt&JkJk t&E*VԏvO;W$D 1Ѓt$jhʚ;jUOjjU@ ,vu EG&$4 1Ћ{ZhqZhjt&Zh^ZjXZhNZhFZh>Zh6Zh.=0"Bht ZhjjKƋE0F F_EPWaEAE8F F&E*t&Eu t VCEe[^_U WVSM 1yE1tB })t}u t R}u{}t.}uhucBuYA fx:utVHLA fx:tjj/‹EB B&*}u t R]e[^_ÍvU WVS} E5k_EttPjj{j@7ÃEt uj{S9tDWی9tjVRuEEPSW~ƃu E1W蓌j{Sh9e[^_ÉUuSE؋ÜB{ jEPs }EԋÜB{ {?u5u/u) u#jVPtE Rt&?W977Ћutf=u52VbEu]jS8%ECCGC GCG CV謦 EpKuՃj5S4]ÐU,WVS} }t!tj@W!GE8t9O&>. wNjUz Mqt;Q w~)F$ 1Ѓ uV WztF f=u BffBOQ;7\t7Ѓ<I9uyuyu y Nj]S EEWEBEBEB ESu_ƒ t'_Kt B @@9uu ;1jGPF PG@=x}fF 9WF G } CF G 2YF G<@9tDV WB9zzu *)$UB$J )ȉB 1e[^_USjhʚ;ju ԆtoAuy 'wj(QptOYSЀf=t fufC SЀf=t fufCjuQuL]ÍvUVS]s{ (vjjdƒuS覄7aC%VfBCBCBCBC B cCBC ؃C(C (j(sVeE 1e[^ÍvUEu1C1ɋBt @ Bt@LBt@LBà tWKtPf~uI} tCUЋu79vU)Q 4SRVEP躱Zf~ut&wFHUBF@fBJjjj=WiHC=Pi w!=Mi :=Oi >=Ji(t=Kih(Wj05E5`TWЃ ZEGEȍ_(FCF CFCFCCf=ufCURPh1j FCFfCFM̉D9$F @@fM̃EE6} qhWj0eESЃ bE}Ѝw"CFCFCFC FCLFCXFC8UԉD:$C}u8f}u}u}u}t=@Sh1}u=@Sah 1UЉЀf=t futB@ffE҃]SWAPSU }$=@Syh`1jbEtHp@l~u?~ u9~u3~u-pt$=@Sh1j蠺}`EЉXPtR ƃj|Sƅ|ƅ}EЉEEԉEE؉EE܉EjSDoà tVC5@t@C0xu7jtQ_ ƃtDžhC0\Dždt S@p!BEB EċBEȋBE̋ǃÃptbtBI $;ltK=@SBlPBIPXQ% Ph1j' vjETPEPT u!TRPh 1jAt<}6},}"}Vv}uz}ut}un}uh0С0ЉEBEBEB EtA@ffE\P`R1uhudt PhjhlQpPTRtQa\P`R1uhuƒ@dt€RXQTPtR MQP=@StfEP^PhH1je =@StAEP9Ph^1j@ =@StEPPht1j (W(WEPRP8[^_ÍvUWVSu j EEP$U:$UBI $X@jj`E(VЁv*jPaUBuRNE}E@t>uUJEEEEEUB @B@(VЋRЉEUBU$ `B:BjEP0j}W"EEEE tEЋFEԋFE؋F E2fEUB@ffEEEUB EEEЋUBEԉBE؉B E܉B$}}tUB tP1ۃx (vZ1ۅt5SEPt!ECECEC Et&jEPWQEPjURjjWƒ0u4=@SuEPPh1j葴EBEBEB Et&jEPEUBEB EBEB׃(B(GGUGBG BGB GWЀf=t fufG }udEP EtNUZIw EXX SUSVG^UBIPGPEP EfUfBfGEPj(j:URxfGjEP}PEPjEP0}t8U@@&WWEtJP8~JP80u5=@SuEPPh`1jUAEAEA EEPEUB EBEB׃(B(GUGBG BGB GWЀf=t fufG }}uEPE&t&UzuUBIU8Bu BDE}tX}tREXIw UZZ CESVIG^UBIPGPEPG eߋEfUfBEGfGURj(j:EP fGjEPjURjEPS0}t1U@@WWEtSP8~ JP8EP_4t&P_Et P8~JP8EP1Bh[^_ÉUEPH5t5t. t',t&#t tGt u1ÐUUHUЅtt&9Ptu1ÐUVS]u shE!Ѓ S:_VSL_e[^ÐUE P_ÐU WVSu} =SuHULUHUSu4F 1ЅtP RF0PPh1j褧vu =Su$F u h1踦@DpV\jj|j8`Ãu7F 1ЅtP RF0PPh@1jj8SEjC P7 LUЉCLUЃ=@St%F0PPF Pht1j衦 sF SЉC CCCCuBVSF @H u7кMb)RSAv?u15u7{‹ u7 u71RSe[^_ÉUVSu=St_VGÃtMStCBCLUЋSj|SF u V\HF e[^ÉU WVSuj0Jǃu h1vVÃuh1`t&t'F 1ЅtP RF0PPh 1*u9F 1ЅtP RF0PPh`1j蹤5t&S9C~6=@StF Ph1j胤t&C 9C}HVSF @H u7кMb)RS v{{t@tV}V4[o=@St#F0PPF Ph1j蹣 t t&CBCLUЋSj|SF tHF W胁e[^_ÍvU WVS}Wƃu"h 1j;WqZvvv_0SPG Ph`1j$ VSPG Ph1jâ,G Ph1j譢tFBFLUЋVj|VG >HG t&e[^_USME X ASDt@tAjj0PjS=]U WVS]u h@1[s01S}=St+=@StGC PVPh`1jȡ%txut SBt@e[^_ÐUS]uh1͠St@S]ÐU\WVS}uGE_CES UKMMKMMEE=S=S{tT=@SE PCPPCPPCPh1j4t&E Gcuu}u }BE 9G s֍EPVE PWwKƒt%Mč9B sh1蒟B11u`WdW]SVPnS- }*=@Sh 1jڟE̅tPU@E}tSMAI $;EtB=@StiEPAIPEPfPh`1jvg 6jhEPUREPMQ W8v(W(WWi8e[^_ÐUWVSU }E@8@4MI0AEA EAEAE=S4Cvyt\=@Sq8 PȃP\P0PFP0BPh1jvEf=tD=@S EPPh1j MqV]9C s卅 99tt VWEP5pe[^_ÐU1ÐUWVSuj0oEv FP0à f~uScdSNJFCFfCFCV 9uEPotCBCdTWЋS]hUR0f~u MQjj|j(bEu}W8o1t&j(EPbE `TWt4EPƃS 9~܋CUBCS!MdTWЉAdTWЉ dTWЉ}WnEe[^_UEU @Tt9PuÍvUVSujj|j gÃt.j SE CFTtX^TTs\e[^ÐUMt ABvQj|Q:UVSuS[t*9uCX8FXuFXPCPFPtω؍e[^ÍvU WVS]jj|j`Eu j`EPEމ}tUEMATAXP΃(V1}!T@~j0lƒSЉGt SЃxM SASЃRl}GLtGWNt7=@St.P PCXPCPgPh`1jk } tE PUR1e[^_U WVSuF8F<FPtLVt<=@St3P PFXPFPPh1j t&~\]j0kǃVtFBVFFTtj|P؅uWkj|V e[^_ÐU=@St5P PE PCXPVPh`"1j貃 v[uCv=@St7EPE PGXPEP`Ph"1jd t&EątP8BP8u9Ee[^_UWVSEtUZXSxlQjtWWp u1jpP轰ƒ9t0=@Stу)PSt Ph #1j葂뭍vjxEhP̵jt dRhQ苔 EEj]`SEP訜xT}!TTE|#uuU\}!\\EEX}!XX}Ӌp#_0 T]#O4 Ήu#W8 \U#G< XEEEjEPlPUB8EB@"E@E@E@ E@Ety@`EtY@@Et9@ Et@EXW\W.TWTWP*4t V E9EuUztBt P8~JP8}t EPg Eh[^_ÐUVSM] UEu)t:i e}tO^lYk|Tu"6SPbHÃt#P uVSP9IIVjj)SQ}8VPRSQ~y)VPj:SQJ(ut P e[^U,WVSU EpEx u uURMQEPUR荡$<&1Ѕth&1r&u E j0PÃ5ubURPWkED&Myuy uy$uy(u E9},EEUZfB(f^}w EffFfFfFU ZMAl$$ `CAH1҅tPWEVu WEVt}uGE'1>fwV-tE'1&}eE\]C(UBHl9v}t>MQ] SEPj'EvE'1 t&}UBXE3E(1ЋMA0E} E];C,UB0MA,Y<)É؋U ]KTEP(v ʉKT1Ɖ1UJTMA(]CU WVSu ]pǃjjjjKSVWExDe[^_ÐUE@D%PÐUSVWl$|$11 * 9u] m9r)߃!$XSv[fVvfVv[vv[ !؍4$hSЍ VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV)y$SvfVfVfvfff_^[]WhSUd$ꐐUVSEu F^NV [^ÍvUWVS5bWЋV1jVS8Gv߃h@5V6hq7h)1WU jh)1hk_7s hr7Уl_Сlr7Уl_Ѓhk_NHYW PRh)1Tjƃj%P5P8轾Ãu h)1PSZ)؃9t h@)1P]Sjjjh@SuV5P8覹@SЃ,jjjhSV5P8膹DSЃW PRhb)14T,SP P5(Sh)1T Yr7t lUe[^_ÍvUSUЉk_Cd1ҍBvƃ,ddWC` CtCUЍSUЃSUUC`Ћ]US]=,SuB HYWЁgfff 0SкQ)‰,SЃ=(Su,SУ(SЃ (S=(Sжv (Sж(SЉ9,S~,SЉDUЉ)Ѝ[ÉU,WVSj jjjj(SPh U5P8 t h)1HN ,SЉș=(SЉEU~EEEE@E}jjPjhhjh0= u>,S)~h9vjjWjhhj P= tʅ~4jjEPjh5bWj Sb= t h*1jM}tEPD@}EU;(S}dEu5 UЋE9E} ]C ] t#jw4V3?u݁EEU;(S|e[^_Ul_u%l_ "uh^M1PÐUVSE t@~ tCt&օ} or7@%or7п}Ɓv 1DtuhpM1"Pt0u 2 @0bWhtM1O@thyM1Oh~M1Oe[^ÍvUSMl_w t"#ò€"#"#òÀ"#1"#ò1"#2"#ò2"#3"#3"#<"#ò<ˇ"#"#òÀ"#QhM1N"vi_%l_Qh^M1N]U DÉUE i_u%lr7uh^M1yNUWԟ!ÐU=SuuhM1HNÉU} ulr7t lr7UÍvUmr7t t110ÍvU WVS] }k_ЃWSEPu u<t32 0EPhN1Mdže[^_ÐUuu uMÍvUÍvUE1҃t t6Vt&r7ЃwC$8N1кJ15v K1+'N1$r7ЃCuJ1C| EJ1ЉÉU1}u\N1Ѓ} PN1ÍvULWVSEEE tr7ЃuTdr7Ѝ4*1Ћ,*1Љ]ԋ0*1Љ]MЉM̋8*1ЉM؋<*1Ћ]E+1ЋE܉EU hN1Ht&EmeE1E+1 t&EG}!j M1hr7h u؋EEă}u\EEN1Ѐ=r7tEr7Ѓ~VU؃~EE+1ЋUU܋MǁvEċE܋UċRUԋMċIMu~EEN1ЋlSЉ]~}~E~}u"u}t}u]S?v}uu}uEPj}uu}uj(ƒGUЍMċTuGUăPu+1ЍG]ċ\ ]؋MċDT]E}u5=tr7~,'}N1r7ЃwEȿr7Љ=r7t t9 t 1ۊF9 uA9u=r7uR]SEPhN1j0WJ U}~aMQ]4\Sк+1ЉЋM܀9tN1PЋ]܀;tPЋU܀:tN1PWhN1jxh`YW(J0X&M4\Sк+1ЉЋ]܀;tN1PЋM܀9tPЋ]܀;tN1PWhO1jxh`YWI h`YWЋEPhO1HU0 i_=~\X Mb)gfff))‹]t RQhO1$Qh+O1UPh3O16HMh~M1H]1EPh;O1G1ۿU#K1t&K1и@O1Ѕu+1PhBO1GFOy1ۿpr7#M1t& M1и@O1Ѕu+1PhBO1qGFOyǃh~M1ZGMt]SURMQЃ]؉DYWЋE=dr7u h`O1GUt  "or7tLYW "lr7Щt7t PYWt UW " YWe[^_U VS]1EPhuO1Ѐ}vO1Љe[^UWVS=k_ЋG 0W$ E t9u0It  vs@ F(Dž$E,C0|C,xpEt4C0C8C =k_u k_U|S襞u诳hO1Bh`t#jh@7hO1Bh LSЃ =$Su!jh h LSЃ jh tuh LSЃjj̦ h~M1BhP1Bh@P1AghbP1A UVS 9TЃ҅|;S|QhpP1=)ЋxSЅQЉÃ~s=h@KLLSЍe[^_ÍvU WVS},G E0t jW|4=YWtfdždž&dž'C'C'C 'CC߿ϋE $C4Uz4 vC8C<EC@CD'E@e[^_ÉUVSMu UEf1fAQ]Q E$€ʀQfq[^ÉUEf@ff@@@ÍvUEU MffPfPUWVSu }UEf8fpMAӀQ E$€ʀQE$U ЋMAA[^_ÉUVSjh 5P8SƍhS5S[SSЃjjjjh ЃpS $h5SЍ]SSe[^ÉUWVSr7УUУk_ЃjhlhUjhjhQ1@YWЃjhlhUjjjhQ1UWЃjjjjhjTSЃP}jjjjhjTSЃPP]jjjjhjTSЃP=jjjjhhYWСTSЃPjjjjh jTSЃ PjjjjhjTSЃ(Pjjjjh jTSЃ0Pjjjjhhk_СTSЃXPjjj jhhYWTSЋB YWЋB$YWЋB(YWЋB,YWЋB0ZWЋB4ZWСYWУ`ZWСYWУdZWЃjjjjh 5Sjjjjh СSЃPnjjjjh СSЃPPjjjjh СSЃP2jjjjh СSЃ Pjjjjh СSЃ(Pjjjjh СSЃ0Pjjjjh, СSЃ8Pjjjjhx СSЃ@Pjjjjh СSЃHP~jjjjh СSЃPP`jjjjh СSЃXPBjjjjh СSЃ`P$jjjjh СSЃhPjjjjh СSЃpPjjjjh СSЃxPjjjjh СSЃPjjjjhX СSPjjjjh СSPlE jjjjh СSЋUP? E}~E SЋUPdE}~݃jjjjhСSPj_5TSЍ]SESQh5SS(}r7P5r7Ѓ  ulr7=~ hQ12jP5r75UWthR12t&jj5r75hZWh dWC8 h!R1x2bWHYWEj_ЉExEUzzOwP9)v~=vq=vdjSV5UWtWVh@R15 HYW E쉰 YWЉ $YWЃEEbWЉ9sУbWЃEEx*UlZWЁbW=HYWwhR1Z5[EE;lZW1 YWЋ$YWЋE 9s9v¡bW 9v9sHw/ށvjVRVR 9vjSVSV jSRSR EU;lZWu "؍e[^_ÍvUEU PAÐUEPQ @ÍvUÉU=`Uu`UZUSUWЅtаdhLSЃdhLSЃh5Sch5SЍ]S11҉hhc "UTSÐUEǀǀUWVSE }u]U IMA$R1Ѓu_ldWЅt @i&E\&u URSVWHPEP uMq)at Ep`EjEPSVWt&jhr7SVW&5hr7n5l_fh'TЋUR/h$SЋMQ=dU~5pZW5hpZWЋEPSVW_.5YW5PYW5UW5LYWSVW誽-e[^_ÍvU WVSu }t}t=@YW=UWh S1-v=lUPEPVWd Ã}t=wr7ƋU21^EPuURVÃtB=lUPEPVWtURVh`S1$1hS11؍e[^_ÐUU E}tPuuR! &1ÉU WVSu] M}tt @YWUW hS1,;Zr;J vh T1p,t&EP=lUPujuWQSR Ã0u}uEU$U(1hE(Pu WuaÃtE=lUPWu5UW tWuh`T1/hT1/EU$؍e[^_ÐU WVS}}eE +]S5P8ךƃu yE8tfjEPV=DYWt6 }t =DYWu  "t&>Eu1e[^_ÉUWVS} }u @YWЉE}~}ukUWЉU+r7Ѝ U=vWE8EPVh dW!})SV5P8M hT1K*=lUPURuEP t/URuU1Ѓ}uU1Ph U1.h`U1 .e[^_U WVSE} u}xuc+r7Ѝ U=v[E8EPVh dW })SV5P8bt&hT1_)v}tEUe[^_ÉUuu uEÍvUUEU 1ÉU WVS}4 EPjVlÃt=VS\E {ECEC E$CCCE 1 e[^_Uju nÍvUVS] uCC;3v6EjEPEPuuVuSuu sUBSe[^UWVSu }FF9Gv_E1҉t8t&PEPEPEPjs sVEPN10ttͅu GFE@FЍe[^_ÉUWVS}EE @@_U;vuOME1E;W}at]UMt9vރPEPEPEPURVME4ȋU RMQu1)0EM;O}ttuGM AE@AЍe[^_ÍvU WVSu E;FE;v ZF t.1;]}#UL;NwՋډ!D!9uC;]|݃EPF PEPTAUV1e[^_UE @@ÉUÍvUbW%Pju$u uuuuu uÍvU,WVSEEE@EU9UME <ȉU D9 MMEh8ЅtKt&MW9r;Ws}t)EAMJutU+UWЍ &1MABAQUM D9t0u+;q4u&k_Ћ0,B8+@L+A4 [^ÐU WVS];1uc/t& 􍃤Pjh0jPY u5k_ЍPh"CPmTuSHK,9tB8tB$%R9uu5k_jjCPTv;w4u 1A&w4 vE @8#E@L#E @8+E@L+e[^_ÉUS] ϋU U SЃ ʇt=DYWu ";[ÍvUSM] tAt& 1!!u=DYWu " &9Ku[ÐU WVSubWЁr7%)‰bWЉ5UUUUUUUUUU dW dWCCC (dWCCjh8dWKUЋPЉS @C$0 s,s0mr7 tH "S; Us) t ρ; Ur׋UЉ ω8UУ(UЃ V1v1ɻ1&cWЍ4tAvIDcWSe[^_ÐUVSu UЅt;A PQ utABA UЋQYA U1ۃ=U~vu,u} PVt&jV ؍e[^UWVS} tk UЅtaʋt BC BUЋAUЉt UЉH UЉ UAUI qA Uwvhƃ= Uu8h h5,W5|7~ UЃuVjjjjP8Ћ@L U)‰1RP5,Wà tc(Vgt;js45 U% U UPRbt11E;5h8}EWEM싁WЋUJ)M19};EE@t%؋tPSUR7tG;}|ƃE$E$Eu M; h8|e[^_ÉU WVS}] { dWtXSƋ%u?stC=DYWu " &8Su18CH,C tP,ftJfP,;_u G t&Ee[^_UWVSU} tBz 19}J1BDJKu} t! UЉB UЉ U$t&UЉBUЉUАt&=UЃ} t D1[^_USUсUЋA XY u(UЉt UЉH UЉ UAUЋAQy uLtABA UЋAUЉtUЉH & UЉ UAU[ÉUu C=U}v=Ut} dWtQÍvUSE tP؅u=U}v=Ut} dWt]ÉU WVShNj5UЃ;5UuP8|7Ћt25k_ЍPhCP!Itt{tFBFUЋVEEPPVS肛u5k_jjCPHt&EtjP^U;5Uu UWe[^_ÉUVSuU EM]BJZ FV[^ÍvUSM] EQt'9Zu 9BuAыt9Zu9Bu[U WVS}jjjju RPWà u(}uVWCÃu1,S/c(fC,G K4U G,_(؍e[^_ÉUWVS1E=Su $UУSСSЉE S;Mƒu*yt&G W$} ƃw4Z1ۃ C%=uu$EPFPPRW5S "SЋ@ SH,Pt5S7t,S;P$uG =DYWu "8E 1RPEPWvSЋ@SЅu $UУSЅuE9SuXe[^_ÉUS]M C t(C(t ;P4t# șRPSC( uQSs]ÉUSjh cWÃS؋]US]CCCC CCC0C,C(C4C8jh5P8vx‰S uh`V1] C$PRh dWh s >>C S$ C<C@CDSPC  Ph%SЍ )PC R=$UЉCt $UЍSP$UC$UЋ]ÉUS]CPSЅSSh cW]ÍvUS];SuCSЋStCBSC{tCf@,PU{uhs 5P8u]ÐUE@ÐUSE,P SDQ`S$Q;k_u"A`и CH[ÉUE@ !BHÉU WVS}] W <t?W‰ 4WE}t  ދE0v1e[^_ÉUUM UЉUЉÍvUEp4ÉUS0UЋ@UЋE% =DYWu ":hRS]ÉUS0UЋ @UЋU =DYWt =DYWu "9hQS]ÐU WVSME P4(UЉE=,UЋ8UЋ5hVS!E=DYWu ";>e[^_ÐU,WVS}EEE;}m} tU fz,YM 1EtUJ0MI,] tEPURWQ9} t/M A,JfQ,fHfwuMQEPWURM EEEh8ЅtLt&MW9r;Ws}t)UAMJu  WЋUE$`WEPEWPstUEE;}s} M fy,}tEPURe[^_ÍvUWVS} E0u1=jVEPURtEH0UJ, tEPVUREPt,G,JfW,fHfwuEPVUREPj UUEh8ЅtKMW9r";Ws}t)Et&AMJu  WЋU$`UREPEWPt PURe[^_ÍvULWVSu EEPE;EMQ = dW]C(t 9P4u UEEEh8ЅtOMWЉ]9]r"];Ws}t+]ȋEAMJutU+UWЍ1ۃUURV MPSEPm t]tYf{,wR1Uz MQPC EURk_/ MI,9Y(uAA(fC,S4u ]S@%EU9vU?OMA > dW]C(t 9P4u U܍EEEh8ЅtPMWЉ]9]r#];Ws}t+]ȋE؉AMJutU+UWЍ1ۃUURMQV UPSMQ tYf{,wR1Uz MQPEC Pk_ EH,9X(u UBB(fC,Su;utu> MQ.e[^_ÉU,WVSEEp4 }Eh8ЅtCMW9r;Ws t)މ7MAMJuE}uhV1kEEeEEUW‰UB>ÃsEC U<tCH0CH, tEPWss3 EE WЋU$` C fH,C fx,w}uEPWss SC1ɋR EPQC @ EEPk_ CH,SC 9B(uBB(C f@,s s\UrjE@u. e[^_ÉUWVSEp4 }Eh8ЅtDMW9r;Ws t)މ7AMJuuhV11wvM WE tTWЋDu1Bǃw‹G wC ?tE tE e[^_UWVSEEp4 }Eh8ЅtI&MW9r;Ws t)މ7AMJuuh W11]WЉ W:#}M E \t_sƋK #E U E!ƒ9tEPRC Ps)suue[^_ÍvUWVS} EEPYEe;}t&%@UM9vM?MA EUЉE߿w E wM U4E E9sJt4Á ]9t%S6WMQEP6WEP;ur};},uURe[^_ÐUVS]u S t-S t K0S[e[^UhjuÉUU<tE t.=t=-Md GM

Et=DYWu  "t&?u=DYWu "[^_ÐUEPuh dWnuhCZ1EÍvUWVSu UB0uhZZ1EXHXL߁)V5DSNEËUZHtCEPWUB,@ 0juEPE ue[^_U WVS}u G0u hbZ1 _HGH%VSVS5DSJGLGHGLe[^_ÐUWVS=j_%j_ =EEPHǡhVЉEM9Q"yƉwDw%)5k_h jVdSЃt?PEPhZ1GTj_ GeCatCh jjCH 0PVeCa t Ch jj CH 0PVdC\tjj CH PVde[^ÉUEpHpTgÍvU1} u-ÉUS]CXtClP贁S1]ÐUE%(t? #t&t#:=#t=&t*!%vA 1ÐU WVSu^TCEC,C0 FTjv8v$@4ЉǃFTjv8v$@4 ǃ tK,FTjv8v$@4ЃtK0C,@tK3t{ uK0vFTjv8v$@4ЉǃFTjv8v$@4!tK0At K03}K0)@t K0v tK0UBC0e[^_ÐUEPH uu v1U WVS} uF Ph@]1h_]1fC(GHFG8GL#"GPP%"Љ_TC GXGhWcGTjw8w$@4#FG\G]t We[^_U WVSuM }AF(u&t;[t=H@;FH9Gt&@;FHt5FTjv8v$@4Љ‹FTRjv8v$@8 &A@DFTjv8v$@4ЉbFTRjv8v$@8ЃVP;FHA@DFTjv8v$@4ЉÃFTjv8v$@4 à uZFdPVd;FhuJFdVjV u%Vt&V/WV91e[^_ÍvU WVSu^TCEC,C0 FTjv8v$@4ЉǃFTjv8v$@4 ǃ tK,FTjv8v$@4ЃtK0C,@tK3 uK0FTjv8v$@4ЃtvFTjv8v$@4ЉǃFTjv8v$@4!tK0jt K0[} K0O@t K0&t@;CH~@;CHt.CTjs8s$@4Љ‹CTRjs8s$@8VvB@Dt7S)@;CHu1Suu SSVS1e[^U WVS}_TCEC,C0 GTjw8w$@4ЉƃGTjw8w$@4 ƃ tK,GTjw8w$@4ЃtK0C,@tK3tu uK0pGTjw8w$@4ЉƃGTjw8w$@4 ƃFw$ ^1Ѝt&K0)K0 K0K0K0 UBC0e[^_ÐUS]SCTjjs8s$@8Ћ]ÐUEPH u"%t |3 2| 1U WVS] }7G %2t t "3t^1^1^1_1ЃG PRh_1F(CHGC8CL,."CP/"ЉsTF CXSCTjs8s$@4#GC\C]t S;e[^_ÍvUVS]U uBC(u t3 t{t@;CH}@;CHt-CTjs8s$@4Љ‹CTRjs8s$@8UB@Dt7SN)@;CHu1S%u SBS_VSi1e[^U WVSu^TCEC,C0 FTjv8v$@4ЉǃFTjv8v$@4 ǃ tK,FTjv8v$@4Ѓt K0C,i@tK3tR u K0Mt&FTjv8v$@4f} tK0t K0t&K0tK2 UBC0e[^_ÐUSEHX ut  uPu 1[ÍvU WVS} uF Ph#_1hA_1C(GHFG8GL1"GP1"Љ_TC GXWGTjw8w$@4#FG\G]t Wce[^_ÍvUVS]U uBC(u t:vt@;CH~@;CHt.CTjs8s$@4Љ‹CTRjs8s$@8VvB@Dt7Sn)@;CHu1SEu SbSVS1e[^U WVSu^TCEC,C0 FTjv8v$@4ЉǃFTjv8v$@4 ǃ tK,FTjv8v$@4Ѓt K0C,_@tK3tH u K0Ct&FTjv8v$@4Шtf}K0K0K0tK2 UBC0e[^_ÐUSEHX  u%t<t7 CPu,%tttt tu 1[U WVSu ];hW_1ht_1 G(FHCEF8FL5"FP8"Љ~TG FXFh SK ƒCPu( ujEPv$G4Ѓ tNX VFX FX uujh@FH 0PW|Qjh!FH &PWcQ jh FH &PWJQjhFH #PW1Q jjFH #jh@FH +PWQjjFH PWPe[^_ÐUVS]CTjs8s$@4Љƒ⟋CTRjs8s$@8ЃCTjs8s$@4Љ€΀CTRjs8s$@81 F)jLSЃCTjs8s$@4Љƒ f|΃CTjs8s$@4Љ€CTRjs8s$@8ЃCTjs8s$@4ЉƒpCTRjs8s$@8Ѓ CTjjs8s$@8ЋCThjs8s$@8Ѓ CTjjs8s$@8Ѝe[^ÉU WVS]M }qC(u kt6A2F;CH#1vV;CHt3CTjs8s$@4Љ‹CTRjs8s$@8t&A@DЃ($|_1ЃSCTh@js8s$@8Ѓ CTj js8s$@8Ѓ~vCXSjS* USF%=uCTh!js8s$@8ЋCThnCTh js8s$@8ЋCThOSGF%=uCThjs8s$@8ЋCTj@CTjjs8s$@8ЋCTj js8s$@8Ѓ vV;CHA@Dt{CdPSd;ChukCdCTjs8s$@4ЉƃCTjs8s$@4 ƃ uShjS tSWS1e[^_UWVSu^TC,C0 FTjv8v$@4ЉEFTjv8v$@4 EFTjv8v$@4ЃFTjv8v$@4ЉEFTjv8v$@4ЉǃFTjv8v$@4ЃFTjv8v$@4ЉEFTjv8v$@4ЉEtK,E@tK3VXt$E t% = tK0 u!f}K0@tK0K0 f}K0 t K2vK2 FX uUEtt K3BvU u% = uK3 u uK3e[^_ÐU WVSuFXue u1FTh jv8v$@8ЋFThj v8v$@8Ѓ FThjv8v$@8ЃFThjv8v$@8Ѓ} t^1FTjv8v$@4ЉÃFTjv8v$@4 à u&hLSЃG~Dt&1"GP!"Љ_TC GXWGTjw8w$@4#FG\G]t We[^_ÍvUVS]U uBC(u @;CHt ha1ttt,JtEt3>B@Dt5S'&Su SSVS 1e[^UVS]CTjs8s$@4ЉƃS CTVjs8s$@8Ѝe[^USEHX ut  uu 1[ÍvU WVS] u>VN u(u Qh-a1hKa15CPA"ЃVN u.%=u QhZa1hKa1CP!"ЃG(CHFC8CLA"Љ{TG CXS CTjs8s$@4#FC\ C]t S]e[^_ÐUVS]U uBC(ut&t3 t{t@;CH}@;CHt-CTjs8s$@4Љ‹CTRjs8s$@8UB@Dt7Sn)@;CHu1SEu SbSVS1e[^U WVS}_TsC,C0 GTjw8w$@4ЉE tK,GTjw8w$@4Ѓt K0C,r@tK3t^GTjw8w$@4ЉƃGTjw8w$@4 u K0,t&EtK0K0Et K2FC0e[^_UVS]SsTjs8s$F4$Pjs8s$F8Ѝe[^ÐUEPH uu v1U WVS} uF Pha1ha1C(GHFG8GLC"GP!"Љ_TC GXWGTjw8w$@4#FG\G]t We[^_ÍvUVS]U uBC(u t>&t@;CH~@;CHt.CTjs8s$@4Љ‹CTRjs8s$@8VvB@Dt7S)@;CHu1Seu SSVS1e[^ÐUEPH }u"%t tu 1U WVS] E0a1ЋPH }u:%t t"ta1b1 b1ЃUB PWh?b1F(CHUBC8CL F"CPF"ЉsTF CXSCTjs8s$@4ЋU#BC\C]t S[e[^_ÍvUVS]U uBC(u t3 t{t@;CH}@;CHt-CTjs8s$@4Љ‹CTRjs8s$@8UB@Dt7Sn)@;CHu1SEu SbSVS1e[^U WVSu^TCEC,C0 FTjv8v$@4ЃFTjv8v$@4Љǃ tK,FTjv8v$@4tK0C,Pt&@tK3t4u K0/t&f} K0 t&K0@tK2 UBC0e[^_ÐUS]SCTjjs8s$@8Ѓ CTh1js8s$@8Ћ]ÐUEPH u"%tu &1U WVS] u>VN ub%0uQhb1hb1VN u%%@uQhb1hb1訥G(CHFC8CLPI"CPLJ"Љ{TG CXSCTjs8s$@4#FC\ C]t Se[^_ÉUVS]U uBC(u t>&t@;CH~@;CHt.CTjs8s$@4Љ‹CTRjs8s$@8VvB@Dt7S)@;CHu1Su SS/VS91e[^U WVSu^TCEC,C0 FTjv8v$@4ЉǃFTjv8v$@4 ǃ tK,FTjv8v$@4Ѓt K0C,Y@tK3tB u K0=t&FTjv8v$@4Є} K0vK0@tK2 UBC0e[^_ÐUEPH 9u@u 1ÐU WVS} uF Ph c1h?c1C(GHFG8GLL"GPL"Љ_T[ _XWGTjw8w$@4#FG\G]t W`e[^_UVS]U uBC(u t:vt@;CH~@;CHt.CTjs8s$@4Љ‹CTRjs8s$@8VvB@Dt7Sn)@;CHu1SEu SbSVS1e[^U WVSu^TCEC,C0 FTjv8v$@4ЉǃFTjv8v$@4 ǃ tK,FTjv8v$@4Ѓt K0C,Y@tK3tB u K0=t&FTjv8v$@4tK0K0tK2 UBC0e[^_ÐUÉU WVS} ]3hc1zS ЃP%PC PGEPhc1FF(GHCG8GLN"GP!"ЉwTv wX$W/GTjw8w$@4#CG\ tGTjw8w$@4ЉG`G]uGauEPhc1 W}e[^_ÐUVS]U uBC(ut&t3 t{t@;CH@;CHt-CTjs8s$@4Љ‹CTRjs8s$@8eB@DtGS9P;CHu?u:S^u't&Swt&SVS1e[^ÐUEPH @uu 1U WVS} E0hd1RF(GHUBG8GL uK09FTjv8v$@4Шt K0vK0tK2 UBC0e[^_ÍvUVS]S4CTjs8s$@4ЉƃCTjs8s$@4% ƋCTVjs8s$@8Ѓ sTjs8s$F4Ѐ3Pjs8s$F8Ѝe[^ÐUEPH u8ʁBvtttt tu 1ÉU WVS] u>N %ud1Ѓud1Ѓud1Ѓud1Ѓud1Ѓue1Ѓu%e1ЃuBe1ЃQRh_e1ȏG(CHFC8F %CF Phg1h&g1W(SHFC8CL4g"CPHi"Љ{TCX  G CXChjh"RWS¶jhCH +PW jjCH +PWjjCH PW|e[^_U WVSuM }YF(u&t-0C;FHS;FHt1FTjv8v$@4Љ‹FTRjv8v$@8nvA@DKЃ $8g1ЃFTjv8v$@4Ѓ*jVHVC%=u!FTj@jv8v$@8ЋFTht&FTj jv8v$@8ЋFTjjv8v$@8Ѓ t&S;FHA@DtxFdPVd;FhuhFdFTjv8v$@4ЉÃFTjv8v$@4 à uV藴jVD tVWVA1e[^_ÍvU WVS}_TC,C0 GTjw8w$@4ЉEGTjw8w$@4 Eu tK,GTjw8w$@4ЃGTjw8w$@4Ѓ @tK3t_E ut K0 lvK0cK0 GTjw8w$@4ЉƃGTjw8w$@4!@tK2'K2 !S0у K0t  S0e[^_ÍvUVS]CXu*CTj`js8s$@8ЋCThjs8s$@8Ѓ } tB1CTjs8s$@4Ѓ u"hLSЃF~˸814CXu( CXSh"ЃlS'7u7PS27e[^ÐUSEXH n`ut\ @`ut@ n`u %@t  Áu@u t&1[ÍvU WVS] }7WO u%=@uQhg1vG Phg1hg1kF(CHGC8CLl"CP|m"ЉsTv sXSQCTjs8s$@4#GC\ C]t Sֲe[^_ÉUVS]U uBt>&t@;CH~@;CHt.CTjs8s$@4Љ‹CTRjs8s$@8VvB@Dt7S)@;CHu1Sůu SSVS 1e[^U WVSu^TCEC,C0 FTjv8v$@4ЉǃFTjv8v$@4 ǃ tK,FTjv8v$@4ЃtK0C,@tK3 u K0FTjv8v$@4ЃtVFTjv8v$@4ЉǃFTjv8v$@4!tK0tu4|>@tK0^t& uA뇃FTjv8v$@4f} K02@tK0' t K0 tK0t&UBC0e[^_ÐUEPH u"%!tu &1U WVSu ];C Phg1hh1&G(FHCF8FLp"FPp"Љ~TCFXFhV FTjv8v$@4#CF\FX t,jjFH 'PWjjFH 'PW F]t V^e[^_ÉUVS]U uBt6 tvt@;CH~@;CHt.CTjs8s$@4Љ‹CTRjs8s$@8VvB@Dt7S~)@;CHu1SUu SrS菭VS虭1e[^UWVSu^TCEC,C0 FTjv8v$@4ЉǃFTjv8v$@4 ǃFTjv8v$@4ЉEtK,FTjv8v$@4t K0C,H@tK3t1 uK0,UtK0K0EtK2 UBC0e[^_ÐUEPH 2uu 1ÐU WVS} uF Ph@h1h_h1R|C(GHFG8F %G}k1PQhl1i~VNB B B tQh%l1hjV|‰װtRh:l1h~tFPhMl1hjV/‰װtRhbl1She[^_ÍvUVS]u hhUKCECS ƒtDt&tRh4ShUą C PC Phj1hhUzh{}H$l1АPyl1ЊU@tul1Phl1hhUhƒ w]EtVPhl1и)PUPg7Phl1hhUgt&Phl1hhUgUЍe[^ÐUSjjhhÃhS舖j@"ALeWЉtZLeWCLeWЃPA؋]ÍvUS]j@@t CB&SQ@jS]UVSuj@@‹LeWЃtC9uR@؍e[^ÍvU WVSu~0uv hm1eWuv hm1xeC[FXCZF,wg$m1ЋF(v$)Ɖs$C[oCY CXPC(PF4P0|C[M&Rch@m1'C[-&C[ R=v,hm1dC[ WAye[^_ÐU WVS}1ۃWuhm1dB 9Gj@8>Ãjjh;n1jW G0tS!>-vG0G0W4j@=ÃWwS=e[^_ÉUWVSEU$=Qqw'=Q  =Q =Q = Qw=Q xv=Q`ÍU׋uEMQ AC|ǃǃǃǃ4UC|PMApU$PM QCPh؉"E 6C8CPCDE CLUS4CPK\B\B\2 A<_v$\B0B$80B$0 B CN[^ÐUWVS]E tPhCv1|[{Pt@pUeG|1ۉ%@t6 t t9`t$2Džxu13t&DžxFv1#t&h`v1VvDžxu1лv1ЅEwt$w1лv1kv1bv1[v1Rv1Kv1Bv1;v12v1+v1"v1v1h w1HVEw1ЃjGPE܉lPjGPUhRjG PuVxPWw1Ѓ|tMw1PSEPG$PVhRlPpRtPh`w1YH[^_ÐUWVSUB4MU<t1-jjj(=Ãu  ߋMq0 EfCUfSCSCK4S Ph USSEt}E& UЉ%@~t o`ucW}uj:M Qh Uo:t&K,St0SЋMu UЋ} :XEPjj,ho1h U "U$ <v''Utc'Utc'U tc}tRf S"UЈ'UЈC=!U}K]uF UЃVEPhL"]ǃt ct.mdt&*dtw mtQ`tdu}t$E@ E &c@Hc B|c w> c wQ 4 c c gc c c 6c Tw2c c c vc .pd sd 6cJcw@edA'w c@6rdAc(hv c$w cFmdqd(vgdw Ƅ77)ȉ7у}t*}uUUE}u 0E}0EE9E5}jEPmEsf}tjURh}u}uOuEPVhX"ЋE%U ƒ%e E UUR&e[^_ÉUWVS}u LJLJ@j ]SlE%Vjh NjjuVj SuoUMB B B ~tUF F F Bcwe[^_ÍvUWVS] uj }WkEEEEE]EEjjh@ jjjj WE e[^_ÐU,WVS} ]u 9cVEPe{C@9~))x)L0 T0 D0 0w]jVdC€FC€VFC€V€V$FC€VFSC C C ‰V SC C C ‰VC C C ‰VCF O(1e[^_ÉUWVSu j ]EPcj}WcEE EEFEhjh0ujjWj SEuGFGF1e[^_UWVS} j uEP(chScEE EEGEhjh0ujhSj VEG0uhGPPI1[^_ÍvUWVS} j uEPbh4SlbEE EEhjh0ujhSj VE0u>45 ‰WB=wRGP8PI1[^_UWVS} j uEPahSaEE EEhjh0ujhSj VE0u> ‰WwRGPPWH1v[^_UMU w\$y1Аt&RQIt&RQ9t&RQ)t&RQ&t&RQ t&ÐUWVS]uj}W`jBE P}`E]Ehjh NjVE PjWEe[^_ÉUWVS} ]juV#`EM]hjh NjSWjVEie[^_ÐULWVS}u Vjj]SW uE$ EVjSWle[^_ULWVS}uVjj]SW u"E EЋEEҋEEԋEEVjSWe[^_ÉUTS] ujjEPuuEшEӈCEՈCE׈C1]ÉULWVS] }WjjuVEP@ u,EEECEӊCEՊCEWjVEPue[^_ÐUÐU,WVS}uh NjVj]Sj u1E EEEEEEEh NjVjSe[^_ÍvU$SU] h NjujEPj7uEECECEC1]ÐULWVS}] uh NjVjEEPj udh NjVjEPjN u?"EوEC"EۈEC"E݈E["]߈]h NjVjEP e[^_ÉU1ÐUWVS}] j uV]E]EEjjh@ jjjj V^e[^_ÐUUEPjjhdy1rkEÉU WVS} EU2B$dFSЉ~LJSЍGG\_0SiWSkF tt LJ{1 LJ{1Ѐ~|N@FuUB@uhy1 ,4S PjºÃjUBPePYjUBPnP>jUB PP#t"4S PPWЉÃwVhy1Z+tP tftKYEHQX Sp0p1É1Qhz1+ h@z1 t&hNz1*hy1*Wh"jh@7 uVh`z1*e[^_ÉU1ÐU WVSEEj@Ƌ]Et)B$C$B4B0B0R>S$u׃VUr1ۃ;S},dSЍv?"ujFPVSS|C;S|1;S})SЁ?"ujFPVS |,C;S|܋UtPh@7R1e[^_UE0POÐUWVS]ۋE% ÉPhSƃu ]F0EPsÃtGt&hjW踷ÃujjWÃLG fGthjWfÃGuM fGjRVЃu jVMQ }t)9E}Muq} t }`t)M &M MQ&VA1Lt&gu#@thjW?gEPV؍e[^_ÐU WVSU}% ΃QhS^Ãu&C0EPE t`t$t&!! u~ txtjS@Ѓ@th@j `@t!jjIf`EPS1e[^_ÍvU WVS}GD% PhSƃuG4t&O<1s(t G4@u"tG4G4w&tuGDt' PW~Cj@ÃWP.V]SV>G0G0GC0u U耊 C0tRSh`jswpd t4; Q@t$+qdtw mdt Q`u t#DžBDžmdwJedAwpd (sd ticvrdAtyQG&mwqdhdttgd fdjSUR<jPMQSEP}eUƔrt&MKC0PvjURӾu^gduVh"Ёe V% E UMQi􋅰PUtyM9t jE8PRMf9tDžBtIfBs&Eu Dž YU2Sc@t&t Dž'uMQEPWURQ S[^_ÉUWVS]hS>Mh@EP-MU C(M S0u K,C4щS8 uC8dfCE du jhz1 jhz1ЍCP+ } nWE ePhz1juV v jWV: эAPCPV3M S<fCHfCJCXǃ ǃ ǃC( ЉƃfǃWEVǃWEVSfuuVSh"ЋUE% Ѓҁe U% EEP躳e[^_ÉUU txt jR@ÐUWVS] j}WBKjuV4KE EEUEBBZhjhjjVjWEZe[^_ÉUVSEH4P Z@4$Bt<wA$<u yvy tt&A t t2CPhz1h@KLLSиn@tCPh{1=sVh-{13hj6 tPVh`{1e[^ÐU WVS]ۋE% ÉPhSƃu ߃#ujh`jEP uZ@tt&z( ujh`jMQtVe[^_ÐU,WVSUu =UuXU% ‰Ӄ; S}oSЋ Mt`EQ(UE1uEt  }Ɖ| M19~ֿ`UЃ}j ]S!HE*EEEEEEUUhWGOMG GG'_G EEG(G,G0UW G$@WЃ0U1e[^_ÉUVSuU ]t& A<_vB t&BFK~:u[^ÐULWVSu }j ]SGE#EE Pjh Njj EPj SEC0]ĊC$t!t&t[ FKSA A ‰V uF C C C ‰Vuvh NjWj&EPjELu9E؉EىFEU ЉFEU Љft‰F@F F F1e[^_ÐUWVS} ]j,WEjuVEEEEE, Sjhpjj,WjVE˧e[^_ÍvU~~ uF EPUޡ‰VN1N1UREjSEPǃE׍\CCS ЉFEU Љft‰F}vEU Ut&CS ЉF SVF‰F~ GF ;UREjSEPǃE׍\@F KSA A A ‰V V}vEU U CS ЉF ~t{u~ F U@@uBuEPЃPh{1EPh|1h|1UREF@F VF e[^_ÍvUWVSu E$<v_GuYj ]SAE5Vjhjjjj SWs@tEPh@|1 E@e[^_ÐUUEPjjh1r[EÉUVS] E0sLFSЉ^pSĥ1v{1Ѓ{Xt΂1PCPhւ1T4S Pj@ t~4u V0DF0HDKu1X[^_ÉUWVSuhjV Ǎ]ECCGC jEPE PSWV 0h0uSWVÃWVWV6 ؍h[^_ÐU,WVS}k_ЋJuk_@,u PFjEPW.ák_tdEXjjS&ƃu =vSVWÃtjV(Glt jP(wl1e[^_ÉUWVS]hjEP ƃSjE P }EGGFG GEGjSE PWVEP) 1}uPWVEP%ÃVEPzVEP ؍h[^_U WVSE4jjW%ÃtAjWSURƃuL39tQjS'jjVT%à u bt&jVSEPƃtjS['9UBtt jPB'EXt 98EPx1e[^_ÉUWVS}uPEPUR ƃjjj $ǃ uVMQq jjjm$|u"VEP? jW& w~ |V}t  ]E E CCFC CffGfWfGEfG}u/k_ЋJuk_@,u PBE PjURU jj WSVMQ (EPU RMQSVEP 1}u0uPSVURÃ}u2k_u|A<ufyt t}tt6VEP VURjW%j|Q%؍h[^_UWVS}]}tPjWE ] ]EEFEuEPVW ÃVWB؍e[^_UWVShjEPǍuEFFGF UB FF<xdAHp`BQtqlPhPjjhRjjMËhx0t/SEPh1Džxd@`QtqlPhPjjjRhjE耰Ëhp0t/SEPh12Džp`Bk_ЋJuk_@,u P?j5XeW5TeWVWEPjjdRVWMQjj`PVWUR hVWMQ ÃWEP WURk_؍H[^_U,WVSuEEEEEEEEF8x tjjjP@ Ѓ EPV ajdLSЃKt&F8x tjjjP@ Ѓ ?tȋtPFPh1R~4u V0@F0X@ujdLSЃOu҃tSV 1FPh!1e[^_UVSU] UЍH UЉȉC$C u,t XCj@=ƃK$# PeWЋ\eWЋCt SP PeWЉ#S$ \eWЉ#C$C Ve[^USM] C u!t CBt&Sj@褸StC B S CQ虸]UWVSuM )V8z tjpQPRB Ѓ Pt%F8x tjjP@ Ѓ Ou EN#PeWЋ\eWЋE@Et 9H$u}u#QFPh@1%M&G tj@輮Wt-t1)t&t t&1ۃt P莮؍e[^_U WVS}uj@SE4O4u W00G0@0thuW0D t&G0@DÃu0uW0DW0D+t&G0@DÃtSWQ4tЋG0XDE @ujdLSЃN_EP諭e[^_ÍvUVSu j@sÃFt Sw9jM u7кMb)Rh1jVvSt&jW1vGxUB9vEXSU2wpƃEPjjURe[^_ÉU,WVSEEEE Pw6M 9w%v E P|@=~=~t&19U}1&M |w3 G9|jjhj Eu0 <E t&Et&E pUR0EhjMQOEUPBMAB 1UE ;PEƃ]MF=f~tPS6E#~PvSEPURMQE EE GE ;xwU rMQEPURhEMA8~U B 9vǃWM qEpEuiURMQhE1Eu  E GE ;x}*~u]Uv6SEtÃ}tMQEP}tURMQ }tjEPY Ee[^_ÐUE8ÍvUjFP_S F @G4EPW-G OG<%f=uO G<fuO G<$`G F1jh"ЍF0PVU{~1t2V1SЋ@4tj@PS Wb0e[^_ÉUWVS}O q FXEV`)ЋUD,EfytG,.GP9Ãu  Gt F`C { G CG$CC,8#C09#ЃEPh9#ЍC#Ѝe[^_ÍvU WVSM] { C)t,PjjjC=~PhCPQd. @tFjLSCT>#ЋGUF $`< uBe[^_ÐUt&hV(jLSЃVF(tG~C AvF@0C@C<j PjjjhPV#C F@1t V@dЃF(tCFV@`ЃC t"jC @PjjjhPVB#$tXjC PjjjhPV#C E@dF@1t V@dF(tcC GT=#5&RGPvFPh1臤E@,GTJ#Ѝe[^_ÉUWVSu ~ ,t FTJ#7V\OYACSG$FFXFFT=#[^_ÐU WVS}u ^ K,EUMEPjjWMK tWo t&S+4FTe[^_U WVSMu }V)Ѝ\,{ uFTJ#2&jFPQd$C C FTTK#Ge[^_ÐU WVS]} W)ЍD,Ew }t1RsCPhl1F,EP]&SC(uGTJ#Ѝe[^_ÐUSMt,9u'E X tA9uStA9t 1 t&[UG0G0Gt&Q$t,B$A$xǃRSxNj]ÉU WVS]M QDtv1QT‰Pp( 1ƉPǃTpHt ~ fǃD fǃDy<1v(ƀ|}&PH=~D fD|@tD fDA0tD fDA<`AHdlC0PkDPt|!~)u5u7ЍPGO h1le[^_U WVS]p`F@ƅh*h$ 1АF0F0F4Ε1Ht&ؕ1=16ltlhWlPtt2 TjWh1Vf02h1脚u7u7PPNh1RF0F0F4%D@u ~CPh1F0%PF@V<)‰PC0P`iVkxS[^_ÐU WVS]pj@HtǃVSWKte[^_ÍvUu h9hujhP#OÐUu h9jujhP#*UWVSEEeǁ EPhSUcÃu 8K0MQCiƃt|uR|u8 ||PjS| jSEP0Ut'9}1ul} t }`t' & MQghSb1 EPHhS`be[^_ÉU WVSU% ΃QhSaÃu{0WgEuh} t}`t&!! ujS WigSaEe[^_ÉUVSu] hSC(S0K,~C4щS8txufCjh81t&fCjhF1ЍCP' jPCP S=St!Sh1sh1ASЉ9v)׉9vU 9vB(E(S1[^_UWVSUp@}1fxHt^1ɍ&FEUB8T1 }W,T1 Ћ}9pC}Ef<uEpC~~[^_ÐUVSu]SE PtttV^uYbj(h 1ЍC6P蝛 f@fCfCfC fC^fCdfCbt@1h@1ove[^ÐU0VSutxj ]S?EE@E@} t fEfEE0uSttFPh1E}FPh1EtFPh1Ƌe[^ÍvUju-ÐU WVSu] ~8j< ƒu t u%F0tu{ G@@u @BZ C BCBB,c#B0i#B4 l#ЃRWX tЍe[^_ÐUVSu] C uu7ЍPPn>SV e[^ÉUWVS}E X P)ЍD,EE@ < t5UB PM APwGPh`1Bh1u F0l#ЃFPWh'j@j@W jFPW E@ SjLSЃjU RWM @t-uF=w@FfƒU}UM yt t EsE P1v(EKAXt=1FC,t-+S xuA,I<))HC ;U} fEtS UC $ @E!S s1v,UE1v0U΋U @$MKBC}E5 tE%Eʨ tEȃWEPsM AAPAPwrDBHЃ tC$C(u VU BPWh'j@j@W }*EPC RPEPM APWq/&jEPEPEPPEPu FPWGM QRwpD@LЀO$ K;MvMKSB(C~2u+}E9 tGE)AEŨ t4E.}E4 tE$&E0 tE U BPWh'j@j@W }&EPC RPEPM APWF tCfxu@\t&1PEPEPEPPEPu FPW -K~#E PЋs1v(E9~ CU BC h'jjW}TG+Ph1G(PM APwGPh1SuVtC$E PSURuM QWsu FFPEPu O$jLSЃG$ th'U RW g$߃jM QWpWG+Ph1G(Pu FPwGPh@1SEPtC$U RWe[^_ÐU WVS} ]w W)ЋUD,Ex w2@ PGPrBPh1腄h1`t&1u'PjjEP}8t1wwGPUrBPh1 TUB@1t R@dЃVEPË@tvUBxTtt F$E@(t<tÃjSWxƃ ffjSWTEje[^_ÉUWVS]M Uu}(t-CtzEPEPEPRQs s uW,CtMEPEPEPRQs s u*[t9}v}EP uVuuS=t7}tE}tEU} tEU }$tEU$1e[^_ÐUWVS}u 1ɻ1Љ1f;<u f;tu At1[^_ÐUU72Ѓxtf972txtf9u@ÐU,WVSUE uEEMME72ЋAtf9=72tAtf99uE}t/1ЋHt#f9=1tHtf98uf9PuME$1Ѓ=$1tEM;AtE M9t;Au1ۋE8tXt;tE;Ct t ;t;Cu}uPPhpG2hG2VMQ0}tEPMQhG2vPMQhG2VEPn }}VhG2ЋMQ }эQEuEPEPhH2%tuEPQh@H2 PQhaH2Љ)PEP"n }эQEPhvH2)VEPm1&}эQEPhH2)VEPme[^_ÐUS]1K(u <u utFjs s u+j3菶us3Kt1]ÐUVSu ]hH21ljs3V踴e[^ÐUÉUjju uoÐUÐU WVS}heWhQFƃ=Ut!VRF;=UtOhH2zgEPjjj"W{9à u2UЉ=UЋEUUVEU%t&VEShH2-k1&e[^_UVS]u hE=UuQEhH2fS;tCt&;u SBCXQMEÍe[^ÍvUVS]u EEhE=Uu5QEhH2;fS'&SBE&;t܋Ct&;tۋCUPQDe[^U WVSEEmɋ] U ҉ ‰11҉1 ׋E1҉1 ׃}t?SE PEPEP t'؃u u u 1,&1۸SЉ#P#H 9u9Ht C=v1e[^_ÍvUS]j,s s FsPs$1҅t xЉЋ]ULWVS] uǃƃAƃ1ҍDŽӸӼB~剳LCEPS7YFjv v 覽E܃j,v v 蓽vPv$dE  jjjẼuThI2/h_ ỦU1ҋ}ȉF ỦF BFB FBF(BhSMAЃ jjjEPEPjjjV=0thI2gEU쉃jSwj@v v 脼j@v v tǃtThJ27gWj@v v M}Wjv v 謼 t翉}܋EPjv v 艼@SQU ǃP#ǃTȗ#Ћu(‡%‡4t&@ tϋu‡&t̋tGu t#u 9@M.uǃ}@ƒU؃uM@ǃ}䃻u EEEEjSWQuRŸOŸ X[]Ÿaxht vt@[ttƀxEPVtThJ2vuuuuv 聻ǃURShBj@uuuuv 褻0uCh@J2ctWh_J2chfJ2cSpTvuhJ2PhjJ2cu"„Nlj t$Njtʀרt$Džtj v v ?Ht!ujj v v vǃHtj@v v ȷujjj@Klj1EPSQu$?@t⋓$?Bt:tƀw>w-†t拃ƀtwuB}tj v v ?u„ Bu† C*u)Ÿ&&Ÿ -!ƅt֋ u  @@u @ u Ÿ.@  f<tы򈐟u A t/ut&Dt*u ES>iu S SOe[^_ÍvUSEMU1f} uDfu=f9t8ʃftft ftfu҃t | u[UVS]j@hp0U‰ t2u„ Fv v 1t t1e[^ÍvU WVS]} t$t{hR %t j@hp0kt}u+„(t&h@ 눋E} teMteMtDUMv}t t& } tɀtƄE}tQj@hp0e[^_ÐUWVS]E1EESnjjjjSHS RƃGE@`txƀtQƀt&jjjjSSQƃuJ‘uI’믋’넋`]tEu1’.’<’H utƀtƀ&jjWjSSP9u‘ustcuO’L`’&’ uE@t5jEPWjSSO9|E?~^@`XƀSƀ}tG }t@PJ2ЅtJ2PJ2Ѓ}tJ2PThJ2 Y EPEPWEPS1e[^_ÐU WVS]u’ @jhp0购ƃ u b @bȅu c @c PTh K2?X}Th`K2#X@tThK2X tThK2WtThK2WtThL2WtTh@L2WVjhp0u+ThL2[W,t&’t拃ƀu$‘!‡+ ut׋t&e[^_U WVSMtxBtGCt&Ÿv†C뻋„B농Ÿ @t& ‰ &ŸAt&DE Ã' &@Bt&< P T&A tDtEQSe[^_ÍvUUƂAǂǂ %hxt 5ǂP1UUƂAǂǂ %hxt 5ǂP1US]Su 1]ÍvUEƀAǀǀ%ǀP1ÉUS]Su S!]US]Su S=]US]Seu S]UMƁAǁǁ hxt%ǁP1ÍvUEPÐUS]Suu S1]US]SMu SM]UUƂAǂ ǂV@hxuǂP1ÍvUEƀAǀ ǀ@@ǀP1ÍvUS]hAx uBxvǃ ǃ1b?ǃǃ1`jp0 Pjhp0茦 @ǃP1]ÉUUhAx uBǂ ǂv@ǂP1UUhAx uBǂ ǂ@@ǂP1US]Su 1]ÍvUhL2OÉUS]hBtu ƃBrhL2OƃA1]US]hBtwt=+ t$t&ƃB.&ƃC&rhL2DOƃA 1]ÍvUS]hBt wtYG&tt&4t&ƃB>&ƃC.&ƃD&rhL2NƃA 1]ÐU WVSM%] 11҉1 1҉1 փ=h7t #|M2#5M2ESЉډ#P#H 9u 9HuE}v1[^_ÉUS]j,s s Ps$R]ÐUe[^_ÉUWVS]tEjv6輜ǀPjv62 Kpu"Sx&KxME.Cx@E}retӋCxMUPS蛞tjjS_Kpu9Sx§6KxESxcvSxbCxEtCxUjv6QPjv6̚ {ptCx@t&{ptCxƀWjv6蛚Ee[^_ULWVSuEVà jj P}WV`à u WVQZjj PEPV+à th]O2UD1EPYÃV芕hVŧhVǃ _hV`AuFhVJDu0hV4PuhVThVBuBhVIu,hVةOuhV©St\hV謩AhV蒩Su{hV|PuehVfIuOWV茦]1PV茩f?~߃EPǓÃt u;VTÿ jpdž t&EPVUËEx"uWV1t&؍e[^_ÉU WVSu} tj@s3 $t Pj@s3苗tjjV&EPjVlÃu#E$Et Et%MtV[PhP2tAE u#E$Et E t%MtVPhP2*AM ~pu)Vx=&Vx= SvVx=Ut&Fx@=$Et @~ptVx B=v~ptFxH=t&EPjVÃtV^PhP2w@e[^_ÍvU,WVS}tEpuWxBWxGx@t SWWPhU2?WEW[yjjW"E&}tpUUGpE<u T9x T9x8%T9xUEU<tȉ%T9xEF}vE}t^1ېUD*sH`SУUЃuu UU2ЃE4 SЃW͔P5U>CvE}vjUr2ړPjEp0REPWܕpOGx@Wge[^_ÍvU,WVS]tE‹BPr2iEPSPh V2,>SE1&VVSQ}{pu Sx– Cx>M{pu*Sx—'Sx–>-Sx—0Cx{ptЋSx>{pt͋Sx}{pu Sxž Cx>M{pu+SxŸ(Sxž>0SxŸ3Cx{ptϋSx>{ptʋSxF11D.s1@SУUЃ4SЃS蕒P5U<w9D.s/@SУUЃh R2ЃSWP5Ul<GvFuEPUBPr2{pu SxCx@EPSTe[^_UEU ǀ|ǀRPZUEU ǀ|ǀRP.UEU ǀ|ǀRPUVSU] C(w4PRDPh`V2Z;jjs s A{uBw8<$ <$ @< ΁Pt p<$ F<>jDs s 賏 PjDs s +jDs s 蓏v1e[^ÍvUSE E1ۋE 1҉1 ӋE1҉1 Ӊȉ[ÐUE@$f=Du=u1UWVSu ]C EhV29jjjF0PPjjjSF@thV29Cjs s 觎 Pjs s EPSthV2Z9uuuuEP褐Ã~WVh`j@uuuuEPƐ0u5hV28tShV28hV28+VtWhW28 SVe[^_ÐUjh@W2uÉU,WVSu ]C Efdžj s s fC&=t=u0=u<w0 Rj s s 谍EPEPjs EP uEPjuu3 tFPh`W27 F0EF4CF8C$ffdžV&t hW2Z3EPStFPhW2M7t&uuuuEP蔎Ã~WVhj@uuuuEP趎F@0u8WhW26tShX26h X26vSh X26Ve[^_ÐU WVS]{0s4F fFfǃƃƃ ƃƃƃƃƃƃƃ ƃƃfǃƃƃƃƃP9+ƃƃƃfǃqfǃPVW < fǃƃ ƃƃƃ ƃ&ƃ,ƃ2ƃ9ƃ?ƃEƃKƃRƃXƃ^ƃdƃkƃ < u4t@F `&V1ftt&V Ut&< vktF PaV `WV POV `YV Isƃƃƃ#ƃ(ƃ2ƃ<ƃFƃUƃ futF `ƃVW f=utF IfǃtVW)1ƄƄƄ@~e[^_ÍvUt jj6SVxe[^ÐU WVS}] 1j6SWt6jj6SWAj6SWtjd F~؍e[^_ÉU WVSE1xtf@@GPE PEPÃjd) Fu͸1e[^_ÉU WVS}] 1j6SW/t8j j6SWij6SW  tjd F~ظe[^_ÍvUWVSu~0^4EEƆVSW uEu VPu ESWSSWvESWEEe[^_ÍvUtfCzuSft&Szft&CtfCuSffEvSft&SfUtfCuSffESfvSfUtfCuSffESfvSfUEt&tfEfCuMuSfESfފCE}vMPSW fEft  t&uPEPSW fEft S ft!fC8uSfUfS8fCMft"fC:&uSfufS:fCUfMtUtfC"uSfS"ft&Cu S"ffC" fCvut1tEt&2t4C #vu Sf@f C@fCtC S S S fS St&SMrfSutfu Sf@f C@fCEq uatfC"&uSft&S"ft&Cu S"ffC"; fCv8C St&UquduSf t&fCMrfCt&u SffCutfCt&Ut1E&MvEsMSfM ƀ}u7uSf &fCtdt&Sf[&}u*u SffCt.Sf)t&} u+u SffCtfs1-Sf$}uu SffCtfsE}u SffCtUt&SMfxSufSMxft&SuzfSM|fSu~ft&UfS P$f(u SffCVMfCt&u SffC:uxfCt&u SffC"UzfCt&u SffCM|fCt&u SffCu~fCuSf t&fCUf P$fCMt/ tUt0HEPSW ,t&EPSW EPSW fEf}t* t&u$ȸSf7t&u SffCtƋU$ȸfCMAH7q@uu>t&US@fMS@t&uFHQ 7F@+P A u S`ffC`uUS@fM@fCu SbffCbNu@fCEu@@CUuz{MS@fSS*f5S @f2SEfhvSEfSEfvUBHQ 7uF@+P A u SdffCduUS@fM@fCu SfffCf u@fCEfǀCtfC(uSft&S(ft&Cfs*fC @Uqf}ȪUuSf vfCMfKu SffC}ufst&u SffCbEfCE&ufESffEfCuESD( ED(CE}vt&UR tfEEx[^_ÉU WVSu] E<1tC8@j uS8S8@ᐍS8C8$<uotC8&j uS8C8uBG~tC8t&j ZuS8S8t&C8$<t@ S8 tC81e[^_ÉU,WVSu EEtDttkx2ЉU y2ЉM y2E ^2Љ]2ЉE 2E@=V1fDt&V1ft&2ЉU 2ЉM 2E}tfFt&1EɉM9M)M<EytH}u"fYf]fA^f EEމffAfQ fFGEA9E|Et&fYf]fA^f EEމfȃt1x500(t&Sfw&SLf VVuȃ t ~t uVfF% uSffCtfKu SffCrfCL1[^_ÐUWVS}] uu SfKuS4f%?=?tC4%?=?u vt V0u>ȃt1x500(t&SfM&SPfZt& VfFЃ0 u SffCtfKu SffCtfCP1[^_ÍvU WVS} ]fE1VWEP[fEfF~߃VWEP:fVWEPfF~Ee[^_ÍvUVSu] Et fCt&SV&uSfS fCe[^ÉU WVS}] 1u Sft&CujQFc~ՅuSfCe[^_ÐU WVSu }fE}uV0f t&fF0VEPm1ۃfE}u Vft&fF}u V @f @fFVEP&jd Cfv}u VEfEfF}uV@f t&@f^VEP}u VffF}u V @f @fFVEPCfv}uV1f &fFVEPMe[^_ÐUWVS]u C0E{4~vFEFt&v4STEu1W"t&SHA $7S@+B fA Cu1e[^ÍvU,WVSu }Ejw w MÃhEPjFpPFlPjSjWN@th@2suF`IFdJFhxJF`GFdHFhHЋGFtjw w CÃSjw w EPWt#hb2uvpvluuuuw .ÃFEPVh[j@uuuuw NF00uFhy2臽tSh2rh2buvpvlQ Sh2@j,w w Lú`2Ѓ `2Ѕt 9u Ed2t 9uU}G$f=u-=t =`tvE裩2&E諩2Ѓ}uo2f=2tDf92t f:t/9uf:t"SBPh2j h UB Sh2j h U*E UЃhw w Q=t=uȩ2Щ2ة2ЋURPEPhܩ2V+ t&v0w F0uvpvlƌe[^_ÐUEP(x+uuu1ÐUWVS} ]C Eh2f'Vs EP`u(uh2+,hjjG0PG4PjjVSJ0tGPh 2t&CG8Cjs s  Pjs s QEPSLth?2茺vuuuuEPÃGPWh#j@uuuuEPG<0u8hT2/tShn2hu2 t&SWe[^_ÐUEP$fu=v=vfu=t=u1U\WVSu EEEh2vF`EP$%==E= }~ft&=|=~n=n=|g^=mtW=8tN|S=kL=h|E<=|<=~.=a.=`|'F`t&F`&F`~`ufw F` vF`fvN`=uF`jUUREEP}W]SjjF`uRURG0tIjEPURWSjjF`uREPsG0th2vMEFdEFhEFlUBFpF`jEPEPEPEPjjjR G0t h2MjEPEPEPEPjjjEPF0thĪ2}MEFtEĉFxEȉF|F` t$hWZ}乌Et1}u Uu Ethڪ2fdždžh?$džp?$dž x?$dž$?$dž(?$dž,?$}乌Et1}u Uu Ethڪ2Rfdž@dž?$dž?$dž ?$dž$?$dž(?$dž,?$U}tEǀ]uU=uE䋀=~uh2U,UUUEUU }t1򫍶}uU4U4  UB4 B4}TE@,}REƀ}OEƀt&}HUE艂}DEƀ};E@ jLSп]uU2jw UR Pjw MQjw EPuh`2u h2hEPEPE `PE \PjjjW:0th2EEPW t h2~uuuuURƃE PM QhS$j@uuuuEPU B00u:h̬2tVh2ܩh2̩EtVh2諩GM AdTf=TtuW$f9udA9uYf9YuSA9uFAU Btt t;} T$} T f9uE PKt5}~U r0MQ}~uE p`p\ye[^_ÐU,WVS]ǃXXXǃXXXǃXXXǃXjSЀKhS tFaPCPh2CPh2CPh2%t&SGEU썃E荳t&CdURjjhj@hP@Ѓ eCdjURj}WjjhP@$Ѓ LEFCdjURhuWP@,Ѓ 0XFX0XE,E,,E}H[TCPTCHTfC>fC<@fC:@jh"ЍC4PSi1e[^_UUM 1:t9Lu @<uDUVSuƅP SjPjhV tFPh 2`&fXtjXPFPh@22`CPCPCPCLPPhPT0PCPs shTPFPh2ܥCS FlVp[^ÉUWVS]1SЉƃ |hLSЃG~ uVCPh 2CdjURj}Wjjh4P@$Ѓ tCPh`2 EEC|SdjCxPh4uWRB,Ѓ t.CPh2Ф xS`,Eh4sxSxǂC|Cxǂǂ C|1$ǂ(ǂ,ǂ0KxD$X)C| h@!XXX@X@X@ X@X@X@X@X@ X@$X@(X@,X@0X@4X@8X@<XP@XXXXX X X !X {tu{\C`@,jjjjC|PjS u9S1yCPh2 CPh2qSCPh2S}~Cdh4sxP@0Ѓ}~CdjWP@(Љe[^_ÍvUWVSuEEDž|1|EEPEPj EPjhV t!|PFPh2蝡t&f}dtjdEPFPh 2xd}u_}tYƄ>XXUEPEPEPRcE>XE>XEEEEf>X||?fhjVЍh[^_UWVS] u}E =@ UyEыE) = &v[VE)MmU ?[^_ÉUE@,UWVSuV B EZEF,?wÍ@MXtfztWF,NVW0~EPF,MQizXvE:t&j@*zEE;XjVPF,V ZN5we$2ЃV1aNV/F,NV/F,NVo/fF,NVP/G&95~u5AyP @ ǁEyt<IM3QyB B B AEA EÍ@UX9s M99v0REPWEPh`2#F,NV.yvMQ Ã{ EC$sFCF85t6Szt&SMQ* F,NV. SEPx FMQsƃEP xEe[^_ÍvUMUA$uhX249vЃPq u )ÍvUWVS}G p @oW%$ 2Ѓj ]SEpEEEEj j:]SEEEEE jht2ЍEPy oPh|2jEP:jh2ЍEPK j:Ej,xSG@Eƅx"ƅ{ƅzEEEEoRh2Xd2X1dh0Xd1dEEMh2XEj,{&PFPh2}jpS?o@XJpCCStƅt@@@jSW#vPh2G,1t&G,H[^_ÐU WVS]1SЉǃ tVCx1t&1PhCPh2pCxƀ1j SЃj Sо tSrjSо tSjSо t!jSЃjSоe[^_ÉUS]EfxtCPh2蔙EPEPjStʋ]ÐUWVS}hEpt\FhPMV F@ X j@sƒXFX0XRsEPEPjW tjWe[^_UVSut&j@JsXttCB CXSQ,stK(S맍&e[^ÐU WVSUzG @ E_0C0B p REPuC@;&C4C0C0VhTPVEPh2 WG(e[^_ÍvU WVS}u]j@@rESVEPEPE PWЃjWЃjWЃh NLS1ۃhLSЃC/uWЃtҁ0uuEPq9t&jWЃWЉÃEPq} tE 1e[^_ÍvU WVS}MU_x2fvt&E 2E f2ƃ2Ѓf2fǃ22G|22tPF PQV2 jjjj2j WX t .}t$2U fPEPF P1e[^_UuÐUEx\u P` @`ÐUEx\u P`l@`@lÍvUEM x\uP`žf@`fUEM x\u P` @`H ÉUEx\uP`œf&@`ÐUEx\u P`,@`@,ÍvUEM x\uP`˜f @`fUEM x\u P`,@`H,ÉUWVSM] u}y\uQ`¨ A`y\uQ`¬ A`y\uQ`° A`y\uQ`´EA`Uy\uQ`¸E A`U[^_ÉUWVSM] u}y\u Q`PA`XPy\u Q`TA`pTy\u Q`XA`xXy\u Q`\E A`UP\y\uQ``Et&A`UP`[^_ÉUEx\u P`¨ @`ÐUEx\uP`P &@`@PUE} t>x\t@`fǀ& f;EfF  f}t}t]f\[^_UWVS]} EfEE@tAusMufDEMt t&}tHfLffEfz Ef~Eft&DEtEfDt Mf }t"oMfL[^_ÍvU,WVS]|/jjV芳puhX2jS]nVP莣jjPG u/jpfǃphs2jS1&F9}tPjjhjhWGЃ tʃh2jS誇9},Nwt&4WGЃNyUv@jEEPjUURjhVWG$Ѓ jtRVuURP@,Ѓ PjjVjVWGЃ jjVtWG Ѓ o@ |jEPjURjVVWG$Ѓ :jxPVuEPWG,Ѓ PjjVjVWGЃ jjVxP@ Ѓ @ UjEPjURjhVWG$Ѓ u|jE$PVuEPWG,Ѓ uYPjjVjVWGЃ u:jjVU$WG Ѓ u@ U$1yh2jSN1ft!4WGЃF9|߃jpZjJǃpǃe[^_ÐU|WVSEfEUJM fMt]SuTUE P$u fCU@M A t ]tMQ$f A ]f C u ~ UM QRjq$q ]SP@ Ѓ tu F,eE@EPU r Ȼ2B t2PM q$hӻ2j@]S趃EEf@ U9U9u1ۋMt0E@EU,MD $MʋE@EU(.E@EU$MD $MʋE@EU MD MʃEt$t UBPh2j@MQ EEf@U9U}MA9=]9]ZuuEUtЉEMfMCf]uf9dE@j@UR谝MAEE]9]}wvMUu$u2]D ] uD1M4 4]CPCHPh2j@uV fCEEE9E}}~URMQ]STi1ҹuD2]DD2 D IyE1uy tjj@PQA Ѓ E9EUx t)M A tR]sjSP@ Ѓ u t'WEPUR{hMAGAGA G A fG A fG AfGAfG1ɋ]DDA ~1ҹuD2 D D2$D$Iy+WEPURgMAGAGA G A fG A fG AfGAfG1ҋ]DDB+~h2juV URP@ЋM A,fW]SuV[gCGCGC G C fG C fG CfGCfGCfG1ɍvUDDA~B$G$1ҹ]D(D(D,D,IyEufgx[^_ÐUVS]ރEPEPEPSЃt3ǃEPEPEPS"ǃv1e[^ÐUVSuU\z t&E @ tQsjSRB Ѓ SP@Ѝe[^ÉUS]hh@`S u4tjjS@hjS@Ћ]ÉUS]E tPh22jS}j(Ph52jS}]ÐUS]`2f=`2t#S$f;uA9uvf9u1[ÉUuu 1 &ÐU,WVS} ]SEuh2]ht&C 4C 8CLJ0`$Ѓjs s +ƒtu-jjjEPEPjRjS}0t&1uh2guE艇E쉇js s Ƽ Pjs s >j0s s 覼$Pj0s s EPSth2Yguuuus 襾ƃGPWh@j@uuuus Ⱦ<0u7h2ftVh 2fh'2f}u)2Ph+2fWfW=th@2fǃuQSSupvHu>Puǃǃ <tu rxr ǃǃS?SV߃ Swk$2ЃS*9uYNxrD{8u S< C<u+QS$fǃ Se[^_ÉUS]tM{8K< t&j LSЃ{8tmK< @uq{8t+K %ǃ{8t‹KfSCfVfSCfVfSCfVw tc t t1}fF fFfFEfF fFfF]UfFfF?fF0MfFfF=fFt&SCV SCV#t&}W<1ECFCC*EFFCFCC*EFVSM\E9Uspj LSЃEx8u"GЋMQ<+t&E@jCPSt, u!CC뺐t&@E'E}~@te[^_U WVSuxt V@Ѓ~8uXV<V|k+E܉A SEBEBEB fEt(9uURqPdt&SPdEEMA\@tv1Ҁ>} | 2Ћt#tt2&x+2Ѕt@u7RCPѕPwG @ph32/ E@XU;ru2Mq}uu~jj莵ƃt"jVFuV輤1}t%CC ECUSSEPRuEvMQ B% BEH S % ЉAUB B HJ ;BuB C4u 0vX48P8˅^Ѓ~MqEE1E}t 8EP 9Re[^_ÉUWVS]EEE9nMQB @t @!S{8t_StV<VVE G=UBL&EEPEe[^_ÉUVSE@tb!u SXt5Pt"VSt9t h2Xu ǃ<$Ѝe[^ÐUSE@t5Xt,Pt"SPt9t h2Z]ÐUSEfǃ8twt S t34 2sC @ph 2 tPS3ǃStlP$uRsC @phE2_CPuǃǃS7SN]ÐUVS]shfFD"ǃ@$ǃ<p$ǃL@$fFBǃ8lЃSh$Ѝ@PaPBP%}2=ua2RƒRP 2ЍLPsC @ph2]DS@h$h8$jCLPS S(V+cVe[^ÍvU WVSu] XE؉\Mɍ`MdUhUUډlKpE+}txE؉|UҍUډMى{E+EÉ[^_ÐUS] UEC KPR)SB%? B]UE@$f=utt tu1ÍvUEx8uXP<t&PHÃEPVh`$jPuuuuw aHF00u7h2tSh2h2utSh2^jVjEPvVh2tWh,2h32`UBpCPEp p iqƒjEPjCPC PjRCPURq@tEPh)2CPEp p pƒjEPjPCPjRCPURKq@t(EPhG2E0scCPjjs; uEEPh@2SU2ss @E0s *1e[^_U WVS]} j w w pƃtwjjEPjj w w p Ctuh2@t$E=vCtPh2jjjC|PCxPjVj Wo0ЉStGuh2=<&[DCH%CL%CP%CtVh"2e[^_ÍvU WVS}_tX v{xuWS| GS|DujLSЃNƅu1 &e[^_ÍvUS]Smt SN1]U WVSu1E;~8}at&u=C$t7St'SMtu  t&uǁEE;F8|e[^_ÍvU WVS}GE1_,t&Ct30t Uztu $fCvVwEP tcρ<F~e[^_ÐUWVS}U )ЍǨU~LjURjUURhhhP@$ЉÃ tSEPU RGPh@2jVRhuURP@,ЉÃ tSEPU RGPh2VjhhjhP@ЉÃ tSEPU RGPh2t&jjhv6P@ ЉÃ tSEPU RGPh2MvVRjjhP@ЉÃ u1SEPU RGPh@2؍e[^_ÍvU WVS}U )ЍǨUjjuuvP@ ЉÃ tWSMQE PGPh2>;vG|] LB MG|U ȉz t(MtPFpjPRB Ѓ 1&t&ND ًNF$DCF;X|׋FPFLz tjpjPRB ЃxuG|] TG|TW|M DDxG|R ] Tt&xW|E$M ʐt&]^ 1e[^_UVSu] ~xuV|V|  V| ڀ ڍ )ٍt[^UWVSuEU )UDŽ0t~xuF|M T vF|U \}u@u;G EF|M ȉEeEU/F|M Tw~xtʋV|G M ʍ&z t&G tPGpjPRB Ѓ wP@Ѓ~xtF|U \t$PMQE PFPh2kM u!PURM QFPh2BMtMEe[^_ÉUVSEX{xupS|TS|THS|DD[^UVSuM )ȍƨ2uǃ@2 vǃJ2ЉKsjjjRtǃt&FPh`2]1e[^U WVS] }uSɸEtuVWSEP&VWRSEP tC CCC SCe[^_ÐUS]CC.u1ju(Ph2ǃ1]ÐUVS] sKɋEuMǃSh %uuVy/ u!FPh2)ǃe[^UU JɋEuEp M/ÍvU WVS}u 19}Kɸ2s2P2Ѕt2RJ2Ѕu@2Ph2C9|h32{e[^_ÍvUuNÐU,WVSuE @)EU RVr}}Yh&2X2uF @uh,22t&M QV~tt:h;2hO2Ft~ttN0Fdl%F4F5Ft*VA9vЈEEFfEAt[FEf@fU fUfMT8TuT8TƆ@fU>t>fAEFEUT8TuT8TtjFE`VwFEf@EC@wƆ@fEfEU%@F9vЈEEFfE@Et&U)Du"E}v}vNMAPjELMAPjD*8&EPMQ|Et&UBPjEPq EE})Dt%3P EDt EE}v}tExxhMQ@|MLEPj@Urlrh!MQe[^_Uh2TG6+h2AG6&h&2'G6U RWG0ƒW0tt G0Gdl%Ѐ6t G0G4G5G`1%ЍGuEPURVE PEU;W8e[^_UWVS]E @)EE PS}uEh&24E PSh32{ttK0Cdl%C4C5C6C<u FT'<uM EFT FT$ E^fVVFX9Ӹ ME FF1 ^FT$E+G+UЍBe芃T$ EE E<E}}tUzxJWMA|MLWEPjHUrlrh MQjPEplphe[^_UWVSu ]U)ЍƨjPvlvhEUB(z*t'E jPr r @tE %E3}u LJ@2 LJJ2ЋEGw8I}~tLjjjuFPh`2}t)Uu!FPhD2边t&LJEPURWEPh5%ЍEPEPURWEP uUREPWUR4_WgtI}uCeEp X jPSV10E PjPSV URjWEPe[^_ÍvUWVS]EjPslsh EjTslsh E1E;C8}Kt&u,uEu uEtV%'tEG;{8|Ee[^_U WVSu} _)hO2FtFG0 tG0=Ht0w=Ft7=IG0G6Gd<%yG0G6v~ G0G6ԃ~ϋwh_ljpSV %PjpSV`  wh_ljxSV %PjxSV<  Gdl%ЍW EEphXljHSVE PjHSV EMU;J8/ӁèvWEPURõ Mu&EPhD2耎&WEPSU Rݶc%Ё}~L%PEPEPWSM Q׵ uWEPSU RSS1t!uMQjEplphuWURSM Q诶 S#EUE;P8e[^_U,WVSEEPUEjTrlrhEMQ蝮UB.f j tDjHMqlqhQЋMAsy2vA2EnvƀnEU,U܋MyuUB\L ¸ !U0u]t& E EfxUBL EUB T$ EzjHMqlqhC EEphXljHSV#E PjHSV Rt&MQA9~AAUBR9~M܊A<vPE܈PU܀zuB M EUBMIhMURlUMYU\ZTЃ߃WMQEP_‰ك! PWURMQ E<E}EPjTUrlrh}t6MyxuEPQ|Et&MQMA|MLEP5e[^_ÐUWVSuEjtvlvhE1E;F8}Ru7Es/S uWFPh2*EG;~8|Ee[^_ÉU,WVSE PURG EEU B(z*u>&Uu Evtt tuh&2pE PUR@h32SE@0xtt@0@dl%ЋUB4B5B`h%ЉB<8uO}uIB6U Bu E&tPEPh2ԈEE@8CUB8BwE@6 t&u}u UB6E@6EUB89Eցƨ&U~EEEZPSUrlrhJu#EPhD2 WEPURtxEshj%ЍEPEPVE P<EPEPURVE PG F FFF V8V EUB89EUu Evttt jPEplph2$EUrhZljPSV0E PjPSVjTEplph$EUrhZljTSV0E PjTSV9jXEplph$EUrhZljXSV~E PjXSV UBv uU}uOjXEplph/À UzhrljXVW  PjXVW{e[^_ÍvU,WVS}wjXvlvhEWҦEw sRt {t]tt&CwE`TEtTETtE0TE@TELTgETETETNETETET7FPh 2&WV|EE_,CUUeGMD@PvlvhC t)$fC+GUs {vCCM't8KvC9~KCM M E vCMRGUD@Pvlvh<E}&}t~xWF|MLWDe[^_UWVS]E1E;C8U{xu C|TC|DuQEPu7WCPh29{xt C|TC|T t&EEG;{8zEe[^_ÐU,WVSu=hMtG=hbt@=iMt9=ibt2=ut+=uRt$=urt=v3tjPvlvhEE PVݝ=hMt5=hbt.=iMt'=ibt =ut=uRt=urt =v3teE =hMt7=hbt0=iMt)=ibt"=ut=uRt=urt =v3t}}Mh&2ځM QV譠F0 =3Mt=8Mt=0 t=0MuN18v3uN1 ~ttN0Fdl%F4F5=iMt#=ibt=ut=uRt=urt=v3uF6u=0 t?=0Mt8=hMt1=hbt*=iMt#=ibt=ut=uRt=urt=v3u F6(t&=8Mt=0 t=0Mu F6 t&F6=hMt1=hbt*=iMt#=ibt=ut=uRt=urt=v3u 4v% t&s%ЉF`FE2ЋECECEu҉UC,EC0Ejhh%ЍEPW#e[^_ÉUE tPh2`Eph2_Ujh2uPÉUWVS} uF&f0jv v ʴÃf0ujv v 觴tfSjv v jv v zà t@jEPj4P8PjjjV0tTh2_jEPj4P8PjjjVw0th2^EPVst h2ruuuuv ÃGPWh4;jPuuuuv (0uMh@2d^tSh_2O^hf2?^u48(/"Shh2^FPWPe[^_ÐUjh2uPÉU,WVS} uF Ejv PѲuh2]5EPEPjv EPG th2o]G4Pjuu6J+ th2:]G8EPVγth2]t&uuuuEPTÃGPWh QjPuuuuEPvG00u8h 2\tSh?2\hF2\!t&ShH2v\FG2J thU2J@thk2J}h}2Jhg2JF@ B@Mz !jtpjPRB Ѓ Ez tjFpjvRB Ѓ jWjCPFPà Mz tjFpjvRB Ѓ F@ B@Ez tjtpjPRB Ѓ uG\2jSGXG4t SPQSWdEz tj tpjPRB Ѓ E Mz tjtpjPRB Ѝe[^_ÍvUS]uf틓$fB$fBh'LSйufu@t It Ӑt&u2CPh2?H @ *Stً R Puf틓 fB fBuf틓 @fB @fB]ÐU WVSu^4fCBTxJ&E ufu@tItӅu$FPh2F&UuG G Bf}CdtChtChxChC`WttRP@ЃGtPAG9udždžvGxe[^_ÐUUB4uf`Dǂf@BÉUVS]hT ƃt6CPh2ES SS PUq5u7Ѝ\PVe[^UWVSuEF4E@DuNV 1a1fJV9V8 f tf@u& f!& f!X ftt݋fX vzEt V߁tFPh25DE@\$tpPFPh2D th2Cth2Cfth2Chg2CV P "V"E@duf틖 fB fBu$f틖 fW&B fB;V*f@Et P;Ee[^_U WVSu }jj1Ãu vjSCtgswjWWS S;w)<)PC CPrC<+C CC UhSvP@ЃtSdEz tjFpjPRB Ѓ WF@ BF@ B^HF@ B 1e[^_UWVS}E7ExvUUE@SURVztStS$CuEUU}&E9Et UG4tUrP蛕Uxu3t)Cu LJC }Eu Uz t!jtpjtB Ѓuf틖 ft&B fBfGBe[^_ÉU WVS]s4Eh/ǃSS1Ƀut&A~ʃun싓n$Bn$Bnun싓n Bn Bnun싓n$Bn$LjBnun싓n Bn Bnuo싓o$Bo$LjBouo싓o 8Bo 8Bou싓$B$Bu싓 @B @Bu싓$B$Bu싓 B BS7uCPh 2 vS7u/CPh`22=SWM&FEt.u싓 <B ,u싓$B$BFDu싓 B  @ &Zft@  fft&u싓$B$BS9 R P3f@Z&(tR P f@ f@&EPfFD @fFDpu5u7Ѝ\PWve[^_ÉUE@Dt R1ÉUVSEu PfLFHFe[^UWVSu E8hEURVG4EPUR2à *2i w!1i  i t*i tf5i 6i(UJDUxu!WEPUR WUBDtWt&@t W1q1i uEPUREPUR<Ã4u;W)1ۃ+VPEPURà t&EP؍e[^_ÐUVSuFdCPh28S.SS t Ve[^UWVSuF4Ef@Bpt\Pu f틖 fB fBuf틖$fB$fBu1ft&f@u1 @u1 @1E?vtjPTyEt5tSP@ЃSP@ЋEMyhf1EtPEt6{~SP@ЃSP@ЋEMyhPIfEf`De[^_UuÐUVSM] Dt,@fXDu(ڃ@ $@؉fσ@D [^ÍvUVSM] Dt%@fXDu#ڃ@ f@؉fԃ@D [^ÐUVSM] Dt$@fXDu"ڃ@ @؉fՃ@D [^ÉUWVSMu ]Du@f v@fpDu@ @\ [^_UWVSMu ]Du@f @fpDu@ f@f\ [^_ÐUWVSMu ]Du@f @fpDu@ t&@\ [^_ÉUWVSu] Dt'@fZDu6ڃ@ 2@fԐڃ@ #؃@L Mt׃@L [^_ÐUWVSuM Dt/@fJt&Du9ʃ@ 5v@fѐʃ@ -ȃ@\ U ӅtӃ@\ [^_ÍvUWVSu] Dt(@fZDu7ڃ@ f3@fӉڃ@ f(؃@L MtՃ@fL v[^_ÍvUWVSuM Dt(@fJDu7ʃ@ f3@fӉʃ@ f)ȃ@\ U!Ӆtу@f\ [^_ÉU WVSu} j jVt&tjjV jjVjLSЃj@jV[jLSЃj@jV uj jVj@jV!jVÃj@jVÍe[^_ÐUVS]EjjSj@jSjjSj jSjjS0j@jS#hSu St jSPCPh`2j jSjjSj@jS+j jSjjSj jSj@jSj@jSjjSj jSjjSKj@jS>hSt- jSBPCPh 2d/j jSj@jSRjLSЃjStEj@jSjLSЃ uj jSjjS}j@jSj jSjjSj jSIj@jSV1*VjjjjjjhjV%0jj]S}Wjjjj'V%0Vb.GE戆CCCE舆P%PhM3dž 0h\&h&j8 SIjjj#Su jjh# Scjjh#ST jjj&SEjjh& S6 jjh&S$jjj Sfdž jjjjjjjjVz$(j S胞v0E@Lf@Ddž0&džldž&dž&@Tdž$ǀjFPPEP{V-Vh&Ѝ PEPYnEP Vhl%jh@7pe[^_US]tw@tP@ t'@StovՋ 뮋1눋1: ?Dtŋ@t@ t@1]ÍvUVS]hLSЃtwt&1u @ @@ t]hLSЃFo~ƒZ3Ѓ uCPh[3U1돋R1e[^ÐUWVS]uE @EtߋUPu  E @ EtߋUP 1u@ v@@ t6j2LSЃF'vƒh3rt拃@jh2h3 t6h3,2/&0/t΋2ЉB,tϋ@0S#t"CPh30N21;52s"VWSuwx F;52rރt@0&1u @ @@tKj2LSЃF'vŃh٥3QE% E1t؋UPtҋUP 1e[^_ÉUVS]1&u  @u3j2LSЃF'vƃh3[t拃@t&u @ @@u1h 3e[^U,WVS]u }Džu 1t&-2=wvWh@3>&=wv Whj3#jE䉅PRS-tWh3B6uF P fDžDžDžE쉅fDžRPn f;FPFPWh3Dž,(F$F E&E0z tjEpjPRB Ѓ [B,TFB(t&HFB$&:EA &3EB&%@0StWCPh 3Džz tjEpjPRB Ѓ PS[^_ÐU WVS]1t?@ x >j j,j P@ Ѓ !v 뿋 pH 9t P PSA 9t P PSVF9u S-d t-h 9` t0 PT PS | t- 9x tL Pl PSuHx tj j,j P@ Ѓ @ C0Pe[^_ÐUWVSE0EEU B8B%P3RËU 9EEUx tjjURUr P@ Ѓ @t)C PEPh@3%E@\jEPCPUy tjEPrjpQA Ѓ EEpRBЃEEpRBЋE0jP<CF FUB4t VP`OC tM C tMC } M@vC tM C @t M&C tMEF VUR}Ux tjjURUr P@ Ѓ  uEE1E vEEU B9-U Be[^_ÐUWVS}G0EUBEZCu1ۉ jjjϟUj2OM@mUP@ @APjjhjhRBЃ )jE0pRBЃz tjjP RB Ѓ jFPEPvE@@ E@@ 1҉1҉Fy tDjEPrjpQA Ѓ z tjjP RB Ѓ UBCu 1ۋ ;]tUjjj7Eu7UrP@ЃE0{juw9e[^_ÍvUWVSE0EU BEr BEU;ut&Ez tjjPEp RB Ѓ $<ufEz tjGpjwRB Ѓ UwP@Ћt P莌CCE@`UfbDFuE 1} vM;ut }(U r EBu UfBBe[^_ÍvUS]u  @ jjjjjjjjSv$jjjjjjjjS]$jjjjjjjj]SD]ÍvU, D0Kt‹ A(vt B,t@0Eu@ t&@@ trj2LSЃE}'~h3^,1H(1R$1X01bt@,t@(t&t@$t@0t&1UrP@ SWEPWURWEPWURWEPWzURWmEPW]URWPEPWCe[^_ÉU WVS}uUjWRjWURjhU RP@$ЉÃ UVWRU RwURP@,ЉÃ UW RjjU RjRP@ЉÃ uTUjjU Rww P@ ЉÃ uG @ G1OUw P@ЃUU RwP@0ЃUwURP@(Љ؍e[^_UVSu] s P@ЃC psRB0ЃsCPRB(Ѓs P@Ѝe[^ÐUWVS] E8jPEURSG0EPUR-hƃ %2i w(1i  i t4i t_&5i 6i(vUJDUxu,WEPUR UBDtW@}W+ o1i uEPURrEPURt&dž.t&džot&&džhEp UR+<hEp UR+ljjEp URg+EjEp URP+E܃j;jPŦEUBUBLXSRjP蕦EUBDt'@u SkS[S @t SEPY1i uUREP0UUREPzVǃ4uyUBD@tLjPES-S$ u Ss%Ss-EP˥1 V@PUREPce[^_ÐUVSu 8u Pu @@tfFB:P>atCPh3fDS6Fde[^UVS]s0SmFDtfǃfǃTt&fǃ fǃT S!tCPh@3StCPh3.SqS S#tCPh3SXS#S FD @fFDu7P|P.}PS+ǃe[^ÐUVS]jPˣƃSVϣe[^UWVSuEjP蓣E~0 8u P @uEPr1 tE|S|džP'_V u7PS1| }t"GD@tjV&V^ MuGD@tt WFEPӢe[^_ÉU WVSEu W^ 8u Pu 3@@t)uBPPWbƃ"ufǃfǃƃFF t|Fu F+cdt, t:v=t).&F#&F&&F0fuNN e[^_ÐUSE@D% t Ѓ$t3ƃfǃ~/t&ƃfǃ~ ƃfǃ~A%=u ƃXvƃL&ƃfǃ~A%=u ƃƃCPhX3ǃS1]ÐU|WVS]EEE1f w0Sf w|77&(URjjh?j h?P@Ѓ t (jU RuP@Љƃt"(uP@ЉvUJ9~(R"&t uEE9MIEMȋUD 1҉EUẺEPUt $EURP'EE9E19Ek$EUTWD) GG F9u1EEă EU9Urb$EEȃ MGEȃ$  WG F9u1MEEEȋU;Pt+EvUf+BfE MEȉA(z tjEpjPRB Ѓ O  uCfu9SvU(uP@и7X 8u@8v8t&@8v82 uU rS1x[^_ÐU WVSu1ɋ 8uB@8v 8v>jPuP8v8fEf9fH@%fCf;u1ۅtrWVk 8u#@8v 8t&@8v8ÉWV1Ƀf;][e[^_UVS]jP苛ƃSV菛e[^US]M fu&l+)9|SDu1]ÉUUE $flflf='v flÉUWVSu ?uO8v8O8v8?u$O0v89t'O0v89?u#Ov4t&Ov4?u$Ov49t'QOv49/?uW(4 G(4 8uP 49t@ 49 8u P04 @04 8u]PXP$aP(4 P 4P@ 8t@ʃ 8u"@v4 Pv4 8u'@v4%&Pv4 8@ǀ(4 8@ǀ 4t& 8@ 8u P t&@@fdžl1[^_ÐUVSMY0 8uP @CDt. 8u6H/Ht 8tڋ@[^ÐUS] 8uPP @狃 8tۋ@[ÍvUWVSDžE0U{ 8uPPB@UtPU 8t@hLSЃ߅t{4R(j.PSVtB{t;jCPS tHEDžu~OU 8uP @U 8t @4P&jjRPEP+r Euw 8uPP$@U 8t׋@hLSЃEtP5[^_ÉU WVS]s0jP_ǃPNPS1S= TtFD@t S1Su7P|P"mW e[^_ÐUS] 8uPu{@@tkPPPSٱ3fuͱ3PPCPh3Ҹƃǃ3u*fǃfǃCPh3蓸ƃ]ÍvUS] 8u Pu C@@t9uRPPPSƃǃ"ufǃfǃƃ]UVS]s0S]P5|Pl􍃔PkS SffDe[^ÐUS]j fft6CPh@3PPj  ffj j, ffP3tCPhx3襶w ǃ]U,WVS]E싃EjPu ƒt h3vj(P,PPEPjRjEPE0th3-t&1F"WEp p ƒtۉ\j8P<P0P4PjjWEP E0t h3ǃ<EPEP t hѲ3yuuuuEP ƃCPSht%&jPuuuuEP `0u9h3tVh3״h&3ǴVh(3貴E䉃 1e[^_ÍvUS]`t PR ǃ`<t804Hǃ<,t(ǃ,]ÐUVS]V1fǃlVe }CPh`3DvPVdi}CPh3V4}CPh3~wvVI 8u Pu @@t ƃƃtPPVMfǃfǃ1e[^ÐU WVS]{0jCPCPPGLǃlGTʚ;[0fGDǃX!&ǃ(!&ǃ#&H$hx&&h'&h@VDI ujjh+VaIjjj+Rjjj#VLIjjh#V=I jjj&V.Ijjh&VI jjh0V Ijjj0VI jjj VHj VIWW8e[^_ÐU WVSus~ f}Wj SOf}5Wj SOf}Wj SOEfEPj SPS?WjSQOMEPjSZPul}Wj SOMEPj S'P t7S?u'WjSNuMEPjSOPu dže[^_ÉU WVS} uUFV RjjWjWP@ЉÃ tSEPh 3躯FjVRjVURjhWP@$ЉÃ tSWEPh`3xFjVRWvURP@,ЉÃ tSWEPh3=_&UMURjWvv P@ ЉÃ u~1PSEPh3 FWvP@0Ѓ FvURP@(ЃFv P@F ؍e[^_ÐUS] Cs P@ЃCssP@0ЃSsCPRB(ЃCs P@Ћ]ÉUS]jjP‰$tPR1CPh@3 ]ÐUS](S}uIPǃǃfǃ1 ]ÍvUWVS}X 1 9u!A v8t&A v8 9u+A$v 8v1؉#t&A$v81҉ 8u'@(v8&@(v8 8u!@0v81"t&P0v8 8u@8v81P8v8wGrB Tt&PUP,8Pu ` 8t@ 8u"@@v 8!@@v 8v 8HP,8  8:@ǀ LJ  ~ LJ [^_ÉU WVSu$tx1ftK;t1(sP@Ѓ(sP@Ѓ3=@G9|$tjPdž$(t dž(e[^_ÍvUWVS}G0Ef;E@ E;tbE@`(z tjCpjsRB Ѓ (sP@Ѓ(sP@Ѓ3E?F9u1$@ c} ~OÃuE t7jSOCuSS>U x7CC CC C$C~LwjSDM \U<Ѓ`jjs swP@ Љƃ t SpWSVGdt P4ǃdǃhUB 8u!@(v (t&P(v(0FT9u 1LUEMA Pe[^_ÐUEM UvA u@tJ A $`<`uJ ÐUS] 8t"@@8 8u%P"t&P8ډP@@ 8t@[ÉUE 8uP@ǀÐUE 8uP @ǀÍvUUEfEujEPRu1ÍvUEUH Pu q q ÉUSE]@ u p p f]UEP  Pjr r ;ÐUEP $Pjr r UWVS]u }Mv!ڃƒtBvBwqyA0+qGAY qA QAA0[^_ÉUWVSMt) 8uPu@@EU 8u P@ @@]uÃ؉򉁴EU 8uP8@ v@8@]uÃ؉EU 8uP@ v@@]uÃ؉򉁤EU 8uP@ v@@]uÃ؉EU 8uP@ v@@]uÃ؉EU 8uP@ v@@]uÃ؉EU 8uP@ v@@]uÃ؉EU 8uP @ v@ @]uÃ؉EU 8uP(@ v@(@]uÃ؉EU 8uP0@ v@0@]uÃ؉EU 8uP@@ v@@@]uÃ؉ EU 8uPH@ v@H@]uÃ؉ $(EU 8uPL@ v@L@]uÃ؉$(,0EU 8uPP@ v@P@]uÃ؉,048EU 8uPT@ v@T@]uÃ؉48<@EU 8uPX@ v@X@]uÃ؉<@DHEU 8uP\@ v@\@]uÃ؉DHLPEU 8uP`@ v@`@]uÃ؉LPTXEU 8uPd@ v@d@]uÃ؉TX\`EU 8uPh@ v@h@]uÃ؉\`dhEU 8uPl@ v@l@]uÃ؉dhlpEU 8uPp@ v@p@]uÃ؉lptxEU 8uPt@ v@t@]uÃ؉tx|EU 8uPx@ v@x@]uÃ؉|EU 8uP|@ v@|@]uÃ؉򉁄EU 8uP€@ v@@]uÃ؉򉁌EU 8uPˆ@ v@@]uÃ؉򉁔EU 8uPŒ@ v@@]uÃ؉򉁜EU 8uP@ v@@]uÃ؉򉁤EU 8uP”@ v@@]uÃ؉򉁬EU 8uP @ v@@]uÃ؉򉁴EU 8uP¤@ v@@]uÃ؉򉁼EU 8uP¨@ v@@]uÃ؉EU 8uP¬@ v@@]uÃ؉EU 8uP°@ v@@]uÃ؉EU 8uP@ v@@]uÃ؉EU 8uP@ v@@]uÃ؉EU 8uP@ v@@]uÃ؉ EU 8uP@ v@@]uÃ؉ EU 8uP@ v@@]uÃ؉ EU 8uP@ v@@]uÃ؉ $(EU 8uP@ v@@]uÃ؉$(,0EU 8uP@ v@@]uÃ؉,048EU 8uP@ v@@]uÃ؉48<@EU 8uP@ v@@]uÃ؉<@DHEU 8uP@ v@@]uÃ؉DHLPEU 8uP@ v@@]uÃ؉LPTXEU 8uP@ v@@]uÃ؉TX\`EU 8uP@ v@@]uÃ؉\`EU 8uP@@@]uÃ؉򉁬EU 8uP @ v@ @]uÃ؉򉁼EU 8uP4@ v@4@]uÃ؉ EU 8uP<@ v@<@]uÃ؉ dhEU 8uP@ v@@]uÃ؉dhlpEU 8uP@ v@@]uÃ؉lpQ0BlBpBtBhp B\Bd[^_ÉUVS]sVh3މ 8u P,8 @,8P 8u@@v 8P@v 8PVh@3n 8u P,( @,(P 8u@v (Pv (PVh3RPRPVh3Ԉ0 8u"@8v8!&P8v8P 8u@0v8P0v8PVh3=PVh 3$|Vh`3Vh3tVhŸ3xVh3ԇpVh 3e[^ÐUVS]sRPVh`3葇RPVh3x RPVh3\RPVh3C RPVhϹ3'RPVh3 RPVh 3RPVhB3ن RPVh]3轆RPVht3褆 RPVh3舆 RPVhź3o $(RPVhں3S,0RPVh3: 48RPVh3txRPVh3 RPVh93e[^ÐUUBH=0 At w= At9t&=P At =t$B)&Bw BB1ÉUVS]{ h NLSЃh@jS$hLSЋC t jhS$h!hqS$jhyS$hh0S$jh1Ss$hh2S`$jhSP$j?hS@$jh hhsS!$ h3jS${ uVh S"EurVh S"M%ʃpf@v f@u% p fMPh S#jh Sw#e[^UU{$`3Ѝt tBBBt&Bt&Bt&B~&Bn&B^&B N&B >&B .&B &B &1ÐUMyt ǁ=(t={u AGyv:A8u P@@ tAǁA vAÍvUVSu~u VzF8to@ǀF8tJ@ǀF8t$@ǀF8u9P6PދP1뵋P돋@@džh'LSЃF8uP@F t u% PjVNhLSЃ Fw[$P3Ѝt&SjVjNLF8t@X6vP"PF8t@Fv wy rthj LSЃF8uPPv@H F8t@HF8u P@@hh NhLSЃ~vFF8uP XP X"@ XߋF8t܋@ XvF t ugV2F8u0P+Xȉ4P?@F8tŋ@F8tċ@ǀ&F8u P @~ut V/1e[^ÉU WVSuV<Ãt#P812PRVF8t΋@@8V;~uXVF8t@ǀF8uPP1?@@hLSЃV4~uSF8t@ǀF8u P@@hLSЃt V1ɋF8u'@~vR t&1#t&@~v RAvt7F8uPXȉv@F8t@Ftw tr~$ul]ShVEPhVMʃ fE`f fuf9v fMShVVÃ~vNF8u P(8x(8ȉ&@(8F8tӋ@(8V=؍e[^_ÍvUS]{uFCt u9EPjjSU,u&EftfEPjSu1]ÍvUS]EPjjS,} {u9E%0u C%f= uCPTt&C{uc{w ucCCT{u E%C8t@Hv{uMSKP(QP,TP0VPp]SC8t@@(C8t@@,C8t@@0C8tPpt&CC8u@h{v`!1t&Ph{v`!C8u@`{vh!1NP`{vh!.C8u+@h{v `! $@h{v`! C8@`{vh!C8u'@h{v`!$@h{v`!C8u*@`{v h!t&$@`{vh!ȋ]ÍvU WVS]1C8uP@0{u {S5SSnL<S* Ct#rttt& 1 *!Px!P(C8t@x&C8t؋@0vC8u P@@KXhLSЃ{t,C8uP%9tj&@%9uU1h'LSЃC8u P@@uF1v̓2uC\S u C\1e[^_ÍvU WVS]C8u P t&@{v5@C8t@?pȉ5pȉ@C8t@S@S|Cv t t t u ǃ${qSh:LSЃC8u"Pt&pȉ#@C8t֋@jSH7}WjSC t u ǃfeƃ[&ǃMʀfUt ~+t$t&fM& fU &MEPjSs8{@uC@u ǃf unWjS+0eEPjS4Wj SfeEPj SEPj SEtt t&S<twt &tvMEfEfeEPj SluVjS05UfUt/~)tt fUt&@fU &M`E$fEu fEEPjSVjSE pfE{Lw$fEPjSmS`Y/fu fǃ/S/EPjSMEPjStSǃS1t&uVjSVjSjusEtP{wS2tUt&SSu4{u,jSBuj LSЃfGf b1e[^_US]EPjSEPj SUfUMfMt fUtM@tMtM tfMCt-rtt!'&feEfEM -EPjS1uEPj Su1]ÍvUWVSuFF8u P@EPjVMȀfEtu fE fM<w!E $fE&P(fe߃VF8tۋ@~u?EPjV ReEPjV3M SjV' ~EuhLSЃfOufu~uV`CEuPhLSЃ]SjV  SjV fOtEt~]SjVm MpEPjVv SjV7 MEPjV@ us~wkwbjjV uPhjV u9h@ LSЃjjV uhjV u1e[^_ÉUVSMA8u$Pp؉&@A8tӋ@A8u P@@[^ÍvUVSuF8u P@~uOEPjV Et  &V E%f=tDf=uXSEPjV uOE tVE%f=uPt&f=@uF8t@1e[^ÐUSMA8uP@Atr t%t06F2"3H؉&yuA8t܋@&1[ÍvU VS]SBw{\u^uS"C{7*uVjS! VjS E EPjSEPjSUtEt{TumCkt&% f=uE% f= u CB f uE% f=tCTtt t CCEPEPSxuf}uCSu1e[^ÐUWVS]Esu{EC8u P@C8u P@@EC8uP€ @uVjS^VjSGEujS79iǃS8u<&jS8{wSt &S#S#EPEPSf}tj_C8u%P &pȉ @C8t܋@vǃǃC8uP v@C8@u %;Et U {\u&C\PxCX%C8tPCX%xvC8uP P@AC8t@vS?PxCX;PΈFw7@t2 t*C8tƋPCXxt&C8t@ΈjC8u Px @x|ej LSЋC8uP€@u4@@t$u&ǃpȉ ǃ{uKC8uPx|3@x}&C8u P@@41e[^_ÍvU WVS}v^G8u P@@} U f@t U fdU f tEf%t&UfE fUfu]tTuVjWÃu>Et.VjW9t&U fduEt f uE@uEf1e[^_ÍvU WVS}-]SjWu1SjWuE uhLSЃfNu1e[^_US]M C8tP C8uPP ␋@@j LSЋ]ÐUS]M C8t$P%&C8uPP%@@j LSЋ]ÐU WVS}EHG8uP@EMtwu tMt&PE&eG8tPEG8u P@@j LSЃ]SWSWue[^_ÐUWVSuF8uPH؉'@E]]F8tԋ@F8u P@@]SVSVi1E ]SVF8uP@EtSV$E}vSVSVǍe[^_ÐUVSu] ~uvPjVLuuSV e[^ÉU WVSu] }v!&X ȉ#v~vj F8t׋@H 1ۃj2LSЃF8u P @H uC?vʸ>@uf.vj jV[ jSVIVf1e[^_ÍvU WVSu] }~uvPjV uPSVe[^_U WVS}] uvX ȉ"v^ ف G8t׋@H 1ۃjLSЃG8u P @H u9CvǸ+j jWEP j QW)1e[^_ÍvUVSu~F8uPP "@F8t@ځF8uPP,&@@h'LSЃF8tы@F8F8u"P&P%t&@XF8t܋@XF8uPP4t&@@h'LSЃF8t΋@X&F8u P@@hLSЋF t uPF8u%P &Xȉ#@F8t֋@e[^ÉUS]{ tDEPjSuKMEPjSu0jLSt&S{u S1]ÉUVS]1EPjS`ECHjLSЃEPjS0 E$ CHEƒSLC wG$p3Ё{HP AuC<{H0 Au3,{H Au#{Hu t&SGtu1e[^ÍvUS]jjSu$hjSu jjSr]ÐUWVS}] C CCEPW!+ECuVjWE S%f=Vj Wu}E S CEPEPW(uQEUf2w5fPw 'fnw f=w 1e[^_U WVS}] C uVjW ESCEPW)ubECVjWuHUCf}2Vj WuE S C1e[^_ÐU WVS}] CCC CCCCu/uVjW uBVjWu/Eu "t SW SWe[^_UUut<uƂ1USMY(A8u P@PAH $3ЉfC@fCfCfC 2fCfC 2tFfCy tfCfC uIUfCfC 2t fCu|feE= tM=tT~Z=tCQ=t"=t!?&=u1fC /fC&fCfCfCfCfC@]ÐUVSME A8t@XA8uPp؉@@A2PLSЍe[^ÍvUVSME A8t@XA8uPp؉@@A2PLSЍe[^ÍvUWVSuE fEV(UEHF8u P t&@@EUue'&Xȉu M&UUEtUF8t!PEBF8u P&PE܍t&@@UB PLSЃ]SVOSVtMMF8?@He[^_ÐUWVSM UB8u P@@Ee11ɉM9s`t&ۃ}WEPUB8uP &@@ƒUtWEPF;urÍe[^_ÉU WVS]{(1C8uPt&@‰Cv@H{@C8tՋ@HXȉPFjLSЃC8u P@H|7v˄|+ΉC8t@H}pȉuEC8t@Ht&C8t@H?Xȉ2XȉvuC8t@HjLS1e[^_U WVSu~(F8uPP't&@X?F8tԋ@XF8uPP2@@G PLSЃF8tЋ@X&F8uPP4t&@@G PLSЃF8t΋@X&F8uPP4t&@@G PLSЃF8t΋@X&F8u P@@G PLSt&P%t&F8t܋@XF8uPP4t&@@G PLSЃF8t΋@X&F8u P@@G PLSЍe[^_ÉUVSuF8uPP't&@XF(uBF8tԋ@XF2PLSP/P5t&F8tҋ@XF8tƋ@XF8uPP3v@@F2PLSЃF8tϋ@X&F8uPP4t&@@F2PLSЃ~v㿋F8tˋ@Xt&e[^ÐUVSu1ۃF.PjVOjVp tjLSЃfvfw 1 t&e[^UWVS}UE fEЍ_(EMf;Kw)EC)9EftWt5t&G(EWtWƐt&Wf{u f}vE CPEPWCCPPW/E E9Et&jW5fUMfQBUE9rl&u`U9UsXvCPjWCPEEPWjWMUfJW EM9MrW1e[^_U WVS}11ۍEPjPWD|fufCf?vft &1e[^_ÉUVSufE1ېEPjPV|9UfUfUfCf>vָ)fEEPjj?V| 1 t&e[^U WVS}U E(f;Pw(@)9ftEP>tPEx(uEPSVEPTÃ#EPSVEP*Ãh'LSЃ EPJ؍e[^_UWVS]E fEUfU{(1f9ESct SGPjSSfu f}vE GPEPStGPEEEPSS f;usNƋUBfjPS-FƋUO ЙuƒS!f;u 1e[^_ÉUWVSuE fEUfU~(fEGPjVGPjVVGPjVGPEfEPVijEUBPVRVa1ۃ F8u P@@uj2LSЃfCfvfuKVfEEf9ESGPjVGPjV1e[^_U WVS}u ]SjjW|(ESjj Wp|E 1 e[^_ÍvUVSu1ۍvfURjPV'|DÍUfUTffv‹Fw/F8uPu0@@t1ۍӊ 2fCfv1e[^ÉUWVS]jPSrE E t&C8u(@{vT T@1#&@{v TD@C8u@{v TT@1#@{v UTUD@EEAVe[^_ÉUWVS}EGl]U։MG8u%@v TvT@1#&@v TD@G8u,@vUT &D@E1U @v TUD@EECL1ۍ&G8u(@vR 1#t&@v RCv1;]sKt&EËu VW8}wEPVW!E PWC;]re[^_ÐUEM 1ҋ@ht r t+t8CAA/AAAA QA ÉUWVSE EEX;uSxv RSExv R:U׋Ep;uCRTCRDE;u'SvR t&Sv R:EP:u+BUzvQ EmvBUzv QUG;u(CvR&t&Cv R8[^_ÐUWVS}U ] B B B rB ƁG8u(@vT T@&@v TD@G8u @v TTDt&@v TDD0[^_ÍvU WVS] }EpH9uAVTAVDE9uQv VQv V:EP:u(RxvU EmvRExv UEGUB8u"@v Vt&@v V8[^_ÐUS]1ɍ&C8u(@{vV 1#t&@{v VAv[U WVS}G8u P @GxG|EPjjWW} EftfufEfE]u|?#G| #G| ЉG|CwE$о3Љ## ЉfEf}N1e[^_US]CrP wB r=PjSm$PjSrCu^C8uP t&@Kx0C8t @;Xȉ+PC|uC8tPC|t&1]ÐUS]Cr7vF w- r(PjSt%PCxC8tPCx1]USMA8uP@Arv uyuDXAu"@BP>u*A8tP!H؉A8t@v1[ÍvUSMA8u P@Ar#v uyu@Ut&AuD@PA|Au,A8tPA|&H؉A8t@v1[ÍvUMA8u P@ @@EA8u P@ @@EA8u P@ @@EA8u P@ @@EA8u P@ @@EA8u P@ @@EA8u P @ @ @EA8u P(@ @(@EA8u P0@ @0@EA8u P8@ @8@EA8u P@@ @@@EA8u PH@ @H@EA8u PL@ @L@EA8u PP@ @P@EA8u PT@ @T@EA8u PX@ @X@EA8u P\@ @\@EA8u P`@ @`@EA8u Pd@ @d@EA8u Ph@ @h@EA8u Pl@ @l@EA8u Pp@ @p@EA8u Pt@ @t@EA8u Px@ @x@EA8u P|@ @|@EA8u P€@ @@EA8u Pˆ@ @@EA8u PŒ@ @@EA8u P@ @@EA8u P”@ @@EA8u P @ @@EA8u P¤@ @@EA8u P¨@ @@EA8u P¬@ @@EA8u P°@ @@EA8u P@ @@EA8u P@ @@EA8u P@ @@EA8u P@ @@EA8u P@ @@EA8u P@ @@EA8u P@ @@EA8u P@ @@EA8u P@ @@EA8u P@ @@EA8u P@ @@EA8u P@ @@EA8u P@ @@EA8u P@ @@Ey'A8u P@ @@EA8u P @ @ @EA8u P4@ @4@EA8u P<@ @<@EA8u P@ @@EA8u P@ @@Eyv`A8u P´@ @@EA8u P¸@ @@EA8u P¼@ @@EUEtju-fǀfǀ(fǀPfǀ fǀǀ@8uPX1&@ǀXÐUMApQt9ǁf;fu ffA8tPXg&PXMPX1?t6w.fǁǁA8tƋ@ǀXÉUWVSu }OV# 3#3ЉEU}UEU t%3Ћ3#E#U uUjEPjPPLPjjjS#0tPh_3!RjEPjPPLPjjjS0thv3I!F0EjFPPFEP58v0Ef@Ddž&dž&dž&Ѓj,s W vfj.s WufVh EPS`wth3 k&uuuuWwÃEPVh&jPuuuuW xH0u;h3B tSh3- h3 t&P荦PSh3 h&h&jS躶E艆 dž$&dž( &dž,&ЃjjjjSV!H0ujjj"S衶j"S. j SVh(&Ѝ0PEPbEPVhl&jh@7|e[^_Uu7ÐUWVS}] 7EhE2i w%1i  i t.i }85i  6i(ODUxu,VVEPF0PV{V GDt@u)V v@tV7V"VaVr1i uF0PURsF0PEP輨E}4u;VE&SPURW艵E t&EEPEe[^_ÉUVS]2jjV]u(h3-P OVPL% LtP@ hLSЃLuP P@Ny1PSfsFvǃǃyǃǃǃ ftPCPh 3 1e[^ÍvUWVSEE>UMEUMȉEEGUu ǂGME&MUF ]V % Љ6Et}>~UEjjƃt&jV"FuVȰ1uCEPh@3W袰MAd t&EPvwjWʴGF FUBMNV % ЋUBW( M9EU@MfA W<9sЋUfBfML?PvEf@BUB4t WPnMEHEe[^_ÐUWVS]T<BufGfEEjjͿt.jPU@uPu*CPh@3Ufh&P % ЉGfs0EpEUB BCdt RPymEPV艛fe[^_ÉU WVSuNIB7tf؃t f}wffte[^_ÍvU WVS]ELu"Pt&P2PpEtЋPp& t^S tJLuPP"PutPt&t*SwCuu tC0Ptmg3Љtb3Pth3Ptm3Ptr3PCPh34SKSttg=vP@LtPS SN Sm ufCrEe[^_ÐU WVSuhǃCPh3HSt$Fdh3"S9 S h3t VWe[^_UWVSUEpBD; u'ǃǃP8!LtڋPx8ǃEP$R0t;BHuPTjp8p$B4ЉǃPTjp8p$B4Љ ‰% Q`t t%Bvt)5u+ǃ!uǃu ǃUR>t*w4&tKu LPB8t&PTjp8p$B4Љu?PTQjp8p$B8yP8ȉ!Lt؋PH8Ep0@,S/&CPh 3#P81e[^_ÉUVSEu @DuFF$t R= FFe[^ÐUSM $t f_fwFtt&P8LtދPB8Cw ǁ ǁQ]US]LuP8uG&P@8t3A( A(  $jjPQ詧CPh`3]ÍvU WVSu~0hEGD@t@PP 18P ?P 1YLtNjP@ LtP@ t&hLSЃLtP@ vLuPP@IyЃVS FPh3_EPt& %P Љ %P ЉP@t&PDPHt&PP  HLP % ЉLP % ЉLPB@LPBDLPBHV7VVLP@LuP틖P PBBLP@  vGDt @t&$fGDfgDVt"tt&S;[0uWEPd5u7Ѝ0P[1e[^_ÐUE@utLuP` PH`UMt3LuPvPLuPpvPBpÍvUMfytLuPPP@PLuPT P@TLuPXP@XLuP\ P@\ÉUELu) t P t&P tÍvUWVS}LtkPa1ۃLu P P@%=tjLSЃC~Lu"PPa듉P@uGPh33 LuP&P@uGPh3 WSW LuP|P@uPP$P@EeU EUfVE8Jjj辯Ã1C <F<C CW0SPs8C FS % ЉFE@UfB C<9s‹EfPfLP$1ۃLuP vP@ujLSЃC~LuP vP@uGPh3 We[^_UVS]0P hIfCr LuP1vP@LuP 1 P@ SvLuP  P@ hLSЃLuP  P@ SctVe[^ÉU WVS1]TUf@@t P~Ny1]ÔUff@@t P0Nye[^_ÉUWVS}LJLJLJLJ1TEfF ρ% ‰S C uC %=vGPh3jj Ut7jP葬U@uP2EUuWP@ ρ% ‰SCf1t&EfVUЃ ρ% ‰S C uC %=vGPh@3pE  % ЉCCuC%=vGPh3u1e[^_USMU ЃLuP vPP1ېt&LuP u&P@ t fCfv[ÍvUELu P P@ÍvU WVSu] WVHPV8WV.Ve[^_ÉU WVS}u sj jWKye[^_U WVS}1jWZt  Kyƍe[^_ÉUVSu] jVV @t ؃? شPV;VnÃjV=Íe[^ÍvUVS]M uLtzP ΃p01LuP0u*t&P@0tjLSЃF~Lu2P4/ ΋P0념t&P@4e[^U WVSuM }]LuP4 t&PZ4Lu ϋP0t&P σz01ۃLuP0u(PR0tjLS҃C~e[^_ÐUuu ueÍvUuuu u ÍvUEt R/,ÐU WVS]} uD틓D BD BD&t4uD틓D @IBD @6uD틓D%t&BD%BDjLSЃuD틓D BD BDjLSЃuD틓D%BD%BDuD틓D%BD%BDu!D틓D BD BDuD&HDuD틓D%BD%BDȍe[^_ÐUVS]u EuD틓D BD BDuD틓D @BD @BDuD틓D t&BD BDuD틓D%BD%BDu!D틓D%BD%BDhSt2uD @DPCPh 6{%PSTt5uDt&@DPCPh`6+VSt1u D @DPCPh`6uD틓D%BD%BDu"D틓D%&BD%BDuD틓D BD BDu!D틓D BD BDuD틓D @BD @BDu!D틓D%BD%BDuD틓D%BD%BDu!D틓D BD BDuD틓D @BD @BDu!D틓D BD BDuD틓D%BD%BDu!D틓D%BD%BDhS!t<uD @DPCPh6,uD틓D%BD%BDt&uD틓D BD BDjLSЃuDu@DtEuD틓D%BD%BDjLSЃCuD틓D%BD%BDuD틓D%BD%BDu D틓D t&BD BDuD틓D BD BDu!D틓D @BD @BDuD틓D%BD%BDu!D틓D%BD%BDEU1e[^ÉU WVS}u1E1 vEM  C9}EP;PEP:Ѓtԅe[^_UWVSE EUUEE}M]gEhE%k}&Ƌ}U}E)л)ËEtE%Bh؅}Ct&EE%4UX;uh}]])][^_UWVSE EUUEE}H]bEhE%ht&uuU}E)л)ËEtE%BhEE%<؅}CUd9}mu󥐍t&]])][^_U WVSu EE}*]BEh%Jz})л)ËEt%Bht&E%<؅}CU~1)]H[^_ÍvUS]t ty$h3h`h@Sh@4hh`\S h\4h h`QSh h ^Sj8h]Sqh4hh@SkhT6hhmSV h5hh\S>h hpS;hh@oS(t+ǀD@>D@*t&D@CPh 6]ÉUVS]u :Ru&A?u v f:R[^ÐU WVS]u }:Rut&A?19}H&uEUUUA?F9|u t& f:R[^_US]  %8R;8R H$6  %uCPhO6ivuCPhd6SuVCPhy6@S/:S*/t&(8RJRCPh68R@)f8Rt(8R ;]ÉUWVS]jURjUURjhh4P@$Ѓ tCPh6t&jURh4uURP@,Ѓ th4CPh6$6Rjjh4jh4P@Ѓ t0CPh&6sh4uP@0Ѓ lvjjh4u$6P@ Ѓ CPh@6$6P@Ѓh4uP@0ЃuURP@(и7&$6P@Ѓ$6P@Ѓh4uP@0ЃuURP@(ǃ(RCPh`6R7|&E(RǃHRǃLR1(FDŽ,F@#jjj,ƒ':HRBHRG~1e[^_ÍvUMHRt6BHRLRBLRDŽ,F(F1ÉU WVS]Muh6@t&+(Rk: vh6&,F2uh 6x<2u7LRu h?6LR@LRHRBHRe[^_ÉU WVS}]UuEURjjhjhP@Ѓ t2GPh\6g #uRP@Ѓu E>$.urjj辑ÃtjSFCuS7CC jSKjSuP@Ѓ t$CC C$CjS>$ E  UR Pf@f@ UR$fPU fP MQ A$H%9t hw6$1e[^_ÉU WVS}]UuFURjjhjhP@Ѓ t3GPh\6 uRP@Ѓu E>(6uKjj5Ãt/CC jSjSuP@Ѕt7WC$CCC E  `>$UR Pf@f@ UR$fPU fP 1e[^_ÍvU WVSu} EuvjjrÃu 7vVuS~7C$CKC0:#C:#C :#C('Љs,[<[8ËC$CC0:#jSƄ @$$6(Rs)։Q Pf@f@ S fPfx 1e[^_UVSu1jjSV07t,C~䀾u:C EEPV87;C&tދCKfC~܃u,CC,Kf>R1e[^UWVS}EE`u$t2P{(64P@ j E PE E}~e[^_UWVS} E1E$3t5Pzz3$& PRAPRjE P:EMy.PR@PR3P@ЃjS & PRuȍe[^_ÐUVS]ǃpRfǃ4Ru1ǀǃPR1t&URjjhjh:#P@Ѓ t7Ojjj!#ƒuuP@и7EPRBPRF~1e[^ÐUWVSu] EEt_fW&CfCf ljSvtftSfCf ‰vEEPVXRfESfCfM ‰QEjQEPVFPh6e[^_UWVSu] EEtWfPCfCf ljSvtftSfCf ‰vE EPVRfESfCfM ‰QEjQEPVSFPh6e[^_UWVS}G0EUBEtEEPWE EPWtu;8mESvEtǀ0DRSWDR@DRjS!DRuNjUFEt&jFPV]t<t!UEHEt&Eރjjj Ãu h6jSVDRCDRSWut VULUe[^_USMuG\D1R1ZUUet&@\tǀtǀtǀUUu=UUtS=UUu@u2u\틑\ B\ B\1[UVS]ƃt-@@""u'@u&5v@""ϋ@tCPh6u!@틓@ @ @u @ @@%=@t =`tƃJƃ;&CPh6cot&\vu&@틓@ t&@ @u D틓D&BDBDuP틓P BP BP@\vu8u\틓\ vB\ B\u\틓\$B\$B\u p uu@we wUO@v  @tIVCPh 6 u틓$t&B$Bu\틓\vB\B\u\틓\vB\B\ǀ@t&ǀ vǀvS_u1CPh`6e[^ÍvUVS]s0ǀsǀv30RR ` S/ 0R@ d fǂh  0R@   ǀǀ(fǃ8R ǀt fǀx fǀz 1ɍvu1t&DŽA?~Ƀǀ,ǀ fǃ:R 0R@ `  0R@ fǂ fǂ  0RR @ fǀ :#fǀ   0R@ ` fǂ fǂ t& 1-,1(1dt&0R @ `1Ut&h ofǂ I 0RR fǀ fǀ  0R@   t@h t&h PW  ufǀ  t&fǀ @I fA u A 0R@ A 0R@ @ x tjhh`0RP@ Ё~Lt#XR%60XR%6Љы00XR4\R8TR@`R<dR$hRd1t&16XR00\R4)TR8"`R@dR<hR$ ǀdvǀvu'@틓@%@%@1e[^Ujh6u]ÉURq%)f>R$4(6<E@ tUB\WV>RPS;t&Wj>RPS7MA\WV>RPSR:tNjR,u7@R EEPS9$@R#vtދ@R$t&e[^_U,WVS]C0E4REPj PSEtE@`$7toP^7$&E4z tjpj6RB Ѓ 6P@ЃPRFPREpR4RJ%)f4REf@B14R ;@u Ef`De[^_ÐUWVS]EC0E4R E@tE@`$7tvP\7$&E4z tjpj6RB Ѓ 6P@ЃPRFPRE&pR4RJ%)f4REf@B4R ;@}t Ef`De[^_ÍvUVS]s0u @ @@u1t苃ǀt&FD@t=SAuS$11S,St΋ǀFD@tt Ve[^U WVSu ~0x tjhh`0RP@ Ѓ hlЋ|ЋxЉGhx tjhh`0RP@ Ѝe[^_ÐU,WVS}EPREU2E]싇jU RVP@ЃEE;F$U܃<EEEEET0 UD0$fEfEEPj PWEpR)ƒv0]CEEE;F} U܃<t4R9u7vMEPjE PWhx tjvjVP@ ЋEU 8$PRRPRU䉔8$&EpRU1e[^_ÍvU,WVS}EPREUUE0ujU RURP@Ѓ1ۋUE;P $E<ugUT QUD$fA fAUpR)Ѓvu$L틑L vL LE EPQ!1]ÉUSEM AA A<uEuh htII t}I{<uwullttItIvtItI tItI [ÐUWVS] E8hfEURSG0EPUR6ƃ ~EPt&2i w(1i > i tEi v5i ewi tNut&6i(E_UJDUxu8WEPURP 1UB=(#UBLW t&EPDtd%@f=@umRuE EPWF@f@umRtE EPWW8@t WUBDlR1s1i uEPUR@t&EPURBƃ4u;E@D@tWtSPUREPNƃvUR{e[^_ÐUVSuCPh6誶SSXFde[^ÉUVS]s0uǀE EPSeShh SSSSSS$ ǀ ǀ  ǀ@fǃ4RffDe[^ÉUuÐUS]6Ё6s'S$f;uA9u t&6r1[Uuu 1 &ÐU,WVS} E@ E܃EPwƃuh6h6аt&EPEPjEp EPC th6贴EEPjuuS葂 th6聴bEPjjuS( th6T58E䉇<EjEp EP9  PjEp EP LJFFFF EPEPw th6跳uuuuEP ÃGPWh LjPuuuuEP$ 0u4h 6ZtSh?6Eh65ShF6%jW薑e[^_ÐU WVS]} πt.PuL$틓L$ EPEPjUr Vw- th6蟞 E LPjuuE0rl th76bUU PEPEPthN6+uuuuVwÃ} WU RhdZ'jPuuuuVU B00u7h6̝tSh6距h6觝Sh6蔝j Ep V%U \RTjjj] SE P(S#Ph69 EPjEPj]SjhhDRB$Ѓ tWh6jt&UBjURhDuSP@,Ѓ thDWh6輜vUBURjjhDjhDP@Ѓ t=Wh6|UBhDuP@0ЃUBuSP@(UBjjhDuuP@ Ѓ tTWh6UBuP@ЃUBhDuP@0ЃUBuSP@(Ѓ KE؋U dhDPU EЉ@Lf@Dǀ g'ǀlǀ,`'ǀh'@Tǀ?jEЃ PWfE Phf'hf'j] S2EЋU (ǂ@G'ǂDG'ǂHH'ЃjjjjSRs U 0ujjj"S1j"S}2 j Sm2EPURz! E Phj'jh@7UR'ue[^_ÍvUWVSEh1d1< ?u 4 t&DG?~̉H ǂ@ ǂD 1[^_ÉU,WVS]hEdEUKPMC84UPHe[^_ÉUS]8u4t&41ɐ8u4u4t A~ӁuCPh6khLSЀ<uP8u4<t&4@<8u4<1 4@<]ÉUjh6uxÉULWVS} E@ E؃jPqEE܃UB&= tw t27=pt.&Ƈ<&Ƈ<&Ƈ<jPEp UR蕿<jTEp URvÉރjEp URPEԃjEp UR9EЃjiJt&EPEPjUr EP th6i4PjuuU26 th6hU8EPRXth6huuuuEPƃWURWh'jPuuuuEPG00u7h6;htVh6&hh6h"UB(=Wh6g Efx$ 8u4X t&4@X@=u h 6+=u h6=u h 6 Ph+6tgjjj]SW9SfK fSfS fKffSE fSCP%fCCPfCCPfCjPEP}r=B<wjj PURWKuW :t tuEPW=jjjPWB PPVh46LfEPp jPjxSjhhRB$Ѓ thE6fpjRhSP@,Ѓ th]6eptRjjhjhP@Ѓ ths6epjjhtP@ Ѓ th6LedvDhP1ۃ1pDRjjhjhP@Ѓ C?~pRjjhjhP@Ѓ th6d1۾pDRjjhj}hP@Ѓ 3C~pRjjhj}hP@Ѓ th6$d<w44FLfFDLJ 'LJlLJ'LJ'FTLJ(jGTPURzLJ(z'LJ,@|'LJ0}'h'hh'jSajjjjSW uCjjj"Soj"S 5&h67cRh6'cBj SV!V Whl'jh@7;EP=e[^_ÍvUWVSEHEuD11ɍEtE@ uDŽ DŽDŽG~E@ @@1[^_ÍvUWVS]DHECxtǃ@7t&ǃEM;}uFEEt&jWSh7ttP H9Eu Mt1MEL0TEEEEM;|E1e[^_U WVS}u EuJjjÃu7&jS-Ct_CC CC C$CpjjhsP@ Ѓ t$GPh 6`St7VFpz tjFpjPRB Ѓ jS^ F@ FFpx tjj+VtP@ 1e[^_ÐUWVSE4EUHUMDR|UUU<Mpz tj j+PtRB Ѓ Gw G ÁEEEUM;uEEEu#UB\tBhVWMQEpz tjGpjwRB Ѓ jWURuMN^ ^SvjEPjCPFP5ÃVWURYuMA\CjSރE@XUB4t VPJVMQZUDM||EUHe[^_US]SS ]ÍvUWVSEu4fFBEP;L`EUUMDMEpz t#j jEM+PtRB Ѓ UB@t(MTEGE1uFdE@tFhUB tFhMA%FhF`Y{t9Upx tjsjSP@ Ѓ MpSP@ЃUB tPMA ETEGu E1fFBU;LMP}tffDe[^_ÉU WVS]jP6E{4V >u>V$ t$t>t W5u7ЍXPrEPZ6e[^_ÉU WVSuE~4GDuLEFEBt$Bu džBF4t RPbE@D <u#tEPRStNEE;Lt-L8u 4  4 fFBe[^ÐU WVS]{4jPk2ES; ǃ <84@H84BLv8to4@H8tF4BL8t4@H8th4Hዓ4L븋4H덍&4LZ4H1)4LCv4H14L4Ht&4L4H4L8m4@H8d4BLv8Z4@H8S4BLv8I4@H8Cv4BLS;7CPh 6>US EP/44414@Pt&441t&S<8J4ǀ8D4ǀ@ua844ǀt&8'4ǀ@Pv8#4ǀv84ǀv<um8u4H틓4H @v4BH @BH8u4H틓4H 4BH BHGEt48u4H틓4H E4BH 28u4H틓4H%4BH%BHGDt58u4H틓4H @F4BH @28u4H틓4H%4BH%BH<ubS`&t40@ t4 @ 44p&S8u4H틓4H 4BH BH8b4tR P08[4tR P 8S4@4p8u44틓44 4B4 B4F0uA8t4@$0@?4$0@.&4$0P8t拃4@$0PF0%=8u4$틓4$ 4B$ B$8u44틓44 4B4 t&48u 4$틓4$%?t&4B$%?B$8u44틓44%4B4%B4<@F08A4ǀ8u641t&4)4tЋ4jdLSЃ8ug4b4z414u@44} '&wVt4ǀ&8u4틓4 4 8>4ǀ8;4@u@854@t&8u 4$ 4$8u 4  4 GD @fGDEP(ShL'ЁXS5u7Se[^_ÐUVSEƀ>ttS|[0uVx1e[^ÉUVSEu Px$F Fe[^UWVSu E8jP'EURVG4EPURià A2i w$1i  i t0i tlv5i 6i(vUJDUxu!WEPUR!3 WUBDtWo@thWZ1i uEPUR(EPURlÃ4uK<u W W1%VPEPUR'à t&EP%؍e[^_ÐU WVSuFdCPhU6JjPl%ǃS=SSt VWF%e[^_ÉUWVSuHF4Ef@BXP8u414@8u41 4@8u 4 4 hLSЃ8u4 1t&4@ 8u401 4@0Ɔ>1E?D{t3px tjsjSP@ Ѓ pSP@ЃD tPD jDPxMm1EvD{t3px tjsjSP@ Ѓ pSP@ЃD tPnD jD8PAxMbEf`Ddže[^_ÍvUuÐUEP(x+ u<uu1ÉU,WVS] Ex P UKMjlPjhPdPjjj EP'0t$h6Gkh1fdt狃hf@$ U쉓( MA`jRWT PjEPW͜EPURŝth6uuuuWWƃMQShbj@uuuuW|, 0u2h6FtVh6Fh6)Vh6Fh hEPWj`URWx%tw t Cvt9ǃ\7ǃ\+ǃ\t&h1f1ǃ\jSodtϋhf@vMq$r‹MA$ tjR PjTUB$Ph6j PYFSԬt.PMQh6_ElhdE(SEP Pjh,-SS e[^_ÍvUS]u SRuc, tP$ ǃ, lt"Phdǃl P^1]ÐUEP(x+ u<uu1ÐU,WVS] Ex p SUjlPjhPdPjjjMQ0t9h 6CAt&h'h^dtՋh@UB`jVW躘 PjVW6 dth@t&j@EEPMQ tlhdjh,-SS,e[^_US]u SuQ<tP4ƕǃ<ltPhdǃl1]ÐUSUM ] TЉB TЉ TЋABAB ABZ[UMtABA TЋQÐUEP(x+u<uu1ÉUEM h TЁTs;h Tt Ts;utBBÍvUS]jDS {DuSH1&CH@js|c$Pjs|ؑ]ÍvUQH> EPH> >hVWÃtShVWtjjVWfjj VW[ jj$VWMjj(VWB jj,VW4jj0VW) jj4VWjj8VW UzDuыQHQH$EPH$jDURe[^_ÉU WVSu} FtCCdžTFhLFDCFHCC $'CP'džd TЃjPjSCЃujjSCjjSCЃjSC !6ЋdG_G G@ tjt[t ㏃ Ht&EPh!6t ㏃0%EPh"6. &㏋E %t~,0t!@u" V t^uVNuhLSиQSEPh@"6a.1e[^_ÍvUEPHxDuB1t1u| t tÐU WVSu@uj<v|Á@Sj<v|iWLSЃFxt"Sj<v|>WLSиe[^_ÉUEPH1ɃxDu t&BttÐUÉUVSu] jv|;Sw($x"6 %t&$ $t&  $1t&Pjv|we[^ÍvUuuuu uÐUu uÉUS]xuej<s|肁%Pj<s| u0hs|JPhs|軁 jjjk‹EEBEBB xux@ x uP Ћ]ÐUS]E xxJ R t9uB jR~mxubj<s|胀 Pj<s| u-hs|KPhs|輀]ÍvUEuuu p|~UÍvUEuu p|UEuuu p|ZUWVSuM]uEz0EPEPjQhVu r<u ;ECECs C1 t&e[^_ÍvUEU jr rp<"U WVSuEx}9B0th"6%t&1ɋVxu1ۃAr˸ ‰Vxt1E[|0|U0U 0SV1e[^_ÉUWVSu VE @M|M PREP‹BЃMD PF PEP‹BЃ};M H%PF PEP‹BЃ;M H%P VEP‹BЃjMQA ЈÃjEP‹B ЈE } t} t3M TЀM@UTÀMPjMQAЃEPjEP‹BЍe[^_ÉUVSu] vh"6$t&jVF t t t&$$PjVFи!Fxe[^ÍvUVSu1ۃjVF Ѓ uhLSЃC'~Ӎe[^ÍvU WVSu>DuWH &GH@t E#uPh #6M'Bt&EjjVFЃjDWjVF ЈÀ㟃PjVFЃjVF PjVFЃEPWQj LSЃhLSЃh NLSЀ@SjVFЃh NLSЃVjjVFЃƒ؃u ÃPjVF1ۃF$t SVoC~1ۋFxt SVC~e[^_ÉUVS]3jSC Ѓ%PjSCЃhLSЃjSC ЃPjSCЃjDVhLSЍe[^ÐUE0!ÉUWVSE}0U  htSEEPEPjh CPSjv@du%F4EGEGE G _G1e[^_ÉUEU jrrp@UWVSuE EeMEeET0(|0,ÀˀE RQVFЃPEPVFЋ htEPE @PVFЃÀˀ PEPVFЃPEPVFЋMD10  ?|14u @ÃPEPVFЃPEPVFЃjVF Ѓ M ƒRjVFЍe[^_ÐU WVSu}1ۋF$u F$CV$r ‰V$udE 9B4th #6t&E%U)EUT|1(T1,E)D10E D14SV1e[^_ÐU WVSu} ~h`#6vjVF !؃PjVF!^$e[^_UEuuuj0UEu 0~U WVS]}MUuu ;C4uw p;C0ukvfw EE(Pu$Vu RQWEPu V# ujE(0Wu$6E 0Sq1CPh#6!e[^_ÍvU WVSu}E WEPSV;^4t ;^0tjWEPE PHe[^_U WVSuE 9F4u uuuuS t)#69u#6RFPh#6 E PVW1e[^_ÐU WVSuE 9F4u uuSt)#69u#6RFPh$6V E PVW51e[^_ÍvUVSu] jjj_umEDAEA EAt59Zr)BAtYX AFJQRuAFANv1e[^ÍvUS]E th9A u[Q)‰ЋUJ9tRQ)‰P1h@$6W8Qt ABACQAjQ#a1vIu]ÍvU,WVSuEEEEEEE E,U9P4u E!ES!UCE}u6C9EuUU#9rC!E!UC!EYE;EuY;Cu7EE)lj##KU)9sEE!EO&MKEE!ES!UCE.;Cu!C!EE Ph$6S!U[(E p|uURSVCsuEPSV2s uEPSVsuE PSV s UE ;P4u4j1EExE1ۋMM u%E#M8A @_.vEM M8A  @EM9@EfDŽ@fDŽ@" EE Fe1Ml2jVQ7uVEPh@%67"F~Eǀ|2ǀ21e[^_ÍvU,WVS]8El8h@W=ǃ8EV U}EEUE}u8@ ?'&UET08@ EUD:UB`URjjh<#jh<#Ur`@Ѓ t7&jjjLƒuUB`ur`@и7TE8B8E E E E E} ǃp2ǃt2ǃx21e[^_ÉU WVSu} EjjֲÃu7&VcuS7C<#C <#C$CC $fCC0<#C(@'Љs,C4[<[8C<#C <#C$CjSlX8S)‹EP Q<#U1e[^_ÐU,WVSu8C`jURjUURjhh4s`@$Ѓ tCPh_%6C`jURh4uMQs`@,Ѓ t!h4CPh%6 C`l2Rjjh4jh4s`@Ѓ t6CPh%6 C`h4us`@0ЃC`uMQsC`jjh4ul2s`@ Ѓ CPh%66 C`l2s`@ЃC`h4us`@0ЃC`uURs`@(и7-C`l2s`@ЃC`l2s`@ЃC`h4us`@0ЃC`uMQs`@(dž8CPh%6 7E8dž8dž8E2U<<#jjj H6Mt&8Pt HJv88!8PtHJ88PE}t1e[^_US]8u1KQtABAQ8At 8QP88A2[ÐUSU]uh &6+8E@t vh`&68u h&6QtABAQ8At 8QP8à8Y]ÐUSES0S$31]ÐUVSEu Py3 FFe[^UWVS] E88UhEEPSW0UREPƃ ~ UR82i w%1i  i tAi 5i wi tMt&6i(EHDUxu;W/EPUR UB=(#~UBLW/vEPD%@f=@8UBDt tF08 H"y4uQ0A0H"Ãy4t+A0\08 (y4uQ0fQ01Q0f)A0Ɓ? (y4tًA0f4W@f@8UBDt tF08 H"y4uQ0A0H"Ãy4t+A0]08 (y4uQ0fQ02Q0f)A0Ɓ (y4tًA0f4W#t&W-t&@t W7UBD81s1i uEPUR趍t&EPURƃ4u;WQ1+SPEPURǛƃ t&EP[e[^_ÐUjh$6uÉUS]{4uS0f C0f@{4uS0f C0f@{Du({4uS0ft&C0fǀhLSЃ{4uS0f C0f@jLSЃ{4uS0f vC0f@{Du${4uS0f C0fǀ{D{4u S0f C0fǀ {4uS0ft&C0f {4uS0f C0f {4uS0f C0f {4uS0ft&C0f{4u S0  C0ǀ0*{4uS0@ C0@${4uS0L&C0L{4uS0H vC0ƀH]ÐUEf8w1ÐUWVSu] U08MFdf9u ǃ8hEf8u ǃ8p1ɍ&U~4u V0 &F0A~ȃR Ph&6x ~4u V0 F0tVTFP4!VT0FP4ЍH8<D@~4u V0 F0Dtt+t$t&ǃH4t&ǃH$t&DFPh&6Dt&F`jURj}Wjhh`P@$Ѓ tFPh_%6KF`jURh`uWP@,Ѓ th`CPh%6 vF`8Rjjh`jh`P@Ѓ t*CPh%6F`h`uP@0Ѓ \F`jjh`u8P@ Ѓ tLCPh%6zF`8P@ЃF`h`uP@0ЃF`uWP@(E8h`P.S tE Ph&6C0E[0@Lf@DǃP'ǃlǃ'ǃ'@Tʚ;ǃ$jCPP{WFDtt!S$Sg PFPh'6:U쉓 FDt t(Dǃ$'ǃ('ǃ,P'ǃ$$'ǃ(4'ǃ,'h'h'jV躓jjjjVSH%0u!Wh'6jjj!V躓j!j V@ Sh`'ЁTS5u7S$MQxdEP,MFde[^_UUE t(PBf:uAPh2'6 %&Bf:uAPhC'6ÍvUw =72t5;=t,2= Ct!w =H Ct=Lt=PtFDFDh'6vEبu h'6ujEPEPjw EP t h'6FF0Pjuuw th'6GF4GF`EPWwPth(6vuuuuEPQÃ~WVhL(jPuuuuEP&QF80u(h@(6_Sh_(6{Shf(66VV~D~4u V0 F0t< tSvtt6Dt&FTN&FTFP>FT.&FT &PWhl(6FTFPN4u V0 F0Lt+ Ct4RSt Tt6Dt&FX m&FX]&FXM&FX=&u V0 F0PWh(6vHWh(6fEjhX'Ѝ]SVn ~4uV0V0f6F0ufEjhX'SV&~4tċF0f@EPe[^_UWVSE8E8Mt"E8M1B`jM QWr`@Ѕt 7EE;G}qUMx2)Ѓv̉E8ET8 QD8$U}u U@ UsEEM;O|[EpM U8@8l&M 8L(E8MLUEx211e[^_UWVSu8p2EEEt$Bu džBEF4t RPpJE@p<u#tEPRS+tNE}t6Ep24u8W0W08fFBe[^_USECPh(6S2]ÐUVS]{4us0ȉf C0f@Se[^ÍvUWVS}0E|2E]8HEE@]l @Z]p@El2EU8@fU@fEUBy0)‰UEtG\URV]SEP~URjEPURf7uPjWjCPFP6à EPVUREP/uG\VvjSރ ~^ ^GXEPEPVWUG4t VP1HVWDv]8M@UE|2e[^_UWVSUEfE] s[ E=vfEF =uwf~UvF=vNF=vA=vfE u$<@ЃEuVf9E_f9PM~\1=vǃU=vfEU=vMf}t!E@4U RPJF] K F?uE@ E<u f~ }UBf+ER ffы]K [Љȉۍvfuu V }u U B e[^_ÉUWVSE8EEU0UEt2;p2ue8 tE@`v}p;P;Ul&UEP`z tjpj3Ep`B Ѓ UB`3r`@ЃU8C8Et&Ux2FEf@B;p2tue8UUEt2}t UfbDe[^_ÉU WVSuEFtDuV 108 y4u Q0f vA0uC~ăt5u7ЍTPZ y4uQ0f&Q0f)A0À ؃y4t܋A0ft&08 y4uQ0fA0EPEP.TPGe[^_ÍvUWVS}EG0E08 y4uQ0fQ0f)A0ƃ y4t܋A0f4t&jjWÃE@D@uWpW&Q0XjjWkuPPtGEP08< y4tA0LJPQ0PtYhjjWHEPLJP08< y4tA0EP!EPV5u7ЍTP08 y4uQ0fQ0f)A0ƃ y4t܋A0f4t&e[^_U WVS}08 y4uQ0f&A0fED|t\ y4uQ0fQ0f%A0À ؃y4tۋA0f5u7ЍTP}}5u7ЍTPEtG08 H"y4u Q0 Q0A0ƃH"y4tA04EtI08 H"y4uQ0Q0A0ƃH"y4tA04e[^_ÍvUU08y4uQ0f&A0ÍvUWVS]CdE{hEEEt0EW0US0`_S0duS0hS0pEtEP{4tC0@` tW{4tC0@dt$UR{4kC0@ht W{4SC0@p t/E@D@t&{DuURvEPdt&UBD@t{Du W W6t9}tEDu P}tDu WK4u S0C0pS\Uu K0 Љ C0UP }tEt P3}tUt REe[^_ÉUWVSE8EU0UMMϾ(6U08 y4tGA0fhLSЋM08 y4u$Q0f$Q0f붍t&Q0f)A0ƃ y4t܋A0f4t&U08 @"y4uQ0A0%M1DpEEX4u P0\ UB0\E0u EP0\&tދUB0\M08 y4u;Q0f;t&Q0fMQ0fQ0f%Q0fLt&A0ƃ y4tA0f4hjjURNh'LSЃ hjjMQ*jjEP =A`u5E}<8t&t(48jUREE<uڋM08 "Ey4A0fvU08 "Ey4A0fU08 "Ey4A0fU08 H"y4uQ0vQ0"A0Ɓ@H"y4tދA04MAEtDE08 H"y4uQ0A0H"Ãy4t3A0[U08 H"y4uQ0Q0(Q0"A0ƃH"y4tߋA04UBDtGM08 H"y4uQ0A0H"Ãy4t.A0VE08 H"y4uQ0Q0(vQ0A0ƃH"y4tA04U08 ` y4uQ0ft&Q0f)A0ƃ` y4t܋A0f4t&M08 @ y4uQ0fQ0f'vA0ƃ@ y4tًA0f4E08 H"y4uQ0&Q0"A0Ɓ΀H"y4tދA04UzLvPM08 ` y4u Q0f A0` Àˀy4t5A0fsE08 ` y4u-Q0f-Q0f>&Q0f0Q0fRA0Ɓ` y4tЋA0f4U08 y4tA0fMQvE08 {4u K0fC0MDu& {{4u&S0f$S0f {4tC0f U1qBt&MQ06EP06MQ06t&EP06MQ0°6EP0²6t&MQ0±6EP0³6Uz4KB0ƀ6My4GA0ƀ6Ex4D@0ƀ6Uz4CB0ƀ6My4@A0ƀ6Ex4;@0ƀ6Uz4u U E싀u!uUu?E싀t2h*6 uuuuuu7VWtOuuu”uuu豔 uuu蝔?UA}tEƀAdžuuuY1e[^_ÍvUSVC}tUuU܃L t&E܋HLt%U܃L't&UA$@u @tԋE܉HL}t؋EƀAǃ}"u! P(tPP-Jfv B(tBPf-JhLSЃu" P(tPPff=-Ju# B(tBPf=-JtkCPh +6v  EtPuW薑uuu肑uuuq uuWUS1e[^_ÉU VSu] EjEPjEPEPjjjVO0thM+6EEjEPjEPEPjjjVGO0th|*6諿9t&E艃E쉃 SVxt5uuupuuu_$t&UA }tEAǃ1e[^ÐU VSu] EjEPjEPEPjjjVN0th*6UE ǃSVt?uuu蒏s&ULf!UL1f5t&}tڋEf@LhLSЃ}tȋEf@LhLSǃL1e[^ÐUWVSM] y u! P2tPd1f B2tBdfu P4tPhf B4tBhfEPQthh+6y&uuuuWƃCPSh<7jPuuuuW0u;h+6tVh+6h+6ݼVh+6Ƽ1e[^_UWVSuDžDžƅ0CC%g gC1ɐu H H:A~Ӎ11ɍvuTH,t&DH,9uC DA~EFPh+6諻[^_ÐUEP$fu=t=tfJuu &1U,WVS} ]js s M DPjs s jjjEPEPjjjSJ0tGPh+6vEG0EG4CG8EPSqtGPh+6譺t&uuuus ƃGPWhj@uuuus G|0u:h ,6QtVh?,6<hF,6,<tVhH,6WNujh"ЍG@PW|e[^_ÐUE@$f=u=u1U,WVS} ]wjs s  Pjs s 2 f{&QjjjEPEPjjjSH0tGPh`,6JEG4EG0CG8VW tGPh},6&EPStGPh,6߸uuuus %ƃGEPWh0j@uuuus E0u:EPh,6}tVh,6hh,6X(tVh,6Bjh"ЍGdPW{e[^_ÐUE@$f="u = t1vÐUu)at&U@붍t&M @@Pj3] 3}WRB ЉÃ t>SEPh06跮ED+EHjUtҋBDvM][]}O$x X E)}UtxHt&+M~t&;U}.]L$\ B;U|1e[^_ÐU WVS] $ x t>tRqjQP@ Ѓ x tjvjVP@ ЃuXF F BXut@tP@ut@tP@ǃe[^_ÍvUS]u$ t@ tQ@ǃ[ÍvUEu@ut&@@t1ÐUSM t&u K[ÉUVS]u틓 B BSu틓 t&B BSIu틓$B$BSu틓 t&B BSNyu틓$B$BSu틓$t&B$BSIu1@e[^U WVS]} πt.u틓 <B ,u틓$B$BSu틓 B BSYu틓$t&B$BSe[^_ÉU WVS]1S!S u틓$B$BSu틓 t&B BSiu SA t&u틓 B BSuu@t Su틓$B$BSNSEf8e[^_ÍvU WVS}fE19};] EPEPEPO}t EfEfF9|ȍe[^_ÐUVS]u틓 0B 0Bu틓 @B @BjLSЃu틓$B$BjLSЃNye[^ÍvU WVS]} u틓$B$BMIt.u틓 <B ,u틓$B$BjLSЃu틓$B$BjLSЃu틓 @B @Be[^_ÉU WVS]hEE @@f@@vu틓 B BSpjU PS&jU BPSjU BPSjU BPSu틓$B$BjLSЃu틓 @B @BjLSЃu틓$B$߉Bu틓$B$BjLSЃu틓 @B @BjLSЃu1+pt&u틓$B$BjLSЃu틓 @B @BjLSЃOyu틓$B$BjLSЃuAuut&@tU f zjLSЃu틓 @B @BjLSЃ7u틓$B$BjLSЃu틓 @B @BjLSЃEP{u1e[^_ÍvU WVS]u hH{FFu틓 vB BSQjPS jFPSjFPSjFPSjFPSjFPSu틓 @B @BjLSЃu틓$B$BjLSЃu틓$B$߉BWy1e[^_ÍvUVSuj]SE CECSVCe[^ÉUWVS}uj]SE CECfsSWe[^_ÐU WVSEEǁu( MH(uE8 UX8G0%=u75vE(ȉ5E8؉:?tċUH(MtX8vG0uHEu)‹M @[&EB @>Uu!M%EB%B[^_ÍvUWVSuF0EUBEuH틖H%BH%BHuH틖H -BH BHMIErt&uH틖H BH BHu"H틖H%&BH%߉BHu&H!Hl&xH1ɐt&uHt&BHuL1 @LvUKMt&jCPSMjSc#ÃuHMMBHu+EeLËL ]؉⋎AL ЉAL]t CEAxHe[^_ÍvUS]u  1ɐuut A~ӁuCPh@06hLSЃuǀu1ǀ]ÍvUE@$f= u"u1ÉU\WVSEx hsEȃjPUr Wt <jTMq WXÉރjEp W5EăjUr W!Ejt h06uuuuWÃU URM Qh`g(jPuuuuWU 0u9h 16 tSh?16 hF16%&ShH16M QFjjj ]EPE PIjjj EPU R3jjj SM Q SPhM16聖jE PSyEPM DjEPj]Sjhh RB$Ѓ0tEPh\16Rt&U DjURh uSP@,Ѓ t8h MQh16U DuSP@(&M DURjjh jh P@Ѓ tEPh16膕=U Djjh uuP@ Ѓ tMM DuP@ЃU Dh uP@0ЃM DuSP@(ЃEЋU Hh PM QA tEPh16єt&u 0U R0FLfFDǂ|v(ǂlǂj(ǂ|y(FTʚ;ǂ$džjЃPPMQ`E uu U @M Ɓhu(hs(jˁÄS*jjj"S* jjj+S*jjh+S* jjj S*j S\+ E u,M , E B, B,U u ы틑 @E B @BU ǂ0TO(ǂ4O(ǂ8O(hhs(hs(jӁS)jjjjSM QJ0E u+URh16讒jjj!S)j! &j S5*VVHM QhHe(Љˁ`SE5u7SE EPle[^_U WVSELHE1ۍ }u3 ρ% ‰/  ρ% ‰ DŽ DŽ DŽ  E}jG GG1[^_ÍvUWVSEHLEE^ E&jWEP7u 7g}u ρE\0 ρ% ‰S E E}~E1e[^_ÍvU WVS}u Euzjj 7Ãu 7W6uS2&7C$CKC @#C@#C0@#C(a(Љ{,[<[8&C@#C @#C$CjSS,^S % ЉFC FF 1e[^_ÉU,WVS]DjURjUURjhh4P@$Ѓ tCPh\16DjURh4uMQP@,Ѓ t!h4CPh16DURjjh4jh4P@Ѓ t:CPh16َDh4uP@0ЃDuMQsDjjh4uuP@ Ѓ CPh16vDuP@ЃDh4uP@0ЃDuURP@(и7DuP@ЃDuP@ЃDh4uP@0ЃDuMQP@(ǃ\CPh 267vE\ǃxǃ|1\DŽ`@#jjj $08xPt HJt&xxPG~1e[^_ÉUS]xu 1c&Qt ABvAQ|At |QP||ADŽ`\[ÐU WVSM]u h`26l+\k: vh26C&` uh26x< uV|u h361QtABAQxAt xQPxxYe[^_ÍvUWVSE0EULUE4NV U^FUByE$)‰UuE@\SVURjVEP7uJjURjWs.ǃSVEPu UB\jWi' EC{ {UBXB4t SPEttK K Utt K @vK E t@t K! t&K SURs EHE|EULe[^_ÉU WVS}E_0fCBT{@tXFht&uCdE@ tChUB tChUB%ChC`BtPE@XFfCB;Pt HE@]T}tfcDe[^_ÍvUWVS]C0EhcE5u7Ѝ`P< Auvb@5Eu&#1&u'}tًǀEP)c>}u }u( H(}u8 vp8t@t+)(084?}tˋH(tNjp8AEtUGVoV螳 (t,,tA tEPEPae[^_ÉU WVS]E{0GDu8SS1t&12tӋ@u,틓, B, B,|Et S;7t St$u v tSgDS6 u pF W@t Wt3u,틓,$t&B,$B,Ee[^_ÍvU WVSEE8u ^ t|UMX)Ѓ~qH @AV % ЉA}t YWЅ}$)E6s7]]H U B tgt]]H LE @ t]]H LE @ t]]H L MH] HdEHLUXM91[^_U WVSu1APEFECt$Bu džBGF4t RP>UH<u#tEPRStNEt0EPu    fFBe[^_ÐUWVS]C0E@D@/h;]ES 1uJ@HBL@HBLvtz@HtQBLS7CPh 36辁S URQ\L뭋H낋LVHLH1SuH틓H @BH @BHuH틓H BH BHE@Et4uH틓H EBH 2uH틓H%BH%BHUBD u!H틓H @vBH @H %0 ЉMH % ЉW&8`(\¼et&(plut&uH틓H%BH%BHSuH틓H BH BHH % ЉA0t&H % ЉA t&@8`(ǀv@(pǀvt pv0u( v@(Eu8 H8umMk(En8rF e?MtUP(tH8S[u틓 B B@@9@F 3@u $ $u    tEP&UR(UBD @fBDEP1Ve[^_ÐUVSEƀA$t tSb[0uVצ1e[^ÉUVSEu P),F(Fe[^U WVSEƁAE@u$`tڋu$"t׋t|u( vX(u8t&p8UB%=uEC&O(/83?t͋X(tȋp8u,틑,$B,$B,1[^_UWVSE] u @u7ut&uC"CtCC+@tC+@u.u @u u %=u K K [^_ÍvUWVSu EhREURVC0EPURǃ ~ EP2i w)1i   i i h5i -w i tM6i(<EPB="(EPLUz~ EǀUJDUxu&S=EPUR9^ t&SEPD%@f=@uH=u?u H틓H 0BH 0BH%@f@~=tuuH틓H%BH%BHUBEucuH틓H%?BH%߉BH,⿋EfPDS@t S UBD<11i uEPUR3EPUR|ǃ4uKE@D@tS 뭀t VVPUREP4 ǃUROe[^_ÐUVSuFdCPhU36tS2SQfDS t Ve[^U WVS]C0Ef@Bt1`P(u1@u1 @u   hLSЃu 1t&@ u01 @0u VƃA1HtPc H Ny΃hH71HtP H NyʃhHPޢEf`De[^_ÐUS]S9S]ÐUS]u j|8h]ÉUVS]uu j|Vhe[^ÉUVS]uu jxVhe[^ÉU WVS]u u!h틓h h hǀ8h` jLSЃtz`‰8h1j LSЃu8ht&8h@u G?B~@BuCCPh36po8h `넍v8h` >u.UuQjj ÃtjSyCuS7t&CC CC C$CjSURP@Ѓuu jS@> M UB u &#56ЉAUB u1҉1҉fA C fAE fA 1e[^_ÉU WVSu} Ejj Ãu 7 vVkuS7C:#C :#C$CC $fCC0:#C(d(Љs,C4[<[8ËC$CC0:#u jS@<S)‰Ћ6B u#56ЉA<S)‰Ћ6B u1҉1҉fA $C fAfy 1e[^_ÉU WVS}1ۍ.VjjhjhP@Ѓ u%C~1ۍvjSW07u 7Jt&C~Kf<ult&<l1e[^_ÍvUWVS}EE] 3t)P3;.P@Ѓ j EPГE E}~e[^_ÐUVS]1&jVSH7u 7F~Nf<ǀp uH$1t&ǀH$ut<<t1e[^U WVS1E@uƤ3tP3j EUP衒E G~e[^_ÐUWVS} tsEE]3t)PD3;&P@Ѓ jEPEE}~e[^_ÐU WVS]ǃ<fǃ<u1ǀqu*u1ǀu„1ǀqu*u„1ǀ1&vVjjhjhP@Ѓ t 7G~1e[^_ÉUWVSu~0EEEE1Ƀup1DŽpA~GEtI1ɐupDŽpA~t&OE뱋CjCPSuuڃjS‰Ӄ` D+]tCEu11ۃupD+D+pA~Ǎe[^_ÉU WVSuhjh uP@uCP@t1FPh56#_t&1t닆ǀ%Pj|w w su1%DŽ ~ %Pj|w w u1%DŽO ~jpw w 6t?vov<w^u>t;h4lht&@tw@<w0Qjlw w %tǀh4jw w p$Pjw w gǀhv1e[^_ÉUWVSE@|Uu'tMD"]tDuu%u} D%EMu D]ǀ,D utyǀ0D t&}Et5ǀDt&UtxǀDMD1ˋ]0D 넍t&u,D F}|1NEDMDP]D uD`}4DE8D MD]0ǀDPu0ǀD }0ǀD`E0ǀ4DU0ǀ8D M#ǀDv1ۋuuDv}Duj LSЃC~uAEPh 66P E\2M\1<]tNjǀ\utċǀ\t&1ۋ}u\u+U\tj LSЃC~uEPh`66 ]X u<@ \ <@ 1҉1҉X u ǁ`  ǁ` }tgC eEP$kMT$Cut&uX$C{}\$C vC `EtP$UtCT$t&MtCX$t&uuC \$}0h <@ @l <@ @1҉1҉h ǁp &ǁt !E@$)MD$C1uH$C8}L$C @Eh$VM,@V], Vu1}<@ E @M]l1ut1}|1E12U<Ӌ@ `;u 1Dt&}<EEEU]uu}8E؋}D?=Md &Cv]Fu F} FE FM<1Iǁt pu@$}CD$ECH$UC L$Mǀ ǀh$]ǀ,@uǀ, }uUDuu 1v}D KyE$ǀt&U<R T&]D @utD1ۉ}u1&Uuu1t&}DEu#<ʋu }< DEu 1UD uu؄1}DŽ؄CEǀlUǀtMǀ|]ǀu<R `T&}D E<DUЋ]D?8&uǀd &}ǀEǀ Uǀ Mǀ ]ǀ<1ۋuu<u+}<tj LSЃC~XEPh66M E<<AM <<Kt&]<<Ut&u<<Wt&}<1iE<1rM <1y]$<1u0<1}<4<@ XE@<MD< ](<<t&u8<1}<<<@ E<M0] u4}h8EdFMLF]HFu(F},FE$FM8V]VuV} VEVMV] Vu V}@VE<<UM< <]<<&u<<}tBǀ<t&Eǀ<Uǀ <Mwǀ$<]cǀ0<vuW<R X4<t&}Pǀ@<EPǀD< UPM<(<]Kǀ8<uB<R <<}fǀfǀ"ǀ<E ǀ0U ǀ Mt$ǀ4&]u&tvu }tEǀhUt"ǀdt&MǀL]ǀHuǀ(}ǀ,Eǀ$Ut$ǀ8&Mǀ]ǀuǀ }ǀEǀUǀ Mǀ ]ǀ@ut[tǀP}PEnUu#ыT틑T  ]T  Tuutǀ}u틗E1e[^_ÉUjh36u|ÉULWVSE@ EEhnE̋} u=T~h66BjEp UR賗 PjMq EP'jUr MQ苗uE Ph76TB=T~h&769BjEPEPjEp UR th476B=T~hL76AE PjuuMq th[76A1UBM =T~hr76AEPEP"th76bA=T~h76GAuuuuUR蔘à =T~h76Au VM Qh@(jPuuuuEP蔘U 0u7h76@tSh76@h76@ Sh76@=T~h76v@M Q?E P tVh86F@U RUh M Qx=KHtIjj~E PE Pt{URh 86?M Q a&M h QM E PPhG86i?UBM  =T~hT86A?U jURj]Sjhh P@$Ѓ tVh 46?=T~hf86>M jURh uSP@,Ѓ t8h Vh@46>U uSP@(Ѓ &=T~hv86n>M ʁ¬<Rjjh jh P@Ѓ tEVhf46+>U h uP@0ЃM uSP@(y=T~h86=U jjh u<P@ Ѓ tMM <P@ЃU h uP@0ЃM uSP@(=T~h86M=E؋U h PmjhMq EP8%U M Ѓ <t*QtVh86ǃ<<PS tǀvjjS_jjjS# Ѓu'$t&@Q@u%ǃ<<P(S tǀ@u# v1OFD@tSS? StǀvFD@tt Ve[^U WVS]4{0h Eu S S5u7Ѝ<Pz<u+u*]4t&t5A<tȋǀt WEP QV[<u0F,t*F0tǃ<t WEPx e[^_UWVSu~0D1ۃu vɋd`ptGh[^_ÍvU WVS]C0Eu< <uD Du\ \UBhudt&dȋUBh[^_ÉUWVS}EE]>&U􋇔jM QRP@ЅEUE;PE<1U A1҉1҉UD$fA fAU<)Ѓ~]CEEEM;A} U<tt&<9t5UU MM<E17e[^_ÍvU WVSuE1<u )uJEt&E1&ECt$Bu džBGF4t RPcEu#tEPRStNEtK8Equ (ǀvfFBe[^_ÉUWVS]h[E{0GD@tIvSSzS Sx CPhb96t+EPx<GLjf}FfFf ‰Љ~tGL<tf&vVfFf ‰GEtNu h틓hfhN1 u"h틓hvhhS S 0uM1F w$jLSЃh`S =uփ uCPh96)Lv Sfǃ<SRu\틓\ \ \uh틓h h hu#h틓h h huh틓h Bh Bhuh틓h$Bh$BhǀW9GD @fGDEP5u7Ѝ<Pe[^_ÍvUVSE4x% t ȃ uuHu)틓$&$wt X틓 9ǃ<\tXtSU[0uVgR1e[^ÉUVSEu 4tFF uutNN uut N &t&NP1RdF`Fe[^UWVS} EhnEURWC0EPUR£ƃ ~ EPY2i w%1i  i tBi  5i wi t_t&6i(UJDUxu!STEPUR` S3uExUB=(#UBL{EPD%@f=@uK<uBu"h틓hhhy@f@uL<tCuh틓h<hh%t&S't&@t SUBD<11i uEPURcEPUR謮ƃ4uKE@D@tS뭀t Wt4WPUREPd끍vURe[^_ÐUVS]3FPh96*#cDV9Cde[^ÍvU WVSE0EE<P1Uu ыh틑h$Eh$hUu'ы,틑,$&E,$,Uu ы 틑 $E $ UtAu!ы4틑4$E4$4Uu ы$틑$$E$$$Uu ы(틑($E($(Uu'ы0틑0$&E0$0Uu ы틑$E$Uu ы틑$E$Uu'ы 틑 $&E $ Uu ыH틑H$EH$HUu ы틑$E$Ut@u ыd틑d$Ed$dUu ы틑$E$Uu ы<틑<$E<$<Uu%ыL틑L$t&EL$LUtDu$ы8틑8$t&E8$8Uuы\&Uǀ\Mu\1Uǀ\Mu$D틑D$ED$DUu ы@틑@$E@$@Uuыh틑h EBh BhUuыUǀMu!h틑h%Eh%hUR'Mt Q[EP踹Uu54MyDID<sC"PGsEfxDUǂ<fǂ<MfaDe[^_ÐUS]SS]ÐU WVS]} Dt,{8uS4PS4P 7t&S4BP &{8uS4PS4P$ S4BP$BPjdLSЃ{8uS4PS4P S4BP BPhLSЃ{8uS4PS4P$ S4BP$BPjdLSЃ)e[^_ÐU WVS]1{8u S4PC4@Pu S{8u S4PC4@P{8uS4PS4P t&S4BP BPjdLSЃK8uS4PuC4@Pt uS4PS4P$ S4BP$BPjdLSЃo{8u S4PC4@PEf8e[^_ÉU WVS}fE19};] EPEPEP}t EfEfF9|ȍe[^_ÐU WVSuM} lu/~8u V4lF4@l؉^4`ȉ~8tF4H`hLS1~8uV4` &F4X`|jdLSЃG~ƁtۉFPh:61e[^_UVS]uM{8u ΋K4`C4 ΁p`hLS1{8u S4`C4@`}jdLSЃF~ρuCPh:6e[^ÍvU WVSu]hLǃ@uSE PVDt&} ytt]t/|t!Xt,JbcvdYfRjIhB~8u V4XF4@Xf@t&FPh2:6W1*~8u V4f ЋF4WwÍe[^_U WVS]}h8ƃE@uWSU RPYt&} uNw5$H:6иbW&dIfBj9h2EPh2:60V0ЋMQ4fUz8tЋMA4f<Ve[^_ÐUÍvUWVSuEEEF@EN8u2V4D-&V4D5t&V42F4xDUBEtatʋF4xDt&~8tʋF4@~8F4@ G&V41%t&V4 1%t&t܋F4@~8tڋF4@ E]tGSU?jS E t&AEE]t7CEt-jCPSr*tUJEE}u}tB@V4 _V4D4t&V4E4t&V4 E4t&~8tȋF4xD~8tʋF4UP~8tʋF4UP e[^_UVS]{8u S47C4@71vj LSЃ{8u S47u C4@7t F~ˁuCPhd:6v{8uS4‚ C4ƀe[^ÐU,WVSE@EEEEhEeElElEoEEwEoErElEd=$Tth:6jjzǃu%7MQ4>fEHEUǂPsMQhLSЃEPLwjVUURg)jFPMMQR) fF G <G<Ex8S@4f@>t&jPGU싂u t&xM쉹QISh1 =$Tth:6hLS1ۃEx8uP4>f&UB4@>%@f=@tj LSЃC~uEPh:6&MA6 hSh>6 USh&>6 UBG6 1ۍM8uW4G4 C~LJLJDjjjEPW f})t LJDjjjuVW1ۃ Et&M0fD0U UC~ۃjSEP S艏Ph_>6$Ww@@jGEPG`P&FLfFDLJ(LJ(LJ$(LJp(Ѓ@u FTʚ;FTdžWh$(ЍPLJ4(LJ8(LJ<(h(hh(hS =$Tthm>6jjjjSWf0 $u*URh>6jjj"S՞j" j SUWVoVbW5 tGPh>6mV=$Tt h>6Le[^_U,WVS}EuOjj蹭Eu 7@}jP1UBuRԜ7G$GGG jW/M Me]à]EEUBE!UEWpjPRB Ѓ G<>P@ЃuueC u&cjEPWUByE@$)‰Ut&@umUtYuF\t P`LJLJSEPW UByE@$)‰U-jURWtZuF\t PLJLJSEPWUByE@$)‰UUByE@$)‰UthE֙S wA ЉA ScS cLJLJE EC CUBXSB4t SPWSuVE<WfftEtF4fX>f{t Vt VÈ@t Vf}VWX tP詳V N8uV4>f F4X>fBt WЋEe[^_ÍvUWVSE iUMME]C|EU\$у V1҉1҉F }u ?u@E]M;YtWЅ}G@$)끀NE]U] MB)ULM9t]LWЅ}G@$)‹M1e[^_U WVS}7EWvEPSVFt+CuOEXG4t SPRE0u3t)Cu LJCiVURm1ۃ+VEPEPUR%ÃEP؍e[^_ÐU WVSujPǃCPh?6FdSSVW^e[^_ÉU WVS}_@fCBP̨fcD8u W47G4@78u W4<1f G4f@<t P$LJLJE]<3t(G<;P@Ѓ43Љ3 E}?~E]<3t(G<;P@Ѓ43耉3 E}?~e[^_ÐUS]d?6Ѓyt'S$f;uA9u &yu1[ÉUuu 1 &ÐU\WVS} ]GEG0EG4CG8js V0G Pjs VGjEPjs V| t^E܃Ps VFuhA6&t#Ph@A6jE܃Ps V4G EPS,HthbA6lovuuuuVHÃWURWh<)jPuuuuVH0u8hA6tShA6h@6SEphA6G8jURjUЉURjhhP@$Ѓ0tPEPhA6&G8jdRhu؋URP@,Ѓ tPEPhB6J:G8`RjjhjhP@Ѓ tPURh@B6G8jjhd`P@ Ѓ tPEPhB61ۍhG8Vjjhj hP@Ѓ C~1ۍh UG8URjjhjhP@Ѓ DŽ>d EC~0u W40| G4@0} LJ LJW0u W4xf G4@x0u W4xf vG4@x0u W4zfG4@z0u W4zf vG4@z0u W4|fG4@|0u W4|f vG4@|PtPEPh0C6 0u W4vG4@v$(Ủ$LJ<0)LJ@L)LJDp)h)hH)jS蓄jjjjSW!0,ujjj"S衄j"S. j SGl EPh@C6&PSURhB6APSEPhC61ۍh ؅tG8RP@ЃC~1ۍh؅tG8RP@ЃC~ڃG8`P@ЃG8`P@Ѓ G8hdP@0Ѓ G8u؋URP@(Ѝe[^_UjE@&E@>@}uU<1t&UB<}uU„MALfUBLMfdž}u Ul1 E@l ~R}uU,fU,fUB,fB,}uU,fU, f MA, fA,P5u7ЍHP迊UBD @fBD }tFPhD6Ee[^_ÉU WVS}d ;t*G8sP@Ћ3l Nyˍe[^_U WVSEHP觊P {0u S4\1f C4f@\{0uS4l@ C4@l@S;{0uS41&C4@{0uS41t&C4@{0uS4 1t&C4@ {0uS41t&C4@d>t$C8vs8@Ѓ6Kk Oyу} t SmEf`Df@Be[^_ÉU WVS}E d jj{Ãu 76jS|CuSj7S$SC >tG8vP@ЃG8jjs0s$vP@ Ѓ t PE PGPh@E6phjE6KW8z tjFpjPRB Ѓ U RpdF@ 1 |E6 E6ЉAQ`P pE @%@‰AAA G8x tjjS`P@ 1e[^_ÐUWVSu~C8 P@ЃC8h uP@0Ѓ C8uVP@(Eԉ|EC8uWjjhjhP@Ѓ tPEPhG6$DŽEȃ}~EC8uWjjhjhP@Ѓ tPCPhG6DŽEȃ}~{)ǃp?)ǃt@)Ѓ hA)h|A)j8VbjjjjVS0\u"jjj"Vbj"Vb j Vb{0u S4Z C4ZxjjS%PjjSjjS @PjjSW2WMQShA)Ѝ P}e[^_UWVSu] EjPΤEURSEP@ЃEG8hjs0s$4P@ Ѓ u~W8z tjpjPRB Ѓ M |E@@ @B} tG8x tjjQ P@ 1e[^_U WVS1t&uƄ<3t+UB8P@Ѓ43 P3 G~e[^_ÍvU WVSE􍃘 P+n8P4 {0tC4@$K0uLS4$IS4$1名t&S4,?S41S41C4@$tËC4ǀ,E{0uS4,&C4,tj LSЃE}~{0oC4ǀ{0hC4ǀj LSEvu<>t*C8s8@Ѓ4>~N> E}~} t S Ef`Df@Be[^_ÐU WVS]K0uCS4˜>vS41RS4,RS41C4%= tC4ǀ{0tC4ǀ,1{0u S4, C4,EUtj LSЃF~uCPh J6h{0HC4ǀ{0u8S45S41&S4,C4EEt\1{0uS4C4EU uj LSЃFc~duCPh`J6襶{0\C4ǀ&{0VC4ǀ,1&{0u S4, C4,EUtj LSЃF~CPhJ6 S4˜S4˜h   h h  J {0uS4”S4” S4 {0uS4S4 S4 Vh   X{0C4ǀ1{0u S4˜ C4EUujLSЃF~uCPhJ6諴1{0u S4œ C4EUtjLSЃF~uCPh K6M{0PC4ǀ{0u.S4˜+S4˜fFD{0uS4S4 FS4 0fFD{0uS4S4$vS4$FDt9{0uS4S4$LS4$9S4(1D{0uS4S4 S4 {0tC4ǀ(jPS{0uS4S4 S4 NE{0uS4(S4( S4( (e[^ÐU WVS]} {0C4ǀ{0tlK4E ` ‰v1{0u S4 C4uj LSЃFc~̃{0uHS4EE `K4 Ɖ됋S4RC4dt% &PEPWCPh`K6 1e[^_ÍvU WVS]}{0C4ǀ{0trK4ҋE  P ‹E ‰1{0u S4 C4uj LSЃFc~̃{0uTS4QE  P ƋEK4 Ɖ눋S4Dt&C4duWEPU RCPhK6e[^_UVS]K0uS40 C40jtAuQtC4?K402&K40ttC40jjS8%PjjS<jjS @PjjS"e[^ÍvUE@Dt8P1UVSEu 8PhFdFe[^US]8P5u7ЁØ SB`]ÐUExu'K6Ѓ=j_tK6P5ThK6NU=Tt t&ÐUVSU EuTЃttGh L6 ~ hBL6ǧ  Ot& ~hBL6荧f   щȍe[^ÍvUVSU M]uTЃtt9h`L6(t %t t2(t&tt f te[^ÐUVSu ]TЃtt3hL6袦 މ 12v  ù ؍e[^UVSu ]TЃtt,hL6 މ E 1)  ڋE e[^ÍvUTЃu{j_Ѕt u"uJ  uuT9 =u1uT T1ÉUVSEu H P0X4@5~Sh M6m&F^VRQ3(Ft=uC@Ph`M61~PhM6̨u hM6貨1 Fe[^ÍvUUt%uRh N6TRhCN6j@h`U2`UÍvUSEt uPh`N6u(u$u ujPj?à tE Pu$؋]Uu j% ÐU}uEPuuj@jRjUu jÐU1ÐUVSuF\Pjhju,v\^ShN6DSVu jpjv\jb1e[^ÍvUuuuuu uTÉUu uÐUUB$f=u =W0tB(z+uu1Uw =$t5:v=@$t)=L$t"'=$tw =$t=$t=$u1ÐUuu uÐUUB(z+u!<uB$f= u=u1Uuu umÐUE U@p2輰u1ÐUVSu ]SVuhO6CF8CF@=t&PCPCphP674 flC @fE̋C @fEҋUDf{ h4`=7CphP6詚ft#jPEpD[ =7tCPCpCph Q6Pfu!EPh`Q6-DžhQ)WdRMQ]SEP^d ftU BHftM AH`hWdRMQ@Ѓ=7tCphQ6gjdPK0=7tCPCphQ6-4WVUR@ЃfltLjlPMqDu-lPCPCphP6ØjV=7tCPCphQ6蒘hQ)WVEP[f}tM̸U BHf}tBMҸM AH/=7tCPCphQ6,jVH[^_ÍvUEt% t6tt$t&Q6)R6" R6R6Ph@R6螓ÐUEǀÐU WVS}=eW1۾eWкtG@VjRRjRP@Ѓ t hR6$C~hR6&e[^_ÉUVS]M ΃vQCPhR6SHsQCPhR6ږu ‰SHu/{8t SL B -SL SP v{8tSP Bu{8t6CLP 5{8tCPP%hR6;SP t&SL e[^U WVS]M }vQCPhR6Wt9vPSHr( ‰SHS@DXPuVWjWRB!QCPhS6貕hS6荑e[^_US]M vQCPhR6&SHrQCPh*S6Z!!‰SHS@CX4RBhFS6v]ÍvUWVSuM E Eeȃ} vU RFPhR6i] ]etC}w}uUtNMQ]S} WFPh`S6螔 6}vEPU RFPhS6u ] ]eVX}u#teWЉE PhS6F@QuURMQSP@ Ѓ }t@F@x tjsjSP@ иM >t&VL E TF@x tjsjSP@ иM !{ E]D3x}~8tVLE B ~8t FL@ VL VPE VPVL EM @T&E TVTVLVLMVLBE~8qVPE Bt&~8iFP@M !}5~8LVLE] @TЈB ]ۃ~8JVTM TЉ t&~8>FL~89FL ~84FLMUT~8tFLmML?&VLBmE%VPEM @Tt&0TVTVPVPMVPEVPڃmE~8yVPEM @TЈBt&]~8pVT0TЉ ~8gFP~8bFP m~8TFPMUT~8KFPmML}u2~8t FL]X 1VL E$t&VPEt&~8tFPUP1 hS6;e[^_ÍvUVS]u v!VCPhS6 SL "uS{8tދSL B v{8t CL@ QSL Et&SP #vSP%t&{8tڋSP B{8tڋCP@vS@CX4RBи!e[^UWVSu} } v"E PFPhT6'VL U UeuR~8tVL B ~8t FL@ QVL Et&VP #vVP%t&~8tڋVP B~8tڋFP@v}uNۋF8Eu VLB vFLDH}u VLB t&FLDSV8Uu VP FPDH}u VPڃ FPDɁFxU ; u1Ƀ}u6~8tFLP 6VL %t&VPt&~8tFPPȍe[^_ÉU WVS}] vSGPh T6ju)8u WL t&GL@&t&8u WPGP@ e[^_ÉU WVS]u vVCPhBT6ֈSL #CX<uJ{8tڋSL B {8t CL@ KSL @SP #vSP%t&{8tڋSP B{8tڋCP@vVSuVCPh`T6AS@z t+􋃘tQwjWRB Ѓ C@WP@и!e[^_ÉUSEU vRPhT6訇tUH@uEPjEPShRQA$Ѕu UE1]ÉUME vPAPhT65EEUEBA@jRP@(ÐUS]E MvPCPh U6EEUJC@uuQjRP@,Ћ]ÐUEU vRPh`U6衆t&@@uuP@0US]E MvPCPhU6at&|-EEUEBC@u uSQjRP@4]ÐUEM vQPhU6@H4UWVS}u ]jEPSVW upjEPSuVW uJuujoƒt&:rZEB MJTЉBTЉSuVWSuVW1e[^_USMTСTP@t9Huuh V6*3t&CsQs35ss s3u S]UUT@t&9Putjuu pp p0h`V6覈ÐUWVSu^F|t`uV\uM8ftfu:fu0j`SzEPjjj`S V t 1EPjjjdSU tjuSX͍jjuuS=xhuSwu1/jjuuS x UtPhV6苇1juSxXjuSjXtF|`dždžhe[^_ÐUWVS} UBGPrGTGX GLLh)Ѓj`Vyt`UЋCECEUxEPjjj`VT uEPjjjdVT t hV6苂jjjfE@fEEꄃ]EPjSjjuWXl {@u st&juWFN}tXf8t 8;Euft;Et1+Ef8EfdžhdžEe[^_ÐU,WVS] EEpHMhX6|EPjEp|VJ0tCPhX6|s0US4MA C8EEPRVwuCPhX6A|C@EtPMQO&S~/X6й1t }CPhY6{C@sVShj@juEPCD uVh@Y6{)MQSleWMA|eWeWЍe[^_U WVS]sEPjj s|V=I t18uVǃj uVLtǃhǃ e[^_ÉU WVSu ]{EPjj s|WH tFPhbY6v~@EFDh~Y6zFPVhtj@j8PsF<$Ve[^_ÐUWVSE }UUEY6ЅtEE N} uE}tD N&j2LSЃNtUtuPMQhY6/t t&UBUumrhuj2LSЃNtUu.&}tMQhY6}y@UUBMAMmsrduj2LSЃNt Ut*}tWMQh Z6y@Unt&MEUBˆs}tG Nj2LSЃNtUtuPURh`Z6x U1e[^_ÍvUÉUS]1ҋ eW9}C|9eWt1B9|jjS uǃhǃ1]ÉU WVSE] UU@ @pZ6йtP5eWVSEPJ tCPhZ6sUB|CDB C@CLtuP5eWlSTS ǃǃfǃTǃTfǃCPShy)j@jsHEp(C< jh"ЍPS9e[^_ÉU WVS}Wh;u61ɀ;uB|9uZ@A~ GPhZ6vKSA A RWƃuGPh [6Cv}1t u ufPGPh`[6vM@uhP,*W@z tjpjRB Ѓ VW{WhB|9uZ@;e[^_UVSuNDQÄ|1Nt& t-EfEfEjjEPjVQVdt VOe[^ÍvUE ǀÉUWVS} j@vOEz tMA@RP@ЃEH # u7кMb)RhP'# WhB<9uGhe[^_ÉU WVSE u!EPh[6 oh[6j{,U zt'Bu C,PEPh[6^M ytfAt t'5t&U B{4tC,9C,/&PEPh[6_nC,C(C C{$~{0uuE PM z~pC t MA@x tjrjRP@ Ѓ C t)EP@z tjM pjPRB Ѓ UB@M P@ЃE PURSe[^_ÍvU WVSu~|jdLSлhLSЃK<0uރhLSE UEPjRj] SW0E t* tt9@t$=t$+NFAQPRҍNFAQFF@@FF@@FNMQ$ЈFQ$ЈFF FFF F F @@j@@ÃVW Ex$x0@jjh ^6jVH @t݋x~{Ut*W@z t!jpjw@B Ѓ Mt*W@z t!jpjw@B Ѓ G@w@@ЃVWEPS/?_S#?Uu1KMQWAt,VEPW t Vje[^_ÐU WVS}]wDt6V} WmE @t1hLSЃKuʸe[^_ÍvU WVS]j@6>ǃV@z tjpjPv@B Ѓ @ p Ph^6Zc th^6Ac8h&^6/c@,ǃSV W=e[^_ÐU WVS] E\u1L^6ЉC@Ct&r7‰SD@^61v6FCDPrxt^6v׋C@t!t뚃uCDSHCDSHCLCDƀCDƀZCDu ZtCPh*a6a/t&Efǀǀh ǀe[^_ÍvUE tPhAa6aÉUVS] uS[pXfCVCllTCdTfCZhNa6ZaCPSh|)j@j8PvmC< jhЌ)ЍCPPS#e[^ÍvUS]SH@u$$$<$u-ShTЅuӃCPhPa6`]ÉUVS]CHjLSЋCH`j LSЋC@u ǃX| ǃXX\ǃǃǃCxCxC|1ɐ]A~ǃt&BC|B C|s|Iye[^ÍvUWVSuF @ E~tPhba6_fWEP3ÃuF,Cst'EPhma67_F,&F$CF j@9ESEP uRSh)ЋChPwN u7кMb)RChPfEPN91SEP>9vVEP" t+SfhVEP t SDe[^_ÍvU WVSu} j@8E^xtStC B C F|S CzGjjj裝ÃtjS迍Dt&FPh|a6]*u"jjha6jFxP cvEP 8؍e[^_ÉUMU BB hTЅuÍvUWVShTEE_TЋU4Gj@w7ǃvCH Q]AStC B C S CW 7FH$$<$uV%jSVtYj@6ǃCtSP CS W6[.uFH$$<$u VWq6t%VEEE;T}uhTe[^_U WVSu] j@5CFxCt FxSP CF|^xFxC {u PW5e[^_U WVS]sF x PJha6Zj@k5ECt+ha6ZC@KSWTt&hNa6ZKSW Fu/Sh)ЋChPu7PChP EP4e[^_ÐU8E<EVt LJ j uSe[^_ÐUWVSu }_h`j6-EPjj w|S0tFPhbj6m-gt&EPjjuS tFPhj68-28U<Et tj6 j6Ѕtu U !ut*uBjLSиe[^_ÐU,WVSE@EUDUM IMEt5u E BEu @E @jLSЃEuk} }}U rJ }u B9s t|9M I ME E uTUUEfAEfEfEE} U Z JM}tsUffM fMBUK}tEUf t&EE뷍vuuȉfuff?Muf+]e}}}t9}r͋uft&]]}t MEAM1ۅ}hl6t&E E }tE}EUMfEuvMEt-uMBjLSЋEe[^_ÍvUWVS] EfE؋U;)fEЉUыE@DtAUt`4t;ur!}f[}ffJ&MƋ}f/}B"t1E|4t;ur}Uf)UEUUEEU@DtAUt_4t;ur }fZ}ffCMƋ}f/}B"t1E|4t;ur}U[^_ÐUWVSEu }@DtWօt 9rfRffBf4t&B&t&օt9rv[^_ÍvUS]t.u  Bu @ @jLSЃSvut*uBjLSЋ]ÍvU WVS] u  Ht㋃ʀʀPt&u u@ tt:H@u HthAhAjS衰jjj$SͰ jjj%S辰WSLe[^_Uul1ÍvUEU @BÐUUpRÍvUWVS]} tsuQ&Q Yt Au Q A u  Q  $t A t)YQu Qt&Iu%#Q%t&ȉt鋃H[^_ÍvUWVSu E1ۃ}u VEVUE*y$m6Љl6jl6Zl6Jm6:m6^m6W}u Vu Ft@!m6t&*m63m6ЍBu4un69\uǃǃh E}tjuV}tjuV}th uWEe[^_ÐUWVS] hn6{EpxEPjjUr|VW0tCPhn6CEPjjUB|PV tCPhn6 LEPjh E\W CPho6UUUUHU!U#HU-E8E<@EDǃ1ɍt&H A~9E@j2LSЃ)E@hLSЃE@1ɍuHUt&HU9A~˅E@UH!t&UUHuUu,EtǃHU!Eǃ o6Ѓto6P{Wh@o6tUH!ƃ HtIǃ)ǃ,)ǃ)ǃ)ǃH)ǃ)ǃ)ǃǃ S`tWhbo6RtwC @tfǃ vfǃfǃfǃ  fdt&Udt&UBcvfǃfǃ fǃ&  ftUtUBU8@ w?$@p6б @Who6 "U8PWho6 UUt&U Ut&U Ut&U Ut&U Ut&tEHtE@ t&tE@ t&tE@ t&tE@ t&SctWho6 }uffu+9r19s}uu A9r1QEPhp6 e[^_ÉU,WVSEEUUM@MEDEU RUM} }}E pH }u B9s t|9M I ME E uU4t&UUEfaU q}tˋUBvEfEfEE} M Y AE}tsUffM fMBUK}tEUf t&EE뷍vuuȉfuff?Muf+]e}}}t9}r͋uft&]]}t MEAM1ۅ}hp6t&E E }tE}EUMfEt}UB Ee[^_ÐUWVS] EfE؋U;)fEЉUыE@DtAUtY4t;ur}fT}ffCMƋ}f/}B"t1E|4t;ur}Uf)UEUUEEU@DtAUt^4t;ur}fYt&}ffCMƋ}f/}B"t1E|4t;ur}U[^_ÐUWVSEu }@DtWօt 9rfRffBf4t&B&t&օt9rv[^_ÍvUShAhAj]Sjjj$S2 jjj%S#j$S谞]ÍvUEP<ÉUEU @BÐUUpRÍvUS]U % tK&Ѓtt&t狃H1[ÐUWVSEu }M@DtAtKօt 9rfIff;Mf*B t1|vօt9rv[^_ÐU WVSEU Ux4X81uS@u"EC@ttE1!t&j LSЃF~e[^_ÍvU WVSEU Ux4X81u St&Cuj LSЃF~Mu S9t C9u1e[^_ÐU WVSEx4p81ۅu V u F t1 vjLSЃC'~̸e[^_ÍvUWVSE@4EUZ8u S$vC%CUE19}UPRYF9|1}u SvC@uj LSЃF~҃}u S  C CEPEPjURau1e[^_ÍvUWVSuF4E^8u S$ C%Cj@UR3Vv }uVO}u>1tCEVug}u t&MU EG9|ƃVu-jVCu}u9t }u S$  C$ C1e[^_ÍvU WVS] Eps4P|EPjjRV tPUEC8t@tE@t&1hLSЃu Uu E@t G~ʅu UE@ƃƃSSt1҃BA9|fA t!1҃tsvBA9|fff fEǀǀhjuV{C8C4juVX1e[^_ÉU WVSu EPV4~BA9|1jSPhSۅPPPPhq60Ɔ4VVt!1҃BA9|@t$1҃BA9|ujF\P^Sv<džl)dž)dž )fGD"WfW=SVh\)jPjU8Pr|^F0e[^_ÐU WVS]{4s8C1&{sEEEEUU ~t}tjj ÃtEvjSCtEM9vMK {UMl+uE]U UEe[^_ÐUWVS]} 3jPEEPWV4URSPlE  i t i t2}KDUxuIVIEPURA WSDЃAf@uVcD6t@uV&V EEPIEe[^_ÉUSECPhq6j SF]ÐUVSu]`UЃN UЋE E $Uи(UЃt4 v `UЉD f\B`U[^ÐU,WVSEEpURU=UuUUUЅtMA9Bujjj =,ƒuhr6S&]ZUЉtUЉP&UBUЃEPjjhV th@r6 1E}wuVGhuV }u tiEЍvjuVn%ff=mPjuVO%ffEÀfPt4Phr6oU똋UXUhjuV$Ej uV$ juV$tEfPuu#tEvEPWURMQ}E}juV賻1ۋ=`UЉ}91 UЋE9 u6| t/}G|t;$UuEf8t$8;(UtC;]|>&D $UЋ]C|(Uf8ǃǃhD e[^_ÐU WVS] }wEPjw|Vʷ thr6LEPƃhr6%=Pu jjjjS CPShjPj8PwyIC0e[^_ÐUVSu ]SV8u#SV_uSVu1e[^ÉUVS]u F|C4ǃ(*ǃ*ЍPƒt* tt)t&ǃt&ǃt&ǃƒ f8t \u#4TЍCPh@s6Or7‰S8S$S tht6.1$vC$puEPkhuUR'huEPs4N$1D)E1;EA~V tCPh@t6huEPS4s4Vǃ)TQ Vf8t"89tQ8PCPht67vf8S4 \t9tQPCPht6\S4r7\C8SSujuWx1C1ɍuUE1AvߋE ǀjuWCxe[^_ÉU WVS]E xEPjjE p|Wu t1Eǃǃ ǃ|SkujuWw1I1ɍuEH t&EH1AvًE ǀjuWjwe[^_ÐUS]jjSqjdLSЃjSfu!<PjS> &1]ÐUWVS] }wEPjw|Vs tCPhy6袡E|Thy6艥|r7Ё\@E1;hsM @;hr1h9st&M8 um@9r}t E뾍&fǃ<ǃDhHtjjh@@u1CPhy6ĤCPhy6认t&fǃ<PZDǃH@ǃdǃǃdǃǃ̲ǃ B*ǃA*ǃ ǃsVhz6SW ftP5eW VShtB*jPj8Pwxe[^_ÐUVS1۾j jjj4ЉSPf C~԰ !!!!h 栰(桰桰桰桰h栰 栍e[^ÐUVSSPeKye[^ÍvUh z6j胟1ÍvUVS]h_Ћ q4w^z6ЃvLz6RSh_z6j:e[^ÍvUWVS111ɋg_Ѕtt&B Ruf_Ѕt߃C~111ۍt&f_tC~g_ A~Ҁ g_ g_ g_1ɸ A~1EE1Ug_Ћu5g_.‹J  4g_Ѓ}t;M}M9~ϋRu։g_Ћ9tPVWShz6NE@h_ЋMh_Љ@g_ЃECX11ۍt&u9t4VC PSR&tVCPS Rȱe[^ÐUbWЉ=vRju$u uuuuu uNtUuu uypÍvUuuuuu uqÉUuu u!rÍvUu uEURPuu urÐUWVSMUˋEE]E E1t B ExqE dW9sbt&EPSEPÌUUуwt"9t EE9E}t1ׅ}u}9r1e[^_ÐU WVSE XUSURSRp{Wp hsEP$ƃ u$URC PssWEP`ƃ t'sWUR+CC& i_Љe[^_ÐUVSuE Xi_Ѕu"hh|6h|6? Hi_Ѓss VsCPVCC#e[^ÐUVShorƃE pjLSЃqÃjLSЃVUrÍe[^ÍvUShrÃE pjLSЃEqjLSЃSr]UXjjDth }6Phj}6UEt PJKj j@uÉUS4Cu7Љ4}@4}@[ÐUu7yUVS]1S}j jc@u܉e[^ÍvUWVS=i_@E@ E@@ @@ 9M|9|E)=9M} EM9} ȉƍ9M} EMvE)=~H)uE)Eu7Љ4әU‹E)9|9|E0&9|!t&C@@ ‰[^_ÉU WVS]ƃxG4@BÉș=u7ЉDž~&&9~ )))))΅[^_UÍvU4C@@ Hug¹)Ѻ Й i_ÉUVS1Éփh@BLS1) jh@BRP迪 i_Ѝe[^ÍvUUЀUh}6jhW*hjjj?h}6jhX*hjjj j)j j>jBj j0hdUhxW*hdUQGjhdU^GUVSuj j|.j j|1ۃSjoC ~1e[^ÉUVSu j jA Pj j1ۃ 4SjvC ~ j j $Pj jUe[^ÉUUBÍvUSMgfff)ˆÁ) ˉ[UVS1t&SjƃC-~j.jnÃj/j`9ЉЍe[^ÍvU WVSuEEEU4=xThlTtj2jÃ1ۃWolSÃ;]tuVSh}6蚑=xTum}ugu_EPh}6jhkǃUR|Pj2jWkvu=xTu xTe[^_ÉU@VSu2h ~6@K UhakÃEP tS[kh`~6%SCku]ЈCuCuCuwEӃuiE҃uXPfEЃ f=v0h~6$fEh~6h 6ST¡ u7+ u7ЍUЃ=u7tUUСU9}h`6誏4t&Uf 9~"h6艏h6| v|U!t&|U5UЃh 6Ge[^U@VS=|UJhiÃuVh tj(VSi u7+ u7=u7t]SU)PZCPE؃CPECPECEUйdf1fPECPECPwEhhÃV=xT~6Ufҍ))P*Pj2jM She[^ÉUU9Euj)j jt&j&j jUWVSE0E9}mEuBEQ)9u)9E}t En vEmC9|1u=Q)ڍ9u)ٍ9t MyvEUB~1ҍX 6MKuUBMLMIMAЉ)Q)A[^_ÉU\WVSuj0EЉEPh 6JE.‰)ЉÍ))Ɖu̍K$I)‰)(U JulEuBEQ)9u)9E}tÒ &ÓFEuFEQE)9u+M9Eă}-m-U f2EuBEQ)9u)9E}tEU;]|11ɉ+F;}E HÈXųEU E)‹M Q))E̺EUE)ˆQ)U(ˆQe[^_ÐUhd6م6UP X6UύvU,WVS]8p XESЋLUMUMj jjjhd*ЍPKjjjjhd*СSЃPK=t78 Уt7Ѓ t7!t7桰hLSЃ $"ǃǃhhLS}fE}U%?=?UmUUУUjLSСUЅtUfǃ8bW-UЅtUt&Ufǃ8U1 "=t7Рt7!t7桡SЋM] \M]艈]SЍe[^_D$D$j$XÉU $"h/h@tYWEPh6e "ÍvUVSu ]UЃttIt\zhɀ6! $"FPjh$h*jj8Ps(F0 8hˀ6߆&h6džUA&hk_UW=YWtThi*t&TPj*Ѝe[^ÍvUS]k_ЋhWЅt =Uu$5U5k_Qh@61hp6 ,=YWt ݰYWЅt**tBB BBlBBp; k_ujC<u_C0Blt3t(t t t&1Ҩ ts8RjjQjjQ]ÐU WVS}t Ph61h_Ƌk_ЃtjW{  "V`_,`th/_Ɖ,V*_4u,٨4 ,e[^_ÉU WVS}t Ph61vh^Ƌk_ЃtjW  "Vu^,`thD^Ɖ,V?^4u,٨4 ,ݠe[^_ÍvUVSu} t7dž,=YWt ݰdž ",Hths]‹,ǀdžRf]e[^ÍvUE,tu hk_4ÐUVuM F1F^ÐUjEPk_Ћ,,cjEPk_Ћ,,@PBEPk_Ћ,,h6UvЃP%PPh6vЃPh6辁jÉUVS]1f}"k_Ћ,[k_Ћ, k_Ћ,Ћ!Ȩ?t ɀ`tuk_Ћ,k_Ћ,!ب?uuQ1ɋT AͬTЅt!9u<ͬTuSh6ȀuVh6诀e[^U WVSu }Myu<~u&Y F !9+u+A9Fv#vQ V u%y |TfAGAQ GW Ek_Ћ,t'y |TfAGAQ GW O@j(e[^_UMk_Ћ,t#TfTЉATЋTЉAQ jUM k_Ћ,t(TfTЉATЋTЉAQ EjÍvUk_Ћ, t h GÐUk_Ћ, tk_Ћ, j ÍvUk_Ћ,uj 1ÐUS]k_Ћ,t) TfTЉCTЋTЉCS Ch(m]UMk_Ћ,t.yÿ},TfTЉATЋTЉAQ A`j ÉUk_Ћ,k_Ћ,i_Tfk_Ћ,i_ЋTЉPk_Ћ, i_СTЋTЉAQ hAIÍvUk_Ћ,t5i_Tfi_СTЉB i_СTЋTЉAQ jAÐUS]k_Ћ,tsTfk_Ћ,TЉk_Ћ,TЋTЉjAM]US]k_Ћ,Tfk_Ћ,TЉk_Ћ,TЋTЉi_@k_Ћ,jA]ÐUk_Ћ, i_Q,i_PQGUk_Ћ, i_Q,i_PQqUk_Ћ, i_Q,i_PQIUk_Ћ,i_PP,i_PWIÐUk_Ћ, i_Q,i_PQSUk_Ћ,i_PP,i_P_SÐUk_Ћ,,i_P,i_P5i_FÐUk_Ћ,,i_P5i_Ћ,i_PoÐUk_Ћ,,i_P,i_P5i_GÐUk_Ћ,,i_P5i_Ћ,i_P'GÐUk_Ћ,,i_P,i_P5i_WQÐUk_Ћ,,i_P5i_Ћ,i_PPÐUk_Ћ,,i_P,i_P5i_Ci_@k_Ћ,ÍvUk_Ћ,,i_P5i_Ћ,i_Pmi_@k_Ћ,ÍvUk_Ћ,,i_P,i_P5i_Di_@k_Ћ,ÍvUk_Ћ,,i_P5i_Ћ,i_PcDi_@k_Ћ,ÍvUk_Ћ,,i_P,i_P5i_wNi_@k_Ћ,ÍvUk_Ћ,,i_P5i_Ћ,i_PMi_@k_Ћ,ÐU塀k_Ћ,k_Ћ,(ÍvU塀k_Ћ,ǀk_Ћ,ǀk_Ћ,ǀ1ҹvk_Ћ,ƄIy础k_Ћ,ǀǀ(ÉUi_ЋTU塀k_Ћ,ǡk_Ћ, k_Ћ,$fB(Ui_ЋTUÍvUi_Ћ<TUVSk_Ћ,syt i_؃|fk_Ћ,i_Ak_Ћ,i_RAQ k_Ћ, i_*t i_t&jAe[^ÍvU$Sk_Ћ,i_=i_uL{u\*i_fi_ЋCB i_ЋCS AQ i_P|{u5i_fi_Ћ@Ci_ЋP @CS b& i_fEAEAQ EUfi_ЋCB i_ЋCS AQ EfECEUCS ]U塀k_Ћ,i_ƄÐU塀k_Ћ,i_Ƅi_@k_Ћ,ÍvUSk_Ћ,i_i_fk_Ћ,i_i_ЋRk_Ћ,i_i_ЋJ R[USk_Ћ,i_i_fk_Ћ,i_i_ЋRk_Ћ,i_i_ЋJ Ri_@k_Ћ,[ÐUWVS]EC8th@6ajt&k_Ћ4u" 4k_Ћ,ǀk_Ћ,$k_Ћ,$@4,k_Ћ,ƀ k_@-t ,ƀ j]Sk_Ћ,$p4Uu"k_Ћ,|V$@4 k_Ћ,%f=%0f=0ufk_Ћ,fǀk_Ћ,Nj _k_Ћ,k_Ћ,ǀk_Ћ,ǀ1ҹk_Ћ,ƄIy础k_Ћ,$,B4,$R4,(}fu6k_Ћ,$@4jSk_Ћ,$p4`k_Ћ,$@4]$i_ЀP&Mk_Ћ,i_Њ@i_<fȃtt,tt t&IKG4L5k_Ћ, i_ЊAi_<t =i_u:,lj$0<u jfQhi_Qft&؃$l6Сk_Ћ,i_Phi_P7k_Ћ,i_Phi_PaW>P~>t&k_Ћ,i_Phi_P9k_Ћ,i_PPhi_w9k_Ћ,i_Phi_PC=i_uk_Ћ,ljk_Ћ,i_PPhi_Ct&$0<uXjAk_Ћ,k_Ћ,EtCi_@k_Ћ,'k؃8ʃ PB%k_Ћ,i_Љt&8E$ák_Ћ,i_Њ@i_`TЃ$6А=i_=i_t,k_Ћ,i_i_P=i_t,k_Ћ,i_i_Pi_@k_Ћ,c=i_8k_Ћ,i_u% i"&h `TСk_Ћ,(EffEk_Ћ,fMk_Ћ, j]S,$p4RU$</&fuJjSk_Ћ,$@4@PE$PTfi_СTTЉB i_СXTЋ\TЉAQ i_e[^UVS i_ЊEk_Ћ,K؃~t -qi_< tTt&<Cvy} /i_5i_tlÃth?i_PPhPT/i_PP)i_Ј2Ei_Ѓx} Pk_Ћ,Yvk_Ћ,k_Ћ,i_ЊUuk_Ћ,EU5i_PTfi_СTTЉB i_СXTЋ\TЉAQ k_Ћ,e[^U WVS5i_Сk_Ћ,Htwi_Єuw~} ]k_Ћ,=i_fi_ЋFB i_ЋFV AQ i_@FEVEPL<uOVjk_Ћ,=i_Tfi_СTЉB i_СTЋTI<uYk_Ћ,=i_Tfi_СTЉB i_СTЋTЉAQ i_Ј<u\F@uj0i_ЀH@k_Ћ,=i_fi_ЋFB i_ЋFV AQ @<u6t#k_Ћ,=i_r jAe[^_ÉU塀k_Ћ,ÉU塀k_Ћ,ÉUSi_Єu\i_Ѐ8tdx} Huei_ЋZ؃Bk_Ћ,Re_i_X+<t!<ui_Ѐ8uPv]ÉUi_ЄuEi_Ћ@?E= u55i_ Ki_@?PQTv<t <t{ÐU$Si_ЊEi_Єi_Ёx} ??5i_Ãth?i_PPhPT*EP5i_#k_Ћ,tuU0Ui_ЋEfi_ЋEB i_ЋEUAQ i_Ёx} Pt&k_Ћ,k_Ћ,i_ЊUL<uk_Ћ,4<u+k_Ћ,k_Ћ,E]ÍvU VS]ECi_Ёx} SZƃuh?SShPTs)EPSS"k_Ћ,FtuEfECEUCS 1}<u;PTfTTЉCXTЋ\TЉCS k_Ћ,1@=i_t)k_Ћ,k_Ћ,Ee[^ÍvU5i_ÉU$Sk_Ћ,H{t[ri_fEBEBR EUEPFu@k_Ћ,i_ЋEfi_ЋEB i_ЋEUAQ ]ÉU,WVSk_Ћ,@EX i_Јui_Ћ@MQ)=~ {rk_Ћ,k_Ћ,U ?h?]SMQ5i_1SFE?u}SOh?SSEPN h?i_PSP&  ttk_Ћ,k_Ћ,G h?uVUR5i_0] ]VEE?V O)߉}h?VVMQM h?i_PVP&k_Ћ,k_Ћ,k_Ћ,U艐i_ЁxP] Шt eu2uMy}L=tVublu:t?tKi_Ёx} LuGu/k_Ћ,.ut5i_i_PURP e[^_ÐU WVSk_Ћ,@Oi_Јi_Ѐ8x| } k_Ћ,ǀ?i_PP\k_Ћ,k_Ћ,h?WW5i_Ki_@k_Ћ,k_Ћ,i_j@&tujx;&tuWW5i_WNi_@k_Ћ,k_Ћ,i_ЊB<uR <u4Tfi_СTЉB i_СTЋTЉAQ lR4PVi_Ёx} 7i_Ѐ8u @Tx}@k_Ћ,k_Ћ,i_Tfi_СTЉB i_СTЋTi_Ѐ8tu @} {i_@k_Ћ,k_Ћ,i_Tfi_СTЉB i_СTЋTЉAQ i_Јi_Ѐ:B|auUz uLzuFBk_Ћ,k_Ћ,i_ЃPB t&= ut7i_@k_Ћ,Ui_Ѐxu%@k_Ћ,=i_Ѐ7)t&@k_Ћ,=i_ЃW`e[^_U,WVSk_Ћ,@S i_Ј9;i_ ǁz| {} Mk_Ћ,U苐Uǀ?i_So"uh?EPS5i_h?EP5i_S#*uV_th?VVhTcth?VVhTGtuk_Ћ,U쉐k_Ћ,U艐EfECEUCS 'vtuj*&tuSS5i_Wt EuOi_Ѐ8u%TfTЉCTЋTvh?ShThT v{} F}i_Ѐ8TfTЉCTЋT8i_Ёx} 5TfTЉCTЋTЉCS U&Ei_Ёx} i_Ѐ8uBTfTЉCTЋTЉCS i_@k_Ћ,TfTЉCTЋTЉCS UEvu?E{} uGTfTЉCTЋTЉCS Ui_@k_Ћ,Ae[^_ÐUh ÍvUjÉU WVSk_Ћ,@Ki_ЈEi_Ёx| {} 5k_Ћ,ǀ?i_PP-tSt&k_Ћ,k_Ћ,h?SS5i_LCP&} Шtj?A}Ou{} ai_Њ0i_fi_Ћ@Ci_ЋP @CS uSSS5i_}u`i_Ѐ8u6@|Sj= o3Mt&x<I*uki_Ѐ8uAx|x uxtS7x} D3x"SS5i_}uSS5i_~t&}uSS5i_Xi_Ѐ8tuS{>t&{} uA TfTЉCTЋTЉCS i_@k_Ћ,e[^_ÐU VSk_Ћ,@Ki_Јi_Ёx| {} u{~a;uEji_ЊTfi_СTЉB i_СTЋTdt&jzi_Њk_Ћ,k_Ћ, fECECS EUEP7k_Ћ,U;tڡi_Pk_Ћ,jPMA}ui_Ёx^Ti_Ёx} .u5i_Tfi_СTЉB i_СTЋT3t&i_Tfi_СTЉB i_СTЋTЉAQ i_Јu+t0u ;Buya&uKu{}c\&u;tKtFu5i_r1u't&uti_PSPr t&e[^Ui_ЋTUi_ЋTÐUWVS}jEPk_Ћ,$p4^k_Ћ,$@4EEm$Eu<u1k_Ћ,ETЋ$4u}t5j&k_Ћ,ËTЋ$MƃuDjEPk_Ћ,$p4 ^Eơk_Ћ,$@4Kt}u:jEPk_Ћ,$p4]uk_Ћ,$@4e[^_ÐU VSMEEi_ЈE<utPg!k_Ћ,i_Ћ4T$tl tv}u:jEP,$p4\k_Ћ,$@4EjEP,$p4\EEk_Ћ,$@4IjEP,$p4j\EEk_Ћ,$@4t&jjEi_Ѝe[^ÐUVS1u TЃtt;tvk_Ћ,i_ЊCi_Rk_Ћ,Iȃ{t m&TE$6?!G##+.'g/*W.S'{'/k?2t4d#5jk_Ћ,P5i_bZt&Kp!k_Ћ,i_f i_ЉC$i_Ћ(i_ЉCS A5;6O/j5i_Сk_Ћ,Vt&$~k_Ћ,ǡk_Ћ, j5i_Сk_Ћ,PXk_Ћ,i_Ћ("t&+tCk_Ћ,e[^ÐU VSMu Qyu(TfTЉFTЋTЉFV f}9tVvf}*TfTЉFTЋTЉFV {t&AE]A Cf}PSA}EUfEEj h@TSEP[ UJUEfVEUFV V81e[^ÐUWVSƅEXxu"TЋUfTЉBTЋT/ff|/TЋUfTЉBTЋTЋMAQ f}Ex ƅMAQ EUf}!PEP@}EUEU؃ډEUEuV7MAQ EUPEPN@ }EUEUEUMEUBh?REPV;MYMAQ EUP]S?}EU}WSSuVWWfEE jhTV]Sc SSWfEE jhTVEP7 U؋M+UM̉U؉M܋EfEEԉEUM]Sr h?SEPS'=fEuEPh0TWHV;h?URVSK th?MQQhT h[^_US]jCP>KC]UMfiftQÍvUMfQi) ftQÐUMfQi) ftQÐU|WVSExEP 4v(GEEh?EPURhPT9EMAE؉U܋EE܃}} E܋EE؉EE܉EEEEP#EEh?EPURMЉMQ9E Eȃ E]SuVVSE jh@TSEE]SfUUEMQ3}t.TЋU fTЉBTЋTЋM AQ EEE}t:MAQ ؃ډE؉U܃EP>3h?URMQR EP3EEEh?]SURMQh?EPPSF: h?U RMQS6E P2UM &SVSAEEEEE9EvSEMEEf}u>t:}EE Et(}}SE]U]f}GO߅}ۉ1ftDEt@EEPft%EPtMffGfuۋUJ‰UEM fQEUM AQ Q1x[^_UlWVS}Eh?uVhPTWWE Et h?]SVhPT,h?UURSWEEă | }̰vE PVBEfEMĉMEȋỦEUQ]SJ:uVSSpVjh@TV]ЍEPEEES0h?SSUR7 h?E PSUR4E @U1e[^_UVSuM ]1EE!EUaEUUF!EUUFaEUEtEUu3us[^ÐU\WVS} EPxu(TfTЉGTЋTЉGW "MAEA Ef}!PEP8}EUuVEPP]SVVfEE jhTSEPefEEjhTS]SGSSVE)EȋEE̋UJUċEfWEȉGẺG W. h?WMQW-h?WEPW2G |%w  t hȴGe[^_ÐU|WVSEEHxu.TЋU fTЉBTЋTЋM AQ Xf|:f|] S荷<EXP X P.UJE]CS EUf}!PEP97}EUEEUUREPPDMMQ]SS0fEE jhTЋEPuVfEEjh TЋURMȉMQx]SSEPU؋M+UM̉U؉M܋]K]ԋEfE]UM}W- h?WURW+h?WMQW1fEE jh0TЋ]SVVVEPPfEE jh@TSURM)MȋMMfEE]Sj,UJUċEfEUEȋỦEU]SA,h?SEPS+ h?SURSh?SShPT1 }th?M QWS h?E PSW x[^_ÐU VWSu} ]MT U U1Exk1EEE'UUEgEUUE'EUUEgEU ED EEEEEEtEUyEEF[_^ÐU WVSu]}NE PU 8uWSRV /T&M AV)‰Ѕu,A N )ȅuNE P9u 9s~WSU RV2u&TfTЉCTЋTЉCS eWSVM Qp2U ^tuSM QVlAufuAE 2fFCFV CS  U zvu1u~} ݲfFCFV uet0uE x} 蟲u}fFCFV cvU 8ufFCFV CvS;;t&u1u~} =uM fACAQ CS e[^_ÉUWVSu]}VE @E EU RUN)u/M A N )u"FEM Q9ȅu 9UsEU UP t ~WSM QVJ0t&uD}u} <TfTЉCTЋTЉCS WSVE P/zWSM QV+fWSE PV+Rt}uSU RV軮4}u\u@M 8fFCFV CS  ~~Xu6}uE x} 0U fBCM uX}t"}u0E x}$uqt&U 8u S貮VfFCFV CS <}u4u~} 蜯uM fACAQ CS 3e[^_ÐUVSui_ЊKV,u;uB~} #$>uu {}(C<ufw5u~} Ѯi_к8uDuJ:t,"u<wV{I7{t~u/C@t ~uF@u Dji_Ёx| ~}t i_Њ:tungFQ)‰Ѕu)F Q )‰ЅuYV9u 9s~9u"}9u e[^ÍvUS1ۃhi_`t@t j5&1Ot~ tt @Ek_Ћ,k_Ћ, ]ÍvUS1ۀ=i_t$k_Ћ,Eu.k_Ћ,k_Ћ,EjAGvP`t_@tEk_Ћ,k_Ћ,Ej+k_Ћ,nk_Ћ,Wt~(tt&@Ek_Ћ,k_Ћ, ]ÉUS1ۀ=i_t$k_Ћ,Eu+k_Ћ,k_Ћ,EjAPPƒ`tg@tLk_Ћ,k_Ћ,Ejk_Ћ,mk_Ћ,Wt~(tt&@Ek_Ћ,k_Ћ, ]ÉUi_PrUi_PZti_@k_Ћ,ÉU=i_t HfjtRi_@k_Ћ,k_Ћ,i_@k_Ћ,ÉUi_PUi_Pti_@k_Ћ,ÉU=i_ubjtYi_@k_Ћ,k_Ћ,i_@k_Ћ,ÐUVSuk_Ћ,K؃zt腩I&i_fi_ЋFB i_ЋFV AQ k_Ћ,[^ÉUhPTeÍvUh`TMÍvUhpT5ÍvUhTÍvUhTÍvUhTÍvUhTÍvUi_ЋTUVWSu] }F CuJ~ W  { A  G8 VC)ƒW#~t{uWSVWܥ~u&{t{tk{bզ n S{u~tW2Pk{u~ug~^蘦 1 O{ 耦  FGFGFGF G 8 u8ue[_^G䐐USi_ЃjEPSjA舒k_Ћ,EjSEt&i_fEBEBR EUEP}uE};=u}t.jk_Ћ,t E1}t؉EjSEP*]ÉU$Si_Ѐ=i_u>jA蘑k_Ћ,fEjSEt&i_fEBEBR EUEP}uEt2=u}t%jk_Ћ,u1}t؉EjSEP)]U,WVS=i_Сi_Ѐ8uEE=i_u(jA蚐k_Ћ,u_1i_fEBEBR EUEPEUEUE= w uC}cv:j뇉EjGP]S&)jGPS)jG PSL1j ]S Ej SEj>PEP(F~ÃjG PEP(e[^_ÐUVS]{uCC 1S?~C C?)PCP‹s#C k_Ћ,% =t9ta=t9W&%=t+}>t6t&t,;t't&t;u[CS  e[^ÉUWVSi_fEjk_Ћ,PS5(jk_Ћ,PCP(jEPCP(jk_Ћ,PC P'jk_Ћ,PCP'jk_Ћ,PCP'jk_Ћ,PCP'k_Ћ, EE11ҹE$fmt/tpt;tNbt&k_Ћ,ƄIk_Ћ,Ƅ4k_Ћ,}Ƅk_Ћ,}ƄEEIak_Ћ,i_Ћ(Ce[^_ÍvUWVS¡k_Ћ,fMfMǀ1։5i_2k_Ћ,Ei_fk_Љ, i_Љk_Љ,$i_Ћ(i_Љ}uk_Ћ,uƄk_Ћ,U G>k_Ћ,Ek_Ћ,Ek_Ћ,i_[^_ÉUWVS1ۿpk_Ћ,Ѓ }t tt&}f ÃOy[^_ÉUVSi_ЃjSk_Ћ,P#k_Ћ, fUjCPuV# &fEjCPV#jC Pk_Ћ,Pt#jCPk_Ћ,PU#jCPk_Ћ,P6#jCPk_Ћ,P#Ce[^ÐULWVSEPUPU܉ljUԉU؉ỦUЉUĉUȉUk_Ћ,EV?fUFf~7EjW]S}"jEPSn"fE|&ff~TfENMFV EU=@MEPsjWEP"jUREP!(EjW]S!jEPS! fEjWFP!jU<u0EjW]S!jEPS!fE<u6EjW]S\!EjURSF!fEW<u,jWFP)!jEPF P!fE(v<u$jWFP jURF P E>t̀fEjEPEP E E E E E E E E E E}^e[^_ÐU WVS}u ]2EOVuuSVW`NIu ~| u} TfTЉCTЋTtuSVWχu/t4u~} 覉uafGCGW BuHuS[8t&u} bufFCFV CS Ee[^_ÐUS]S C x$u t31k ʃ)KS C{@}"{~[CCSs[S [ލvUS]S C xu tlj1k ʃ)KS C뤐UVWS}G _U MM"!T T΁Ft t7 thtt?uS?tL u&^r)u u ut*%1 T %1 T t5 tctt?uN?tGف u#فr&u ut$ Trف t| Tm t. tMtt ?u8 u=?t- u2rut TsG t T!T= Tt%= Tt%@9GG _[_^PԅXPX!TQOك@sK sO 1YO 1 ˉډ1Yy@uO1  ȉ11YUG11Y?G`!T,=!Ttb u t41ۃo ȃ)O TPjQXXPXPj;XXGWb_PjXXUVWSu} ~  }N+O} ^F f_G }VW1f s ?f@s t t1"ډ1fAs t 11^F ssG[_^ÐUVWSu] }F= " C= {uJK V F9<Tr)8T14T1<TtG8T4TF(TЋF $T1,TУ0TЋFV <T;S rw;Cr<T+CS (TЉ$TЋK s8Tc )(T$TС8Tc),T(TЃ$Tt8TЋCS ),T(TЋ(TС,T;S rw;Cr+CS (TУ,T8TЃu4Tc ),T(TС4Tc)0T,TЃ(Tt'CS )0T,TЃ(T4T8T,TС0T;S r1w;Cr*+CS ,TУ0TЃ4T8Tu s<T 0TЋ,TЉ t$r+KS spu<TtG8T4TO‹4TС8T]UVWSu} F= 蹁 RG= 袁 ;11ۋFg@TЉDTЋFg DTӋF gDTӃF g ыFG}Gu%@TDTO@TЋDT tUVWSu} ~  N+OG _}VW1҃ s T@s t t18ډ10fAs t us t 111)щʋNىˋN ȩuS u< u+uo@@GGGG 8؉Ӻo ȃ)OuG _G~[_^Wi[UVM u sSV1V[^Ã@s VF^Ã`s@F1҉V^1F^UVSM u@sW r2 V1 éf F[^ËV1V[^Ã`s0@F1 éf 1҉V[^1 ^1ۉ^[^UVWSuF N1҃~uڣ`TЉ dTЉhT@u֋ `TƉƉƉ dT)ȋ `TsЃЃ؉u1HljƸXTЉPTУTTЉXTTTЃPTXTTTЃPThT)XTСdTTTС`TPTs>XTTTPTЃXTTTTTСXTσ)TTСXTуσw+ r,=r= rP‰}GM |Ӊ x u u 1ĸ뽃։Ӊ x u u노{qUWVS}M u1c|Z}GP4~4)؍ΙP}؃[^_UVSuM tUAtCA1ۍu Q A8tuC~ՃQ빐Q1[^ÉUWVSEEP B@ƿ6йt&ƿ6йtƿ6йu;EX@|EBp6йu UBxE1 t&1E;,i_u =4i_tMt%EPjjURSl t EAuSEtjuS<}tEǀǀhEe[^_UWVSE ƀƀEP B@ƿ6йt*ƿ6йtƿ6й}E@|EEXBp6йuUBx9E;,i_t)EPjjURS_ th670i_ЉEE8Et&h6vU Z4EEB|ǂ RhX+ЉЃh6E ǀ&h86hT6U ǂ ut&hm6E ǀ@JU Ph6fE ǀhÅ6(UtE@t&u&U.&U&U&U1e[^_ÍvUWVSEPlTЋ} yptAl v =t&A<t*jpFPjp FP1e[^UVSu] StBhjR7Ѓ1ɋS9}"=SМ"+t1,A9} SМ"+u1;^Xi_t~u F tEuVWjp9 9wpuGpUP/F t VwXVG0Sw4@ ЃE PGPhن6@1e[^_ÉUE @ ttE8t 1ÉUVSu ]s ss3V;tNldWЁ`Tu@1ҋ S9}#=SМ"+t1,B9} SМ"+uF ‰Se[^UE tPh6mÉUÉUEp0jju 'ÐUE tPh6ÉU WVSu] 1vh6臂uh 6t&pht}jjjjjjjVF< 85li_Ѓ5di_5`i_hC6Vgh tPh`6_FlFK jjh 6hSYE EU;tE t&c V?Ee[^_UE@p} t @@j@P iÐUli_Ѕt!EpQu li_1UE E=Ti_t*li_Ѕt @<@ uXi_ЋJ jjEPrAÍvU1ÐUVSu] 1ɉ;T}TЋ ti_ЅtA0x$tSq4@$Ѓpi_ЅtSVЍe[^ÉUEM UhTЉtTЉ pi_ÐUhTи9+tTpi_ÐU li_ЅtAu T*t&TtjPVԶue[^ÐUWVSUM ]u}AZA$BAB ABrEBz[^_U WVS]} i_ЃEPuuWSVF$ C$ti_hi_jjji_hi_jjjW@Ѓ tEF FLFPFTdžFxFtFpF|Vze[^_US}ti_.jjhWÃu uuuu S0EC$jjs%CLjjs CPs jsP̦CTjjhjjhCpjjhCtjjhCxjjhC|SiSt؋]ÐUS]U MCCCLtjPCLCPtjPlCPtjPMǃCptjP.CpCttjPCtCxtjPCxC|tjPC|i_t jS]US]E trt#NSKBt&S'2t&jS CCjjS,@RsЋ]ÉUS]C(C,`CC0C4C8C<C@CDC CHCLt'sjP耤;SsCL;SrǃǃC`C|CdCpChClCXC\ǃ]UWVS]E EC,!!u`CHCDS)H~7JKCPt|tCTCH9CvCCTvjS Cc,}} eC\tC`ǃ CXT`tE< t&}C,tD`-ApAt AxD `[ÍvUM} 5uApD `1USM1E ۃ5w$<6лqApD `]L&>7.'   PQ؋]ÉU} 6u ju1ÍvU1ÐUSM] t [U} \t t&u]1ÐUVSU ] 0|:9~;t'. RˆDCЉ80Hȃ ~ ǂ $u [^ÍvUUE p|.q~)tu$vuǂǂ U WVS]E ̓@$6А{T.1jVQss@ Ѓ FC9rۃs4C)PVssBЋSPCCT{TCp|#t&jQVss@ Ѓ Ny1C9s-s4jWss@Ѓ FC9rڋCPSCTCH9CvFCA1;{ s,1;sss0jEVWs@Ѓ F;srG;{ rCC1e[^_ÉUVSUE ؍K߃wN$,6Ѝ& aˆDCЉG?v4,Hȃ ~ ǂ SR&1e[^ÍvU WVS]u }C,@tKTSRsjsЃt]$<wEPPS{9t&S(t}tEPPSPSTЉC(FOuC,@tKTSRsjsЍe[^_U WVS]u CH9vƉ)~4WSDRRs@ЃKPtWCDRPs4VSDRs@ЃCPt>Vj{DPYSPt&C<tCTCH9CvC CTe[^_ÐU WVS]u CH9vƉ)~5 WSDPRsAЃKPtWSDPRNs4VsDs@ЃCPt6VjCDP蝗SPt C<tCTCH9Cv CCTe[^_ÍvUVS]E t3s4KTCS)PRssFЋSC )Ѝp s4VBRs@ЃSPVjC@P}St+s4Rjs@ЃCPtsjP茖s4SBKTRjss@*s4s js@ЃCPt5s jP>SPt C<tCTCH9Cv CCTe[^ÐUVS]E t9t jtLb3s4KTCS)PRssF:s4SBKTRjss@s4sjss@Ѝe[^U\WVSuE E E ƒmAMeLCA>@ HD t&JwKf.XPt&cGhOQil}$||p"n>rnJSt&yEp!4p$u$w$K?'u&6c>tIJ?tPi?h?l?p$?*j h6VjVAV1;Hj!4VG;|#t&1;j!4VG;|1;j,4VAG;|1;j,4V^G;|t&j7Vhj7V!Rt&V[@/&1ۃjh̒6v$1;~sJFL<t;GPԒ6ЅtҒ6PhՒ6j]SPSv$G;~rjhڒ6+j hݒ6vuNTMFE^)9vЉǍM)щM~&MeMQMRSvv@ Ѓ v4NTWVRuN+FD9vЉ)‰VFPtY<u5QuFHFDN)H9vȉFVPt$<tFTFH9FFFTuNTFN)H9vNavuF9v)Nf,6F,t"uFH9vFDt&uF 9vHFVPt F<tFTFH9Fv FFTuNTF9vHFf,u^DFHE؋N)9vЉlj)؋U)‰VHND}LuWV&t&WVV^DMNH6uFTEFME^)9vЉǍM)щM~&MeMQMSRvv@ Ѓ v4NTRV)R4u^TV~)9vƒv4RWvv@taj h6t&t t:VLF+vjvL ^8FEFD~H1F,tEFFFF0F4F8F<F@e[^_ÉU WVSu] }t FuuڃRURWv@Ѓ tFuttFut t FutFut E}ǃuSURWv@Ѕu1e[^_ÐUVS]}u`sjsL11;}61 ]ÉUEuuu % ЋLT4US]E t(ǃC@P CTjS1]ÐUSE% ЋLTЋtBuu C@P‹Hȃ}SЋ]UEuuuu % ЋLT4ÉUVSu] MUEPRQSV.ËPЃ } V?؍e[^ÉUME U=~ft(w =}ft?=vtt6:ƒQ\1=AT$@9t&&uuRPQt‰ÍvUWVSU uM]Ww[W @pwW W@y$W@uw W @uW@Ww1W wW> W W+wW WUB4SQlRhW}`tFUBpFt F &}GtFtF UBxF }G4SQVhWw8@ TUlt F &BBtFBBtF B B 1UlBFBFB F 1jSÅxTxxT뻉M|tu7VMbtu7VMbtFvAAtFAA1M|AFAF1jSÅTNT=<jjWEWRvà uVEPEP6qW}WE ~U Pr0j}W}U9vPv}}U1u 6%=u)}%=utIrt&UB0PEUUrEPEPRÃu0}Vw01}G4SQVRw8@ЉÍe[^_ÍvUU% ¡LTЃuu @PU1ҋ \T9} t&LTЋt xhu B9|ÉUSUЅt+EChhTЍPC@PSju v1]ÐU WVS]E 1tph{du t {htc{huV{hshPSt{h2tFPCPh6SdGPCPhЛ6uH ` ,C0>uH ` t&C0>uH @` >ʁ,t -t&NC0@ tEChdjPTC0@ t!Ch@jP߬0C0@ u%`=` .$6ЋShj PR>ChjPϨChjP貨t&=pZWpZWjj5XUot&f%Pf$uPjBf(Pf'uPj f+Pf*uPjSf1e[^ÉU,WVSu]~ E} uYV % F ttt;_<vG4Sw8@ЋF X<\t(P;DPUvUURS6bt#Mf9tAPPE PWEUB?$6Ѓ} u N [f R} u N Cf 9&} (v } v  } u N f } u N f &} u N @f &} u N f &} u N f |} uvv p} ujv d} uv F %PW$9&t]t%E u ;u ;nt+tLJ􍇐PP} u}tSV tttV ;Z<B4Sr8@ЋF X<]]F t F 0u]N t@Sfov0%f=t#%f=u%=u*ȃuEP`ƒECfov8%f=t"%f=u%t&=tT=t=tDD=t=u40f u+f F~uf FfVt&fuGV tttV tl;ZMuU RE@PMMЃE؋UЋ4^ F9 fov1%f=t%f=uʲ t&ftP6h6M%f=u%E&ʉ%f=u҉Ũfov(%f=t%f=u%=tf tftfuU E̍fQEVUȋN MčQ9saߋE Cfov-%f=t%f=uʲ ftEԋUȋMčQ9r}~P6h6LU̍M BPEPSw,>F4@w@F@+edAtWmt6wmdnv=FgdXvf?5hVUh@,(PTH F(@F8@F0F,@ F4jh6ЍtP|3fF jh6ЍP`3P$VUB ǃEPjr|EP th6at&UURuEPuh 62uURAE} h`6u<6йu60uD6йu 6t&EPh 6PhG6ƃAǃǃ@UEjS 4u \ @\}Su Hω4 DžtۋPu*@lj8t)M6$߉DžtҋP@ &`6ЃQThs6{u:]5†$9…BH]tNjʀtt&SC%t„"S tڋƀsVShBj@tPUREpz uVh6_S jS*S\le[^_U|WVS1ۋUE؋EEEEEEfEfEfEfEfEfEj jMMQEPJt1ҍvMfQB|f;]t1u[EnM2fE3EZEUtE11;}}`ɋEt tˀt  ƋEu U\ G;}|M!ЈB2EfЈB3E€MEt @t@E t EUHZE t Mx[^_ÐUE U@p2*u1ÐU WVS}u t*hSGPVSh6 wh6[^_UU MB t;At 1t&QRu@ÍvULWVSEE؃PU Ru)h6E؋pPUԋ@EЃP)E̿9EU؋B EuEԉEUЉU}EPjhEPV t!WE Ph 6It&1ɍ]uU܁€ E܊ A~؊E}huVB$# tsF ECPSsSFEPjhF  PW; th6&uWdE} h 6Fƿ6йu`60ƿ6йu 6Ph6Ph6ƃAǃǃ@jS u \ @\}EPUREPtURCPh6 u _ @_ȅu Z @Zu[ @[t00uU&t$}7.€}}u!v Hω4 DžtۋPu*@lj8t)96$߉DžtҋP@ &L6ЃQTh_6ku:]5†$9…BH]tNjʀtt&S3 t„"StڋƀuURǃsVShBj@tPuEP0u>Vh6AtWh6,h6S*tWVh6jS,SQe[^_ÐUE M}u 8tt ! t 1ÐU WVS}1t&F%TЅtPGP u܃%Te[^_ÍvUWVS} ]3C EhH6EPjhC  PV0thK6&EG0SURPVtuh`6EPuEP!tuhy6ZuEPEÃwVWh`j@juEPn0u5h6 tSh6h6+WDztVh6 SWe[^_ÐUVS]3jh6ЍCPuIEPjj C  PV\ u%juVÃj uV;v1e[^ÍvUWVS} ]3C Ejh6ЍCP6Ѕu6ЃRh)6EPjj C  PV0t h@6w0EG4WPVuhh6nEPw8EP!tw8GPh6VuEPBƃ_SWh+j@juEPkG@0u5Sh6 tVh6h6-VSh 6GD+GHL+GL+ЃW_e[^_ÍvU WVSu }uV^}uVN}u VEVU$Ѓ t't'.@tu! 2 +v!Ph@6MV }tF }uV F uhLSЃKu؅uh61$}tEx8@6vƿ6йu 6vƿ6йuV6Ehƿ6йuo6EGƿ6йu6E&ƿ6йu6E6ЃEPSEPt'Sh6UhuURAuMQ-ǃE PE PhjPjuURPM A00uHh6tWh6h&6huEP赾8Vh(6tWh.6jURM Q'e[^_ÐUÍvUÉUSE ]vPh@60uh`6 1]ÍvUU t%uRh6Rh6jhUUÍvUE t uPh6{u uuuuPjLÍvUu jMÐUVS]j{8uSHCH{8u SH t&CHt&{8u SHCH$0Ny[^UWVS]Ej{XuZCPh.6+t&SHHSLPSHZSL`SHzSHSL{8tCHt&{8tCLt&KD{8tCH{8tCLvKDhLSЃ{8tCHhLS1EhLSЃ{8uSPCPEhLSЃ{8uSPCP}Uu1Ext&U Br9}6u2SHFSLEG&SHXSLE_u%TЋVUЃ{8tCH{8tCLUЈ%TЍHFEσ{8tCHt&{8tCLUψEGR1EXU Bu9uSHt&SLEt&SHt&SLEt&SHt&SLEt&SHt&SLEt&u%TЊVU΃{8fCH{8fCLUΈ%TЍHFEȃ{8QCH{8RCLUȈ%TЍHFEǃ{8@CH{8ACLULj%TЍHFE{8,CH&{8&CLUEG1E8&U Bs9}%M!SH6SLE7&M%TЊU{8t͋CHt&{8tʋCLUA$tCt:tt.E,E&ESH2SLE7&E%TЍH{8tҋCH&{8tʋCLUEG1EU Bt9}ESHSL!%TЃ{8tCH{8t܋CLEGv1EU Bv9 uvSHt&SLEt&SH&t&SLE't&SH:t&SLE;t&SHKt&SLELt&SH\t&SLEdt&SHut&SLEvt&SHt&SLEt&SHt&SLEt&u%TЊVU{8CH{8CLU%TЍHFE{8CH{8CLU%TЍHFE{8CH{8CLU%TЍHFE{8CH{8CLU%TЍHFE{8CH{8CLU&%TЍHFE{8CH{8CLU%TЍHFE{8qCH{8rCLU%TЍHFE{8`CH{8aCLUEG?x[^_UVS]h\VC8EEV/ uRVK}uUE}u U t&EhLSЃV.H[^UWVSuFEEjh6Ѝ\pPSz. t19jSxF|ydžS`. t S.H[^_ÍvUWVS] }GC8GC!At@AAtffCVC$ЈCQr)Ѝ\xArCFV ЉCFV ЉC FCFCQr)Ѝ\xArCF ЉCC CFCnt&Qu)ЍXAuCVF ‰SVF ‰S FV ЉCVFQv)ЍAvCVF F F ‰SVF F F ‰S V F  F  F ‰SVF F F cQv)ЍAvCVF F F ‰SS CVF F F ‰S1e[^_U,WVSu]DžDžDžhPXjjh hP3SP1V~8tFH~8uVPt&VHFPËU :\0Yt2t-u W@PFPh`6DžtXGtt&V-~8tFH~8uVPt&VHVH8FPÄV/~8tƋFH~8uVPVH4t&FPV~8t̋FH~8u VP t&FPff 1Ӊ9}g&VW~8tFH~8uVPt&VHFPBG;|fv-E @PFPh6 t}PPPPPP` u(E @PFPh6 tufe PjP1 uӋE @P6Ѓ ~6PFPh-61[^_ÐUExru@tu xsuxtv1UVS] UBCxBuBxC| C|BxCxC|B,CPslVh\]j@:P8Pr\(0K0C4shChC`656.6%6666!6ÉUS]E @PPPSh56h@BLS'TЋ]UÍvUj!=r7t jjj?ÐUj!=r7t jjjÐUVSu] j_O UPjC!sV+j UЅt 5P7Ѝe[^ÍvUSMU =j_uA4uj_.j_ЍXj_Ѓ0t% PQC1]UWVS]u EF $`6E v=j_=j_j_vS8j_=j_=j_=j_u =j_t j_Ej_ЃvSrj_g=j_Z=j_Mj_?=j_4=j_'=j_u =j_t j_Ej_ЃvSVj_}Wjh SuxUtl;'TsdC4%=tU=@u9S8tIWS :vVSr|t&UP PSWj_ЃvSC=j_v:]SjhStShL6JSjh SEe[^_ÐUWVSu1=j_tjj]jSSjh S t}|&Sh6SV>t=j_u}u=j_tj_"=j_u =j_tj_j_j_j_j_j_j_ЅtHj_Љe[^_U VS]juVƒUV1=j_uPhS tVh6e[^U VSu =j_tSj]S}ƒUSVhS% tEPPxPVh6]e[^ÉU VSu =&Tt=j_uvY&j]SuSuhS t'Sh6} ut&1e[^ÍvU$S=&Tt3= 'Tt*j]Sj_tSjhS) ]U$S=&Tt'= 'Ttj]SESjhS ]U$Sj]SEj_Ѓ=j_u3<u/SjhS uEj_ЊEj_pt&jSESjhSf uj_j_2&j_j_Рj_Тj_Єuj_j_j_Pj_Ph6\j_u 'Th69]U$Sj]S S=j_uPh S tSh!6SjhSy tSh86EPhJ6誘]ÐUWVSEEX=&T0`6йCS C= w = C= wC= C= w C= wrEPjs sEp e uQs uEp hEPjssEp e0usuEp h1e[^_ÉU,WVS}w j_V F@%)‰V VF@%)‰VVF@%)‰VU B fxtPf;Ht щ j_ЋM A @t 'Tt 'Tfj_8Fj_ЋF^9vÉV F9sЉ)ًV9w9s 9wsF9rjF@L9s9v)EPjQF9vRw bdMMV 9s)MI&)щM9&EPjAPSw dEPjF@Pvw d UF9u N))ЉEjjjjv RjL:jjjjvuj4:jjjjvuj :E PPj_t jVjjj]SMSjh SuSU Rm&Sh\6Vjjhm6j E @PM QE P u"U R 'T'TUM Qh0Z,Bjjjjjjj9jjjjjjj8jjjjjjj 8e[^_ÐUVS]sVhs6ЍCt!V tPRh6|h6|L'T=@m_uh6{|Hm_Lm_Hm_DžW&@m_DžDžC4Vǃ4|'TЅPV5Pm_ЋЃt2L'TVCPPh6{{t&|'TЍR5Pm_Ћ@Ѓt9L'TCVCPPh@6.{ jjjҺ1҉lj󫋅0DfA=|'TtAAvwGHm_Ѕt 9}GLm_Љ8=Lm_bPHm_RGf9DtAL'Tt)PDPVCPPh6z L f!O;=Dm_11Hm_Ѕt^{uNPCP7u2CC L'T tPsh@6}y[u1uOF ƒRPFPEPh@6+y F t*hSjjP Shk6xh6xhPm_h|'TЋPuU RAЃ =@m_uh6xHm_Lm_Hm_DžM@m_DžDžC4V>ǃ4|'TЅPV5Pm_ЋЃt/L'TVCPPh6wx|'TЍR5Pm_Ћ@Ѓt9L'TCVCPPh@6^w jjj1҉lj󫋅0DfA=|'TtAAvwGHm_Ѕt 9}GLm_Љ8=Lm_bPHm_RGf9DtAL'Tt)PDPVCPPh6Ov L f!O;=Dm_1t Z1Hm_ЅKt$ L'T Qsh6}L'T tsh6uPCPu4SC  L'T t*Rh6ZuL'T th6Au[AHm_Ѕtet&{uPf#CuB~0C HCL'T tssh 6t[uL'T tPh`6t1[^_ÐU,WVSE EEPUR)EEffPPƃj EPURF | tFtE&EE%UREPUREPEjREPà ffjUREP%t EjUREP|Áu u SjUREPUREPǁ VjUREP L'Tt%UUЃWURURPh6r 9}}}EE9EEU9U}9jEPUREPvEjREPà }Ee[^_ÐU‹MЃ 9uuE뤃C~11EPEP PuEp0M 9SC~e[^_ÐUWVS}} w U r}}11EEPUUR P@uw7P‹M ;E u&}uAARuw7褻1VC~11EPUR Puw7‹M ;U BC~e[^_ÐUVSu jjj7ÃtI3ECEC CPjjhVJ3 uEL6ЋE1jS!e[^ÐUU MBw(vBwt&Bvœ1ÍvUVSU] uvD&`~hPr r诹}%1e[^U WVSu ]ww r N`~hWEp p<‰! SWEp p螹1e[^_UVS]M uw r6Ѓ;uSCs1[^ÉUWVSuU w ry&EӃ>u V FUE}uEvuEU! EtFUMt&1[^_ÐUVSu jjj臢Ãti3ECEC CPjjh V0 u3CPjjhV}0 uE`6ЋE1t&jSQe[^ÐUU Jv  t&E1ÍvUSME ]vBQ v9tQ t&9u QB t&A@u1[ÉUVS]u MwAw r:S SB%t&;tS ;t݋CHt&1[^ÐUS]uSuu ut t61]ÍvUU MBvBv @1ÍvU WVSU] }Cv :vރVr r̵)} &1e[^_ÐU WVS} uGww r DvSEp pY‰)! VSEp p蹵1e[^_ÐU WVSu]}uWSu VM t#6ЃjDSVݴ PjDSVV1e[^_UU JvE1ÍvUVSE] uv/&jTp pp 6u1e[^ÐU WVSu} w}}wwUsjjTv vǃ]SE PVdU 6и!U ƒ RjTv vcSE PV)uU9Ut1e[^_UWVS}u EE1ۃEPSW9uu8jTw wT‹6ЃEsEEC~EPVW u}tMU; te[^_ÍvUWVSu} 1ۃEPSV9}u6jTv v覲6Ѓ}uPjTv v C~EPWVuEPWVuE9Et t&1e[^_ÐUjjj輜…t&E EBEB E6ЋE1vÐUU Jw E1vÐUVSE] uv6jTp p蛱# 6Ћ$6u1e[^ÉU WVS} uww r gjTEp p- 6Љ!ڋ$6! փjTEp p% VjTEp pe1e[^_ÍvU WVS} sz11EPSEP9}uTjTEp p聰%#6Ћ6t t,vEt&E1vC~e[^_ÉU WVS}} U E11EPSWE 9EjTw w}t}uj6!6Љ!Ӌ6к! ӃjTw ws% SjTw w1&CUe[^_ÐUjjj輙…t&E EBEB E@6ЋE1vÐUU Jw E1vÐUVSE] uv)jTp p蛮u1e[^ÍvU WVS}u} ww rejTw w=EPE PW_M ! jTw w% SjTw wr1e[^_U WVS}u w rPEC1C9EPSW9uujTw w耭%rE1e[^_ÍvU WVS}] w rv1EPVWc9]uVjTw w}ujTw w% SjTw wWF~1e[^_ÐUS]uSuu ut `61]ÍvUU JvE1UVSE] uv6&jHp p 6Љu1e[^ÉUWVS}u wxUskjHw wǫE]]SVW_#E]6 ƒ RjHw w EPVW!u9]t t&1e[^_ÐUExu x u1ÍvUWVS] E@EUR USS0C8C<CHCHCLCDC pRh 6U}tjh,ЋURSxǃt{8}t,hș,h,ЋEPSRƃts1e[^_ÐU WVS]0ut&Cwth 6=hESEPURU B Љƃ jSEPURU B$ЃSEPURU B Љǃ VSEPURU B$ЃEPI u h@6$$!uho6s@*}tU2} tU }$t E$1e[^_ÉU WVS]0tCwt h6;hESEPURU B Љƃ jSEPURU B$ЃSEPURU B Љǃ VSEPURU B$ЃEPB 0t.t h6hU9t PRh6M$uh@63&t.vuh`6t&th6?1}tE0} t ڃ!׋E 8}$t U$1e[^_ÍvU,WVS]sH{LEu s4s0VGЉEEt8EPEPEPUREPURWV( EC5EEPEPjjMQEPFTFPPvPURt"EMEAEAUQ EA1e[^_USE HP @t RQS RQS]ÍvU WVSu vE]|P4(TЋURBЃMDP(TЋEP‹BЃ}M9H%P(TЋEP‹BЃM9H%P(TЋ]SCЃjSC Ћ(T!‹M (TЃRjSCЃjSC  (TЃRjSCЍe[^_U WVSuEx}U1ɋFxu1 Fx#&AwVxr˸ ‰VxuIEMU9B8t h)6e[|0|U0U 0SVU1e[^_ÍvUVSu] vh`6t&jVF Ѝۋ(T!ƒRjVFи!Fxe[^ÐUVSu1ۍ&jVF Ѓ uhLSЃC'~Ӎe[^UVS]jjSCЃhLSЃ {uj/SC %Pj/SCЃ jPjSCЃhLSЃhjSCЃjjSCЃj LSЃj@jSCЃh NLSЃSjjSCЃHƃjSC %u PjSC1t&C$t VSF~1Cxt VS_F~e[^ÍvUEjjP@ЃhLSÐUME tytQAt&yuQBvQA獴&A@ÐUSME ]tyu QA vQAtyu QB t&AX[ÐUWVSu^V|EPjjRSS yhu džh@EPjh\v t=Ut&1tEt&uUBt&U@(E@Ptt֋E@uUBt&U(E@PftGtڋEt&uUBt&U(E@P&tGtڋEt&u UB t&E@PtGjuShuvtdž1e[^_ÐUWVSu ]CE{CEEPjs|W th6~t&EPjh\EPR th6B|\FLh HFHEF@FD@)TЉ~8EFhy6,~UrPh6&UrPh6Vh6o1Et6vhJ6vhX6hc6ohq6_h6Oh6?h6/h6h6Rh6 Urr h 6EX3U2EPh@6Ct t%t&hi6hu6h~6GC4Ph65{ tTsh61;{ }:sS1HP6Ѓ<t6P41h6G;{ |ƃ{8tph61;{8}Y1t&CD46Ѓ<t6RK@S<HP6Ѓ<t6P4h6n G;{8|CTtPh6Mh6=Cth6'Cth6Cth 6Cth6Cth#6C th(6C@th.6{}h86CthB6wCthL6aCthW6KCtha65h6%[XxURU&EftPEPh6e[^_ÐUWVSE EUw.wkt&X!w =&=+MyAh tXjP)0؅u]Chǀ Ch $CClE@Uz]Khzu׋W WWUB BR]Kh}uW WWUB BRA111ɋ}uG WWUB BRЁ}GhuGhD0qCAA=~UzMqhZu׋W WWUB BRȅu]S SSv}G GW fEphUZuыQ QQ}G GWȅuEP PPUB BR fMy]CltxtCl}ljjjdm+UBluh6vjdPuMQlAl@Al@AlXXAl@Ah$AlAhyl$t&EHlUzuӋS SS}G GWAEHxuP PPUB BRЉЃ@EЃ<@EEE9cMyljjjd2*]Clu h6DjdP=}WlGl@Gl@GlPPGl@Gh$GlGhOl$Gl@v]Kl}uW WWUB BRAMAl@ 1;us[v][l][ }uG WWvUB BR ؋MA F;ur]Cl@1;usx]d}l}GEUzuB }WWt&UB dBR EMAdCF;ur}@*T}]{dnExaxuP PPt&UB BREu܁e܀@?u؋MAd;0tjjjj\'Eu h6E}wdE@XUBl@MBlXHE؋}t+zd&EuEuUEPd}MyuQ QQ]C CSE}G$G} G@tMI t]Kt}OEpUzuB M]SSt&}G EGWEuԃeuЃeũeuȃe`uąE9ME@Eu#UB ]}WW&UB EBRE1ۉs<}u}W UWWUB EBRE|C~E9M]}tfMyuA ]QQ}G EGWEtEtEtE}UE9P>xuA QQ]C ECSE}G$ωG t G@tEH UJ6}uG MWW&]C ECSEA}G vUBhfeE9EDžht&0 tvw t"0h\M]{uC }SSUB EBR\ Eh}EEUZuB M}WWUB EBRȅu]C }SSt&UB EBR ȋM] Eh}EEURUuMA ]QQ}G EGWȃ}uUB ]}WWUB EBR ˃}uMA }QQUB EBR ك}u]C }SSvUB EBR ȋM] Ew @t0 &h\MExu‹B ]}WWUB EBR\ Eh}EEUZuB M}WWUB EBRȅu]C }SSt&UB EBR ȋM] Eh}EEURUuMA ]QQ}G EGWȃ}uUB ]}WWUB EBR ˃}uMA }QQUB EBR ك}u]C }SSvUB EBR ȋM] E}hD8hEU;W S]C CC}&E}9Gb uG MWW]C ECSE}G%?G} @G@tMI t]K}_uG MWW}G EGWȅu#UB ]}WW&UB EBR ȋMfA4E]fC4}g E}9G2 } UB8_uG MWW}G EGWȅuUB ]}WWUB EBR MAUzuB M]SS}G EGWE|1H[^_ÐU,WVSE1EEE/TE/TЋEPuf;yRf;Dgftfu`}PK@=UrPA#DMqP}=*TtqEPh6#1}@t&Ƈ.&Ƈ&SE %t&Ƈunt܊E Ct&u S CuƇ>StCuSSE ,t&CuƇtъE CuEuSSKttCu S<t BC<u;Ƈu(%vE)S(SE)&tԊUtӈKtԊECuSt&S KtCuSESZSUtCZuSESt&SUtKv}u}ZtƇLJ$\7Ѓhb7]hr7Qh7Ah71h7WLJuh74ch7"LJ @Ph 7LJhC7輯StCu&SS tCƇtCWh+ЍGTP gWhX+ЍGÃuMu]-SO-uD-`\ ft&}{ECfEEEE}tjj =ÃyfEf}vjS>CcfE}uC$f+Sf)UCUE9vfESUfv9eXtLEfȋ\`}ff]Xu9`\7t&Efȋ`\}fm\`DUEC }f)}E]f}X{\`fD &UBXB4tuPu}WEe[^_ÐU  t& D> jLSЃ}uT> &\> jLSЃmwEMXME\`MM t }u T>  D> jLSЃ}uT> &\> jLSЃmwEMXM܋E\`MMt }u T>  D> jLSЃ}uT> &\> jLSЃmwMX\`D3 jLSЃtlD3 &jLSЃEX\`t(D3 vjLSЃu}T3 zT3 ׍&T3 뗍&T3 et&M`\BT3 /T3 vT3 t&D3 tD3 vjLSЃEEXE؋M\`t+D> jLSЃ}u+T> &T> ׍&T> &\> }tD> jLSЃ tM MmaEX\`D3 jLSЃD3 jLSЋEe[^_ÉU  D> jLSЃ}uT> &\> jLSЃmyEMXME\`MM t }u T>  D> jLSЃ}uT> &\> jLSЃmwEMXME\`MMt }u T>  D> jLSЃ}uT> &\> jLSЃmwEMXM܋E\`Mt }u T>  D> jLSЃ}uT> &\> jLSЃmwEMXMԋE\`M؅Mt }u T>  D> jLSЃ}uT> &\> jLSЃmwMX\`u T3 D3 jLSЃu T3 D3 jLSЍe[^_ÐUÍvUE@Dt 01ÍvUVSEu P @FDFe[^UVS]jPSgƃSXS SVEge[^ÉUSECPh7j S]ÐUS]Xu`\B&\`DXu`\t&\`Xu`\Bt&\`DXu`\ \`D Xu`\Bt&\`DXu`\ \`D h@LSfCz]ÐU WVS]s8heǃS S肶FD @fFDWtee[^_U,WVSEEXU\M`EuFD%@f@ Cuh7EET s;w E<)u}t܋UD}u:MTf7EMT fETEfUDMT19_Et*CUu ǂCMUB4t SPyh dE}IEMfD t&}FEufD7]4K v,}usETfosETffS t'}uCuL7DCDMDhRcCf E&VЃCtjS5CtmS89tCs0CPPVh7#sU BMA BA$BA(B A,ǁ-ǁ-ALfADQCU CfMQE@J& h-h-j] Sm jjhS jjhS U u h vhS M enE Ph-jh@7lU 0Rh-yM 48avE nU (t< B H0SB p4A ЃM B H0EPB p4AЍe[^_ÉU WVS]} s0jPLEt t? &kCPh,7=qS<h7'q IFD@t S{,tP pǃ,  mEPuK1e[^_ÍvU WVS]{08GD@t S(t? B H0VB p4A Ѓ B H0PB p4AЃ jP' WW40h@71e[^_ÉUVS]Sƃu8h07Sh-jP m, uSe[^ÉUS]Ct@t Sǃ<ǃ ǃ$ǃ(ǃ,ǃ0ǃ4ƃ8,tP nǃ,]ÍvU WVS]Ct@t S ht1v}B?}?Zǃǃfǃƃƃǃǃǃǃǃǃ8ƃE@2;u9}vU:tH iPCPh@7m&PDP0rUuUuƃ >u  Nyڋ x,tP0@DDvCt @fCtS&1e[^_ÍvUS]@P!ǃXP!ǃ  <thL-4@t<h-ct h]ÐUVSu<P< ~8 uxFPh7lpPT jPE )PFPh7kpS Vu7ЍPSle[^ÐUEǀ<ÉUÍvUuÐULWVSu EjPEURV0WMQ:à %9i w?i w i tyt&2i 1i vi w"5i 6:i t&i t6i(vUBD@uQÃcEHDUxMRWQ;vMADt5@uP. R.@QU1i uWEPk WURÃ41ۃQ0t&VPEPURr]hVMq~ÃAVP617hVMq>ÃVP1ÃhUrVO j!M܉QEpހÃ} E܃D(@~!t]Nj󥤋E@D@tCR%/&j!MqPÃPB؍[^_UE0ÍvUE@ t Ƃ t&Ƃ8t RB%1ÉUEU BtBu BBÍvUt&MIEjt&Et&{v }Gd{ wjSSÃu E@dKq fUBEt,fwSMAd~E&fvECtt69[8u1+K$;Ms/8&t A &A);Es t&}u }){{ jEPS<Ãt+CtUSE9C sPS^Ãu MAdS} Eu8BBAfBAB A fBMB6t&B}BfBAB A fBBAfBBBBBE@Eufv7ЉB7fB}uUUMQ}WsEP }}E]t|UJ tfz}؍Uw UNju؃t(9r/h7_t|9vuBt&EM Mu}4t9GEt CC CSEp4{UBEt CC CE܃SS}u!MQ}WWE=Et/CUu ǂCM}} y,uQDQ0u^A0QDDtPEPh7bEPUR<}܋Myd[EE(PDP03UtԋM} x,tʋP0@DDU܋EP`e[^_ÉUPM QSJSEe[^_ÍvU WVS] EEuڋEBt&UD}uڋE U1tfwt,&vSEP7BLt&=t&EǁǠ‹4}t9r4-dEǀTU`EPUUuUuUt2VEPPh7NEt&e[^_ÉU WVS]PШu SN1 y,u QDQ0 A0QDDu1}u B @?wPS%;w$PS PDP0@PCPh7MtSօt x,tËP0@DDe[^_ÍvUWVSu} bu.)(tƁu[^_ÐUVS]M u Et㋃wƄZE[^ÍvU WVS]}t> y,uQDQ0u"A0QDDtEPSG1uvZ<t A?v?vE}tURS덉CvBEGPttUTtDE e[^_ÉUS]E  u5u7ЍXPǃ ]UVSu] u SV*jV t vSVwe[^UE#E ÐUS]E #t u u" tXPgǃ ]US]U t  Љ t3u*u7u7P@Ppǃ]ÐUE#E ÐUS]E #t* t%PSku"t@Pkǃ]U WVS]} 1 y,uQDQ0u?&A0QDDt*F2vɃWS}t EPS1eu x,uPDP0 P0@DDEPS8e[^_ÍvU WVS}u1Vu EPWtVuW؉؍e[^_ÍvU WVS]jSeCt@}1Tv y,u QDQ0 A0QDDuK%Wu7tS7ЃF tjSte[^_ÍvUS]jS<Ct@jSbtCjSv<U@LUW&jjEPSFtItU<@D tEDt&juSN]ÐUS]jSCt@tjSu jjS]ÉUWVShEPUU]C]1fuUuCGfdžKf}EE@"UMA$fA(A*A+UuA,A-A.A/&uF,F-F.F/E@0@1@2@3@4UUu @5 t&MA5NuF6F7EUuF8F9F:F;\UB8B9B:8B;MA<uUuA=A>A?E@=@>@?UMA@AA ABUu ACNADvuFC2FDE@E@F@GUMAHAI Uu-AJN?CCCC(C(CCCC MuFJOC?CCCCC(C(CC C C C C CC&E y,uQDQ0uBA0QDDt3h7a?t&uBCvuJJ/MKut9}rʋut&EUudK t 9runBbs Ut&BDt&s5t&MKut9r̉󤍴&hjEP5u h 7E>e[^_ÐUt݃h-1e[^UVS]u Ct@uLjjh#7hhL- ~Ct@tăjSuƒjS u<jSS8jjh.7jhL-f >t݃hL-1e[^ÐUUBxu%f:_uBtt u1U WVS] }G GpP/w/ th:75WB H0 Vj@j@jB p4AЃ thT7y5Kv PVj@jjwS2 t5hm7G5WB H0VB p4AЃ wQ1Y , 0h7ShpjP 2 uh74S"e[^_ÉUVS]s4tCPh74oFD@t SC B H0 B p4AЃ B H0 PB p4AЃV趻V!ǃ1e[^ÉU WVS]} s4jPEttIt& -CPShpjP 1$SAt&fFBFD@t SO $3 / EP1e[^_ÐUÉUVSu ] ^0@fF8F0\4l3Th72|!~t'&h 72FHvh72=r7t F0=FPj F4PjSjv0V:0uJV2cF0P8=r7tFF @t+BTV0r8PFPh@72FH=r7t F0=Vhȼ-fh[^ÍvUSUZSh`7ЍBDPRh$-e tSh71h7m-=3TuW3TTm_Xm_Tm_h7hX3Tjh-seth731h7-]ÍvUVS] j@ ƃ{uXm_ЉCXm_ЉXm_ChTm_pVo e[^US] j@< {t!tCBCXm_ЋSCQ ]ÉUS]C0ƀ<Sw{HuDS_ju7+u7Ph7j C0<P0{HtCDSjdUVSj@j ƃTm_Ѕu%jjh 7j hTm_Tm_Ѓ tыt CB vCXm_ЋCCV s CЃ UE tPh7M/ÉUU% u+=h3Tt Hvh3Thm_1-;3T} 3TЋuxHu1vÐUWVSU} % tt&t#[1ۃj@|􍵀Vu*Euƒjjh7hh\3T4à t|PuWwVHÉ؍h[^_ÐUU% uhm_h3T1ÍvUt Ehm_ hm_3TЋ<Htt&Ut)wU@t&UtT^ F  EEEu lcŰG0<<MtvF E؍E؉XEE]EEEF4EUUjjSlEԃ}uEPSEP腩EЃu\hFPFPURFPG0CPj1hÐU3TÐU 3TÐUjuEPE PuÉUWVS]E EUUs1Ҁ~tC Ћ9tTE8GtBF9|rUtyt]&EPuQS3))t=& /UCBt CUP ECX UE1e[^_ÉUVSuEEu(EPjE PVà 6ƃucu$jEPu uuuVXEp$E@(VËUEu1'B$E@(Vu ؍e[^ÉUS]C PS u[{t PvSt C B vS CCHC0S@ ЃC$t P_jeSf1]ÉUWVSuEVKt7CDtC% @@$tGBQPs3CDt}u9FP0WPBЀcD}uVF@HFu V&NF@$ЋDC${uC 9Cs CuCC tssSЃF0S@ЃCt}u Sa}u!Ctu >tF V_e[^_ÍvUVS]3j@ƒCHFH^~tF1ۃR؍e[^ÐUS]St"C0R@ЃtPhd7C]Uhjjuu uÉUUuuEPuu rRUWVS}]EPƃu jPWG RuWu jURV,E $VE}tFU}EEE]CC %Cjjj}WShjEPV$V>uNEtHECCCCCCCjjjWShjURVm$VVEe[^_ÐUuÐU WVS}] WLƃuSh-jSC RuShjWV$V Ãu 1&V3؍e[^_ÐUE@PÐUEP0PBÐUU} t ===t B0R@ÉU WVSuE E^1Ҁ{tN<ъE8Gu BC9|1[^_ÐUh3TuNUWVSMU }u]Af91uf9tfu Ju1[^_UWVS}M U]uEE% % ȉEMAA ؉AVQWe[^_ÍvUS]Sj u jusu{u 1 t&]ÉUuuu ju8ÉUu jjjuUS]M EEEUBB %BQRS]ÐUS]M EEEUBB %BQRS]ÐUS]M EE% % ȉEUBBBjRS2]ÐUVSuU ]EEEMQA% %ASQVe[^ÍvUS]M E E% % ȉEUBBBjRS]ÐUS]M E E% % ȉEUBBBjRS6]ÐUVSu] ME#E% % ȉEUZB ؉BjRVe[^UVSu] ME#E% % ȉEUZB ؉BjRVwe[^U VSuV8ÃtKEPVEE%ESEPPPu Pu  e[^UWVSu] VǃtSEPVE!E % % ؉EGUBBjRu e[^_ÍvUWVSu ]EP9ǃtlEPEPE!E U% % EGUBJ ىJuRu e[^_ÍvUWVSu ]EPǃtlEPEPE!E U% % EGUBJ ىJuRu e[^_ÍvUWVSu ]EPǃtlEPEPDEEU% % EGUBJ ىJuRu e[^_ÍvUWVS}] W\ƃtQEPWE!E U% % ؉EFUBBjRu( e[^_ÐUWVS] M}EE%" "Eu^F% % ȉFWVEPe[^_ÉUVS]Stƃu Ut&NEPSu< 0SC 9s9wy!tyu1e[^ÍvU WVS]} EPSPSƃ u S?u lt&P@ ‹EjEPRoOu6PE0FPu|Ãu1EP7mQ؍e[^_ÐUS]M EE%EUBB %BQRS']ÉUu諶ÐU WVS}hx-uEPE0ujE PW[j@aƃWE tVZEgjju hW褲ÃV5tE P-EPEPjjW }t E PEe[^_ÉUu˵ÐU WVS}hX-uEPE0ujE PW{j@ƃWE tVzEgjju hWıÃVUtE P-EPEPjjW }t E PEe[^_ÉUS]ju7+u7Ph7jS: tCPh7 ]ÐUu蟴ÐUS] uQA 9sA9u 9r1]U WVSu} j@+3TЃtA93u69{r1E9Cr)S$tC(B(S(C$ 3TЃQ[$uQjjej,Kà 3{ECjCPj{ WjEPsVF$Ѓ jCPssWVF,Ѓ ugCPjjsjsVFЃ u5jjsssVF Ѓ u E1AsVFЃssVF0ЃsWVF(ЃjeSOMe[^_ÉUS]j@ƒ3TЉC$t3TЍK$H(t&3TC(3T3TЃR]ÍvU WVSEU Mu`@w@v,%VQPSÅua@ FOj@%Nj 3TЃt&It 9uuuEPj@hSÃt W{E@ 1ҋEHQ3TЉAt 3TЍYX 3TA 3TЃ@~ċ 3TЋAFQt A B vQ AW{1e[^_ÐUSU x tPeQ&ZXBCj@ƒ3TЉCt 3TЍKH 3TC 3TЃR]ÐUEvPh!7jhU U7UWVS}U MuEE% % E]KC% %ChEPjVSW u!}~CCVSWe[^_ÉU WVS]} CPƃtdu`f{uBPjjS u wfCff fSPCPWSt1ct&Mx19}Bf(f( u t&u tf?AC9|E[^_ÉUSMt&ˉڀ; uB: t A< tˊBu[U WVS}w8EuEE t&}t@E PFPWÃSyEPFPWoEP[ 1ۅt;thSE P$!VF  Rh!7hE Pv}t!E8thPEPw$&t&V F  Rh!7hEP+e[^_ÍvUU%PRh !7u uÉUWVSE8UjV]S}WVSh(!7ЋEPRװэL 0} tJBPBPh.!7ЋEE)PWSװэL X@ ËR G  ‰hEu 1hMQG EPVU RjMQ[à uƅExt&1UBP MQ@tz}qtMEĠEĀ%EčUBB % BEPREPÃu.E$$uVURÃu EtMQҋMA@9~5}t%PRUBPAPPh!7> MfQA UBPQÃMyjje)P؍e[^_ÍvU WVSu}jjep4<Ãu |t&sE {GC C$CCC(EC,CCC@0SЉƃtjeS=@t SE1e[^_US]SC0S@ ЋCHjeS|=]ÍvUMA<<u B~ÍvU\WVSE 8U UEEEEMMEEPC  ‰US C  ‰US C  ‰Uh-hx-ЍEЉPUR菽Ãt*jjej\:M AX.@'DžB9t&jQ] SÃU BLp@E19}J41҉ G9|썅EujjeP9U BXuDž9Džv tfE @@Eh-hx-ЋPUROÃt3M AXBAX OyjeE pX;U BXA9{vjjE P{EEEEh-hx-ЍEPURmÃt/vuEPEPh "7l t&1[^_UWVSE PE}E Ph`"7 qjjej\7Eu O]1҉߉U E,H$@,@-@.@/@0@1@2@PX$7@@?E}G EGUB G &@tx uMA EA fA3TЍP3TЉЉAȃPj PjQƃ tMQ}WyUEP8U1CPMQ8}WjjjEPƃ u…tURMQ}u }@tG@Ext URMQ}?wEPURMA}G0G1Wƃt EPWURMQƃt}WEP qj UREM}OE G  1 uGU G GXtX1ۃ8tSց$EjPV>M EƄ3ECGX<t ~v1ۃt&U Ƅ$C~WT1ۀz tj0t&PtB3@ tttU dCw WTB 9|GT@ M  E ǀ e[^_U WVSuFt P~4t5FLx19}SVC9|jev43FLtjeP3FXtjeP2jeV2e[^_ÐU WVS}_E ECXto18thEPCXPh"7tGPh"7CPh"7sjCX4# FCX<uSj7S<GSe[^_ÐUVSUfrfB  fZ fB  fJ fB  "7"7 ftf9uf9XuPftf9uۃ[^ÐUS]s{{ u x u 1]ÐU\WVSE@U B0hSjP&h$75Su Vh$7 jjQà x vjVh$7ƅ%) )FF % FRVQB~0B€ VFQVPEÃ1۾;+}F()rCF;~փ$7Ћz t$7PS$7Ѓt$7PQE Ph$7jjf0PP-TBTE Ap.Љσ z u+B@ t!x uPh %7&PjR`ÃtQh[%7jƒuPht%7kB$<tRh%7Phh<.jE 8PM Qȃ4PjBP.Ã0tPh%7UhRyM QPjd1҃ ;}J0@H Hy tf@f@d@B;|BT@ EP3vMQ%t&uVt&}Wt&EPt&MQt&uVXt&}WG`EP\vjjjh!ÉڋE ׉EXdxUZdB`M MډωUB`jS#AWh'7.& '$ (7Ѓu ҋM uҋu }W EttUtt&Mǁxuҋu t&uҋ} EP$u ҋM  uҋu }W(qEP,et&MQ0Ut&uV4Et&}W85t&EP<%t&MQ@t&uVDt&Wh'7f}Wh'7P&e[^_U|WVSUE MMEރMQPRGǃ"E9EuE9Eu}u]]]EPWuʃW])B}Bx[^_ÐU|WVSUE }uMMEWPRÃP9}uKEuEE9Eu=E9Eu4tEEFEF} tEU S&EPSuS1x[^_UWVSE P0u 1|&EUmӍE9s2؅}CEMM+M E;]rԃ}H!¸ )Ɖ[^_ÉU|WVS}EEju umÃu7RSBEu }uuu 9u E9Et̓EPSuɃSl1x[^_ÐUS]C tP芽txt1 Cu]ÍvU,WVSEX @U B0Z4SAhVjMq*h`(79GPGPVu Vhb(7,jjSyjSƒ uVh(7E @\z} B$<tVh(7U B\_BM AFG9|{<{= CX<u {><u7PSt'P־PPh57ƃCDPjC=Ps4͡C@PjCPs4苡>ǃ1Ur蒥F~CXt t -u&h4辤CXu CT47vCT471SYBwI$,67ЉSt&Soƃ7Ph57&RRh57/t6CPh57Ph@57pSYSs0j蕝[^_ÉU WVSE1u@3tP13G~Ճj@菠ËUHȃ| R}SuEt3;tu 3kEjSUǂ}u!MQlEPp0j觜1Ee[^_US]M 1t t %t&-ƃtt R{]ÉU WVS1}Ǥ;tP+;F~1}@;tP:;F~Սe[^_ÉUSU]t :BTpEf PuuRu SբSLw1]USU]t 7BTpEPuuu Rr0SТ$Sw1]ÍvUVS]u uIC@4賤CLCMCNCOC<CPCQCRCSujjjCLPSDe[^ÐUUuSǂE BL!BMBNBOB8BPB8BQBRBSjjjBLPRÐU WVS]Uu} E$CdUCeSCfBCgC4TЈCh4TCi4TЈCj4TЈCk4TЉClCmCnCouCpCpE CqSrCsRuPEǃE(E,ǃǃjjCdPsDSg0t jSue[^_ÐUVS] ukPG$`87Ѕǃu3js@S  ivuKjsDS0tNjPjju臠 t/ǃPut4V6PC67Ѓu@67PCPh`67g aHwǃǃPjj Ps@S}  t&t#ǃj C\tO   USBUuƃUƃSƃBƃSC\t'ChCiCjCk   USBStDhUSBS   RCPh67t&   KhCi Cj Ck 9t8Q   RCPh67[<vjPCPh 77<<uM   RCPh`77jSw9~RQCPh77趹<uFǃj   Rvǃj   RtVPCPh77% ǃj;&tV裳PCPh77 ǃ jSft&tVcPCPh 87証 ǃt/PSt&PCPhI87Je[^ÍvUVSUu M]BL!BMBNBOB8BPB8BQJRBSSjQVBLPRe[^ÐUUuIǂE ƂƂt&@ ~j QRMÍvUS]u}E$E EEǃE(E,ǃǃ uuSt jS]ÍvU WVSM] u'B$97Ѓuǃjǃ u0js@S uJjsDS0UMtLjPjjQ臙 t/ǃ Pu{Xu@ǃ fǃjjPsHS ǃj)‰PGt&t#RǃjjEPjjQ~ }{YuCft t1ǃP)‰P$tt tt1 t&ǃW)‰PFt&tVîPCPh87>&ǃjvt,V胮PCPh87ȷ jSǃjvtV3PCPh97x ǃj4tVPCPh@97B ǃjS@`tVPCPh97 ǃt-PSvRCPhI87課e[^_ÉUVSu] EE%EF8MAV9A% %AhjjSQv0耛à twt,u 1&S׬PFPh97؍e[^ÐUE PEPjj1h97违ÐUEjp4ju1ÉUS]EE%EC8MAS9A% %AEPQs0q]US]s43xuCY]US]s0Q A  'CXCXQ A  (Ka]ÐUVSuVfC C(fcC4Tjh"ЍCPVqwPЃ } Vf1e[^ÐUVSuV`fC C(fCKC4Tjh"ЍCPVvPЃ } V1e[^UWS]jjjLz1 z,󫉓B,;.B0<.fB B,B Z$fBB @@f C`fBЍe[_ÉUWVS]K q Et C,,{SU?uA@t C, ES$t5C%=t=tE&E~!Rh`?7ײC,t&CtjdžE@@FTSjsURs$s URWQRVdž0UB@t)C,3vFTESh<.sEPRs URWQRVU15Kj@覌ƃS{BV誌Cu1 t&e[^_ÍvUEx<~@<PU WVS}] UEs S(t t/tFFt2t C8u;S$}C,t&C,t&LJADfAHADFAEAH EYuE WTSh=.sjj C4PEPADPFPW=C,PGPh?7説Kj@DƃSAVHe[^_UVSEu MUǀ!|tu F,F, F,Nj@ϊÃV@Sӊe[^UUz t1(BPB Pjjh?7җ1҅t ÍvUWVS} EphSjV蟩h?7讯S_Sh?7蜯jjV˯ tSh?7zPjV趐tSh @7Mt&w0W4ƅPR-G8G@1ۀtPPƒtUz}B$<uBG8B$<uBG@C9|8t@u)GPh]@7蘮$SGPhE@7肮Ww0j貅[^_ÍvUVS]CLC@fHLMAfRA fPR~ƃ1ۀ~tnP}ƒz}B$<u'BT)B$<uBX<u B\CF9|TtXt \uGPh C7|vjPwWSWsG0S#PwVhC7*,jPS$0BLfBDLJ^.LJZ.LJ`.ЃjVGPP衫 LJ$hJ.LJ(K.LJ,K.LJ h^.h(^.jSb3jjjjSW0u4jjj"Sp3j"S3 &SGPhB7:jt&j S3P+R"jj0POƇQvWHjs[^_ÍvU WVSu~00POPHjPHjj@uE GD@t VjjSjS5W"W ƆPЃ | V蕍EPuVHjr1e[^_ÍvUE tt - Eƀ1ÉUVSuEuvjjAÃuFPh@C7d7rjSACu%FPh@C78S07=t&CC CC C$CjSc6E X 1e[^U WVS}1;sjSW#7t6{u=HwCthPvCu 7F~1e[^_ÉU WVS}1t;sC {u7H,wCthPvCu7 F~1e[^_ÐUVS] uC0@D@tftyttPit+VAPCPhC7耘ǃ u(`xt@d`t@he[^ÍvUWVSuE 8_0CD@vtyi`Pt+V肎PGPhC7LJ `wt&jEPjjURwU B urp軮MvU BTfUD$EtC\rE p AEF FCX^jPqEjU RWm 7uC\"{4tVs4VSEPvqhXV.jjhU rR`EP'uURre[^_ÍvU WVS}E 0^0jPpEfCBfcDtLt9t4CdWPFPhC7* ud`vEPp?C`E p +E @  t SEPlpe[^_UUtuPHudÍvU WVSu~0jPoES0 lu>SSt) tl t W 0S7IVhX.S|H5u7SHEPqot&e[^_U WVS}u ]tCPvjV.s SFSFBFhX.h'j PsSdsr$sGpu 13P׊PGPhC7PHbe[^_ÉUS]u{ltrCEultbjRPtKEIt$Bu ǃBC4t RPbKEfCB]ÍvUWVSuF0EU@D@jPmEV1ۃ ;PCPVC~E@Et jVj  jVU$PjVFVU7u)FPhC7蜒UR8m&V7uFPhD7bpVjHjVjV PjVjV PjVUR謽`uVktEPlNUBD @fBDEPnl0SEVhX.S@E5u7SMEt&e[^_U WVSu`PjTPL8ktPPFPhD7dPjXPLjtPćPFPh;D7JjdhU.jPVhPj\PLk0t!PxPFPh`D7轐@1hXV.jjhsS`s oslOy1e[^_ÉUVSEu8ƀlttSC[0uV踻1e[^ÍvUVSEu P FFe[^U WVSu E1t jP4jE2i w%1i . i t?i 5i Ywi tOf6i(<SUJDSUx6RC0PLv!UB= UBLEPDtf%@f=@uqu jSO #%@f@u$qt jS*$PjS !@uS @t S(UBDp1q1i uC0PEPC0PUR*ǃ4u SSw1!VPEPUR%ǃEPhe[^_ÐUWVS}GdCPhD7貍j@8hEtEPjjjxmuVxt WhEPge[^_ÐUWVS}G0Ef@BjjWjjWW0PBA `tePmtP脃PGPhD7Ɍ `St) t t W􍞜S/Vhr.S8/5u7SE/EP-Ve[^_U WVS}u ][\svjVs h P%;P;tTj@JFǃFD@t S VVƃW)FSjB1e[^_ÉUE tt - Eƀ1ÉUVSuEuvjjÃuFPh J7k7rjS&Cu%FPh J7jS7=t&CC CC C$CjSE X 1e[^U WVS}1;sjSW#7tA{uBCHCt#hPGCus^H7 F~1e[^_ÐU WVS}1tt&;sC {uNGCu79hPGCusG7t&F~1e[^_ÉUWVS]E 8w0EFD@|tvof􍇴PPt+S_PGPhNJ7hLJ  IjEPjjuCHU B urpE X Cff@ ‰Ef wF\zFXjSEC CsjPBEjU RW7u F\(~4tSv4SVEPBh$.jjhU rR rPFE pCe[^_ÉU WVS}E 0^0jPBEfCBfcDtSt9t4CdW ^PFPhkJ7Rg u$GEPAF&C`E p E @  t SlEPAe[^_ÐUUtuP5ÍvUVSuu?^0jiVChjkVChjmVChjoVtC\e[^ÉU WVS}u ]tCPvjVjs NSFSFBh܆.h'jQsS$sfD$sAu17t&Pg\PGPhJ7eP{4e[^_ÉUS]uxCEurthjRPt KEOt$Bu ǃBC4t RPKEfCB]ÉUWVSuF0E@D@jPQ?EVij j"V1ۃ;Pg)PVoC~ UBEtPj`VGVZ 7uFPhJ7=dt&V7u"FPhJ7dUR>V`jj$Vjj#Vj j"VjhV u!VptEPA>SvUBD @fBDEP >SVh.S5u7S&e[^_U WVSu PjP <tPYPFPhJ7:t&$PjP <tPtYPFPhJ7bD1h$.jjhsS sAsy>Oy1e[^_ÉU WVSu E1t jPtPOUPGPhK7^ (:tPUPGPhK7d^ LJ(1EtP$tP`<My1EtPxtP<MyEf`De[^_UVSuM ]E@E% f% ؉EUBBBjRMBe[^ÉUVSuE]} uE@EE% f% ЉEUBJ JuREAe[^U VS]EPEUE uCPh`^7j\1sVh^7R\hhK7jhjS0tPRPVh^7hhZ7jhjS tPRPVh _7[jh]7jhjS u+j W fST1P7RPVh`_7[e[^ÍvUWVS]C0E@Et4UJE, $f,PjS&,EMtxqutpE 9EtEǃp0Mu0QfT0EEtPUEE}uMfaD,uvP0PjjS!,PjSe[^_ÉUS]jjdZuPj^;tCPh_7Yj V]ÉUUz t1)BPB Pjjh]7A1҅t ÉUWVS} EphSjVSSh_7bYS_Sh_7PYjjVY tSh_7.Y~t&UBfB fWDtSh_7X7PjV$:tSh_7X P8ƃ1ۀ~tjPx8ƒz}B$<u%B't&B$<uB<u BCF9|t uGPh`7XUjPjjjW tGPh@`7W &jjf @Pa0u4GPh`7WSGPh`7pW&jP1SPwVh`76W,jPS0n_00CLfCDLJ8.LJ.LJ .ЃjVGPPeSSƇmPd1Wj-[^_U WVS]s0j@1ǃ0tjfPeǃ0mt.FD@t ST VV'ƃm W01e[^_ÉUE tt - Eƀl1ÉUVSuEuvjjfÃuFPh`7U7gjSCu%FPh`7USk72t&CC CC C$CE X 1e[^ÍvU WVS}1Ht&;sjSW'7t6{u72CthPS2Cu7 F~1e[^_U WVS}14t&;sC {u>2CthP1Cu7&F~1e[^_ÉUWVS]E 8w0ElFD@|tvofptP;t+SJPpGPh`7SLJp 3jEPjju3E U Z PrsjC@ ‰UjS } wF\mFXEC CsjP-EjE PW 7u F\&t&~4tSv4ҧSVURn-hT.jjhE pPp 1U r.e[^_ÉU WVS}E 0^0ljP,EfCBfcDtSt9t4CdWHPFPh a7"R u X2EP,F&C`E p E @  t SEP],e[^_ÐU WVS} EU4CPwjW{ WJrBȅ}BA$))΋SGSGBh .hjVsSE s/$s"-u Ud1,PGPEPh$a7PEPe[^_ÐUS]luxCEurthjRPt KEOt$Bu ǃBC4t RPEKEfCB]ÉU WVS]s0FD@jP*ǍjPjjjSfǃ, 0FEt fǃ, ,PjS5j@jS(S7uCPh;a7OMt&S_7uCPhTa7O%SuS2t W)FD @fFDW)e[^_ÉU WVSuPjP(tPEPFPhma76 PjP(t%PlEPFPha7NDH1hT.jjhsSs,sq*Oy1e[^_ÉU WVSu E1lt jP(E2i w(1i ! i t$i toW&i t?CvUJDSUx#RC0P4UB=UBLEPDtt%@f=@u%)u,,PjSP%@f@u%)t,,PjS@uS@t SUBD(1P1i uC0PEPsC0PURǃ4uSA1 EP;'e[^_ÐUWVS}7luuGdFPha7]Lj@&E4EPjjj8+uS8t W3EP&e[^_UWVS}G0Ef@BteP+tPeBPGPha7K 'tP5BPGPha7zK LJ tePr+tPAPGPha7;K &tPAPGPhb7 K LJ $teP+tPAPGPh@b7J $?&tPWAPGPh`b7J LJ$1ETtPZLtP(My1E@tP 8tPE(MyEf`De[^_ÐUVS]C tQP)ƃt?CPC Pjjhb7q1t ~u ~u1e[^UWVS} hSjEp$Chb73IS_Shb7!IUBB BPB Pjjhb700t @fXXtjj$" uShb7Hnt&@1GUB(t7PN(ƃt%F;uUB(B(CE;X,|uGPhb7HvP'LJLJ1ۀ~t|P'ƒz}B$<u'B3B$<uB<tGPh(c7zGCF9|uGPh`c7TG%u2GPhc75GGPhc7GjP!fDž*˃jSP]jPhU]S:PwVhc7F_00CLfCDLJ.LJ.LJ.ЃjVGPP/USnS%ƇZR Wjj[^_ÍvU WVS]s0j@ ǃZt.FD@t SVZVŮƃZ Wf 1e[^_US] utCEuntdjRP_tKEKt$Bu ǃBC4t RP%KEfCB]ÉU WVS} E1@U,swjW@EXt.ws EjGCPEP[ { h.h'jwVsSUs#s u EL1URe[^_ÉUWVS}G0Ef@BtePE$tP:PGPhc7D tP:PGPhc7C LJteP#tPZ:PGPhd7C tP*:PGPh,d7oC LJ1Et& tP*tPf!My1E8tP0tP!MyEf`De[^_ÉUWVS}] 7E t jPEi tcw i ti t8vODVUxulRF0PT)ZvUB=CGLEGDt@u"Vu&@t VE&EEPYEe[^_ÉUU uBdPhJd7|AÉUWVS]C0E@D@XjPESz 7uCPh`d7-Al&S7uCPhyd7APjPt,P}7PCPhd7@ UR[PjPft)P.7PCPhd7s@ EP ^1hD.jjhvVvv)Oy̋UBD @fBDEPe[^_UVSuEuvjjvÃuFPhd7?7gjSCu%FPhd7?S{72t&CC CC C$CE X 1e[^ÍvU WVS}1t&;sjSW'7t6{u7CthPcCu7 F~1e[^_U WVS}1,t&;sC {u>CthPCu7&F~1e[^_ÉUWVSuE 8_0E ~CD@ttxg^TuV4PGPhe7= uT)RLSTLJTjEPjju XtEEU r PrvT} wC\iCXEF F^jPEjE PW 7uC\"{4tVs4VSURhD.jjhE pPp8U re[^_ÉUWVS}E 0^0 jPEfCBfcDt]tuURCdW2PFPh'e7)< u_EPjEPjjjU r~ U B tPE @ }tCdC`t SUR@e[^_UVSu ]uKQA 9sA9u A9u 9r1e[^UE tt&- Eƀ 1ÍvUS]M Itv23T5TCs҉[ÐUUz t 2 +T9Tf=T9Tt9B u A9Btكf9u1U WVSu ExhSjWK4h\e7Z:S^Sh^e7H:jjWw: tShfe7&:UBfB fPjWDtShe79qPǃ1ۀtePƒt{z}B$<u$B&B$<uBv<u B CG9|tt u.FPhe7!9SFPhe7 9jPǍ^0v0CLfCDdž.dž.dž.ЃjFPFPPGCHCICJdž.CTS裠S躝ƆVWVj[^_ÉU WVS]s0j@ǃVu WGFD@t SY VVƃVWSj1e[^_ÐUE tt - EƀU1ÉUVSuEuvjj&ÃuFPhf7t77gjSCu%FPhf7H7S+72t&CC CC C$CE X 1e[^ÍvU WVS}10t&;sjSW'7tA{uBCt#hPCus7 F~1e[^_ÐU WVS}1;sC {uV<Cu7A&hPCusI7F~1e[^_ÉUWVSuE 8_0EUJCD@@tv3*X\PGt+V,PXGPh.f7^5LJX jEPjjuE p upv\LCXEF F^jPEjE PW17uC\"{4tVs4讉VSEPJh.jjhE pPpE pne[^_ÉU WVS}E 0^0UjPEfCBfcDtOt9t4CdW*PFPhKf73 u4EPBvC`E p E @  t SEP=e[^_ÐU WVS}u ]svjVs h0.hjvsSs$s3u L1&P)PGPhdf7 3WDe[^_ÍvUS]UurCEultbjRP3tKEIt$Bu ǃBC4t RPcKEfCB]U WVS]{0UGD@jP ƃS 7uCPh{f72CS 7uCPhf71uS2t Vj GD @fGDVR e[^_ÉU WVSuPjPL tP(PFPhf7t&PjP tP'PFPhf7Jjh.jTPVPj P 0t!P'PFPhg70@01h.jjhsSss Oy1e[^_ÉUVS] uC0Uun@D@thtdt_tZd\Pt+V&PXCPh g70ǃd u@e[^ÐUWVS}u EUt jPG Ei t:w i t ii t_ODS"TE@=@GLBGDt@uSt&@t SE&EEP Ee[^_ÉUVSuUu;FdCPh?g7.S%Stt Ve[^UWVS}G0Ef@BtePtP-%PGPhUg7r.  tP$PGPhsg7B. LJteP:tP$PGPhg7. v tP$PGPhg7- LJteP tPO$PGPhg7-  tP$PGPhh7d- LJ1E<tP$4tP` My1E(tP tP MyEf`De[^_U WVS]u FEjPǃ9|VU7,Fu p1tW&ECpCEuSЃW1e[^_ÉU WVS}u t7jjj0h;:VЃjP<‹C 9C|CR;G|5FCu 5:Vt&psCR GXF Gle[^_ÐUUz t1(BPB Pjjh5u7SK1e[^_UVSuu` h.V Ph.V1ۃ j LSЃCh.VuӃh'LSЍe[^ÐUE tt -t&Eǀ1ÍvUWVS]EEE~CtE@Dt h0Su ;tHUJE h0SW Ph0Sh0S8$Ph0Sjh&Sjh*S, t\rutTЍzljR  EAEEUtBEuUfbD h0S$Ph0S }t h0S_ & h0SF$Ph0SuVh&SEPh*Se[^_U WVSuEt FDPjF8Pv4tPPFPh8i7-FHPjF1t&h.jjhsSvDss\OyϋPЅ} V%Ee[^_ÉUVSuEuwjjÃuFPhi77st&jS Cu!FPhi7S袳79CC CC C$CjSE X 1e[^ÍvU WVS}1t&;sjSW7t>{uAw0*Ct#hPCusE7 F~1e[^_ÉU WVS}1;sC {uFw0Cu74hPCus7 F~1e[^_ÉUS]|tsCEumtcjRP^tKEJt$Bu ǃBC4t RPpKEfCB]ÉU WVS}] EvsjS^ S;<)PVRdK<h.hj RvVwHvvCËPЃ} Wu 1/SPGPhi7Pw0e[^_ÍvU WVS}E 0^tjP9EfCBfcDtuUR!CdWPFPhi7Y u5vHPЃ} V EP?C`U r E @ dt S~URwe[^_ÍvUWVS}E stChClP>t%WPshCPhi7XCh sDPЃS jEPjjMQU B urp+0UvM ADfEEuF\uFXEEU z G GwjPEjM QSS 7uF\"~4tWv4LmWV_EPh.jjhU rRsDMQEP PЃ} S e[^_ÐU WVS] E01tjP:E2i w(1i , i tEi v5i dwi tRut&6i(D_UJDRoUxBRFtPL-UB=UBLEPDt`%@f=@u h0V f@u! h0V$Ph0V" /@u*UR@tjEPQ1v1i uFtPURFtPEP,ǃ4uURZV21,&4SPEPURǃ t&EP{e[^_ÐUWVS}GdCPhi7j@,EEPjjjuVt WEPe[^_ÐUjEtPÍvU WVSEf@BSwCPP; CDt_PtP PCPhj7 sD;tPS PCPh/j7 CDCHt_PtP PCPhMj7_ sHtP PCPhkj72 CH1E7tP77tP17My1E7tP褩77tP7MyǃEf`De[^_ÍvUVSE4t1@t&ǀ\t XtvS3B[0uV>e[^ÐUVSUu 4u8BD@uF"F"&P>dF`Fe[^ÉUUtuPr0\ÉU WVSu~t4jPES> u>S3>`t)dtdt W^PSVh.S_5u7SlEPTe[^_UE5k_jjtPGÉUS]5k_jjtPGPЃ} S+]ÉUVSu]tu} t1V_}2tt!>&t+|7tI&@8B11OD%t&FShj7ЍFPhj71!7u SV& SVVÃVÍe[^ÉU WVSu]}} V~}tt 6t"|7t?@.B'DFShj7ЍFPhj7%7uWSVt&WSVVe[^_ÐUÐUUz t1(BPB Pjjhj7"1҅t ÍvUWVSu ExjjWNtFPh\k7"hSjWhzk7SNQh|k7PjW tPhk7t& $MQf*Q f()dž`džddžxPǃ1ۀtpt&Pƒz}B$<u'B4)B$<uB0<u B8CG9|dž4VqtPh l7z VtQh"l7P {V-tPh;l7* Ut&Ɔy=r7t'Vh.A SQhk7 V V j[^_U WVS]{0ƃxtt(@ttxt P#yGj@E(u&CPhRl7I EP t&SCǃ(W蘓WuƃytPtЃ|IS;4P48DtjPM484uHtiPƃtV%PCPhl7j HƃtVPCPhl78 ǃH@tgP0tVPCPhl7 @lƃtVPCPhl7 ǃ@DtgPtVCPCPhl7 DƃtVPCPhm7V ǃDEPS jl1e[^_ÉUWVS}E LU:8MA,XD:D9@ ~h@ PSh@m7 LJ, LJ0STEP )PTPa9SURT9h.h'j VTMQ@P$P2v(PPGPhhm7 W1Phm7ЍGPhm71e[^_U WVSE} ? uEPV uG4t>4j484xJ44uƒVVLT $dž(ffzEfBEfBEfBj@R7h.h'j j@TS@Pa,(PSVpÃu(dž(VV؍e[^_ÍvUWVSu EtIuF= t =t2fE(!&Ufzv fE#fEuWLTLJ ffBFfBj@R6h.h'j j@TS@PB, PSWQÃf~u'Ef6uFU;u fFEUB=t3= ~=*==DVBwC$n7Аt&f_VOF ?6.EfFtf@UfBEfFUfBu LJ Ws؍e[^_ÐULWVSu] ECf=u"f{ufEfEut&C=t6= t&=E=t&fEfECH $dn7АfE(fECtNfLuu8t tt&f6u ʐfU;&fE,f{v&fE#fECfE]t&<DEEt&j&}Wr3}~ fEfEU$fU҃EPEPS\WV BE}~1/t&URELE̋UȋTEPUčpE@ ~/h@ Vh@n7EPffGCfGf;vEPGPCP+EPUč:PS2h.h'j VETUR@P,E PEPURÃu Eȋ Uǂ R؍e[^_ÐU WVSE} 44-jjWyA8tDE01 4 e[^_ÉU WVSEU u}};4}-8>;DWQuH1 t&e[^_ÍvU WVSEu }u Xuu\t -|M;4}E8t5E;D' ;4}*8E;D~&EPuQ1e[^_ÉUÍvUVSuE tpAÃv+SPFPhhm7V(j5u7hn7juà t<tPtЅ} V؍e[^ÐU WVSE uxjP$ǃtmt]tXV$PCPhn7i u8t@tPtЃ} SW We[^_ÐU WVSE uC0ExjPnǃtqt]tXVnPCPhn7 u8t@tPtЃ} SfWDǃ\We[^_ÍvUUBPjRht.*U WVSuh7ǃS tV@7"t&ttxt PWe[^_ÉUS]S<7Ѓ]ÉUVSEhƋttxt PwVse[^UVSEh4Ƌttxt P!Ve[^ÉU WVSu]>SE PVD7ЉÃ ؍e[^_ÍvU WVS]jjj 4ttFS.h9TS@6S t&~t+tPtЅ} Sj+)Sj@Nj t!$SC0P@7Ѓ -t$SL7t$C0PH7ЃWS >FhFjjho7jVF$WxUS]hA`u!ǃ`P: &1]ÐUVS]hƃ`t,djjho7j`PB `uǃ`Ve[^UVS]hǃ`dtǃd`PgVce[^UVS]h,ƃhtKp9k_uhVFljjho7jhP[ huhk_ЉpVe[^ÉUVS]hƋhPhu/lt&ǃlǃphPcV_e[^ÐUUE 9}ÐW|$L$ D$tA_ÐWS|$ D$L$W~$ĉ Љڃ)ӉكX[_ÐUVSuUt$M ACuJtCJu Ju[^ÐUWVSEU M])Ή)9vIω[^_ÐUWVSEU M]}ƉރEvƉE}ʉڃـuʉكEPQRWVEU}t؃ڍe[^_ÐUESÐUVSEU ىˉ؅tHƉ؉[^ÐUWVSuEU EUv#?wFv1EE't!U )] ‰UmEU[^_UVS]u UM9| 9r9vt&1[^ÐUWVSM] EU4 9sAω[^_U WVSEU M]}ƉރEvƉE}ȉ؃ڀuȉڃjRPWVn}t؃ڍe[^_ÐWV|$ t$L$uL$u1^_ù))GV)^_ÐL$tVWt$|$T$18uIu_^ÐUUE 9vÐU WVSuEà t(t: tvyvtK t ht_ho7E}tho7NM뗍t&}tho7NMur }G;} }ho7sJ&Sho7V}F't&e[^_ËD$T$@BtX8 uT@BtL8 uH@Bt@8 u<@Bt48 u0@Bt(8 u$@Bt8 u@Bt8 u @Bt8 t)ÐUÐD$fÐUUE 9vÐUWVSuEU EUv#?wF]1EE't!U )] ‰UeEU[^_U,WVSEU |EUE؃ډEUE]u} ۃހu}uuSEPEUrSEP{щ‹E9ErE}) E}+})9s)؀uEƉӉ΃}t )t&EUEU}t؃ڍe[^_ÐUWVSEU %u u 19r )E )E)9s)uщ }tӉ)‰9vI)Ӊ‰9sLӉ‰9sL9sAMUEU[^_W|$1эA_ÐW|$L$ D$uA_ÐWV|$ t$1L$u L$t@^_ÐD$ffUEPEURPEU RPZEUÐW|$D$ L$t uG_Ð1_UjEURPEU RPÐU|WVS]u UM u5 9Tк1MԉM؃}Urt&9wu9v}tMq11}EEЍE܉Ẻ]ԉufEEfGEfGEfGufwUԉM؋UEfPE؋MfAEfAufqEft&M}u{EXG1fEG ‰1fEG ‰1G ‰1}t E@UE ‰U؉ ‰UEUfzjEM)MfuMftuuUExt&EUfBMy+EM̍ AMEu^w Eہv}~,EPEEPW)UREHPEЃPEMIfMʋuvfuȉ}}}vE@Mqf;Uu E3 ]ʉ1EĉӍt&UUĉ 9vMEÁv1ۋMM~Cu4Nut&UMuNU))؉ËEf؃EIMʋU)؉ftAM1ۋMM~,E4HvUMQfM}݋MfUċuEfpEEEFuM9}|}tHMMu9~2EGMDG)ˉ ‹ufwNuE9ЋUfWEU ЉEEU ЉEԋEԋU؋MQEU ЉEEU ЉEԋEԋU؍x[^_UWVS}u1;] }'t&_D_) f_C;] |_f_[^_ÐD$fÐUWVSu EMPt 9tAs+])uэD >ttAJG?u)[^_ÐUUE 9sÐUUE 9~ÐUWVSuEU EUv#}?w FUU}'t!U )] ‰U}EU[^_UWVSu} EU!!Ӊȉ[^_ÐUUE 9~ÐUWVSu} EU11Ӊȉ[^_ÐUUE 9sÐD$ffUVS]u UM9rw 9r9vt&1[^ÐUSM] Uu$C)‰EC8EuA}tJu1[ÐUWVSu} EU Ӊȉ[^_ÐUSM] ډ[ÐD$t@Ð1ÐUWVSuEU EUv#?wF]1EE't!U )] ‰UeEU[^_UWVS} u]t#Ntt&BCtIuutBu)B[^_ÐUUM :t9u t&B:u1ÉUSU] 1ɀ:tv9uB:u[ÐUWVS}u ]uK)‰AGF8t.B<w`v zw B<w @vZw 8utKu1[^_ÐUUE 9}Ðreportidreleaseproductvendorinterfaceconfigurationsocketcontrollerdrivemuxconsoledrq2drqiosiziomemsizeportirqslotfunctiondevbuschanneltidluntargetphywsmuxccdrdbpfilterloop+ClCp-.A8/Ј@80x25P/ 80x25P/80x25bfP/ 80x40P(/ 80x40P(/ 80x40bfP(/ 80x50P2/ 80x50P2/80x50bfP2/ 778Ф99И:@;=8?tFЬCvga_init_screen: no fontvga_init_screen: no font vga_common_setup: couldn't map vga iovga_common_setup: couldn't map 6845 iovga_common_setup: couldn't map memoryvga_common_setup: mem subrange failedvga_free_screen: consolevga_doswitch: disappeared vga: pcvt font support not built in, see vga(4) vgadrive at %s channel %d drive %datapiscsi at %s channel %dwdcspl%s channel %d: reset failed for drive 0 drive 1 timeoutatapiata type: %s c_bcount: %d c_skip: %d missing untimeout%s(%s:%d:%d): using BIOS timings using PIO mode %d, DMA mode %d, Ultra-DMA mode %d%s: transfer error, downgrading to Ultra-DMA mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to PIO mode %d wdccmd%s:%d: %s %s(%s:%d:%d): %s user_strat: No ioctl physio split wd ioctl request... cannot proceed FEATURES = 0x%x, FLAGS = 0x%x, CHIP = 0x%x BUGS =0x%x Attempt to queue invalid SCB tag %x:%x aic7899aic7892aic7896/97aic7890/91aic7895Caic7895aic7880aic7870aic7860aic7859aic7855aic7850aic7770NONECIOBUS Parity ErrorPCI Error detectedScratch or SCB Memory Parity ErrorData-path Parity ErrorSequencer Parity ErrorIllegal Opcode in sequencer programIllegal Sequencer Address referrencedIllegal Host Accessin unknown phasewhile idlein Message-in phasein Status phasein Message-out phasein Command phasein DT Data-in phasein DT Data-out phasein Data-in phasein Data-out phase 3.64.04.45.05.76.678.010.013.416.020.033.040.080.0%s: WARNING no command for scb %d (cmdcmplt) QOUTPOS = %d %s: brkadrint, %s at seqaddr = 0x%x ahc_intr - referenced scb not valid during seqint 0x%x scb(%d) for safety%s: Interrupted for status of 0 (?) %s:%c:%d: no active SCB for reconnecting target - issuing BUS DEVICE RESET SAVED_SCSIID == 0x%x, SAVED_LUN == 0x%x, ARG_1 == 0x%x ACCUM = 0x%x SEQ_FLAGS == 0x%x, SCBPTR == 0x%x, BTT == 0x%x, SINDEX == 0x%x SCSIID == 0x%x, SCB_SCSIID == 0x%x, SCB_LUN == 0x%x, SCB_TAG == 0x%x, SCB_CONTROL == 0x%x SCSIBUSL == 0x%x, SCSISIGI == 0x%x SXFRCTL0 == 0x%x SEQCTL == 0x%x %s:%c:%d: Warning - unknown message received from target (0x%x). Rejecting %s:%c:%d: unknown scsi bus phase %x, lastphase = 0x%x. Attempting to continue %s:%c:%d: Missed busfree. Lastphase = 0x%x, Curphase = 0x%x ahc_intr: HOST_MSG_LOOP bad phase 0x%x HOST_MSG_LOOP with invalid SCB %x Unable to clear parity error. Resetting bus. data overrun detected %s. Tag == 0x%x. HaveHaven't%s seen Data Phase. Length = %ld. NumSGs = %d. sg[%d] - Addr 0x%x%x : Length %d %s:%c:%d:%d: Attempt to issue message failed %s: No free or disconnected SCBs Bogus TAG after DMA. SCBPTR %d, tag %d, our tag %d for saftey%s: BTT calculation out of range SEQ_FLAGS == 0x%x, SCBPTR == 0x%x, BTT == 0x%x, SINDEX == 0x%x , A == 0x%x ahc_intr: seqint, intstat == 0x%x, scsisigi = 0x%x %s: Spurious SCSI interrupt LVDSE%s: Transceiver State Has Changed to %s mode %s: Someone reset channel %c %s:%c:%d: parity error detected %s. SEQADDR(0x%x) SCSIRATE(0x%x) CRC Value Mismatch No terminal CRC packet recevied Illegal CRC packet request non- Unexpected %sDT Data Phase %s: ahc_intr - referenced scb not valid during SELTO scb(%d, %d) Selection Timeout TagSCB %d - Abort%s Completed. Bus Device Reset%s: Unexpected busfree %s SEQADDR == 0x%x %s: Missing case in ahc_handle_scsiint. status = %x %s: Infinite loop in critical section critical section loopscb:%p control:0x%x scsiid:0x%x lun:%d cdb_len:%d Shared Data: %#02x dataptr:%#x datacnt:%#x sgptr:%#x tag:%#x %s: ahc_alloc_tstate - Target already allocated DT%s: target %d synchronous at %sMHz%s, offset = 0x%x %s: target %d using asynchronous transfers %s: target %d using %dbit transfers %s:%c:%d:%d: Bus Device Reset Message Sent Abort%s Message Sent ahc_intr: AWAITING_MSG for an SCB that does not have a waiting message SCSIID = %x, target_mask = %x SCB = %d, SCB Control = %x, MSG_OUT = %x SCB flags = %xEnsuring async (%s:%c:%d:%d): Sending SDTR period %x, offset %x (%s:%c:%d:%d): Sending WDTR %x (%s:%c:%d:%d): Sending PPR bus_width %x, period %x, offset %x, ppr_options %x Target did not send an IDENTIFY message. LASTPHASE = 0x%x. No SCB found during protocol violation No or incomplete CDB sent to device. Completed command without status. Unknown protocol violation. %s: Issued Channel %c Bus Reset. %d SCBs aborted Protocol violation %s. Attempting to abort. HOST_MSG_LOOP interrupt with no active messageTarget MSGIN with no active messageUnknown REQINIT message type(%s:%c:%d:%d): Received SDTR period %x, offset %x Filtered to period %x, offset %x (%s:%c:%d:%d): Target Initiated SDTR (%s:%c:%d:%d): Received WDTR %x filtered to %x (%s:%c:%d:%d): requested %dBit transfers. Rejecting... (%s:%c:%d:%d): Target Initiated WDTR (%s:%c:%d:%d): Target Initiated PPR (%s:%c:%d:%d): Initiator Initiated PPR (%s:%c:%d:%d): Received PPR width %x, period %x, offset %x,options %x Filtered to width %x, period %x, offset %x, options %x ЧЧЧбЧ(%s:%c:%d:%d): PPR Rejected. Trying WDTR/SDTR (%s:%c:%d:%d): refuses WIDE negotiation. Using 8bit transfers (%s:%c:%d:%d): refuses synchronous negotiation. Using asynchronous transfers (%s:%c:%d:%d): refuses tagged commands. Performing non-tagged I/O orderedhead of queue(%s:%c:%d:%d): refuses %s tagged commands. Performing simple queue tagged I/O only %s:%c:%d: Message reject for %x -- ignored %s: %s on %c:%d. %d SCBs aborted %s: WARNING - Failed chip reset! Trying to initialize anyway. Unsupported adapter type (0x%x). Ignoring %s: No SCB space found hardware SCB structuressense buffers%s: ahc_init_scbdata - Unable to allocate initial scbs ииЉZPSG spaceTwin Channel, A SCSI Id=%d, B SCSI Id=%d, primary %c, Ultra Ultra160 Ultra2 WideSingle%s%s Channel %c, SCSI Id=%d, %d/%d SCBs%d SCBs%s: Downloading Sequencer Program...shared data%s: unable to allocate ahc_tmode_tstate. Failing attach %s: Host Adapter Bios disabled. Using default SCSI device parameters Infinite interrupt loop, INTSTAT = %xqinpos = %d, SCB index = %d Loop 1Inactive SCB in qinfifo found = %d, qinstart = %d, qinfifionext = %d First/Second Qinfifo fixupWaiting List inconsistency. SCB index == %d, yet numscbs == %d.scb_index = %d, next = %d Waiting List traversalInactive SCB in Wait List Disconnected List inconsistency. SCB index == %d, yet numscbs == %d.Disconnected List Loop. cur SCBPTR == %x, prev SCBPTR == %x.Inactive SCB on pending list Bogus resid sgptr value 0x%x %s: Program too large for instruction memory size of %d! ahc_loadseq: Could not malloc %d instructions downloaded %s: Features 0x%x, Bugs 0x%x, Flags 0x%x %s: BMOV not supportedUnknown opcode encountered in seq program%%%%%/&%'`%`%`%`%`%`%`%`% %s[0x%x] %s:(|%s%s) >>>>>>>>>>>>>>>>>> Dump Card State Begins <<<<<<<<<<<<<<<<< %s: Dumping Card State %s, at SEQADDR 0x%x Card was paused ACCUM = 0x%x, SINDEX = 0x%x, DINDEX = 0x%x, ARG_2 = 0x%x HCNT = 0x%x SCBPTR = 0x%x SCSIPHASESCSISIGIERRORSCSIBUSLLASTPHASESCSISEQSBLKCTLSCSIRATESEQCTLSEQ_FLAGSSSTAT0SSTAT1SSTAT2SSTAT3SIMODE0SIMODE1SXFRCTL0DFCNTRLDFSTATUSSTACK: 0x%x SCB count = %d Kernel NEXTQSCB = %d Card NEXTQSCB = %d QINFIFO entries: %d Waiting Queue entries: %d:%d Disconnected Queue entries: QOUTFIFO entries: Sequencer Free SCB List: Sequencer SCB Info: %3d SCB_CONTROLSCB_SCSIIDSCB_LUNSCB_TAGPending list: ()Kernel Free SCB list: Untagged Q(%d): <<<<<<<<<<<<<<<<< Dump Card State Ends >>>>>>>>>>>>>>>>>> %s: failed to allocate DMA mem for %s, error = %d %s: failed to map DMA mem for %s, error = %d %s: failed to create DMA map for %s, error = %d %s: failed to load DMA map for %s, error = %d ahc_createdmamem error (%d) FEATURES = 0x%x, FLAGS = 0x%x, CHIP = 0x%x BUGS =0x%x Attempt to queue invalid SCB tag %x:%x ahc%s: %s no longer in timeout, status = %x 8D8DаDаDаDrDаDаDУDЀD8DАDаDаDаDаDаDаDаDаDАDаDаDаDаDаDаDаDЗDcmd fail %s: board is not responding %s: Timedout SCB already complete. Interrupts may not be functioning. SCB 0x%x - timed out sg[%d] - Addr 0x%x : Length %d %s: Issued Channel %c Bus Reset. %d SCBs aborted again Other SCB Timeout%sBDR message in message buffer Timed-out target SCB but bus idle%s: Hung target selection Queuing a BDR SCB SCB %d: Immediate reset. Flags = 0x%x FEATURES = 0x%x, FLAGS = 0x%x, CHIP = 0x%x BUGS =0x%x Attempt to queue invalid SCB tag %x:%x %s: Reading SEEPROM...checksum error done. %s: No SEEPROM available. endis%s: Low byte termination %sabled %s: Manual SE Termination %s: Manual LVD Termination isnot%s: internal 50 cable %s present, internal 68 cable %s present %s: external cable %s present %s: BIOS eeprom %s present %s: Illegal cable configuration!!. Only two connectors on the adapter may be used at a time! %s: 68 pin termination Enabled Secondary %s: %sHigh byte termination Enabled %s: 50 pin termination Enabled %s: %sLow byte termination Enabled %s: Primary Low Byte termination Enabled %s: Primary High Byte termination Enabled Primary aic7901Aaic7902aic7901NONECIOBUS Parity ErrorScratch or SCB Memory Parity ErrorData-path Parity ErrorSequencer Parity ErrorIllegal Opcode in sequencer programDiscard Timer has timed outin unknown phasewhile idlein Message-in phasein Status phasein Message-out phasein Command phasein DT Data-in phasein DT Data-out phasein Data-in phasein Data-out phase /usr/src/sys/arch/i386/compile/RAMDISK_CD/../../../../dev/ic/aic79xx.c%s: Warning - GSFIFO SCB %d invalid %s: Warning - DMA-up and complete SCB %d invalid %s: Warning - Complete Qfrz SCB %d invalid %s: Warning - Complete SCB %d invalid ahd_run_qoutfifo recursion%s: WARNING no command for scb %d (cmdcmplt) QOUTPOS = %d %s: hwerrint, %s BRKADRINT%s: Invalid Sequencer interrupt occurred. %s: SCB %d Packetized Status OverrunCFG4ISTAT: Free SCB %d referencedFor safety%s: ILLEGAL_PHASE 0x%x %s: Issued Bus Reset. Invalid phase with no valid SCB. Resetting bus. ahd_intr: HOST_MSG_LOOP bad phase 0x%x %s:%c:%d: no active SCB for reconnecting target - issuing BUS DEVICE RESET SAVED_SCSIID == 0x%x, SAVED_LUN == 0x%x, REG0 == 0x%x ACCUM = 0x%x SEQ_FLAGS == 0x%x, SCBPTR == 0x%x, BTT == 0x%x, SINDEX == 0x%x SELID == 0x%x, SCB_SCSIID == 0x%x, SCB_LUN == 0x%x, SCB_CONTROL == 0x%x SCSIBUS[0] == 0x%x, SCSISIGI == 0x%x SXFRCTL0 == 0x%x SEQCTL0 == 0x%x %s:%c:%d: unknown scsi bus phase %x, lastphase = 0x%x. Attempting to continue %s:%c:%d: Missed busfree. Lastphase = 0x%x, Curphase = 0x%x %s:%c:%d:%d: Attempt to issue message failed Task Management Func 0x%x Complete Lun ResetTarget ResetUnexpected TaskMgmt Func SCB completes before TMF %s: Tracepoint %d %s: Unexpected SEQINTCODE %d .АаРЊЏ@6Ѐ0@аСppppАЀЀЀЀ@ЀЀЀЀЀЀЀЀЀЀЀЀЀЀЀЀЀЀЀЀЀЀЀDLVDSE%s: Transceiver State Has Changed to %s mode %s: SCSI offset overrun detected. Resetting bus. %s: Someone reset channel A %s: lqostat0 == 0x%x! %s: ahd_intr - referenced scb not valid during SELTO scb(0x%x) Selection Timeout%s: SCSI Cell parity error SSTAT3 == 0x%x %s: Invalid SCB %d in DFF%d during unexpected busfree %s: Missing case in ahd_handle_scsiint. status = %x %s: Transmission error detected LQISTAT1LASTPHASESCSISIGIPERRDIAG %s: Gross protocol error during incoming packet. lqistat1 == 0x%x. Resetting bus. LQIRetry for LQICRCI_LQ to release ACK LQICRC_NLQ %s: No SCB valid for LQICRC_NLQ. Resetting bus Need to handle BADLQI! Acking %s to clear perror LQIRETRY for LQIPHASE_LQ LQIRETRY for LQIPHASE_NLQ ahd_handle_lqiphase_error: No phase errors Reseting Channel for LQI Phase error %s: Warning, BUSFREE time is 0x%x. Expected BUSFREE_LQO. SCB not valid during LQOBUSFREEProbable outgoing LQ CRC error. Retrying command Unexpected PKT busfree condition %s: Unexpected PKT busfree condition Abort for unidentified connection completed. TagSCB %d - Abort%s Completed. found == 0x%x Bus Device ResetUnexpected busfree %s, %d SCBs aborted, PRGMCNT == 0x%x Target did not send an IDENTIFY message. LASTPHASE = 0x%x. No SCB found during protocol violation No or incomplete CDB sent to device. Completed command without status. Unknown protocol violation. %s: Issued Channel %c Bus Reset. %d SCBs aborted Protocol violation %s. Attempting to abort. %s: Infinite loop in critical section %s: First Instruction 0x%x now 0x%x critical section loopscb:%p control:0x%x scsiid:0x%x lun:%d cdb_len:%d Shared Data: %#02x dataptr:%#x%x datacnt:%#x sgptr:%#x tag:%#x Lastsg[%d] - Addr 0x%x%x : Length %d%s %s: ahd_alloc_tstate - Target already allocated%s: target %d synchronous with period = 0x%x, offset = 0x%x(RDSTRM|DT(DT%s|IU(IU|RTI(RTI|QAS(QAS) (QAS)%s: target %d using asynchronous transfers%s %s: target %d using %dbit transfers %s:%c:%d:%d: %s: WARNING. No pending message for I_T msgin. Issuing NO-OP Bus Device Reset Message Sent Abort%s Message Sent ahd_intr: AWAITING_MSG for an SCB that does not have a waiting message SCSIID = %x, target_mask = %x SCB = %d, SCB Control = %x:%x, MSG_OUT = %x SCB flags = %xEnsuring async (%s:%c:%d:%d): Sending SDTR period %x, offset %x (%s:%c:%d:%d): Sending WDTR %x (%s:%c:%d:%d): Sending PPR bus_width %x, period %x, offset 0x%x, ppr_options 0x%x LQIRETRY for LQIPHASE_OUTPKT HOST_MSG_LOOP interrupt with no active messageTarget MSGIN with no active messageUnknown REQINIT message type%s: Returning to Idle Loop (%s:%c:%d:%d): Received SDTR period %x, offset %x Filtered to period %x, offset %x (%s:%c:%d:%d): Target Initiated SDTR (%s:%c:%d:%d): Received WDTR %x filtered to %x (%s:%c:%d:%d): requested %dBit transfers. Rejecting... (%s:%c:%d:%d): Target Initiated WDTR (%s:%c:%d:%d): Target Initiated PPR (%s:%c:%d:%d): Initiator Initiated PPR (%s:%c:%d:%d): Received PPR width %x, period %x, offset %x,options %x Filtered to width %x, period %x, offset %x, options %x "LL>LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLE(%s:%c:%d:%d): PPR Rejected. Trying simple U160 PPR (%s:%c:%d:%d): PPR Rejected. Trying WDTR/SDTR (%s:%c:%d:%d): refuses WIDE negotiation. Using 8bit transfers (%s:%c:%d:%d): refuses synchronous negotiation. Using asynchronous transfers (%s:%c:%d:%d): refuses tagged commands. Performing non-tagged I/O orderedhead of queue(%s:%c:%d:%d): refuses %s tagged commands. Performing simple queue tagged I/O only %s:%c:%d: Message reject for %x -- ignored ahd_reinitialize_dataptrs: Forcing FIFO free. %s: %s on %c:%d. %d SCBs aborted %s: WARNING - Failed chip reset! Trying to initialize anyway. %s: No SCB space found %s: ahd_init_scbdata - Unable to allocate initial scbs hardware SCB structuresSG data structuresSense Data structuresWideSingle%s: U320 %s Channel %c, SCSI Id=%d, %s, %d SCBsSecondary HighSecondary LowPrimary HighPrimary LowNot ConfiguredUnder TerminatedOver TerminatedTerminated CorrectlyHardware SCB size is incorrectshared data%s: current sensing timeout 1 %s: current sensing timeout 2 %s: Timedout during current-sensing test %s: current sensing timeout 3 %s: %s Channel %s %s: WARNING. Termination is not configured correctly. %s: WARNING. SCSI bus operations may FAIL. %s: unable to allocate ahd_tmode_tstate. Failing attach Infinite interrupt loop, INTSTAT = %xqinstart = %d qinfifonext = %d QINFIFO:qinpos = %d, SCB index = %d Loop 1 Inactive SCB in qinfifo SEARCH_COMPLETE(0x%x): ostat 0x%x, cstat 0x%x, xs_error 0x%x 0x%x WAITING_TID_QUEUES: TID LIST LOOP%s: Waiting TID List inconsistency. SCB index == 0x%x, yet numscbs == 0x%x.for safety%s: SCB = 0x%x Not Active! Waiting TID List traversal %d ( %s:SCB List inconsistency. SCB == 0x%x, yet numscbs == 0x%x.%s: SCB = %d Not Active! Waiting List traversal Inactive SCB in Waiting List 0x%x SCB LIST LOOPInactive SCB on pending list ahd_reset_poll: Instance %p no longer exists ahd_stat_timer: Instance %p no longer exists %s: Interrupted for staus of 0??? data overrun detected Tag == 0x%x. Bogus resid sgptr value 0x%x %s: Downloading Sequencer Program...ahd_loadseq: Could not malloc %d instructions downloaded %s: Features 0x%x, Bugs 0x%x, Flags 0x%x Unknown opcode encountered in seq programs%s%s%s%s%Ј%s%%H%H%H%H%H%H%H%H%%s[0x%x] :(|%s%s) >>>>>>>>>>>>>>>>>> Dump Card State Begins <<<<<<<<<<<<<<<<< %s: Dumping Card State at program address 0x%x Mode 0x%x Card was paused Completions are pending HS_MAILBOXINTCTLSEQINTSTATSAVED_MODEDFFSTATSCSIPHASESCSIBUSSCSISEQ0SCSISEQ1SEQCTL0SEQINTCTLSEQ_FLAGSSEQ_FLAGS2SSTAT0SSTAT1SSTAT2SSTAT3SIMODE1LQISTAT0LQISTAT2LQOSTAT0LQOSTAT1LQOSTAT2 SCB Count = %d CMDS_PENDING = %d LASTSCB 0x%x CURRSCB 0x%x NEXTSCB 0x%x Pending list: %3d FIFO_USE[0x%x] SCB_CONTROLSCB_SCSIID Total %d Kernel Free SCB list: %d Sequencer Complete DMA-inprog list: Sequencer Complete list: Sequencer DMA-Up and Complete list: Sequencer On QFreeze and Complete list: FreeActive %s: FIFO%d %s, LONGJMP == 0x%x, SCB 0x%x SEQIMODESEQINTSRCDFCNTRLDFSTATUSSG_CACHE_SHADOWSG_STATEDFFSXFRCTLSOFFCNTMDFFSTATSHADDR = 0x%x%x, SHCNT = 0x%x HADDR = 0x%x%x, HCNT = 0x%x CCSGCTL LQIN: %s: LQISTATE = 0x%x, LQOSTATE = 0x%x, OPTIONMODE = 0x%x %s: OS_SPACE_CNT = 0x%x MAXCMDCNT = 0x%x SIMODE0CCSCBCTL%s: REG0 == 0x%x, SINDEX = 0x%x, DINDEX = 0x%x %s: SCBPTR == 0x%x, SCB_NEXT == 0x%x, SCB_NEXT2 == 0x%x CDB %x %x %x %x %x %x STACK: <<<<<<<<<<<<<<<<< Dump Card State Ends >>>>>>>>>>>>>>>>>> %3d(CTRL 0x%x ID 0x%x N 0x%x N2 0x%x SG 0x%x, RSG 0x%x) %s: Timedout SCBs already complete. Interrupts may not be functioning. not %s: Recovery Initiated - Card was %spaused %s: ahd_wait_seeprom timed out ahd_write_flexport: address out of rangeahd_read_flexport: address out of range%s: failed to allocate DMA mem for %s, error = %d %s: failed to map DMA mem for %s, error = %d %s: failed to create DMA map for %s, error = %d %s: failed to load DMA map for %s, error = %d ahd_createdmamem error (%d) Attempt to queue invalid SCB tag %x ahd%s %s: %s %s: no longer in timeout, status = %x G\G\]]]а\]]\\G\\]]]]]]]]\]]]]]]]\cmd fail %s: board is not responding FEATURES = 0x%x, FLAGS = 0x%x, CHIP = 0x%x BUGS =0x%x aicaic: probing for aic-chip STACK futzed at %d. AIC ID: %s chip revision %d aicattach aicacbaic_scsi_cmd [0x%x, %d]->%d aic_minphys aic_poll %s: reselect with invalid selid %02x; sending DEVICE RESET should call debugger here (aic6360.c)%s: reselect from target %d lun %d with no nexus; sending ABORT selecting %d:%d %d:%d busy idle requesting sense aic_done resid=%d sense=0x%02x error=%d aic_msgin n=%d imess=0x%02x %s at line %d: assertion failed %s: %d extra bytes from %d:%d message rejected %02x %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT %s: reselect without IDENTIFY; %s: unexpected MESSAGE IN; sending DEVICE RESET |}А}Ч}Ѐ}~~ }7|aic_msgout retransmitting %s: unexpected MESSAGE OUT; sending NOOP ` ``````````С```````````````0%02x%02x %d> extra data +%d >%d aicintr sstat1:0x%02x %s: SCSI bus reset %s: SCSI bus parity error sstat0:0x%02x %s: target mode selected; going to BUS FREE reselected backoff selector selected %s: selection out while idle; resetting selection timeout %s: selection timeout while idle; %s: BUS FREE while not idle; state=%d %s: unexpected disconnect; sending REQUEST SENSE cmd=0x%02x+%d dataout dleft=%d datain %d target_stat=0x%02x %s: unexpected bus phase; resetting timed out AGAIN ,%xRESET acb@%p xs=%p flags=%x dp=%p dleft=%d target_stat=%x ready list: nexus: nexus list: aic6360: SCSISEQ=%x SXFRCTL0=%x SXFRCTL1=%x SCSISIG=%x SSTAT0=%x SSTAT1=%x SSTAT2=%x SSTAT3=%x SSTAT4=%x SIMODE0=%x SIMODE1=%x DMACNTRL0=%x DMACNTRL1=%x DMASTAT=%x FIFOSTAT=%d SCSIBUS=0x%x nexus=%p prevphase=%x state=%x msgin=%x msgpriq=%x msgoutq=%x lastmsg=%x currmsg=%x tinfo%d: %d cmds %d disconnects %d timeouts %d senses flags=%x dptunknown adapter, please report using sendbug(1)SK2011SmartCache PlusSK2012PM2021PM2022PM2122PM2024SmartCache IIIPM2124PM3021PM3222SmartRAID IIIPM3224PM2041PM2042PM2142PM2044SmartCache IVPM2144PM3332SmartRAID IVPM3334%s: bogus status (returned CCB id %d) %s: unable to allocate CCBs, error = %d %s: unable to map CCBs, error = %d %s: unable to create CCB DMA map, error = %d %s: unable to load CCB DMA map, error = %d %s: unable to create CCBs %s: %d/%d CCBs created! %s %s (%s) %s: interrupting at %s %s: %d queued commands, %d channel(s), adapter on ID(s) %d %s: dpt_cmd failedshutting down %s... done %s: HBA timeout on EATA command issue; aborting %s: HBA not ready after reset: %02x %s: HBA not ready %s: cfg data didn't appear (status:%02x) %s: HBA error %s: ec_hba field invalid EATA%s: EATA signature mismatch %s: DMA not supported %s: can't create ccb dmamap (%d) %s: unable to init ccb, error = %d dptccb%s: HBA status %x %s: SCSI status %x %s: dpt_scsi_cmd: more than %d dma segs error %d loading dma map %s: dpt_cmd failed timed out (status:%02x aux status:%02x) AGAIN, resetting HBA %s: no CCB for inquiry%s: inquiry timed out%s: inquiry failed (hba:%02x scsi:%02xadv%s: unable to allocate control structures, error = %d %s: unable to map control structures, error = %d %s: unable to create control DMA map, error = %d %s: unable to load control DMA map, error = %d %s: unable to initialize ccb, error = %d %s: unable to create DMA map, error = %d advccb%s: unable to allocate overrun buffer, error = %d %s: unable to map overrun buffer, error = %d %s: unable to create overrun buffer DMA map, error = %d %s: unable to load overrun buffer DMA map, error = %d adv_init: adv_find_signature failed%s -get: Chip is not halted Couldn't get MicroCode Start address I/O port address modified I/O port increment switch enabled EEPROM checksum error IRQ modified tag queuing enabled w/o disconnects unknown warning %d %s -set: Фм%s: bad signature%s: unable to load MicroCode%s: unable to initialize MicroCode%s: unable to initialize board RISC chip%s: unable to create control blocks %s: WARNING: only %d of %d control blocks created %s: adv_scsi_cmd, more than %d dma segments %s: adv_scsi_cmd, error %d loading dma map timed out AGAIN. Resetting Bus %s: exiting ccb not allocated! should call debugger here (adv.c)adw%s: unable to allocate control structures, error = %d %s: unable to map control structures, error = %d %s: unable to create control DMA map, error = %d %s: unable to load control DMA map, error = %d %s: unable to allocate carrier structures, error = %d %s: unable to map carrier structures, error = %d %s: unable to create carriers DMA map, error = %d %s: unable to load carriers DMA map, error = %d %s: unable to initialize ccb, error = %d %s: unable to create CCB DMA map, error = %d adwccbADW_BUSY ADW_ERROR adw_init: adw_find_signature failed%s: Bad checksum found. Setting default values %s: Bad bus termination setting.Using automatic termination. %s: unable to create Control Blocks %s: WARNING: only %d of %d Control Blocks created %s: BIST pre-test error%s: BIST RAM test error%s: Microcode checksum error%s: All three connectors are in use%s: Cable is reversed%s: HVD attached to LVD connector%s: single-ended device is attached to one of the connectors%s: unable to create Carriers%s: WARNING: Bus Reset Error %s: adw_scsi_cmd, more than %d dma segments %s: adw_scsi_cmd, error %d loading dma map timed out AGAIN. Resetting SCSI Bus %s: target %d using %d bit async 80.0 40.0 %d.%d MHz %d REQ/ACK offset xfers %s: unallocated ccb found on pending list! should call debugger here (adw.c)%s: bad scsi_status: 0x%02x. %s: host adapter error 0x%02x. See adw(4). %s: host adapter error 0x%02x, resetting bus. See adw(4). %s: bad host_status: 0x%02x%s: bad done_status: 0x%02x (host_status: 0x%02x, scsi_status: 0x%02x) `pppБББppБpppББppББppppБpGGGG0GGGGGGGGGGGGG0GGGGGGGGGGGGGG0GGGGGGG%s: SCSI Bus reset detected %s: RDMA failure. Resetting the SCSI Bus and the adapter %s: Host generated SCSI bus reset occurred %s: Unknown Async callback code (ignored): 0x%02x bha(bha probe)%s: bha_cmd, host not idle(0x%x) %s: bha_cmd, cmd/data port full %s: bha_cmd, cmd/data port empty %d %s: bha_cmd, host not finished(0x%x) %s: model BT-%s, firmware %s %s: mbi not in round-robin order %s: bad mbi ccb pointer; skipping %s: bad mbi status %02x; skipping %s: unable to create ccb DMA map, error = %d %s: unable to initialize ccb, error = %d bhaccb%s: exiting ccb not allocated! should call debugger here (bha.c)%s: host_stat %x %s: target_stat %x bha_find: illegal bus type %c bha_find: illegal drq setting %x bha_find: illegal irq setting %x 3.31parityno paritysyncasync%s: %s, %s %s targ %d: sync, offset %d, period %dnsec %s: unable to allocate control structures, error = %d %s: unable to map control structures, error = %d %s: unable to create control DMA map, error = %d %s: unable to load control DMA map, error = %d %s: unable to create control blocks %s: WARNING: only %d of %d control blocks created 542B%s: bha_scsi_cmd, more than %d dma segments %s: bha_scsi_cmd, error %d loading dma map timed out AGAIN gdt%s: bus_dmamem_alloc failed%s: bus_dmamem_map failed%s: cannot create ccb dmamap (%d)screen service initialization error %d cache service initialization error %d cannot get channel count, error %d cannot get cache info, error %d raw service initialization error %d sdpmem %x %d-bus %d cache device%s onoff%s: ver %x, cache %s, strategy %d, writeback %s, blksz %d %s: raw feat %x cache feat %x gdt_attach%s: out of bounds %u-%u >= %u %s: gdt_scsi_cmd: more than %d dma segs error %d loading dma map %s: command %d timed out @@@@@@P@P@@@@@@@@@@@@@@@@0@@@@@@@@P@P@@@@@@@@@@Plevel > 0%s: DPMEM overflow ЧАЧЧЧЧЧЧЧЧЧЧЧЧЧЧЧЧЧЧЧpЧЧЧЧЧЧЧЧЧРЧАЧЧЧЧЧЧЧЧЧЧpuio move not yet supported ICP Host drive #%02d %s: mode sense page %d not simulated gdt_internal_cache_cmd got bad opcode: %d p p T p p p p p p p p p p p p p p І p p p p p p p  А p p p p p p p p p  %s: uninitialized or unknown service (%d %d) %s: no free command index found gdt_ccbtimed out twe: cannot allocate commands (%d) : cannot map commands (%d) : cannot create ccb cmd dmamap (%d) : cannot load command dma map (%d) twelk: cannot create ccb dmamap (%d) : card CPU is not ready : cannot get card's attention : out of ccbs : error draining attention queue : we don't get it : card CPU error detected : PCI parity error detected : queuing error detected : PCI abort : failed to fetch unit parameters : Escalade V%d.%d %s: error fetching capacity for unit %d %s%s: failed to create kernel thread, disabled %s: done failed (%d) twespankmore than %d dma segs error %d loading dma map %s: twe_start(%d) timed out %s: undone ccb %d ready uio move is not yet supported 3WARE Host drive #%02d %s: mode sense page %d not simulated %s: out of bounds %u-%u >= %u +++C'++++`)+`)+++++++r'+++++++(++++++++++(++`)+`)++++++++++`)cac=P=P>0>x=%s: unable to allocate CCBs, error = %d %s: unable to map CCBs, error = %d %s: unable to create CCB DMA map, error = %d %s: unable to load CCB DMA map, error = %d %s: can't create ccb dmamap (%d) %s: CAC_CMD_START_FIRMWARE failed %s: CAC_CMD_GET_CTRL_INFO failed %s: no volumes defined %s: cannot allocate memory for drive_info %s: unable to alloc CCB cac_cmd: nsegs botch%s: timeout %s: CCB not active, xs=%p %s: soft error; corrected %s: hard error %s: invalid request %s: CMD_GET_LOG_DRV_INFO failed uio move is not yet supported Compaq RAID0RAID4RAID1RAID5%s volume #%02d %s: mode sense page %d not simulated %s: out of bounds %u-%u >= %u 1='='=Г8'='='='=`;'=`;'='='='='='='=8'='='='='='='=91='='=1='='='='='='=Б:'='=`;'=`;'='='='='='='='='='=0;amis: cannot allocate %s%s (%d) : cannot map %s%s (%d) : cannot create %s dmamap (%d) : cannot load %s dma map (%d) sglistcommandinit data: cannot create ccb dmamap (%d) FC loop: cannot do inquiry target%c.%02d.%02d: FW %s, BIOS v%s, %dMB RAM %s: %d channels, %d %ss, %d logical drives more than %d dma segs error %d loading dma map %s: ccb %d not ready <%d> %s: timeout ccb %d ami_stimeout(%d) botch%s: unqueued ccb %d ready, state = %d uio move not yet supported AMI Host drive #%02d %s: mode sense page %d not simulated %s: out of bounds %u-%u >= %u ZZZRVZZZZЈXZКXZZZZZZZАVZZZZZZZWZZZtXZZZZZZXZZБXZКXZZZZZZZZZZЃXpZxZuZxZxZxZxZxZxZxZxZxZxZxZxZxZxZxZxZxZxZxZxZxZxZxZxZxZxZxZxZxZpZxZuZxZxZxZxZxZxZxZxZxZxZTZPolled Mailbox Command (0x%x) Timeoutisp_mboxcmdInterrupting Mailbox Command (0x%x) Timeout%s index %d=> %s %02x%s:0x%08x:%sTarget %d Loop ID 0x%x (Port 0x%x) => Loop 0x%x (Port 0x%x)Target %d duplicates Target %d- killing off bothRetaining Loop ID 0x%x for Target %d (Port 0x%x)Retained login of Target %d (Loop ID 0x%x) Port 0x%xLogging out Target %d at Loop ID 0x%x (Port 0x%x)Command Error in PLOGI for Port 0x%x (0x%x)Could not get PDB for Device @ Port 0x%xPDB Loop ID info for Device @ Port 0x%x does not match up (0x%x)PDB Port info for Device @ Port 0x%x does not match up (0x%x)Target %d (Loop ID 0x%x) Port 0x%x dumped after login info mismatchNot RESPONSE in RESPONSE Queue (type 0x%x) @ idx %d (next %d) nlooked %dHBA attempted queued transaction with disconnect not set for %d.%d.%dHBA attempted queued transaction to target routine %d on target %d bus %dHBA attempted queued cmd for %d.%d.%d when queueing disabledSCSI phase skipped for target %d.%d.%dLoop ID %d, AL_PA 0x%x, Port ID 0x%x, Loop State 0x%x, Topology '%s'Fabric Nameserver rejected %s (Reason=0x%x Expl=0x%x) for Port ID 0x%x(%d.%d.%d): FIN dl%d resid %d STS 0x%x SKEY %c XS_ERR=0x%x%s CHAN %d FTHRSH %d IID %d RESETD %d RETRYC %d RETRYD %d ASD 0x%x%s RAAN 0x%x DLAN 0x%x DDMAB 0x%x CDMAB 0x%x SELTIME %d MQD %d%s CHAN %d TGT %d FLAGS 0x%x 0x%x/0x%xGeneratedNVRAMbad underrun for %d.%d (count %d, resid %d, status %s)????21002200230023121240bus %d is in %s Mode128010801016012160LVDDifferentialSingle-Endedunknown mode on bus %d (0x%x)Unknown Chip Type 0x%x10201020A10401040A1040B1040CDifferential ModeUltra Mode Capablechip reset timed outMBOX_BUSY never cleared on resetRegister Test Failed (0x%x 0x%x 0x%x 0x%x 0x%x)F/W download failed at word %dRam Checksum Failureskipping f/w downloadloadedresidentBoard Type %s, Chip Revision 0x%x, %s F/W Revision %d.%d.%dFirmware Attributes = 0x%xInstalled in 64-Bit PCI slotLast F/W revision was %d.%d.%d%d max I/O commands supportedCannot setup DMAA`X`p`Ѐ`А`Р`failed to set active negation state (%d,%d), (%d,%d)failed to set tag age limit (%d,%d)Enabled FW features (0x%x)Initiator ID is %d on Channel %dInitial Settings bus%d tgt%d flags 0x%x off 0x%x per 0x%xbad frame length (%d) from NVRAM- using %dbad maximum allocation (%d)- using 16bad execution throttle of %d- using 16Setting ICB Node 0x%08x%08x Port 0x%08x%08xNot using any WWNsisp_fibre_init: fwopt 0x%x xfwopt 0x%x zfwopt 0x%xF Port (no FLOGI_ACC response)F PortN-Port to N-PortFL PortPrivate LoopFirmware State <%s->%s>usec%d: 0x%lx->0x%lx enano 0x%x%08x2Gb link speed/sؔConfig WaitWaiting for AL_PAWait LoginReadyLoss Of SyncErrorRe-InitNonparticipating?????&07@GPW`РГgiving up on synchronizing the port databaseRemap OverflowNo LoopFailed to allocate IOCB bufferFailed to allocate XCB buffertimeout or transmit failedno fabric loopremote device not a target%xSNS Failed- %s%07@GPGID_FTGPN_IDGNN_IDfabric too big for scratch areaRegister FC4 types succeededAdapter not at RUNSTATEunsupported cdb length (%d, CDB[0]=0x%x)Target %d does not have target serviceRequest Queue OverflowRequest Queue Overflow+out of xflist pointersSTART cmd for %d.%d.%d cmd 0x%x datalen %ldUnknown Control Opcode 0x%xdriver initiated bus reset of bus %dTarget %d on Bus %d Reset Succeededcannot find handle for command to abortU 0WЀДШҦMbox Command Async (0x%x) with no waitersinterrupt (ISR=%x SEMA=%x) when not readyoptr %x soft optr %xResponse Queue Out Pointer Unstable (%x, %x)bogus intr- isr %x (%x) iptr %x optr %xQueue Entrycontinuation segmentinternal queues fullbad header flagbad request packetunknown flags (0x%x) in responsebad request handle %d (type 0x%x, flags 0x%x)cannot find handle 0x%x (type 0x%x)cannot find handle 0x%x (status 0x%x)asked for %ld got resid %ldRequest Queue Entry bounced backunhandled response queue type 0x%xAsync Mbox 0x%xRequest Queue Transfer ErrorResponse Queue Transfer Errortimeout initiated SCSI bus reset of bus %ddevice reset on bus %dextended message underrunSCAM interruptstalled SCSI Bus after DATA OverrunSCSI Bus reset after DATA OverrunTransition to LVD modeTransition to Differential modeTransition to Single Ended modeTransition to Unknown Mode 0x%xFast Posting CTIO doneLIP destroyed %d active commandsPoint-to-Point modePoint-to-Point -> Loop modeLoop -> Point-to-Point modePoint-to-Point -> Loop mode (BAD LIP)FATAL CONNECTION ERRORLooped Back in Point-to-Point modeUnknown connection mode (0x%x)Unknown Async Code 0x%xfast post completion of %uԵGVeЁƶ'' 0@P'ж0fЖ'''''''''аǸ''''''''''''''ĺаРАЀp0'''''''''htЀАлIgnored Continuation ResponseUnhandled Response Type 0x%xPPPPPBBPPPBBBBB0PPPPPBBPPPPPPPBSelection Timeout for %d.%d.%dcommand incomplete for %d.%d.%d, state 0x%xDMA error for command on %d.%d.%dstates=>%s GOT_BUS%s GOT_TGT%s SENT_CDB%s XFRD_DATA%s GOT_STS%s GOT_SNS%s XFR_CMPLT%s status=>%s Disconnect%s Sync_xfr%s Parity%s Bus_Reset%s Device_Reset%s Aborted%s Timeout%s Negotiation%stransport error for %d.%d.%d: %sbus reset destroyed command for %d.%d.%dcommand aborted for %d.%d.%dcommand timed out for %d.%d.%ddata overrun for command on %d.%d.%dcommand overrun for command on %d.%d.%dstatus overrun for command on %d.%d.%dmsg not COMMAND COMPLETE after status %d.%d.%dNo MESSAGE OUT phase after selection on %d.%d.%dEXTENDED IDENTIFY failed %d.%d.%dINITIATOR DETECTED ERROR rejected by %d.%d.%dABORT OPERATION rejected by %d.%d.%dMESSAGE REJECT rejected by %d.%d.%dNOP rejected by %d.%d.%dMESSAGE PARITY ERROR rejected by %d.%d.%dBUS DEVICE RESET rejected by %d.%d.%dIDENTIFY rejected by %d.%d.%d%d.%d.%d had an unexpected bus freemarkednot markedInvalid IOCB entry type detectedinternal queues full for %d.%d.%d status 0x%xAuto Request Sense failed for %d.%d.%dWide Negotiation failed for %d.%d.%dSDTR Message failed for target %d.%d.%dBad LVD condition while talking to %d.%d.%dport unavailable for target %dport logout for target %dport changed for target %dport busy for target %dUnknown Completion Status 0x%xа8&ХА6`Іа&PxР"HЀУ2XРCommand for fast post handle 0x%x not found?????OOOO?O!/OO1OOUnknown Command 0x%xno parameters for 0x%xopcode %xINVALID COMMANDHOST INTERFACE ERRORTEST FAILEDCOMMAND ERRORCOMMAND PARAMETER ERRORLOOP ID ALREADY IN USEPORT ID ALREADY IN USEALL LOOP IDS IN USETIMEOUTerror 0x%xMailbox Command '%s' failed (%s)skipping target %d bus %d updatebus %d set tgt %d flags 0x%x off 0x%x period 0x%xUsing Node WWN 0x%08x%08xUsing Port WWN 0x%08x%08xisp_reinit cannot reset cardisp_reinit cannot restart cardinvalid NVRAM header%x %x %xinvalid NVRAM checksumversion %d NVRAM not understoodNVRAM Port WWN 0x%08x%08xNVRAM Node WWN 0x%08x%08xNVRAM: maxfrmlen %d execthrottle %d fwoptions 0x%x loopid %x Polled Mailbox Command (0x%x) Timeoutisp_mboxcmdInterrupting Mailbox Command (0x%x) Timeout%s index %d=> %s %02x%s:0x%08x:%sispadded to blocked queueActive Hiwater Mark=%dblocking queueretrying later for %d.%dfinished command on borrowed timerestarting blocked queuewatchdog found done cmd (handle 0x%x)recursive watchdog (handle 0x%x)watchdog cleanup for handle 0x%xwatchdog timeout on handle %xpossible command timeout on handle %xwatchdog with no commandrestarted command for %d.%dblocked cmd againCMD_EAGAINCMD_RQLATER%s for %d.%drequeued %d commands, 16 bit wide, Tagged Queueing Enabled, 16 bit wide, Tagged Queueing Enabled Bus %d Target %d at %dMHz Max Offset %d%sBus %d Target %d Async Mode%sSCSI bus %d reset detectedLoop DOWNLoop UPTarget %d (Loop 0x%x) Port ID 0x%x role %s %s Port WWN 0x%08x%08x Node WWN 0x%08x%08xTarget/InitiatorInitiatorTargetNoArrivedDepartedName Server Database Changed N_Port NL_PortF/NL_Port Nx_Port F_port FL_Port E_port%s Fabric Device @ PortID 0x%xout of space for fabric devicesInternal Firmware Error on bus %d @ RISC Address 0x%x0Рг44P44444%s: %s: Can't get MPT IOC operationalsoft resetsoft reset failed: device not runningsoft reset failed: doorbell wedgedsoft reset failed: ack timeoutsoft reset failed: device did not start runninghard resetdiag0=%08xfirmware downloadboot failure (%d)!failed to reset devicempt_free_request bad req ptrrequest %d already freempt_init_request bad req ptrmpt_get_request: corrupted request free listmpt_get_request: corrupted request free list (xfer)Send Request %d (0x%x):%08x %08x %08x %08xhandshake aborted due to invalid doorbell statempt_send_handshake_cmd timeout1mpt_send_handshake_cmd timeout2mpt_send_handshake_cmd timeout! index = %dmpt_recv_handshake_cmd timeout1mpt_recv_handshake_cmd timeout2reply length does not match message length: got 0x%02x, expected 0x%02xmpt_recv_handshake_cmd timeout3mpt_recv_handshake_cmd timeout4flags %d, upload_fw %dread_cfg_header timed outmpt_read_cfg_header: Config Info Status %xread_cfg_page timed outmpt_read_cfg_page: Config Info Status %xpage type 0x%x not changeablempt_write_cfg_page timed outmpt_write_cfg_page: Config Info Status %xSPI Port Page 0 Header: %x %x %x %xSPI Port Page 1 Header: %x %x %x %xSPI Port Page 2 Header: %x %x %x %xSPI Target %d Device Page 0 Header: %x %x %x %xSPI Target %d Device Page 1 Header: %x %x %x %xfailed to read SPI Port Page 0SPI Port Page 0: Capabilities %x PhysicalInterface %xfailed to read SPI Port Page 1SPI Port Page 1: Configuration %x OnBusTimerValue %xfailed to read SPI Port Page 2SPI Port Page 2: Flags %x Settings %xSPI Port Page 2 Tgt %d: timo %x SF %x Flags %xcannot read SPI Tgt %d Device Page 0SPI Tgt %d Page 0: NParms %x Information %xcannot read SPI Tgt %d Device Page 1SPI Tgt %d Page 1: RParms %x Configuration %xSPI Port Page 1 Config value bad (%x)- should be %xfailed to reset SPI Port Page 1 Config valueSet Tgt %d SPI DevicePage 1 values to %x 0 %xSPI Tgt %d Page 1: RParm %x Configuration %xenabling port %dport enable timed outendis%sabling async eventsdoorbell req = %smpt_get_iocfacts failedIOCFACTS: GlobalCredits=%d BlockSize=%u Request Frame Size %umpt_get_portfacts failedPORTFACTS: Type %x PFlags %x IID %d MaxDev %dUnsupported Port Type (%x)initiator role unsupportedmpt_send_ioc_init failedmpt_send_ioc_init okIOC failed to go to run stateIOC now at RUNSTATEfirmware upload required.firmware upload failure!firmware upload not required.failed to enable port 0enabled port 0failed to initialize IOCenabling interruptsmpt_alloc_fw_mem error: %dnsegs > maxsglassembling SG list (%d entries)sending FW Upload request to IOC (size: %d, img size: %d)fw_upload reply status %dfreeing image memoryfw size 0x%x, ioc FW ptr %pioc FW ptr %pFW Image @ %penable diagnostic mode FAILED! (%02xh)wrote magic DiagWriteEn sequence (%x)LoadStart addr written 0x%xwriting file image: 0x%x u32's @ %pwrite ext image: 0x%x u32's @ %pwrite IopResetVector addr!write IopResetVector value!2///////// /!/"t/#g/$[/%N/@9/A'/B/C/D/E/F/G/H/I}/J`/KL/L3/`/a/b/c/d/e/j`/fE/g./h/i/Ѐ/Ё/Ђ/Ѓ/Є/Ѕ/Іn/Ї`/LAN: CanceledLAN: Partial PacketLAN: Recieve AbortedLAN: Recieve ErrorLAN: Transmit AbortedLAN: Transmit ErrorLAN: Device Not FailureLAN: Device Not FoundFC: Node Logged OutFC: Recieve DID InvalidFC: Recieve ID InvalidFC: AbortedSCSI Target: Transfer Count MismatchSCSI Target: No ConnectionSCSI Target: No Connection (Retryable)SCSI Target: AbortedSCSI Target: Invalid IOC IndexSCSI Target: Invalid PortSCSI Target: Priority I/OSCSI: External Bus ResetSCSI: IOC Bus ResetSCSI: Task Management FailedSCSI: Residual MismatchSCSI: Task TerminatedSCSI: Protocol ErrorSCSI: Data ErrorSCSI: Data UnderrunSCSI: Data OverrunSCSI: Device Not ThereSCSI: Invalid Target IDSCSI: Invalid BusSCSI: Recoverd ErrorCan't CommitNo DefaultsInvalid DataInvalid PageInvalid TypeInvalid ActionIOC: Invalid StateIOC: Invalid FieldIOC: Insufficient ResourcesIOC: ReservedIOC: Internal ErrorIOC: Invalid SGLIOC: BusyIOC: Invalid FunctionSuccess%//////// / / / / r/Y/?/ // /!/"/LAN ResetLAN RecieveLAN SendFC: AbortFC: Send Extended Link ServiceFC: Link Service ResponseFC: Link Service BuffersTarget Mode AbortTarget Status SendTarget AssistSCSI Target Command BufferFW DownloadEvent NotificationPort EnablePort FactsConfigIOC FactsIOC InitSCSI Task ManagementSCSI IO Request///////// / /EventChangeLogoutLoop State ChangeLink Status ChangeRescanExternal Bus ResetIOC Bus ResetUnit AttentionState ChangeLogDataNone////o/ \/Queue Tag RejectedRepsonse_Info_ValidState_TerminatedNo_SCSI_StatusAutoSense_FailedAutoSense_ValidH/8/3///(/Queue FullReservation ConflictIntermidiate ConditionBusyCheck ConditionOK/@/////DMEDisARMResetTTLIFLASH_BadDWEUnknown (0x%08x)(0x%08x)%s No OneBIOSROM BIOSPCI PeerHost DriverManufacturingUnknown*а*з****ReadyRunningFaultmpt mailbox: (0x%x) State %s WhoInit %s %s Reply @ %p IOC Status %s IOCLogInfo 0x%08x MsgLength 0x%02x MsgFlags 0x%02x MsgContext 0x%08x WhoInit %s MaxDevices 0x%02x MaxBuses 0x%02x IOCNumber %d MaxChainDepth %d BlockSize %d Flags %d ReplyQueueDepth %d ReqFrameSize 0x%04x FW Version 0x%08x Product ID 0x%04x Credits 0x%04x Ports %d EventState 0x%02x HostMFA_HA 0x%08x SenseBuf_HA 0x%08x RepFrameSize 0x%04x MaxBuses 0x%02x FWImageSize 0x%04x Port: %d Bus: %d TargetID %d CDBLength %d SCSI Status: %s SCSI State: %s TransferCnt 0x%04x SenseCnt 0x%04x ResponseInfo 0x%08x Event: %s EventContext 0x%04x AckRequired %d EventDataLength %d Continuation %d EvtLogData: 0x%04x TargetID: 0x%04x Bus: 0x%04x Port: %d LinkState: %d Type: %d Char3: 0x%02x Char4: 0x%02x N_PortId: 0x%04x //5/`/`/`/t/Ѓ//P0`0@000`0`0 00%s @ %p Chain Offset 0x%02x Bus: %d TargetID %d SenseBufferLength %d LUN: 0x%0x Control 0x%08x NODATATRANSFER WRITE READ Invalid DIR! SIMPLEQ HEADOFQ ORDEREDQ ACAQ UNTAGGED NO_DISCONNECT Unknown attribute! DataLength 0x%08x SenseBufAddr 0x%08x CDB[0:%d] %02x FreeIn ProgressOn ChipTimeout SE32 %p: Addr=0x%0x FlagsLength=0x%0x CE32 %p: Addr=0x%0x NxtChnO=0x%x Flgs=0x%x Len=0x%0x TE32 @ %p LOCAL_ADDRESSHOST_TO_IOC64_BIT_ADDRESSINGLAST_ELEMENTEND_OF_BUFFEREND_OF_LISTmptEntering PPRunable to write Device Page 1unable to read back Device Page 1SPI Target %d Page 1: RequestedParameters %x Config %xInvalid INQUIRY on target: %dunable to read Device Page 0SPI Tgt %d Page 0: NParms %x Information %xU320 PPR failedU160 PPR failedTarget %d rejected PPR message with %02xSynchronousAsynchronoustarget %d %s at %dMHz width %dbit offset %d QAS %d DT %d IU %dp8t8x8Ѐ8Є8Could not retrieve IOC PAGE 2 to determineRAID capabilities.IOC Page 2: %x %x %x %x %xIM support: %x%s: unable to allocate request pool %s: unable to allocate reply area, error = %d %s: unable to map reply area, error = %d %s: unable to create reply DMA map, error = %d %s: unable to load reply DMA map, error = %d %s: unable to allocate request area, error = %d %s: unable to map request area, error = %d %s: unable to create request DMA map, error = %d %s: unable to load request DMA map, error = %d %d%s: unable to create req %d DMA map, error = context %u reply OK%s: command timeoutrecovered from command timeouttimeout on request index = 0x%x, seq = 0x%08xStatus 0x%08x, Mask 0x%08x, Doorbell 0x%08xrequest state: %sAddress Reply (index %u):%08x %08x %08x %08xmpt_done: index 0x%x, NULL replympt_done: invalid index (0x%x) in replympt_done: corrupted request_t (0x%x)mpt_done: TASK MGMTmpt_done: unknown Function 0x%x (0x%x)mpt_done: no scsi_xfer, index = 0x%x, seq = 0x%08xmpt_request:mpt_reply:context reply: 0x%08xinvalid status code %d(FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF(FFFFFFFFFFFFFerror %d loading DMA mapenable port reply index %dunknown ctlop: 0x%xEvtLogData: IOCLogInfo: 0x%08xEvtLogData: Event Data:%s: 0x%08x%cUnit Attn: Bus 0x%02x Target 0x%02xIOC Bus Reset Port %dExternal Bus ResetRescan Port %dFailedActivePort %d: Link state %sPort %d: FC Link Event: LIP(%02x,%02x) (Loop Initialization) Device needs AL_PA Device %02x doesn't like FC performance Device detected loop failure before acquiring AL_PA Device %02x detected loop failure Device %02x requests that device %02x reset itselfPort %d: FC Link Event: LPE(%02x,%02x) (Loop Port Enable)Port %d: FC Link Event: LPB(%02x,%02x) (Loop Port Bypass)Port %d: FC Link Event: Unknown event (%02x %02x %02x)Port %d: FC Logout: N_PortID: %02xUnknown async event: 0x%xmpt_event_notify_reply: unable to allocate request structure NФPNNNOO2OЕPйPunable to allocate fw memory, error = %dunable to map fw area, error = %dunable to create request DMA map, error = %dunable to load request DMA map, error = %duha%s: scsibus %s: can't malloc mscp uhamsc%s: exiting ccb not allocated! should call debugger here (ultra14f.c)%s: host_stat %x %s: target_stat %x %s: uha_scsi_cmd, more than %d dma segs timed out AGAIN espFAS366/HMEAM53C974FAS216FAS408ESP406NCR53C96NCR53C94ESP200ESP100AESP100out of memory %s: unknown variant %d, devices not attached : %s, %dMHz, SCSI ID %d %s: unknown revision code, assuming ESP100 `^]]]]З]З]]]^%s: resetting SCSI bus [NCR_INIT(%d) %d] ncr53c9x_ecbregs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] SELATNS [ncr53c9x_scsi_cmd] [0x%x, %d]->%d [ncr53c9x_poll] [ncr53c9x_poll: rescheduling] [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)%d:%d busy requesting sense [ncr53c9x_done(error:%x)] %s: QFULL -- throttling to %d commands resid=%lu sense=0x%02x error=%d [flushfifo] ncr53c9x_rdfifo: bad flagstartcont [rdfifo %s (%d): %02x] [wrfifo(%d):%s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT ncr53c9x_sched_msgout %x %d [ncr53c9x_msgin(curmsglen:%ld)] %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d gotmsg(%x) state %dcmdcomplete got %ld extra bytes msg reject (msgout=%x) %s: tagged queuing rejected: target %d (rejected sent tag)%s: sync transfer rejected: target %d %s: wide transfer rejected: target %d noop TAG %x:%xdisconnect save datapointer restore datapointer extended(%x) SDTR period %d, offset %d async mode max sync rate %d.%02dMB/s %s: wide mode %d unrecognized MESSAGE EXTENDED; sending REJECT ident unrecognized MESSAGE; sending REJECT %s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET "~FЀРРа~еРРРРРРРРРРРРРРРРРРРРРРРЀЀЀ[ncr53c9x_msgout(priq:%x, prevphase:%x)]%s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus [ncr53c9x_intr: state %d] %s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error sync nego not completed! %s: unexpected disconnect; resetting sending REQUEST SENSE %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>%s: target didn't send tag: %d bytes in fifo [%d] backoff selector %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] selid=%2x %s: identify failed, state %d, intr %02x ncr53c9x: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: stray interrupt %s: ICCS: : [intr %x, stat %x, step %x] %s: can't get status, only %d bytes %s: STATUS_PHASE: msg %d %s: invalid state: %dncr53c9x no nexusMESSAGE_OUT_PHASE MESSAGE_IN_PHASE %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%ld] DATA_IN_PHASE STATUS_PHASE %s: unexpected bus phase; resetting p¨ԗŗаГГ5555GаЀDMA active%s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled %2K} }}}%}2> > >>> > > >>%+2>K}  %s: unable to allocate script DMA memory, error = %d %s: unable to map script DMA memory, error = %d %s: unable to create script DMA map, error = %d %s: unable to load script DMA map, error = %d siop: can't find my sync parameters%s: rejecting invalid wide negotiation from target %d (%d) %s: ppr negotiation for target %d: no DT option %s: ppr negotiation for target %d: offset (%d) or sync (%d) out of range %s: ppr negotiation for target %d: sync (%d) incompatible with adapter %s: ppr negotiation for target %d: transfer width (%d) incompatible with dt %s: rejecting invalid PPR negotiation from target %d %s: bad offset in siop_sdp (%d) clear fifo failed %s: switching to differential mode %s: switching to single-ended mode %s: switching to LVD mode %s: invalid SCSI mode 0x%x %s: timeout waiting for DIFFSENSE to stabilise DT tagged %s: target %d now using %s%s%d bit async 80.040.020.013.310.06.675.03.33?? MHz %d REQ/ACK offset xfers АРа4x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`884t5r@`X@`PP``XXP``@4zhh5~~4|X4zhh5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`@@@`HHxx5r6r           xxxx(C|z%2K} }}}%}2> > >>> > > >>%+2>K}  siop%s: can't alloc lunsw for target %d INTRF single step dsp 0x%08x dsa 0x08%x %s: DMA IRQ: illegal instruction bus fault parity dma fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid %s:scsi gross error %s: unexpected phase mismatch %d %s: phase mismatch without command parity error %s: selection timeout without command %s: unexpected disconnect without command %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x %s: script interrupt (0x%x) with invalid DSA !!! %s: command with invalid status (IRQ code 0x%x current status %d) ! error, DSP=0x%x %s: reselect with invalid target %s: reselect with invalid target %d %s: target %d reselect with invalid lun %d %s: target %d lun %d tag %d reselect without command %s: reselect with invalid tag %s: our reject message was rejected scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x unhandled message 0x%x %s: extended message too big (%d) invalid retval from siop_wdtr_neg()invalid retval from siop_sdtr_neg()%s: bad offset for disconnect (%d) reselect failed %s: done without command, DSA=0x%lx unknown irqcode %x == NULL!= NULL%s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s request sense failed %s: unable to load data DMA map (for SENSE): %d %s: untagged command already running for target %d lun %d (status %d) %s: scsi bus reset cmd %p (tag %d) added to reset list cmd %p added to reset list from urgent list cmd %p added to reset list from ready list cmd %p (status %d) reset with status %d, xs->error %d %s: can't malloc memory for target %d %s: can't alloc siop_lun for target %d lun %d %s: unable to load data DMA map: %d siop_start: bad statustimeout on SCSI command 0x%x %s: can't allocate memory for command descriptors head %s: can't allocate memory for command descriptors %s: unable to allocate cbd DMA memory, error = %d %s: unable to map cbd DMA memory, error = %d %s: unable to create cbd DMA map, error = %d %s: unable to load cbd DMA map, error = %d %s: unable to create data DMA map for cbd: error %d siop: resel switch fullsiop_stat_intr %d siop_stat_intr_shortxfer %d siop_stat_intr_xferdisc %d siop_stat_intr_sdp %d siop_stat_intr_done %d siop_stat_intr_lunresel %d siop_stat_intr_qfull %d *.0# &.0%.0.0$.0& .0'@@.0&.0(100-T4mii100-FX100-TXbncreservedauiutp#%$&'&(ep address %s , wrote %x to TX_AVAIL_THRESH, read back %x. Interface disabled warning: unknown chipset, possibly 3c515? 0Рr/%s (default %s) (unknown/impossible media)/autoselect default %s%sе`ЀЀЀ%s: media_status on unknown chipset 0x%x epstart: no header mbuf%s: device timeout %s: eeprom failed to come ready %s: erase pencil mark, or disable PnP mode! wi30m30P30;30&303020202020 20 {20 j20 j20 j20j20N20N20N20N2002002002002020202020! 20" 20# 20$ 20&10PRISM3 (USB)PRISM3 ISL37300P(PCI)PRISM3 ISL37300PPRISM2.5 ISL3874A(PCI-bridge)PRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3873PRISM2 HFA3842(EVAL)PRISM2 HWB3163(EVB2) SST-flashPRISM2 HWB3163 SST-flashPRISM1 HWB1153PRISM2 HFA3842(EVB3)PRISM2 HWB3163 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3763 rev.BPRISM2 HFA3841(EVB2)Lucent Embedded WaveLAN/IEEESony WaveLAN/IEEELucent WaveLAN/IEEE: unable to read station address address %sWaveLAN/IEEE nodeIBSS %s: received packet of unknown type on port 7 %s: received packet on invalid port (wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. %s: wi_cmd failed with %d %s: wi_cmd_io: busy bit won't clear %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: init failed IIIIIIIIIIIIIIIJJKпKK K0KпKпKпK@K%s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: unsupported crypto algorithm %d %s: tx buffer allocation failed %s: mgmt. buffer allocation failed 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-%s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: host encrypt not implemented for 802.3 %s: wi_start: xmit failed %s: wi_mgmt_xmit: xmit failed %s: device timeout Unknown PRISM2 chip %s: Firmware %d.%02d variant %d, Symbol %s: %s%s, Firmware %d.%d.%d (primary), %d.%d.%d (station), w'w0wGw4wGwGwGwGwGw@w yIyIyIyIyy0y@yy$~7~P~c~v~Р~~~~ЅЅESЀЀЀЀapЀАРЀEPЀЅЀfan%s: failed to load config data %s: read record failed : address %6s OpenBSD%s: id mismatch: expected %x, got %x %s: command busy %s: reset failed %s: RID 0x%04x access failed %s: RID 0x%04x seek to record failed %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: unknown RID: %x %s: failed to set configuration %s: tx buffer allocation failed %s: failed to set ssid list %s: failed to set AP list %s: failed to enable MAC %s: xmit failed %s: device timeout an_cache_store, bad index: %d of [0..%d], gross cache error 0:::: leam7990_config: weird memory size %d: address %s %s: %d receive buffers, %d transmit buffers am7990_config: can't establish shutdownhook%s: controller failed to initialize %s: overflow %s: receive buffer error %s: dropping chained buffer %s: transmit buffer error %s: underflow %s: excessive collisions, tdr %d %s: memory error %s: receiver disabled %s: transmitter disabled %s: device timeout missing buffer, no_td = %d, last_td = %d %s: command never completed! %s: eeprom failed to come ready %s: reset didn't complete %s: bogus xcvr value in EEPROM (%x) %s: choosing new default based on card type %s: WARNING: no media options bits set in the media options register!! %s: this could be a manufacturing defect in your adapter or system %s: attempting to guess media type; you should probably consult your vendor %s: guessing 10BaseT transceiver %s: guessing COMBO (AUI/BNC/TP) %s: guessing TPC (BNC/TP) %s: guessing 10baseFL %s: guessing MII %s: guessing 100BaseT4/MII %s: guessing 10/100 internal %s: guessing 10/100 plus BNC/AUI %s: unknown device ID: %x -- defaulting to 10baseT %s: rx load failed %s: bad receive status -- packet dropped %s: transmission error: %x %s: initialization failed: no memory for rx buffers %s: unknown XCVR type: %d `а%s: watchdog timeout %s: no carrier - transceiver cable problem? %s: failed to read station address : can't alloc list mem : can't map list mem : can't alloc list map : can't load list map : can't create rx map : can't create rx spare map : can't create tx map : can't create tx spare map , address %s Pdxl%s: warning: SCB timed out fxp%s: unable to create tx dma map %d, error %d %s: unable to create rx dma map %d, error %d : %s, address %s %s: Disabling dynamic standby mode in EEPROM, New ID 0x%x, cksum @ 0x%x: 0x%x -> 0x%x %s: no phy found, using manual mode %s: Failed to malloc memory fxp_stop: no buffers!%s: device timeout %s: fxp_mdi_read: timed out %s: fxp_mdi_write: timed out : can't alloc list mem : can't map list mem : can't alloc list map : can't load list map : can't create rx map : can't create rx spare map : can't create tx map : can't create tx spare map address %s %s: no memory for rx list -- packet dropped! %s: rx load failed %s: reset never completed! %s: can't allocate memeory for rx buffers %s: watchdog timeout mtd%s: reset never completed! %s: watchdog timeout address %s %s: unknown device id: %x %s: can't alloc rx buffers %s: can't map dma buffers (%d bytes) %s: can't create dma map %s: can't load dma map ^^^^^_^Ї_А___З_Ч_Р_rl%s: phy_read: bad phy register %x qqqqqrr%s: phy_write: bad phy register %x `tgtptwtЀtЇtАt%s: failed to force tx and rx to idle state %s: reset never completed! : can't alloc list mem : can't map list mem : can't alloc list map : can't load list map : can't create rx map : can't create rx spare map : can't create tx map : can't create tx spare map address %s %s: MII without any PHY! ААÔÔАи%s: no memory for rx list -- packet dropped! %s: rx load failed %s: no memory for tx list%s: initialization failed: no memory for rx buffers %s: watchdog timeout dcSMC91C100SMC91C95SMC91C94SMC91C90/91C92#%sm: address %s, auiutputp/aui (default %s) %s: large packet discarded %s: receive interrupt on empty fifo %s: successful packet caused TX interrupt?! %s: can't allocate cluster for incoming packet %s: device timeout %s: device enable failed ne%s: where did the card go? %s: setup failed ne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete Lx@Lx@ auxkbdkbc: cmd word write error kbc: aux echo error 1 kbc: aux echo error 2 (%s slot)pckbc_slot_enable(%d) failed pckbc_cmd: send error pckbc: command timeout pckbc_start: command error pckbc_start: send error pckbc: cmd failed kbccmdpckbc_set_inputhandler: bad slot %dpckbcintr: no dev for slot %d pckbciha %+2>error %d loading SG list dma map buffer needs >%d dma segments error %d loading buffer dma map %s: couldn't create SCB data DMA map, error = %d %s: couldn't create SCB SG DMA map, error = %d error %d loading request sense buffer dma map 7@@@@@@@@@@@@@@7@@@@@@@7@7@@@@@@7@@@@@7@@@@@@@@@@7@@7@@@@7@@@@@777@7@@@7@@7@@@77@@@@@@77@7@7@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@7@@@@@@@@@@@@@@@@@@@@@@@@@@@7@@77@@@@@@@@7@@@@@@77@77@7@@77ЀИв ' @Б@@ж@ 3 U  U U '  ЀQдддддддддддддддддддддддддддд`SCSI Parity error detected U              а         p А p   Ѕ       p   p   Ѕ         А     Ѕ       АSCSI OpCode 0x%02x timed out %s: target %d using %d bit async %d.%d MHz %d REQ/ACK offset xfers %s: unable to allocate SCBs, error = %d %s: unable to map SCBs, error = %d iha: invalid EEPROM, bad signature or checksumtrm%s: target=%d >= %d %s: lun=%d >= %d %s: DMA transfer map unable to load, error = %d %s: SCSI OpCode 0x%02x for target %d lun %d timed out :]>]>а:]>]>:]>]>]>]>]>]>]>]>]>]>]>]>]>]>]>]>]>]>]>]>]>]>]>]>:::Ѓ;%s: reselect - target = %d, lun = %d not found %s: unable to create DMA transfer map %s: unable to allocate SCSI REQUEST BLOCKS, error = %d %s: unable to map SCSI REQUEST BLOCKS, error = %d %s: unable to create SRB DMA maps, error = %d %s: unable to load SRB DMA maps, error = %d %s: target %d using 16 bit 8 bit Asynchronous %d.%01d MHz, Offset %d data transfers with Tag Queuing uhciuhci_allocm%s: interrupt while not operating ignored %s: host system error %s: host controller process error %s: host controller halted %s: controller did not reset startstop%s: cannot %s uhci_alloc_std_chain: maxp=0 uhci_abort_xfer: not in process contextuhci_device_isoc_enter: xfer=%p in frame list uhci_device_isoc_close: %p not found uhci_device_setintr: 0 interval UHCI root hubBBЀBBBBBBBBBBBB@BЀBаB0BBBՊBBBBBBBBBBBBohci,, legacy support version %d.%d%s %s: unsupported OHCI revision %s: SMM does not respond, resetting %s: reset timeout %s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted %s: blocking intrs 0x%x ohci_add_done: addr 0x%08lx not foundohci_rem_ed: ED not foundohci_abort_xfer: not in process contextOHCI root hubpАае0Pohci_setintr: 0 interval %s: isoc TD alloc failed ohci_device_isoc_abort: early return ehci%s: EHCI version %x.%x %s: wrong number of companions (%d != %d) s%s: companion controller%s, %d port%s each: %s %s: reset timeout ehcidb%s: run timeout %s: unrecoverable error, controller halted %s: blocking intrs 0x%x ehci_check_intr: sqtdstart=NULL ehci_open: bad device speed %dehci_rem_qh: ED not foundehcidiEHCI root hub%s: port reset timeout ((4VxG(GР2TгGehci_abort_xfer: not in process contextehciabrdrd%drdattach: device name too long RAM diskfictitiousrd_idleWARNING: no memory for concatenated disks ccd%dccdinit: device name too long. ccdbuffer (mirror)%s: error %d on component %d%s ccdiodone: countccdfictitiousdefault labelccdlcki0i0i0иi0Щi0Жi0Ќi0|i0di0Adapter Processer ErrorImage CRC ErrorDMA ErrorPC Trace Path TestHardware FaultSoftware FaultHost Directed FaultHost Bus Parity ErrorSelftest Timeout}j0uj0ej0Wj0Hj07j00j0$j0Ring MemberHaltedLink UnavailableLink AvailableDMA AvailableDMA UnavailableUpgradeResetj0Йj0Аj0Phy PortLinkStationj0Trace Receivedj0ReasonSl0Cl0+l0l0l0k0k0k0Шk0Вk0xk0_k0Mk0=k0-k0k0Directed Beacon ReceivedTrace InitiatedFCI Strip ErrorRing Purger ErrorDuplicate Token DetectedDuplicate Address FailureRing Beacon InitiatedRing Initialization ReceivedRing Initialization InitiatedNo User BufferReceive Data OverrunPDU Length ErrorFrame Status ErrorBlock Check Error (CRC)Transmit FailedTransmit Underrunj0Бl0Њl0xl0Upstream NeighborSourceData Link Headerl0l0аl0Link Confidence Test RejectElasticy Buffer ErrorLEM Error Monitor Rejectm0Directionj0hl0l0Шj0j0Фl0Hm0Dm0@m0pdqcb_command_request != ci->ci_request_completionrspgen->generic_status == PDQR_SUCCESS%s: Unsolicited Event: %s: %s[%d]fpdu != NULL%s: MAC CRC error (source=%x-%x-%x-%x-%x-%x) freecnt == 0dbp->pdqdb_transmits[completion].txd_sop == 1dbp->pdqdb_transmits[(completion + descriptor_count - 1) & PDQ_RING_MASK(dbp->pdqdb_transmits)].txd_eop == 1state == PDQS_DMA_UNAVAILABLEcnt > 0state == PDQS_DMA_AVAILABLEstate != PDQS_DMA_UNAVAILABLEstate != PDQS_RESETstate != PDQS_HALTEDstate != PDQS_UPGRADEstate != PDQS_RING_MEMBER%s: %s: halt code = %d (%s) %s: Flushing transmit queue %s: address %s %s: device timeout dp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed  n;AvXaM ְdx rndrdeeZfpfФfcd9660_inactive: pushing activecd9660_reclaim: pushing activeRRIP without PX field? ..RRIP with incorrect flags?7}0}|F}|F}F}F}|F}F}F}F}F}F}F}|F}F}F}F}F}F}F}F}F}F}F}F}F}F}F} }RRIP with incorrect NM flags? K~D~'~W~0~W~W~W~W~W~W~W~W~W~W~W~W~W~W~W~W~W~W~W~W~W~W~W~W~W~W~W~7~IEEE_1282IEEE_P1282RRIP_1991ASPDL̔$4ȕԚu@cd9660_mountroot: can't setup bdevvp'sroot_devicecd9660CD001%/@%/C%/Eisoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] ЖЪ""ЪЪЪЗАРРЗРР..cd9660_strategy: spectag VT_ISOFS, isofs vnode fБРааOpenBSD#!/dev/fd/%dCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2004 OpenBSD. All rights reserved. http://www.OpenBSD.org %s swappercannot mount rootcannot find root vnodefork initpagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init.bak/sbin/oinit/sbin/init/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d init: couldn't allocate argument spaceexec %s: error %d init: not found no initfileplfdescpldup2: fdalloc0аФРfileclosefkqeueplknoteplkqreadkernel mapping failed %d user mapping failed init died (signal %d, exit %d)reaperwaitprocppwait WARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: upgrade exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: processor %lu, not exclusive lock holder %lu unlockinglockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: draining against myselflockmgr: unknown locktype request %d%І('&Ў&*+ lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by processor %lupid %d not locked with %d pendingmalloc: allocation too largemalloc: out of space in kmem_map%d,rw_enter: locking against myselfrwlockphysbufphysioprocplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0chgproccnt: lost userplimitplTЁTЁTTTTTTTЁTTTTTЁTЁTTЁTЁTTTЁTЁTTTTTTTTЁTЁTsigaplpauseprocfs debuggingissignal pid %d was killed: %s sorry, pid %d was killed: %s %s.core4k@k@k@k4k@k4k4k@k@k@k@k@k@k@k@k@k@k@k@k@k@khashinit: bad cntsysctlsysctl_disklockq'q7q0qPq qGqPqPq@qаrРrаrРrРrРrРrРrРrРrРrРrРrРrРrРrРrРrРrРrРrРrРrРrРrаrРrРrРrРrаrРrРrРrРrаrРrаrРrРrРrаrРrРrРrРrРrаrаrаrаrаrаrРrаrrrrrss s`sЀss@tptАtУttwtuuuЀttu uwwr'u8uEuVusuЀuЇuАuЗuhuРuuvevqvpsЈvаvТvиvuvvwww3wбt1s@sPstwwwPww`wУtwwТwx x'x2x@xPxhxrxаxxxy@y4wАа P%s,denied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleeppreempt: cpu_preempt not yet implementedsetrunnableSG >>> probing for %s* %d mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe unsupported not configured root device %s not configured %s (root)%s at %sconfig_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %sconfig_detach: forced detach of %s failed (%d)%s detached config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structurereadwrit%s%d%c: %s %sing fsbn %d%d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs intrextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundklogpool_init: too much uptimephpoolpcgpool%s pool_get: %s: page emptypool_put: %s: page header missingkernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %s%d%llo%lld%llx0123456789abcdef(null)0123456789ABCDEFbug in kprintf: bad baseP  c      pГ ЊР !!!!!!!!!          И          `     X  У         ЀМ   PМ  ` dгl  \  а?vverbosettimezonesshowquitLlinesllisthhelpffindqexiteenableddisablecchangebbaseaadd--- more --- %d%d0%o0x%x%s*FOUND***UNKNOWN*ИЧЄЧ%3d free slot (for add) %3d %s count %d (pseudo device) Unknown devno (max is %d) %3d at root%c disable ??? %s flags 0x%x %s [] ? Unknown argument change (y/n) ? out of memory. flags changed %3d can't change free slot count%3d %s changed Error unknown state already disabled %3d can't disable free slot %3d %s can't disable pseudo device enabled %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know P P P P P P P P P P P P P P P P P P P P А Р а    P  P P P  P P P P  P  0 P @ %s Unknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d endisautoconf verbose %sabled Unknown command ІІІІІІІІІІІІІІІІІІІІ%r0вІ0ІІІ@ІІІІSІpАІVUser Kernel Config UKC> Continuing... selectpollpipelkpiperdpipewrpipeclpipepl@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ PMuMuMuMuMuMuMuMuMuMuMuMuMuMuMuMuMuMuMuMuMuMuMuMuMuMuMgMWMpM`M0N9NN N3N9N)N/dev/consolettckoutqttyrub: would panic c = %d, val = %d iЈiЈiЈiХiЈiЈiload: %d.%02d not a controlling terminal no foreground process group empty foreground process group iowaitrunnablerunning cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk fsvsІsЖsгsputc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersmbplmclplm_copym0: off %d, len %dm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufm == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREFnetconnetclsnetionetlcksbappendaddrsbappendcontrolsemi-panic: sbcompress sbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 3uipc 4piusrreq01Аа00BCtДвBPBBunp_attachunp_connect2unp_disconnectbremfree: lost tailbufplgetblkallocbuf: buffer larger than MAXBSIZE requestedgetnewbufcleanerbiowaitbiodone alreadynchplcluster_read: DONE bpcluster_callback: too little memoryClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocksvop_generic_revokeallvfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpl(@pА  p!А!!!"lf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvnodesvfslock%s_mountroot failed: %d vnodefree vnodefree vnode isn'tv_lockvgetvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevmissing aliasvgonel: not cleanVBADVFIFOVSOCKVLNKVCHRVBLKVDIRVREGVNON%s: type %s, usecount %u, writecount %u, holdcount %u,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT| VBIOWAIT|VALIASED flags (%s) kinfo: vp changed unmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done softdep %d vwakeup: neg numoutputvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvflushbuf: not dirtyvflushbufvflushbuf: dirtybgetvp: not freebrelvp: NULLfsync failedmounted on: %s sched_sync: fsync failedsyncersyncer vnode vfslockmount: lost mountunmount: dangling vnodehaahhahhhЀЅАЕРХаbbvn_lockdefaultvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_leasevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_whiteoutvop_getextattrvop_setextattrvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfiforfifowtag VT_NON , fifo with %ld readers and %ld writersfifo_badop calledЖЖ ЖЖЖЖspec_read typespec_write typespec_ioctlspec_fsync: not dirtyspec_fsyncspec_close: not specialtag VT_NON, dev %d, %d ааАРаspec_badop calleddos2unixtime(): month value out of range (%ld) !#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largemsdosfs_reclaim(): pushing activemsdosfs_inactive(): pushing activeextendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath(): .. not a directory? RRaArrAaUmsdosfs_sync: rofs mod    @ ( @  @0 msdosfs_write(): bad file typemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirrename: lost dir entrymsdosfs_rename: updating .. in root directory?...msdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED) dev %d, %d, %s p3А3А3F3b3А3p3Ѐ343)4)4)4)4)433434)4)44bpf: ifpromisc failedbpf_detachd: descriptor not in listbpfbpf_mcopybpfattach#N0NVNeN`OtNKOOOOOOOOOOOOOhOРNKOOOOOONOOKOOOpOЁNOO0LOOOONOOdLOOOЀOАNOOOOOO ONOOаLOOOИOаNOO MOOO@ONOOЀMOOOАOOOOOOOO5OOOO8NGNOOРOOOOOOOOGOOOOOOOOаOOOOOOOOPOOOOРLШLOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOM P PpPpPЀPP"Q"Qtoo many interfacesif_attachhead: mallocif_attach: malloc%s: can't handle af%d ooБoАmБoБoБoБoБoБoБo nБoБoБoБoБoБoБoБoБoБoБoБoБomБoБoБoБoБoБoPod n;0&AvQkkXaM~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@6wHHwМw= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM BSEARCH BIGFIRST <>!!!! number of buckets = %d uvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! pgdaemonaiodonedswapsysuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswapdrum_addminirootswapctl: miniroot copy failedswapctl: copystrswap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getpageuvn_getuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_ifawithscope: output interface is not specified %s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) bridgein6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled %s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6m_pulldown malfunctionm_pulldown malfunctionf аf f f f icmp6_mtudisc_callback_registerm_pulldown malfunctionENOBUFS in icmp6_error %d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) m Аm Рn дm m icmp6_notify_error: in6_embedscope failed should not reach here/usr/src/sys/arch/i386/compile/RAMDISK_CD/../../../../netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d icmp6_reflect: source can't be determined: dst=%s, error=%d 0 Ј в ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ ϓ  @ p Р В 0 W Ѐ У (src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s m_pulldown malfunctionip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_forward: outgoing interface is loopback. src %s, dst %s, nxt %d, rcvif %s, outif %s а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а а F P g Ѐ З а register_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full m_pulldown malfunctionassumption failed: hdr not split  ` ` ` ` `  0 A R c t Ѕ Ж Ч и C C C P P P P C      P C C C C P P C @ @ P C P C P C C C C C C C C C C C C P C C C C C C C C C C 1 1 1 ( C C C 1 c p u Ѐ Ј А И Р Ш и а ж  c С @ (  7 c t С m_pulldown malfunctionm_pulldown malfunctionnd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt !!!!!ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)!А!!!!unspecnd6_lookup: failed to lookup %s (if = %s) nd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) default router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) m_pulldown malfunctionnd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_output: source can't be determined: dst=%s, error=%d ???nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_ns_inputnd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_na_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s m_pulldown malfunctionnd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) defrouter_addifreq: failed to find an ifaddr to install a route to interface %s defrouter_addifreq: failed to install a route to interface %s (errno = %d) defrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: there's no default router and no default interface defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) et!дt!t!u!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!Рv!0u!Wu!Ѐu!Чu!u!u! v!@v!`v!Ѐv!rip6_attachrip6_detachrip6_usrreqXx!Џy!y!{!Ѐz!{!Cy!#{!{!7{!Ѐy!$|!{!{!{!|!|!{!mainbuscpu_configure: mainbus not configuredbiomask %x netmask %x ttymask %x raidrdmcdcdsdwtfdswwdroot on %s%d%c root device? %s: not a unit number %d: no such unit use one of: %s%d[a-%c] invalid geometrydos partition I/O errordisk label I/O errorno disk labeldisk label corruptedbad sector table I/O errorbad sector table corruptedgdtlckgdt_init: no pagesgdt_growgdt_get_slot: gdt_next != gdt_countgdt_get_slot: out of GDT descriptors%scpu0real mem = %u (%uK) startup: no room for tablesstartup: table size inconsistencyavail mem = %lu (%uK) using %d buffers containing %u bytes (%uK) of memory cpu_startup: cannot allocate VM for bufferscannot get physical memory for buffer cache*1*1*1*1*1*1*1*1*1*1*1*1ܞ!*1и*1586NexGen6x86486DLCCyrix486DX486SX386DX386SXIntel686486386Dual OverDrive K1*1*1*1*1ГK1ЍK1ІK1{K1tK1*1cK1VK1GK18K1,K1$K1GK1,K1$K1(!K1K1 K1K1J1J1J1J1J1J1J1J1Д!J1J1!НJ1J1J1J1`J1@J1J1J1I1I1I1I1I1I1I1I1I1I1I1P!I1вI1ФI1ЕI1I1uI1cI1PI1MI1p!DI1.I1(I1p!I1*1I1I1I1*1I1H1ܞ!H1H1H1H1I1H1H1еH1H1Ш!H1ВH1ЈH1|H1rH1oH1!bH1]H1I1YH1YH1YH1H1LH1BH1I1:H1:H10!H1-H1H1I1 H1H1!G1 G1I1G1H1SiS55xSiSSiS SiS SiS Geode GX1National SemiconductorGeode by NSCTMS5x00TransmetaGenuineTMx86mP6RiseRiseRiseRiseC3C3 EstherC3 NehemiahC3 Ezra-TC3 Samuel 2/EzraC3 SamuelWinChipWinChip 3WinChip 2WinChip C6IDTCentaurHauls686 class6x86MX586 classGXm486 class5x86MediaGXCyrixInsteadAMD64Opteron or Athlon64FXAthlon64K7Athlon XP Model 10Athlon XP Model 8Duron Model 7Athlon XP Model 6Athlon Model 4Duron Model 3Athlon Model 2Athlon Model 1K5 or K6K6-2+/III+K6-IIIK6-2K6K5Am486 or Am5x86Am5x86 W/B 133/160Am5x86 W/T 133/160Am486DX4 W/B or Am5x86 W/B 150Am486DX4 W/T or Am5x86 W/T 150Am486DX2 W/BAm486DX2 W/TAMDAuthenticAMDPentium 4Pentium Pro, II or IIIPentium III XeonPentium MPentium IIICeleronPentium II/CeleronPentium IIPentium ProPentiumPentium/MMXPentium (P24T)Pentium (P54C)Pentium (P5)Pentium (A-step)486DX4486DX2 W/B486SX2486SL486DX2GenuineIntelM1M1M1 M1M1 M1@L1ЀL1L1L1L1L1L1 L1@L1L1L1L1L1L1@L1L1L1L1L1L1L1 L1L1@L13DNOWSBFTMHTTSSSSE2SSEFXSRMMXACPICFLUSHSERPSE36PATCMOVMCAPGEMTRRSEPSYSAPICCX8MCEPAEMSRTSCPSEDEV86FPUZM1TM1ЀPM1LM1DM1CNXT-IDTM2ESTMWAITPNI%s: TSC disabled %s: RNG AES %s: xchg bug workaround performed %s: F00F bug workaround installed %s: disabling processor serial number Pentium II Xeonf!f!Т!p!w!w!C3 Samuel 2C3 Ezraidentifycpu: strange family valueUnknownVIA%s %s%s" "%s (%s%s%s%s-class, %dKB L2 cache)%s (%s%s%s%s-class)%s: %s %d.%02d GHz %d GHz %d MHz%s: ,%s%sWARNING: CYRIX 486DLC CACHE UNCHANGED. TMS5800TMS5600WARNING: not updating battery clock Attempting to power down... The operating system has halted. Please press any key to reboot. rebooting... dumpconf: bad dumpdev=0x%x dumping to dev %x, offset %ld dump area unavailable %d succeeded device bad device not ready area improper i/o error aborted from console error %d ӯ!!!!!!!!!!!!!!!!!!!!!!!ioportiomeminit386: pcb_savefpu not 16-byte alignedtoo many boot argscannot reserve /boot args memory/boot too old: upgrade! WARNING: CAN'T ALLOCATE RAM (%x-%x) FROM IOMEM EXTENT MAP! warning: too little memory available;running in degraded mode press a key to confirm F!p!А!Х!!!!!!0! !Ѐ!W!`!h!p!bus_space_map: bad bus space tagbus_space_map: pa 0x%lx, size 0x%lx bus_space_map: can't free region bus_space_alloc: bad bus space tagbus_space_alloc: bad region start/endbus_space_alloc: pa 0x%lx, size 0x%lx bus_space_alloc: can't free region bus_space_unmap: bad bus space tagportpabus_space_unmap: %s 0x%lx, size 0x%lx bus_space_unmap: can't free region _bus_dmamem_map: size botchmmrwpmap_bootstrap: PAGE_SIZE != NBPGpmapplpmap_init: unable to allocate pv_headspmap_init: pv_initpagepmap_init: pj_pagepmap_pinit: kernel_map out of virtual space!pmap_page_remove: unmanaged page? pmap_test_attrs: unmanaged page? pmap_change_attrs: unmanaged page? pmap_enter: get ptp failedpmap_enter: no pv entries availablepmap_growkernel: out of memorypmap_growkernel: alloc ptp failedreserved trapmachine checkstack faultsegment not present faultinvalid TSS faultFPU operand fetch faultdouble faultFPU not available faultbounds check faultoverflow trapnon-maskable interruptinteger divide faultalignment faultpage faulttrace trapprotection faultasynchronous system traparithmetic trapbreakpoint trapprivileged instruction faultfatal %sunknown trap %dusersupervisor in %s mode trap type %d code %x eip %x cs %x eflags %x cr2 %x cpl %x trap type %d, code=%x, pc=%xuvm_fault(%p, 0x%lx, 0, %d) -> %x kvtop: zero page framevmapbufvunmapbufdkcsum: open of %s failed (%d) dkcsum: read of %s failed (%d) dkcsum: close of %s failed (%d) dkcsum: warning: dup BSD->BIOS disk mapping qwsdisplay is not in cdevsw[]mii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %d!A  !@@@@miiautnsphyDP83840 10/100 media interface: %s, rev. %d nsphyterDP83815 10/100 integrated: %sDP83843 10/100 media interface, rev. %d qsphyQS6612 10/100 media interface: %s, rev. %d ,"i,"i,"i,","i,"i,"i,"i,"i,"i,"i,","i,"i,"i,"ж,"i,"i,"i,","inphyi82555 10/100 media interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfaceunknown inphy: %s, rev. %d iophyi82553 10/100 media interface: %s, rev. %d eephyMarvell 88E1000* Gigabit PHY: %s 6"7"7"p7"7"7"7"7"7"7"7"в6"7"7"7"7"6"exphyxl: 3Com internal media interface Broadcom 3C905B internal PHY: %s, rev. %d Broadcom 3C905C internal PHY: unknown phy %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYrlphyrl: RTL internal phy rlphy_service: attempt to isolate phylxtphyLXT970 10/100 media interface: %s, rev. %d LXT971 10/100 media interfacemtdphyMTD972 10/100 media interface: %s, rev. %d icsphy?ICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interface: %s, rev. %d sqphySeeq 80220 10/100 media interface: %s, rev. %d Seeq 84220 10/100 media interfacetqphy78Q2120 10/100 media interface: %s, rev. %d ukphy: Generic IEEE 802.3u media interface %s: OUI 0x%06x, model 0x%04x, rev. %d %s: no media present dcphy: internal PHY bmtphyBCM5201 10/100 media interfaceBCM5221 100baseTX PHY: %s, rev. %d brgphyBCM5400 1000baseT PHYBCM5401 1000baseT PHYBCM5411 1000baseT PHYBCM5421S 10/100/1000baseT PHYBCM5701 10/100/1000baseT PHYBCM5703 10/100/1000baseT PHYBCM5704 10/100/1000baseT PHYBCM5705 10/100/1000baseT PHY: %s, rev. %d P`"`a"`a"p`"`a"`a"h`"`a"h`"`a"`a"`a"`a"`a"`a"`a"a`"bge 22  ##  *hhe"e"e"e"e"e"e"e"e"e"e"e"e"e"e"e"e"e"e"e"e"e"xmphyXaQti Corp. XMAC II Gigabit interface: %s, rev. %d g"Аh"Аh"Аh"Аh"Аh"Аh"Аh"Аh"Аh"Аh"$h"amphyAm79C875 quad PHY: %s, rev. %d Am79C873 10/100 media interfaceacphyAC101 10/100 media interface: %s, rev. %d rgephyRTL8169S/8110S media interface: %s, rev. %d PHY s"дt"дt"s"дt"дt"s"дt"дt"дt"дt"дt"дt"дt"дt"дt"s"scxsplgetxscannot allocate scsi xs could not get size scsi_scsi_cmdscsi_execute_xs: invalid return codescbusyunknown error category (0x%x) from scsi driver Ё"ׁ"X"X"3""ׁ"`"R""""ǃ"ǃ"p"Ї"а"̃"ǃ"ǃ"з"̃""probe%s(%s:%d:%d): ReservedMiscompare ErrorVolume OverflowEqual ErrorAborted CommandCopy AbortedVendor UniqueBlank CheckWrite ProtectedUnit AttentionIllegal RequestHardware ErrorMedia ErrorNot ReadySoft ErrorNo Additional SenseASC 0x%02x ASCQ 0x%02xDEFERRED %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set onoff INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s CDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %d"Р"Ё"Ё" "User command with no buf User command with no ioctl host adapter code inconsistency unknown error category (0x%x) from host adapter code F"W"Ѐ"Ц"Г"Р"user_strat: No ioctl physio split the request.. cannot proceed cmdlen too big scistrscsibusscsibus at %s: %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun links;v1,v1'v1v1v1v1@ v1u1u1@v1v1v1@ v1u1u1@u1u1u1u1пu1u1u1Хu1Сu1u1Вu1u1u1Ѓu1u1u1zu1u1u1qu1u1u1lu1u1u1du1u1[u1Ju1u1Au17u1u1@Au1&u1u1@u1u1u1Hu1u1u1@u1u1u1@u1t1t1@t1t1u1t1t1t1t1t1u1u1t1u1t1Цt1Уt1t1Љt1Єt1t1st1nt1t1]t1Xt1:t1u14t1*t1u1%t1t1u1t1t1u1t1s1u1s1s1u1s1s1u1s1s1u1s1s1u1Вs1s1u1s1ts1u1s1es1u1`s1Qs1u1Ls1 SCSI%d %d/%s %s%sǓ"Г"ד""""""""4"4"4"" "4"4"4"4"4"4"4"4"4"4"4"4"4"4"4"4"'" not configured cdx1Хx1Хx1x1Хx1Хx1x1Хx1Хx1NEC CD-ROM DRIVE:260 %s: not queuedRATAPI CD-ROMSCSI CD-ROMfictitiouse"@""а"Р"@"@"X"""Ѐ"А"Р"а""ܾ"0"t"И"Կ""P"Р"H"P"sdy1y1y1y1y1y1y1y1y1y1y1y1y1y1y1y1y1y1 %s: %luMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lu sec totaldrive offlineunformatted media%s: WARNING: unable to establish shutdown hook %s: not queued, error %d SCSI opticalSCSI disk%s %s%s: ..is spinning up...waiting %s: removable disk stopped - not restarting %s: respinning up disk %s: respin of disk failed - %d `""0"%s: mode sense (%d) returned nonsense%s: could not mode sense (4/5); using fictitious geometry %s: WARNING: cache synchronization failed 1Л1Ж11|1{1 1j1{1a1P1{1G161{1-11{1a1 1{1 a11{1 11{11ف1{11ȁ1{11Ю1{11Д1Џ11u1{1EEEE1_1Z1Q1@1{1MT-2ST/N50 TEAC ????5150ES SCSI FA1501 AT4000s HP 263HEXB-8200 EXABYTE Model 1300 WangDAT 5525ES SCSI REV75150ES SCSI5099ES SCSIWANGTEK VIPER 150 21531VIPER 150 21247DMT780 ANRITSU CP525 SANKYO VIPER 2525 25462ARCHIVE TDC 3800 TDC 3600 TANDBERG st{1{1{1 rogue, %s: %sdrive empty or not ready density code 0x%x, %d-bytevariableprotectedenabled blocks, write-%s %s: cannot set selected mode """""""""""""""""""%s: bad request, must be multiple of %d %s: bad request, must be between %d and %d %s: not queued `"v"t"Т"Р"""D""p"""л"R"`"Є"г"%s: block wrong size, %d blocks residual %s: %d-byte record too big %s: bad residual %d out of %d ""В""В"В"В"В""В"В"В"В""iop 0@AQ`apq%s: cannot allocate hashtable I2O adapter%s: cannot create scratch dmamap %s: cannot alloc scratch dmamem %s: cannot map scratch dmamem %s: cannot load scratch dmamap %s: not responding (reset) %s: not responding (get status) <%s> %s: couldn't allocate message%s: couldn't create dmamap (%d)%s: unable to init outbound FIFO %s: interrupting at %s iopconf%s: configuring... %s: unable to retrieve HRT %s: unable to retrieve status %s: unable to set system table %s: unable to enable system %s: unable to register for events%s: configure failed (%d) %s%s: unable to create reconfiguration thread (%d)iopzzz%s: %s failed reconfigure (%d) device (class 0x%x)%s at %s tid %dshutting down iop devices... done. %s: outbound FIFO init failed (%d) %s: dma alloc = %d %s: dma map = %d %s: dma create = %d %s: dma load = %d %s: can't alloc priv mem space, err = %d %s: can't alloc priv i/o space, err = %d %s: reset rejected, status 0x%x %s: reset failed %s: WARNING: bad ictx returned (%x) %s: WARNING: bad tctx returned (0x%08x, %p) %s: flags=0x%08x tctx=0x%08x %s: event 0x%08x received iop_post: frame too large%s: mfa not forthcoming iopmsg%s: WARNING: transport failure: %s: ictx=0x%08x tctx=0x%08x %s: failurecode=0x%02x severity=0x%02x %s: highestver=0x%02x lowestver=0x%02x <%s, %s, %s>ioprbs%s: unable to register for events:%s: unable to get parameters (0x%04x; %d) direct accessWORMCD-ROMopticalunknownremovablefixed %s, %s, %dkB cache %s: device not yet supported ioprbsevt%s: out of bounds %u-%u >= %u p*#*#*#p*#*#*#*#*#+#*#+#*#*#*#*#*#*#*#p*#*#*#*#*#*#*#*#p*#p*#*#*#Т*#*#*#*#*#*#*#p*#*#*#+#*#+#*#*#*#*#*#*#*#*#*#*#*#%s: error 0x%04x %s: event 0x%08x received uio move not yet supported I2OContainer #%02d %s: mode sense page %d not simulated ioprbs_internal_cache_cmd got bad opcode: %d 0#q0#q0#.#q0#q0#q0#q0#q0#q0#q0#q0#q0#q0#q0#q0#q0#q0# /#q0#q0#q0#q0#q0#q0#q0#А/#А0#q0#q0#q0#q0#q0#q0#q0#q0#q0#0#ioprbs_ccb3#]4#Є3#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#И3#]4#Є3#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#]4#timed out atapiscsi 7#Ш7#Ш7#Ш7#Ш7#Ш7#Ш7#P7#Ш7#P7#Ш7#Ш7#Ш7#Ш7#Ш7#С7#С7#Ш7#Ш7#Ш7#Ш7#Ш7#Ш7#Ш7#С7#Ш7#С7#wdc_atapi_start: not ready, st = %02x %s:%d:%d: device timeout waiting to send SCSI packet unexpected data phaseunexpectedly in command phasedata phase where none expecteddata transfer direction disagreementdata transfer direction disagreement during sensezero length transfer requested in data phasewdc_atapi_intr: warning: device requesting %d bytes, only %d left in buffer wdc_atapi_intr: warning: reading only %d of %d bytes atapiscsi: Shouldn't get here BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: device timeout, c_bcount=%d, c_skip=%d, status=0x%b, ireason=0x%x Device Reset WaitIdentifyPost-IdentifyPIOMODEdmamodeunknown state%s:%d:%d: %s timed out G#H#G#G#G#H#G#(H#`H#`H#АH#H#(I#VI#I#I#%s:%d:%d: soft reset failed wd%s: IDENTIFY failed : <%s> %s: %d-sector PIO, LBA48, %lluMB, %llu sectors LBA, %lluMB, %llu sectors CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors %s: WARNING: unable to establish shutdown hook __wdstart: bad return code from wdc_ata_bio()DMA errordevice faultdevice timeout, retrying %s: soft error (corrected) TT#АS#ЀS#uS#ЇS#`S#ST506/MFM/RLLESDI/IDE disk%s: %s wddump: try againwddump: polled command has been queuedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: %swddump: unknown error type`#`#_#_#_#ST506wd_get_params: bad return code from ata_get_params%s: flush cache command didn't complete %s: flush cache command timeout %s: flush cache command: drive fault wdc%s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad stateBSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: not ready, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq wdc_ata_ctrl_intr: state==RECALrecalpiomodedmamodegeometrysetmulti%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) m#0m#om#m#m#@n#n#n#o#Po#Ћo#bad block detecteduncorrectable data errormedia changedid not foundmedia change requestedaborted commandtrack 0 not foundaddress mark not foundinterface CRC errorno media/write protectederror not notified%s %s,mainbus bioscpupciEISAeisaisa%s at %s bus %dpci %s at %s dev %d function %d %sset_pci_isa_bridge_callbackpci_io_find: bad requestpci_io_find: expected type i/o, found mem pci_io_find: void region pci_mem_find: bad requestpci_mem_find: bad 64-bit requestpci_mem_find: expected type mem, found i/o pci_mem_find: expected mem type %08x, found %08x pci_mem_find: void region pci_mem_find: 64-bit memory map which is inaccessible on a 32-bit platform pci_mem_find: reserved mapping register type .Ȟ1Ğ1VGAmiscellaneousP1L1E1A1<181Ȟ1ЀATARAIDIPIfloppyIDESCSI11111ڟ1ğ1Ȟ1ЀPCMIG Multi ComputingWorldFipISDNATMFDDItoken ringethernetĞ1G1D1Ȟ1Ѐ3DXGA111Ȟ1Ѐtelephonyaudiovideo֠1Р1Ȟ1ЀflashRAMϡ1ˡ1ơ11111111 x1 Ȟ1ЀInfiniBandSemi-transparent PCIRACEwayCardBusNuBusPCMCIAPCIMicroChannelEISAISAhost=141"11Ȟ1Ѐmodemmulti-port serialparallelserial11111Ȟ1ЀPCI Hot-PlugRTC8254 timer8237 DMA8259 PIC>141.1&11Ȟ1Ѐgame portscannermousedigitizerkeyboardl1Ȟ1Ѐgeneric11111 10ԣ1@Co-processorMIPSPowerPCAlphaPentium486386¤111111x1111 CANbusSERCOSIPMISMBusFiber ChannelUSBSSAACCESS.busFirewire1 11Ȟ1ЀRFConsumer IRIrDA41standard111|1datavoiceTVʥ11Ȟ1Ѐentertainmentnetwork/computing1 1Ȟ1ЀTime and FrequencyDPIO11Х1؞1Н1X1Е11Њ1L1Ѓ11|1ܠ1m1ԡ1f1D1`1 Ȣ1[1 H1Q1 t1F1 1=1 ̤1911*1@1#111ܥ11undefinedDASPcryptosatellite commI2Owirelessserial busprocessordockinputsystemcommunicationsbridgememorymultimediadisplaynetworkmass storageprehistoric2h726h72rh72%i723i72rip72зj72зd72зY72зS72з3M72з5G72зEA72зY472зPY#72зQY72зRY72зUP62з`62зU`62зV`62зFv62зpw62з62зy62зk62зW62зE62з 462зP#62зQ62зU62зV52зX52зZ52з52з52з52з52зq52з_52зX52зN52зA52з452з(52з52з52з 52з 4242424242 42==42==42==42==42==42==42==42== 42== 424242йp42йPd42йET42йHp42йC42Ъ242ЪQ )42ЪBX 42Б42Б42Б42Б32Б 32Б32Б32Б 32Б032Б@32БP323232323@`323@ 32%532йEv32йIl32йQb32йaX32йN32й!D32й#:32й1032й3&32й532йC32йA32й!22йG22й 322йR22йR22й)R22й7R22йGR22йCR22йQT22йqn22 h22 b22\22O22xF22x!822`8-22xP$22xU22Y22Y22x`12xa12xp12xq12xr12xs12xt12x12x12x12x12x12x12ix12xo12a12S12F12812*1212 12P02Q02_020202020202020202d02ev02dg02Y02I02802)0202 02802/2/2/2/2/2/2/2/2/2/2#z/2%n/2'b/22S/25E/2.B4/20B%/2B"d /2B$d/2Ю/2Ю/2Ю.2Ю.2;.2;.2;.2".2".2".2".2" .2" y.2" g.2"@ V.2"0H.2"p=.2"p1.2" p).2" p.2"p.2"p .2"t.2"t-2"t-2"t-2"t-2" t-2" t-2" t-2"t-2"t-2"t-2"t-2"t-2"@tw-2"Ato-2"Ct`-2"EtW-2"FtM-2"HtA-2"It9-2"Pt/-2"Qt-2"Tt -2"Ut-2"`t,2"dt,2"ht,2"it,2"jt,2"kt,2"mt,2`,2,2`,2T!y,2kr,2ko,2ki,2k`,2kU,2kK,2kE,2k1k ;,2k!6,2k"-,2k$6,2k%&,2k&,2k',2k(,2k),2k-+2k.+2k/+2k0+2k1+2k2+2k3+2k4+2k5+2k6+2k;+2k>+2k?w+21푠p+2홠i+2b+2[+2[L+2Cu1XAE+2BB6+26C&+27C+2TC+2XC+2TE*2BG*2DG*2IG*2LG*2MG*2NG*2OG*2PG*2QG*2RG*2SG*2TG*2UG}*2VGs*2WGi*2XG_*2YGU*2ZGK*2fI?*2nI/*2BL%*2DL*2EL*2FL*2GL)2IL)2ML)2NL)2PL)2QL)2RL)2SL)2WL)2YL)2ZLr)2fL\)2FMG)2LM2)2DN!)2PN )2dN(2DP(2FP(2RP(2DQ(2EQ(2FQ(2GQ(2LQ(2MQ(2NQy(2OQj(2WQ[(2YQN(2ZQA(2lQ2(2ER&(2FR(2GR(2KR(2LR'2HS'2KS'2LS'2MS'2NS'2FT'2LT'2RT'2TV'2UVy'2VVo'2AY_'2aYS'2pI'2?'2PG*'2C'2 '2'2&2&2#&2#&2@#&2@#&2@@&2P!&2D &2D&2D&2D&2Њ~&2Њu&2Ыp&2ЫVk&2D.2E.2Fc&2G[&2HR&2MH&2S@&2]7&2^*&2"&2&2&2&2%2 %2 %2%2D%2X%2X%2X%2 X%2!X%2"X%2#X%2ОP%2ОQ%2Оn%2Оo%2Оx%2Оy%2Оt|%2K@m%2K@a%2K0V%2tcsgP%2}F%2?)%2,#%2,%2,%2,%2, %2,%2,$2,$2,0 $28$2$2$2$2$2$2$2$2$2$2$2o$2]$2S$2I$2?$2`&$2`$2`$2`#2Е@#2ЕB#2ЕC#2ЕF#2ЕG#2ЕH#2ЕI#2ЕP#2Еp#2Еs#2Е|#2Е1o#2Е1b#2Е5U#2 M#2ơ1ˡ1A#2 A#2209#230*#2409#2@A#2p@#2@ #2@"2@"2@"2@"2@"2@"2 p1"2ˡ1"2z"2m"2)ˡ1+f"22P"23@"24/"25"2@!2C!2iˡ1l1m1!2!20P"2`!2xf!20Z!2PM!2D!2 3!2(!23!26!2!2!2C$!2/ 2Ѐ 2Ѐ 2Ќ 2 2 2 2 2@¤1p 2p` 2p 285 2# 2 2 222222<2x2x2x2x2x2xr2xe2Ђ^2ЂW2Ђ P2B2<262(2"2 2 22 22222!2"2#2$2%2&w2F`2eU2(K2(A2(72(72(A2( A2((2(2(A2(72(A2(A2(A2(A2(!A2`2 32В 2І2І2І@2ІL2D2D2D2D2D2X2J2u2r2^2I2#82H$2 225E/2 62.B4/20B%/2>B2$2tq2tP2tX2]2]h2]iy2]xn2]g2]Z2]P2]C2]'2](2]8(2](222282'2'2262Ыw2Ыl2FPf2p`2<S2<E2<72< )2<(2<)2<02<12<H2<2<2<2<2<2Уz2Уu2Уp2Уk2У\2УW2УR2УM2УH2У >2Ј392Ј3ˡ1Ј34202 22 22222 02"2.262>2W2p22}2OI"f2PT2`@272.2%2I 2І92І2І 2І)2І*2І02І22І2І2І2Іv2І\2ІS2ІS2І` C2Іb 32Іd #2І2І2І2І2І 2І 2І 2І2Іm2ІU2І@2І(2І2І2І2І2І2І2І2І2І}2Іa2І&L2І'72І("2І)2І02І1 2І2 2І32І42І52І62І72І82І9 2І: 2І;2І<2І= 2І>2ІC2ІH2ІP 2ІQ 2ІY2Іu2Іv2Іw2Іx2ІyU2Іz(2І{2І|2І2І}2Іn2І2Іn2І 2І!}2І02І1}2І2n2Іa[2І S2І"G2І#?2І&12І'&2І(2І)2І-2І.2І02І42І52І72І<2ІK2ІP2І`2І`j2Іa\2ІbM2І`A2І!62І#,2І$"2І02І1 2І$2І$2І$2І$2І$2І$2І$2І $2І!$2І"$2І#${2І%$n2І&$`2І($M2І@$A2ІB$52ІC$'2ІD$2ІE$ 2ІF$2ІH$2ІI$2ІJ$2ІK$2ІL$2ІN$2ІY$2І]$2І$2І$2І$z2І$2І$i2І$W2І$2І$J2І$>2І$12І$%2І$2І$ 2І$2І$2І$2І$2І$2І$2І$2І$2І$2І$2І$2І$2І$2І$~2І$m2І$2І$^2І$2І$2І$Q2І%G2І%=2І0%22І@%#2ІA%2ІC%2ІD%2ІE%2ІF%2ІG%2ІH%2І1%2І2%y2І5c2І5S2І5=2І5'2І3%2І4%2І5%2І6%2І`%2Іa%2Іb%2Іp%2Іq%2Іr%2Іs%2Іv%2Іx%{2Іy%p2І{%a2І%U2І%I2І%<2І%.2І%"2І%2І% 2І%2І%"2І%2І22Іu52Іv52Іw52Іx52І52І5|2І5m2І5W2І@3K2ІA3?2І002І5%2І52І5 2І5 2І5 2І5 2І5 2І5 2І5 2І5t 2ІRd 2ІRU 2ІpI 2Іp= 2І p1 2І0p) 2Іq 2Іq 2Іq 2Іq 2Іq 2І q 2І!q 2І"q 2І#q 2І$q 2І%q 2Іq 2Іq 2Іqx 2Іqx 2Іqp 2Іqc 2ІqV 2ІqH 2Іq< 2Іq0 2Іq$ 2Іq 2Іq 2Іq 2Іq 2Іx 2ІĄ 2Іń 2Іʄ 2І˄ 2І 2І 2І r 2І!c 2І"T 2ІAE 2І5 2ІR$ 2ІT 2Б 2~ 2`s8 2 2a 2a 2D/ 2Ѓ 2Ѓ0 2.0 2v 2v 2v 2v 2 2| 2| 2| 2u 2u 2 | 2!| 2i 2i 2u 2u 2u 2` 2R 2R 2B 2}; 2}f# 2Д 272 27d 2Э 2Э 2@ 2A 2B 2C 2D 2E 2F 2G 2H 2I 2J 2K 2L 2M 2N 2P 2Q 2R 2S 2T 2U 2V 2W 2X 2Y 2Z 2\ 2 2X1X 2X 2X 2Ї 2(!21 22 2% 2жk 2жO 2ж3 2ж 2ж 2ж2ж 2ж 2ж 2ж2жu2=l2Ы Cg2ЫPX2+E2+)2+2+2+2+ 2+!2+%2+ 2+2+2++~2+y!k2+'%^2+G2+02+2+2+2`1a2к2W2W2WV2WH2ГA2Г@2ГA2Г22i2iz2ij2i Z2iPO2iVC252'22Y 20212 2 2 2 1  2 "2 2 2 2 y2 l2 _2 T2 D2 72 /23513F"23t23}23¤1323X23<2222222%y2g2V2E2ЅA?2Ѕ b92Ѕ c225-2E*2`Qwz22 2222 2JP22222222 2!2021222425262P2Q2R2 2 2 2 2 2 2 2! 20 21 22 2@ 2A 2B 2P 2Q 2R 2` 2a 2b 2 2222222 2 2 ~2 w2p2h2`2 U2!J20B2:2 42!-2"'2#'2$!2%!2`,2 2txN22l2l02] #2]9#2]=I2]HS22 2 2(z2)j2,d2-d2`X2dJ2e>2f22g&2h2j2k2l2m2n2222222v2j2]2I22>2/2(22 222P2Q2R2S2p2q2r2t2up2v\2xM2y92z&2{2| 21111111u1f1W1W1D191,1!1111111111111111P~1Qm1S\1XL1Y<1[,111"1$1N1Ѝ1Ѝ1Ѝ1Л!1EWŵ1EXŪ1Ehş1EhՔ1E!Ɖ1Eǂ1E{1E"t1Eal1a1V1K1 @1!51@*111 11 11111 1B1Myx1f1f1f1fs1f f1f_1fR1fE1f<1f/1f(1f!1f1f1f1f1f1f1f1f 1f!1f%1f'1f01f1f1f1f1f{1r1Ѕk1еv2еw2еPb1еY1ZSR1Z3MI1Z8M@1Z8 71Z0 .1Z0M%1ZhM1Zhb1ZiM 1Zib1Zu1ZuR1Zur1Z31Z31Zq31Zu31Zv31Zw31Zs31Zr31Zf1Z&f1Z)f1Z fy1Z!fp1w h1w"`1wX1w@P1wH1w?1w61w!.1w"&1w#1И1И1 1)1)192i1Ѐe1Ѐf1Ѐu1Ѐv1Ѐw1Ѐx1Ѐ!1ЀQ1ЀR|1z f13S1V`13SY13SO13SD13S:13S613S=-13S&13S13S13Sˆ 13SÈ13SЈ13Sш13S҈13Sӈ13S13S13S13S13S13S13S13S13S13S}13S s13S!h13S"_13SV13SL13S?13S513S(13S13S.13S 13S13S13S1ЮA1HC1H C1HD1Щ 1J1J 1J1JF1d119y19n19g19Y19 M19B19419/19g19191919 19019@19P1919 19019319519@19E19F19H19P19Q19R19U19X~190v193n195f19@^19AV19EN19FF19H>19P619Q.19R&19U19 19a 19b 19c 19U19U19U19qU19U19U19U19U19U19U19b19b19c19c19%c19&c190c19pr19pi19p[19pQ19pF19p419p)1и1и1и1o1o1o 1o1o1o 1o 1)1)1)BI1) a1M q1M9`1MN1B1Ў71Ў31Ў1Ў1Ў 1Ў1Ў+1ЎP1ЎTT1ЎUT1Ў1Ў1Ў1Ў1Ў11! 1 hq1 hry1н4k1Вf1В*2bT1ЭM1ЭF1Э?1M1Эe41=!1=!1)1 i11;'1;41;51L1L=1L=1Lz1L g1LV1LE1L21L 1L! 1L#1L$1L&1L'1L)1L*1L+1L1Lr1Lc1LS1LC1L31L#1L1L1L1L1L1L1L 1L!1L@1LA1LBr1LDb1LFR1LGB1LH21LI"1LJ1LK1LL1LPT1LQD1LR41LS$1LT1LU1LV1LW1LX1L`1Y11/ 1/ 1//1y1yˡ1yn1y ]1yM1y<1y'1y1y1y1y1# 1# 1#1# 1#1# 1#1# 1# s1# i1#P_1#`U1#K1#@1#21# (1#@1#%1#` 1#1#1#P1#P1#1#111111y1Вg1 2V1 2E1 241 2#1 21 G1`1`1`1`1`1`1`:g1`1`j1`1`1`1`1`|1`ˡ1`t1`l1f1й^162аM1а81а` '1а`11111a1q1v111111w1l1a1T1G1:1& *111q11801@01C01D01P01S01W01X0r1Y0f1e0\1h0M1t0B10711(1111 1"11#11G11H11I11w111111'21a3211511}1r1e1X1K1@151*1h11 1111111111 1 1 1 1 1v1l1b1X1N1D191.1#11 111111 1!1"1#1$1%161718z19p1:f1;\1<R1=H1>>1?41f*1g 1h1i 1j1k1m1n1o1111111111v1`l1ab1X1T1I1>1/11 1 1111111Э1Э111111111121Bx1q1Jm1Pe1P@U1P@ A1Pe41P+1PZZ"1Pf1J1]1]1] 1s1s1s1s1s 1s 1s 1s1s1s 1Г181W`1 a1DVDPCI-ST321221754744724F740C740737738734724ModemX3201-3 (21143)X3201-3Linksys EtherPCIW6692 ISDNW89C940FW83C553FW83C553F ISALinksys EtherPCI IIW89C840F 10/100W83769F90CWD9610WD34C296WD33C296AWD7197WD7193WD33C197AWD33C196AWD33C193AP9100P9000Virtual SVGA IIVirtual SVGA82C92582C97582C14782C53582C53482C53282C54382C54182C596/597 Wildcat ISA82C594 Wildcat82C593 ISA82C592 CPUICPGDT8x22RZGDT7x29RNGDT7x19RNGDT6x29RDGDT6x19RDGDT8x63RZGDT8x53RZGDT8x43RZGDT8x33RZGDT8x23RZGDT8x13RZGDT4x23RZGDT4x13RZGDT7x63RNGDT7x53RNGDT7x43RNGDT7x58RNGDT7x38RNGDT7x28RNGDT7x18RNGDT7x23RNGDT7x13RNGDT6x63RSGDT6x53RSGDT6x43RSGDT6x33RSGDT6x58RSGDT6x38RSGDT6x28RSGDT6518RSGDT6523RSGDT6513RSGDT6x21RP2GDT6x11RP2GDT6557RP2GDT6537RP2GDT6x27RP2GDT6x17RP2GDT6x58RDGDT6x38RDGDT6x28RDGDT6x18RDGDT6x21RP1GDT6x11RP1GDT6557RP1GDT6537RP1GDT6x27RP1GDT6x17RP1GDT6x21RPGDT6x11RPGDT6557RPGDT6537RPGDT6x27RPGDT6x17RPGDT6555GDT6535GDT6x25GDT6x15GDT6557GDT6537GDT6x27GDT6x17GDT6550GDT6530GDT6120/6520GDT6110/6510GDT6000B/6010GDT6000/6020/6050VT8377 AGPK8HTB AGPVT8235 AGPVT8366 AGPVT8633 AGPVT8605 AGPVT82C598 AGPVT82C597 AGPVT82C601 AGPVT8501 AGPVT8371 PCI-PCIVT8363 AGPVT8231 PMGVT8231 ISAVT8237 ISAVT8377 PCIK8HTB HostVT8235 ISAVT8237 SATAVT8751 PCIVT8233 ISAVT8623 PCICLE266VT8375 PCIVT6105 RhineIIIVT6202 USB 2.0VT8366 PCIVT8366 ISAVT82C686 ModemRhineII-2VT8233 AC97VT82C686 AC97VT82C686 SMBusVT6105M RhineIIIVT82C596 Power MgmtVT6306 FireWireRhine/RhineIIVT82C586 Power MgmtVT83C572 USBVT82C1595 PCIVT82C416 IDEVT82C570M ISAVT82C570M PCIVT86C926 AmazonVT82C693 PCIVT82C691 PCIVT82C686 ISAVT8605 PCIVT8601 PCIVT82C598 PCIVT82C597 PCIVT82C596A ISAVT82C595 PCIVT82C586 ISAVT82C585 ISAVT82C576 3VVT82C571 IDEVT82C561VT82C505VT8501VT8371 HostVT8363 HostV96DPC i960 (Dual) PCIV960PBC i960 PCIV292PBC AMD290x0 PCIV961PBC i960 PCI3CP5610US201UM8891NUM8886NUM9017FUM8891AUM8886AUM8886F ISAUM8881F HostUM8886UM8710UM8886BFUM886AUM82C891UM8881 HB4 486 PCIUM8673F EIDEUM82C886 ISAUM82C881 486ET6300ET6000/ET6100ET4000w32p rev DET4000w32p rev CET4000w32p rev BET4000w32p rev APyramid3D TR25202HPT374 IDEHPT371 IDEHPT302 IDEHPT372A IDEHPT36x/37x IDEHPT343/345 IDECyberBlade XPBlade 3D3DImage 98503DImage 9750TGUI 9682TGUI 9680TGUI 9660CYBER 9525TGUI 9440TGUI 9420CYBER 9397DVDCYBER 9397TGUI 9388TGUI 9360TGUI 9350TGUI 9320CyberBlade XP/Ai1CyberBlade Ai1 AGPCyberBlade Ai1CyberBlade i1 AGPCyberBlade i1CyberBlade i7 AGPCyberBlade i74DWAVE NX4DWAVE DXMem2Mem1Virtual NorthbridgeSD ControllerFast Infrared Type OToPIC100 CardBusToPIC97 CardBusToPIC95B CardBusToPIC95 CardBus-PCIR4x00 PCITC35856F ATM (Meteor)R4x005634PCV SurfRiderPCI interfacePCI2040 DSPPCI1515 CardBusPCI1530 CardBusPCI1510 CardBusPCI1520 CardBusPCI1620 CardBusPCI1421 CardBusPCI1451 CardBusPCI1420 CardBusPCI1410 CardBusPCI7[46]10 CardBus (Memory stick mode)PCI7[46]10 CardBus (SD/MMC mode)PCI7610 CardBus (Smart Card mode)PCI7410 CardBusPCI7610 CardBusPCI7510 CardBusPCI4520 CardBusPCI4510 CardBusPCI4451 CardBusPCI4410 CardBusPCI4450 CardBusPCI2031 PCI-PCIPCI2030 PCI-PCIPCI1251B CardBusPCI1211 CardBusPCI1251 CardBusPCI1225 CardBusPCI1450 CardBusPCI1210 CardBusPCI1221 CardBusPCI1220 CardBusPCI1250 CardBusPCI1131 CardBusPCI1031 PCMCIAPCI1130 CardBusDWL-520+PCI7(4-6)10 FireWirePCI4520 FireWirePCI4510 FireWirePCI4451 FireWireTSB43AB21 FireWireTSB43AB23 FireWireTSB43AB22 FireWireTSB43AA22 FireWireTSB12LV26 FireWireTSB12LV23 FireWirePCI4410 FireWirePCI4450 FireWireTSB12LV22 FireWireTSB12LV21 FireWire3DLabs Permedia 23DLabs PermediaTLANTerratec TValue RadioTerratec TValueTerratec TV+DC-3x5UDC-690CDC-290(M)Tamarack TC9021 GigE (alt ID)Tamarack TC9021 GigE82C565 ISA82C10582C10382C101Spectrum24 LA41X34S2PSurecom NE-344018A40XXST2021ST201Cassini EtherUltraSPARC IIe PCIUltraSPARC IIi PCImicroSPARC IIep PCIPsycho PCICrypto 1KCrypto 5821Simba PCI-PCIGEMFireWireERI EtherPCIO Ebus2 (US III)HMEPCIO Ebus2Velocity128Memory Stick SlotCXD3222 FireWireCXD1947A FireWireSZB6120FPGA I-Bus Tracer for MBDTulip, power, switch extenderPirahna 2-port910Lynx3DLynxE+LynxELynx3DMLynxEM+LynxEM83C170 (EPIC/100)FDC 37C922FDC 37C6657018 Audio7016 10/100BaseTX7013 Modem7012 AC977007 FireWire7002 USB5597/5598 USB6330 VGA6326 VGA650 VGA530 VGA63006205620455985597 Host55965591 PCI558255815571 PCI5513 EIDE55125511963 PCI962 PCI961 PCI900 10/100BaseTX755 PCI752 PCI751 PCI750 PCI748 PCI746 PCI745 PCI741 PCI740 PCI735 PCI733 PCI730 PCI658 PCI655 PCI652 PCI651 PCI650 PCI648 PCI646 PCI645 PCI640 PCI635 PCI633 PCI630 PCI620 PCI85C601 EIDE550 PCI540 PCI530 PCISiS59685C49685C501300/305/630 VGA62155597/5598 VGA85C503 ISA5595 System85C503 System86C20586C202 VGA86C201 AGPDVDmagic-PRO64GXSTG 1764XKyro-IISTG 1764STG 2000XTigonSK-9D21SK-9821 v2.0984x GESafeXcelSonicVibesProSavage DDRTwister-KTwisterSuperSavageSavage/IXSavage/IX-MVSavage/MXSavage/MX-MVViRGE MXPViRGE MXSavage 4Savage 3DMSavage 3DTrio3 DX2ViRGE GX2ViRGE DX/GXTrio3D AGPPlatoTrio64V2/DX86C968-386C968-286C968-186C968-086C964-386C964-286C964-186C964-086C864-386C864-286C864-186C864-086C928ViRGE VX868Trio64UV+Aurora64V+Trio32/64Trio32ViRGERS56/SP-PCI11P1 Modem5C552 Firewire5C551 Firewire5C521 Firewire5C478 CardBus5C477 CardBus5C476 CardBus5C475 CardBus5C466 CardBus5C465 CardBus816981298029RT2460A85808500ISP2300ISP2200ISP2100ISP10160ISP12160ISP1280ISP1240ISP1080ISP1022ISP1020PDC20621PDC20620PDC20619PDC20618PDC20617PDC20379PDC20378PDC20377PDC20376PDC20375PDC20371PDC20319PDC20318PDC20277PDC20276PDC20275PDC20271PDC20269PDC20268RPDC20268PDC20267PDC20265PDC20263PDC20262PDC20246DC5030I/O 9080I/O 9050ES1849PCC-ISESPT86C523_2PC87550PT86C523PT86C521PT80C826PCI/ISACSB6 LPCCSB5 PCICSB6 USBOSB4/CSB5 USBCSB6 IDECSB5 IDEOSB4 IDECSB6 PCICSB5 SouthBridgeROSB4 SouthBridgeCIOB-ECIOBX2CMIC_SL HostCNB20-HECMIC_LE HostCMIC_HE HostCIOB30CNB20LE HostCNB20HE HostPCIHB7I/O BridgePCIHB5HSP MicroModem 56RZ1000PMC/GNIC2Exsys EX-41098VScom 011HVScom 800HVScom 400H/800HVScom 200HV2VScom 200HVScom 100HVScom x10HVScom 800LVScom 400LVScom 210LVScom 200LVScom 110LVScom 100LVScom 010LRM861HA82C82282C70182C70082C621 IDE82D568 IDE82C568 IDE82C558 ISA82C557 Host82C092GOC2326OC2325OC2183OTI107GeForce FX Go 5200GeForce FX 5200GeForce4 Ti 4200 GoGeForce FX 5600Quadro4 700 XGLQuadro4 750 XGLQuadro4 900 XGLGeForce4 Ti 4200GeForce4 Ti 4400GeForce4 Ti 4600Quadro DCCGeForce3 Ti 500GeForce3 Ti 200GeForce3GeForce4 MX - nForce GPUnForce2nForce2 AGPnForce2 PCInForce USBnForce IDEnForce PCI-PCInForce AGPnForce SMBusnForce ISAnForce AC-97 AudionForce 220/420nForce 420 DDRnForce PCI HostGeForce2 Crush11Quadro4 380 XGLQuadro4 NVSQuadro4 580 XGLGeForce 4 MX 420 AGP 8xGeForce4 MX 440SE AGP 8xGeForce4 MX 440 AGP 8xQuadro4 GoGLQuadro4 550XGLQuadro4 200/400NVSGeForce4 440 Go 64MQuadro4 500XGLGeForce4 420 Go 32MGeForce4 420 GoGeForce4 440 GoGeForce4 MX 420GeForce4 MX 440GeForce4 MX 460Quadro2 ProGeForce2 UltraGeForce2 TiGeForce2 GTSQuadro2 MXRGeForce2 GoGeForce2 MX 100GeForce2 MXQuadroGeForce256 DDRGeForce256nForce3 AC-97 AudionForce3 USB2nForce3 USBnForce3 LANnForce3 IDEnForce3 SMBusnForce3 PCI-PCInForce3 PCI HostnForce3 ISAAladdin TNT2nForce2 FireWirenForce2 PCI-PCInForce2 AudionForce2 AC-97 AudionForce2 USB2nForce2 USBnForce2 LANnForce2 IDEnForce2 SMBusnForce2 ISAVantaRiva TNT2 UltraRiva TNT2Riva TNTDAC64NV1Imagine-128 T2R4Imagine-128 T2RImagine-128 IIImagine-128E-mobility WirelessBS21 10/100NDR4600 PCINX82C501 PCIPacket Engines G-NICFC919FC929FC909AFC90953c875J53c103053c1010-6653c1010-3353c895A53c151053c87553c88553c89553c89653c1510D53c86053c810AP53c81553c82553c82053c810Universe VMENetVin 5000NSP2KHSP56 AMRCMI8738B AudioCMI8738/C3DX AudioCMI8338B AudioCMI8338A Audio4S2S1PGA620TGA620MA301MagicMedia 256ZXMagicMedia 256AVMagicMedia 256XL+MagicMedia 256AV+Magicgraph NM2360Magicgraph NM2200Magicgraph NM2160Magicgraph 128ZVMagicgraph 128VMagicgraph NM2070Versa Va26D MaestroVersa MaestroUSB 2.0I/OPowerVR PCX2NS87410SC1100 X-BusSC1100 SMI/ACPISC1100 ISASCx200 X-BUSSCx200 VIDEOSCx200 AUDIOSCx200 IDESCx200 SMISCx200 ISADP83820 1/10/100/1000DP83815 10/10087560 Legacy I/OPC87415 IDEDP83810 10/100NCP130 Rev A2NCP130MV1000MTD891 10/100/1000MTD803 10/100MTD800 10/100eXtremeRAIDAcceleRAIDDAC960P V5 RAIDDAC960P V4 RAIDDAC960P V3 RAIDDAC960P V2 RAIDDMA4 serialC168HCP-104ULC104HCP-114Raven PCISM56MPC106 PCIMPC105 PCIGUI AccelMGA Marvel G200 SDMGA Millennium G200 SGMGA Mystique G200 SDMGA Produktiva G100 SDMGA Millennium G200 SDMGA G550 AGPMGA G400 Twin HeadMGA 1064SGMGA G100 AGPMGA G100 PCIMGA ImpressionMGA G400/G450 AGPMGA G200 AGPMGA G200 PCIMGA Millennium II 2164WA-B AGPMGA Millennium II 2164WMGA 1064SG 220MHzMGA Millenium 2064W (Storm)MGA PX2085 (Atlas)Belkin F5D5005SKv2i740 PCICollage 155 ATMCollage 25 ATM16/4 CardBus Mk2Smart 100/16/4 PCI RingnodeSmart 100/16/4 PCI-HS RingnodePresto PCI16/4 CardbusSmart 16/4 PCI Ringnode Mk1Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk2Smart 16/4 PCI RingnodeMX86250PMAC 98727PMAC 98715LS242 DVD DecoderFW322 1394USB QuadraBusUSB 2-portVenus ModemLTMODEMK56flex DSVD LTMODEMPNIC-IIPNICEG1064EG1032LXT1001Leadtek WinFast TV 2000S3 805Dual Parallel BDual ParallelParallelQuad SerialSerialDual SerialAppian LiteDS1SSIDS3HSSIKTIIT8330GIT8212FADSP 2141ITT3204 MPEG DecoderAGX016AEONPRISM2.55526 FibreChannelPowerstorm 4D50TS21154AE/BE PCI-PCIS21152BB PCI-PCIRCU31L I2O RAIDRCU31 I2O RAIDRCUxx I2O RAIDRCU21 I2O RAIDI2O RAID PCI-PCI82802AC Firmware Hub 8Mbit82802AB Firmware Hub 4Mbit82454NX PXB82451NX Mem & IO82450KX/GX Memory82450KX/GX82740 AGP82443GX82440BX AGP82440MX Power Mgmt82440MX USB82440MX IDE82440MX ISA82440MX Modem82440MX AC9782440MX Host82443BX82443BX AGP82443LX AGP82810E Graphics82810E82810-DC100 Graphics82810-DC10082810 Graphics8281082371AB Power Mgmt82371AB USB82371AB IDE82371AB PIIX4 ISA82439TX System82437VX82371SB USB82371SB IDE82371SB ISAPRO 100 Serveri960 RD PCI-PCIE7710 WMCHE7710 MCH PCIE Port C1E7710 MCH PCIE Port C0E7710 MCH PCIE Port B1E7710 MCH PCIE Port B0E7710 MCH PCIE Port A1E7710 MCH PCIE Port A0E7710 MCH DMAE7710 MCH ERRE7710 SMCHRCU32 I2O RAID82855PE AGP82855PE Hub82852GM Configuration82852GM Memory82852GM AGP82852GM Hub-PCI82830MP CPU-I/O-282830MP Integrated Video82830MP CPU-AGP82830MP CPU-I/O-131244 SATA6300ESB PCIX6300ESB APIC6300ESB WDT5300ESB USB6300ESB USB6300ESB SMBus6300ESB SATA6300ESB IDE6300ESB LPC82875P PCI-CSA82875P AGP82875P Host82865G/PE/P CPU-I/0-282865G/PE/P CPU-CSA82865G Video82865G/PE/P CPU-AGP82865G/PE/P CPU-I/0-182845G/GL Video82845G/GL/GV/GE/PE AGP82845G/GL82860 PCI-PCI82852/82855 CPU-I/O-382852/82855 CPU-I/O-282852/82855 AGP82852/82855 CPU-I/O-182850/82860 AGP82860 HostE7500 MCH HI_D vppb 2E7500 MCH HI_D vppb 1E7500 MCH HI_C vppb 2E7500 MCH HI_C vppb 1E7500 MCH HI_B vppb 2E7500 MCH HI_B vppb 1E7500 DRAME7500 MCH Host82850 Host82820 AGP82820 MCH82801ER SATA82801EB/ER IDE82801EB/ER Modem82801EB/ER AC9782801EB/ER SMBus82801EB/ER USB82801EB SATA82801EB/ER LPC82801DBM LPC82801DB IDE82801DBM IDE82801DB Modem82801DB AC9782801DB SMBus82801DB USB82801DB LPC82801CAM LPC82801CA IDE82801CAM IDE82801CA/CAM Modem82801CA/CAM AC9782801CA/CAM SMBus82801CA/CAM USB82801CA LPC82801E LAN82801BA AGP82801BAM LPC82801BA IDE82801BAM IDE8256282801BAM Hub-to-PCI82801BA Modem82801BA AC9782801BA USB282801BA SMBus82801BA USB82801BA LPC82801AB Hub-to-PCI82801AB Modem82801AB AC9782801AB SMBus82801AB USB82801AB IDE82801AB LPC82801AA Hub-to-PCI82801AA Modem82801AA AC9782801AA SMBus82801AA USB82801AA IDE82801AA LPC82845 AGP82845 Host82840 PCI82840 AGP82840 Host80960RP ATUP64H2 Hot PlugP64H2 IOxAPIC82870P2 P64H2 PCI-PCI82806AA PCI6482439HX82380FB Mobile PCI-PCI82380AB Mobile ISA82441FX82437 PCI/Cache/DRAM82371 ISA and IDE82371FB IDE82371FB ISA82437FX82557EE Pro 100 SmartEE Pro 100EE Pro 10 PCISAA711682092AA IDE82559ER82806AA PCI64 APIC82815 Graphics82815 AGP82815 HubPRO/1000GTPRO/1000MB DP (82546EB)PRO/1000MT Mobile (82541EI)PRO/100 MPRO/XGBPRO/2100 3B82562EH HomePNAPRO/100 VMPRO/100 VE82559PRO/100PRO/1000MB (82545GM)PRO/1000MF (82545GM)PRO/1000MT (82545GM)PRO/1000MT Mobile (82540EP)PRO/1000MF QP (82546EB)PRO/1000CT Mobile (82547EI)PRO/1000CT (82547EI)PRO/1000MT Mobile (82541EP)PRO/1000MT (82540EP)PRO/1000MT Mobile (82540EM)PRO/1000MT (82541EI)PRO/1000MF DP (82546EB)PRO/1000MF (82545EM)PRO/1000MT DP (82546EB)PRO/1000MT (82545EM)PRO/1000MT (82540EM)PRO/1000XT (82544GC)PRO/1000T (82544GC)PRO/1000XF (82544EI)PRO/1000XT (82544EI)PRO/1000T (82543GC)PRO/1000F (82543GC)PRO/1000 (82542)i960 RN PCI-PCIi960 RM PCI-PCIi960 RP PCI-PCIGDT RAID82434LX/NX PCI/Cache/DRAM82426EX ISA82378IB ISA82424ZX Cache/DRAM82375EB EISAIOP331 Channel 1IOP331 Channel 0PCIE-PCIX Bridge Hub BPCIE-PCIX Bridge Hub A80312 I/O CompanionEES ISA211458849INIC-950INIC-941INIC-940INIC-1060 (A100U2W)INIC-850 (A100UW)WDT 50x Watchdog Timer77201/77211 ATM (NICStAR)PCIX-PCIXFireGL2i82557B 10/100OlympicMiami/PCIServeRAID82351 PCI-PCI82G2675GXT-150PAuto LANStreamerCPUISA w/PnPCPU - Alta MPCPU - Alta LiteMCAEIDEHost7955/795479568154816580657814/7851/7854795178116500775182557B 10/100 NICNetServer SmartIRQNetRaid-4MTopTools Communications PortVisualize FXeDiva Serial MultiportJ2585BJ2585ATach XL2 FibreChannelTach TL FibreChannelVisualize FX2Visualize FX4Visualize FX6Visualize EGWinTVPR103GL24110P02GL24110PTMC-18C30 (36C70)801 SoundATM PCA-200eATM PCA-200WL11000PFreedom GBusRoadRunner Gig-ERoadRunner HIPPIES2898 ModemES2838/2839 SuperLink ModemES366H Fax/ModemMaestro 3 Audio AcceleratorES1983 ModemMaestro 3ES1989 ModemES1989Maestro 2ESOLO-1 AudioDriveMaestro IIES366H Fax/Modem (early)CT5880AudioPCIAudioPCI97CB-1410 CardBusEndace Dag4.23GEEndace Dag3.6DLight Pulse 8000Light Pulse FibreChannelQuickStep 1000 ISDNSpeedStream 102325SS-3010 ATM (ASIC)155P-MF1 ATM (ASIC)155P-MF1 ATM (FPGA)IS64PH ISDNDMX3194UPCI-SCIMemory ControlSmartRAID 2005SSmartRAID (I2O)PCI-PCISmartCache/RaidDGE-530TDGE-550T530TX+550TXViper/PCI8139PERC 4/Di VerdePERC 4/Di i960PERC 3/SiPERC 3/DiPERC 2/SiSWXCR RAIDCompaq SMART RAID 42xx21154 PCI-PCI21153 PCI-PCI21152 PCI-PCI21150-BC PCI-PCI21150 PCI-PCI21052 PCI-PCIFarallon PN9000SX21142/3ZLXP-L2 (Pixelvision)DGLPB (OPPO)21041DEFPATGA221140KZPSAZephyr NV-RAM210302104021050 PCI-PCIDM9009DM9102DM9100Cx5530 VideoCx5530 XpressAUDIOCx5530 IDECx5530 SMI/ACPICx5530 SouthGXm ISAGXm PCIIQ80310Cyclom-ZCyclom-Z below 1MCyclom-8YCyclom-8Y below 1MCyclom-4YCyclom-4Y below 1MCyclom-YCyclom-Y below 1MEctiva 1938SoundBlaster Audigy Digital InputPCI Gameport JoystickSoundBlaster Audigy LSSoundBlaster AudigySoundBlaster LiveC-Bus II-PCICY82C693U ISA82C599 VLBHSF 56k HSFiSoftK56 PCI10/10056k WinmodemPMAC 98713RL100-ATX 10/100EthernetNetFlex 3/PBNetFlex 3/PSmart Array 5i/532 rev.2Smart Array 5300 rev.2Netelligent 10 T/2 PCIEmbedded Netelligent 10/100 TXProLiant Netelligent 10/100 TXDP Netelligent 10/100 TXIntegrated NetFlex 3/PNetelligent 10 TNetelligent IDENetelligent 10/100 TXISAPnPSMART2P RAIDUSB OpenHostPCI HotplugNetelligent ASMCSmart Array 6400 EMSmart Array 6400Smart Array 642Smart Array 641Smart Array 5312Smart Array 532Smart Array 5iSmart Array 5300QVision 1280/pQVisionTriflex PCIEX110TXSiI3512 SATASiI3114 SATASiI3112 SATAPCI0680USB0673USB0670PCI0650APCI0649PCI0648PCI0647PCI0646PCI0643PCI0642PCI0640CS4281 CrystalClear AudioCS4280/46xx CrystalClear AudioCS4615CS4610 SoundFusion AudioCL-GD7541CL-GD7543CL-GD7542CL-PD6833 CardBusCL-PD6832 CardBusCL-PD6729CL-GD5465CL-GD5464CL-GD5462CL-GD5480CL-GD5446CL-GD5436CL-GD5434-8CL-GD5434-4CL-GD5430CL-GD7548690306900068554655556555465550655486554564310Cinemaster C 3.0 DVD DecoderNitrox XLGPPCIFlashPointMultiMasterMultiMaster NCBt8474 HDLCBT879 AudioBT878 AudioBT879BT878BT849BT8485823582258215820580558025801BCM4401BCM5901A2BCM5901BCM4401B0BCM4704SBCM5703XBCM5702XBCM5788BCM5782BCM5705M_ALTBCM5705MBCM5705BCM5702FEBCM5704CBCM5703BCM570256015501VME 2706VME 617PRI T1 ISDNBRI ISDNFritz v2.0 ISDNFritz ISDNLP-PCI 4 SerialALS4000ALG2302ALG2301AVG2302AVL2301Vortex AdvantageVortex 2Vortex 1IDE-2015PLMyrinet LANaiS5933 PCI MatchmakerRS200 PCIRS200 AGPRadeon 9200Radeon 9200 2ndMach64 VVMach64 VUMach64 VTRage 128 Pro TRRage 128 Pro TLRage 128 Pro TFRage 128Rage 128 SMRage 128 SLRage 128 SKRage 128 SHRage 128 VRRage 128 RKRage 128 RGRage MagnumRage 128 GLRadeon 8500 QlRadeon VE QZRadeon VE QYRadeon 7500 QWRadeon 8500 QORadeon 8500 QNRadeon 9100 QMRadeon 8500 QLRadeon QGRadeon QFRadeon QEAIW RadeonRage 128 PKRage FuryRage 128 Pro PDRadeon 9500/9700 SecRadeon Mobility M10 NPRadeon 9500/9700Rage 128 Mobility MLRage 128 Mobility MFRadeon Mobility M9 LfRadeon Mobility M6 LZRadeon Mobility M6 LYRadeon Mobility M7 LWMach64 LSRage P/MMach64 LQMach64 LPMach64 LNMobility 1Mach64 LIMach64 LGMobility M3Rage128 LEMach64 LDMach64 LBRadeon 9000 SecRadeon 9000Mach64 GZMach64 GYMach64 GXMach64 GWMach64 GVMach64 GUMach64 GTMach64 GSRage XLMach64 GQMach64 GPMach64 GOMach64 GNMach64 GMMach64 GLMach64 GIMach64 GDRage ProMach64 ETMach64 CXMach64 CTMobility M6Radeon IGP 320MRadeon 8500 BBMach32AX88140A/881412000MI2000MT2000PV1000PVIntrepid USBIntrepidIntrepid ATAUniNorth PCIUniNorth AGPUni-N ATAGMAC EthernetUniNorth FirewirePangea FireWireUni-N2 HostUni-N2 AGPPangea PCIPangea AGPPangea USBPangeaKeylargoGMACUni-N AGPUni-NUni-N EthPaddingtonHeathrowOHareGCBanditAntares GigabitMegaRAID Series 434MegaRAID Series 428MegaRAID8111 AC978111 ACPI8111 SMBus8111 IDEAMD8111 LPC8111 USB8111 PCI-PCI8151 AGP8151 Sys Control8131 PCIX IOAPIC8131 PCIX768 USB768 PCI-PCI768 Modem768 AC97768 Power Mgmt768 IDE768 ISA766 USB OpenHCI766 Power Mgmt766 USB766 IDE766 ISA756 USB Host756 Power Mgmt756 IDE756 ISA755 USB755 Power Mgmt755 IDE755 ISA761 PCI-PCI761 PCI762 PCI-PCI762 PCI751 PCI-PCI751 SystemElanSC520 PCI79C974 PCnet-PCI53c974 PCscsi-PCI79c978 PChome-PCI79c970 PCnet-PCIAMD64 Misc CfgAMD64 DRAM CfgAMD64 Address MapAMD64 HyperTransportAC9100AC1001AC1000BCM5701BCM5700Acenic CopperAcenicAT24AT22Endace Dag4.23Endace Dag4.22GEEndace Dag3.5Waikato Dag3.2ASP-3940U3WASP-3940U2WABP-940UWABP-930/40UA1200B1200AAHA-39320DB U320AHA-39320D U320AHA-39320A U320AHA-39320B U320AHA-39320 U320AIC-7902B U320AIC-7902 U320AHA-29320B U320AHA-29320 U320AIC-7901A U320AHA-29320LP U320AHA-29320A U320AIC-7901 U320Dell PERC 2/QCAAC-3642AAC-364ASR-2120SASR-2200SAAC-2622AIC-7899 U160AIC-7899FAIC-7899DAIC-7899BAHA-3960D U160AIC-7896/7 U2AHA-3950U2D U2AHA-3950U2B U2AHA-19160B U160AHA-29160 U160AIC-7892 U160AIC-7890/1 U2AAA-131U2 U2AHA-2930U2 U2AHA-2940U2 U2AIC-7895AIC-6915AHA-2940UWProAHA-2944UAHA-398XUAHA-3940UAHA-2940UAIC-7880AHA-2944AHA-3985AHA-3940AHA-2940AIC-7870AHA-2940AUAIC-7860AIC-5905 ATMAIC-5900 ATMAIC-7855AIC-7850AHA-2930CUAHA-2940AU/CNAIC-7810ADM8211 WLANAN985AN983AL981M7101 Power MgmtM5451 AudioM5243 AGP/PCI-PCIM5247 AGP/PCI-PCIM5237 USBM5229 UDMA IDEM5219 UDMA IDEM4803M3309 MPEG AcceleratorM1647 PCIM1621 PCIM1541 PCIM1543 ISAM1535 PCIM1533 ISAM1531 PCIM1523 ISAM1523 PCIM1489 PCIM1461 PCIM1451 PCIM1449 ISAM1445 VL-PCIM1435 VL-PCIRhineIIrtl8139EN1217EN2242MPX 5030/5038AEC6715UWAEC6710DAEC6712SAEC6712UAEC6712UWAEC6710ATP865-RATP865-AATP860-AATP860ATP850U/UF2051 ISA2051 PCIACCM 2188 VL-PCIMPI-350 WirelessPC4500 WirelessPCI35x WLANPC4800 WirelessEscalade IDE RAIDPermedia 3Oxygen GVX1Permedia 2500MXPermediaDelta500TX300SXVoodoo5Voodoo3BansheeVoodoo2Voodoo3c990BSVR3cr990SVR973cr990SVR953cr990-FX3c990b-TX-M3cr990-TX-973cr990-TX-953cr990-TX3cr9903c980C 100Base-TX3c980 100Base-TX3cSOHO 100B-TX3c920B-EMB-WNM3c9201 100Base-TX3c905C 100Base-TX3c905B 100Base-FX3c905B 10/100Mbps-Combo3c905B 100Base-T43c905B 100Base-TX3c905 100Base-T43c905 100Base-TX3c900B 10Mbps-FL3c900B 10Mbps-TPC3c900B 10Mbps-Combo3c900B 10Mbps3c900 10Mbps-Combo3c900 10Base-T3crwe777a AirConnect3cSOHO-TX3c556B 100Base-TX3c556 100Base-TX3CRSHPW796 802.11b3c555 100Base-TX3c595 10Mbps-MII3c595 100Base-T43c595 100Base-TX3c590 10Mbps3c4503c3593c3393c940V.90 Modem3c9963c985OZ69[17]2 CardBusOZ6933 CardBusOZ6922 CardBusOZ68[17]2 CardBusOZ6836/OZ6860 CardBusOZ6832 CardBus=`G2pGG2u>G27G2)G2%G2G2G2G2 G2 F2F2F2F2F2F2F2"F2#F2%F2(F2)F2+F2,F2/yF23uF26gF29cF2<SF2BEF2C=F2D9F2E4F2H/F2J#F2KF2LF2MF2NE2PE2WE2ZE2]E2`E2aE2fE2iE2kE2sE2tE2wE2xE2}vE2~kE2ЀWE2ЊRE2ЍKE2ЎGE2БB25B2$B2B2?A2DA2[A2]A2`A2lA2oA2tA2yA2zA2ЂA2Ѓ|A2ЅsA2ЇjA2ВQA2ЮJA2й>A2+A2$A2A2A2A2@2J@2M@2v@2Ѕ@2Г@2Д@2У@2@2@2@2@2 @2@2=v@2Op@2af@2@2й^@2X@2O@2F@2=@242/@2@2$@2;@2b?2В?2Ы?2Э?2?28?2`?2Ы?2Ю?2>A27?2 ?2;?2Tt?2}m?2e?2^?2D2W?2Ј3R?2==J?2@G23@B?2OI'?2J ?2FP?23S?2tc ?2І?2JE2. 2>2>2>2>2Y>2>2>2>2INVALID VENDOR IDARC LogicEndaceTigerJet NetworkNetMosAtronicsAdaptecIntelc't MagazinS3GemtekNetVinIndustrial Computer SourceAddtron3D LabsHintTekramRalinkLanergyCaviumAntares MicrosystemsAltimaNetoctaveLinksysSafeNetGlobal SunNetSecEumitcomNational Datacomm CorpVMwareBluesteel NetworksSybaSymbolTerraTec Electronic GmbhENETopic/SmartLinkMyson CenturyConexantBroadcomInvertexAvlabAironetAvermediaAskeyTamarack MicroelectronicsOxfordSunixLavaC-Media ElectronicsSundance3wareHifnLevel 1MoxaNetgearLAN Media CorpPCTELDTC TechSIIGForte MediaPacket EnginesADMtekAurealNVidia/SGS-ThomsonUS RoboticsAlteonTriTech MicroelectronicsLuxSonorPlatformITExpressDavicomRockwellTransmetaEnsoniqSilicon MotionNortel NetworksIntersilESSASIXAVMC-CubeAdvanced Telecommunications Modules3DFX InteractiveO2 MicroEssential CommunicationsCycladesCompexPijnenburgZoranIREMesa Ridge (MAGMA)DolphinAT&T/LucentPinnacle SystemsV3 SemiconductorLite-OnMarvellOmega MicroZeinetAcardCorrollaryD-Link SystemsRicohServerWorksXircomMutechSchneider & KochAlliance SemiconductorCycloneZiatechFORE SystemsIDTEfficent NetworksVortexAcctonSiemensCogent DataVIASigma DesignsHighPointCreative LabsInitioNKKRealtekApplied Micro CircuitsNewbridgeTekram (1st ID)Integrated Micro SolutionsEmulexNvidiaEvans & SutherlandMacronixMolexAdvansysMentor ARCNeomagicSurecomMitsubishi ElectronicsAcer LabsSMC3ComMadge NetworksPLXSTB SystemsSymphony LabsACC MicroelectronicsSilicon GraphicsBrooktreeQuantum DesignsCMD TechnologyDiamond MultimediaIntergraphSunOlicomBit3Contaq MicrosystemsInterphaseLeadTek ResearchCyrixQLogicNexGen MicrosystemsYamahaAppleMylexPicopowerI. T. T.UMCNumber 9PromiseMotorolaWinbondOak TechnologySonyTexas InstrumentsBusLogicSGS ThomsonElsaOptiDPTAsustekPC TechnologyHewlett-PackardSISFuture DomainNECToshibaChips and TechnologiesMatroxSiemens Nixdorf AGDellAcerTridentAMDAMIWestern DigitalIBMCirrus LogicDECWeitekTseng LabsNSAvance LogicVLSIULSI SystemsATISymbios LogicCompaqDynalinkHauppauge Computer WorksMartin-Mariettaunknown %svendor 0x%04x product 0x%04x"%s %s"vendor "%s", unknown product 0x%x (unknown class 0x%02x, subclass 0x%02xclass %s unknown subclass 0x%02xclass %s subclass %s, rev 0x%02x) rev 0x%02x cy82c693_initcy82c693_init: bus_space_map failed (%d)cy82c693_readcy82c693_writeFEATURES = 0x%x, FLAGS = 0x%x, CHIP = 0x%x BUGS =0x%x Attempt to queue invalid SCB tag %x:%x >%s: unable to allocate bus-specific data : unable to map registers %s: Enabling 39Bit Addressing %s: couldn't map interrupt : couldn't establish interrupt at %s ?: %s %s: Using left over BIOS settings , parity checking enabledfastslow%s: External SRAM, %s access%s, %dbytes/SCB %s: PCI error Interrupt at seqaddr = 0x%x %s: Data Parity Error Detected during address or write data phase %s: Signal System Error Detected %s: Received a Master Abort %s: Received a Target Abort %s: Signaled a Target Abort %s: Data Parity Error has been reported via PERR# %s: Latched PCIERR interrupt with no status bits set RAID functionality unsupported adapter at unexpected slot %d unable to map to a channel PCI 33 or 66MhzPCI-X 50-66MhzPCI-X 67-100MhzPCI-X 101-133MhzPCI bus mode unknown%s: unable to allocate bus-specific data %s: cannot malloc seep_config! %s: warning: can't find PCI-X capability %s: unknown memory type: 0x%x %s: unable to map registers %s: Enabling 39Bit Addressing %s: couldn't map interrupt %s: couldn't establish interrupt at %s : %s %s: Reading VPD from SEEPROM...successfulfailed%s: VPD parsing %s %s: Reading SEEPROM...Unable to read SEEPROM checksum error done. %s: No SEEPROM available. onoff%s: STPWLEVEL is %s %s: Manual Primary Termination %s: Primary Auto-Term Sensing failed! Using Defaults. %s: Manual Secondary Termination %s: Secondary Auto-Term Sensing failed! Using Defaults. %s: Unable to set termination settings! EnDis%s: Primary High byte termination %sabled %s: Primary Low byte termination %sabled %s: Secondary High byte termination %sabled %s: Secondary Low byte termination %sabled CMCOVLYDFF1DFF0TARGMSINONESG%s: Signaled Target-abort to early terminate a split in %s %s: Split completion byte count error in %s %s: Split completion address error in %s %s: Split completion data bucket in %s %s: Count not complete in %s %s: Receive overrun in %s %s: Received split completion error message in %s %s: Received split response in %s. %s: Address or Write Phase Parity Error Detected in %s. %s: Signal System Error Detected in %s %s: Received a Master Abort in %s %s: Received a Target Abort in %s %s: Split completion address attribute parity error in %s %s: Split completion read data parity error in %s %s: Target initial wait state error in %s %s: Data Parity Error has been reported via PERR# in %s %s: PCI error Interrupt %s: Signaled Target Abort %s: PCI Split Interrupt - PCI-X status = 0x%x %s: Unable to attach to unsupported chip revision %d : can't map i/o space can't map interrupt can't establish interrupt at %s %s: readcfg failed - see dpt(4)  %s: unable to map device registers adv_pci_attach: adv_init failed %s: couldn't map interrupt %s: couldn't establish interrupt at %s : %s AscIsrQDone: Corrupted SG list encounteredAscIsrQDone: Attempting to free more queues than are activeAscIsrQDone: completed scsiq with unknown statusAscExeScsiQueue: Queue with QC_SG_HEAD set but %d segs.AscExeScsiQueue: Queue with too many segs.QUANTUM XP343011071HP TANDBERG TDC 36WANGTEK NEC CD-ROM DRIVE YAMAHACDR400 #$sH6s#6@6 PH#6`OH#6`bF M#asM΁3swO 33i`J`c,c<3 #hM #h##acj3 Nv3 6-3PNPDF##Ɓ#a Jac6-3#hW`愀#愀sKa O#AObHFV#s)Bg#sw2|<LزjNgc-xfjn3|P`P##< #%aOo##$+fj 3cCM #a15l8?#a31 5 9=~-   x33|`B~`)1`C~"X<\"3%|>`> 3B~#:nl8?B~B؃|3/B؃|ă3&8+26##k#c 3|`  k#c-<4830| ` 3 #b cZ3cd# v3 3B##"#"(#"#"B#JaE#3 bG# 3 bC##D#sM3'##&KOO"va F$Hڀ#4#Ja@#AK`#I0I`w#]b#c3-c#Ja#APb#Ac̆_+gcz|#hH##c|#cJa6#Ac37 #c`c#|ocKARaN#Ac3 b#Acg#cc#|gc3@ bcc|+@c|@cC|g@c|#c3*c +3)Ccކ3 bڀc|{c3, .c,|3=gc D|#acrqpcrppqrqppcrppqrqppc##3H#HCڇ#c nCvwc nCvwc#tC@Dt$&$scuZF&JudNsc{cv3>gcc8+8+2 1 c26:>c26:>c8+@2@6@:@>cZ @]cs #ss#f ##bswhA###BT+#%' %s: unknown model: %d %s: unable to map device registers %s: adw_init failed %s: couldn't map interrupt %s: couldn't establish interrupt at %s : %s @?@DDDDDD?DD%@UUUUUU?UU'$$Ф$$$$Ф$$$$Ф$$Ф$Ф$Ф$H( U 8TW > 2 @W<ln>W>"JTX0K 2>$<hjprtvxb ,.LUP(6G& I_CP P(b?(ZfCHlWH=iG&rI߉ MhC? ?rpn%2 \d"  .2a8 nfL:U_K2  oE2b,f{%2 2\"C,w TU Jj5 t7 c'ġ@ JO5@XPPDQQ RS @PP 9:J j*, TU OXDƐ VW RS@ 9: 8N J5*NeH\2*sݸtz"Caa E  h.$ aEa R, $ +vmmp^+35Z|ZtmgD ;'tgm  ! j fXD.c'@YYwT1U {|TUc'X8NyVhW8N# { |yVhW y9h: 5R1SXXYYm  5:U_/  91:w XXm#G  lAz3Dl9: QQ4t vZ z3B < "Z $Z  La;*Ne 2*sݸ""*e, %2H Թ"Cp}"0.ؼ}"0.ֱEBZxI8  DK TK(! @]>( 2Y-o)DK > > 4F> C J 5Y-og Y<*  > \aX P\ b J5 _\GA$pk(!_ABY) 717T<>E4<GKuWQV8 BDHF  @GAX IT* * Q>E4BHLMT!$ x,F v 2p< Gx,FB/-4 B6EH̰=u \o~ElDXt@v'*}0.H V0>#J"3+C+b 2~)+/y9h:w jr8NX&{1|w TU# { |$isX8NUU8NV1W@VV VW8NR1SVV RS jX@T1U,PPV1WDPPR1SPP91:@PP\$[+D0.!D/![n=D  y9h: U4U9: QQ[A[+%20.KK ;D%20.!D0. I`(I4EKE>x=nKE/(?(4^[]P P^+&\\%2D0.!DBXJ DJ /[? ?^+&\\e&r#r%^+lWH0V\lWH=0V\lWHlWH X P ?TH}}}|c' RSVWbJZtBH_`0.0. Y(I#bKd;xxUUb0,Vb d d(b` MNCV`lC"=MiiM`#M߉VX` & &&rI&&&I&rJ`DI;r^'/ Z#CE J5 B  Q EX B Q BI  Qqf`$f,/!qdXfX<0EH̰=u o~@$$  Yv'< J5-o8yhHU4Us  @IDsu BE Q @suNd$:E[Nd6N dH,NE hTizZt$ 4Z$&]$, ]$]$M 3}%e\e2-H U8T W ><2| @W>lntvT>W>zJUFv6kF2@G+ 8W$L[ 'xV4!, ֙ B,= ]M 8(AHIJFTGZCHDLEP + p+Y9X p pX,+=#Z09H" 5i OC JTX7/B+ FfsAX Tk+,O*WCwW'K @&ZHhe,H!" Fx'4K $p(m6{j,gWwWHt F Qdy*p(m6{jǁȃ$'@<;WN- - $31LDLQDHoLTkOy*HGb*2R oLTkHG@20M 6{d $-@\6+B[FYWwW1[  |Sl(1ZS V(Ng'H4H'V&!SJvIp%!%"%X H'&SM%9'"AM 6{d $(\(6A& SPK\ \(bE(Z vCHqWRCnA&S YxKE Evt'4 lt$ .     Bh80     lXPUzB  oE2iml'T4 Bl$K,V `aTZ7" 9 j*H@T[7@bPPDQQ ^_ @PP =>JZ*, `a[bDƐ ?@ ^_@ => . AYR z$ :ITWI}cXXJ:I;cYYWIWcJZf"bD.j*@YYV`)a W`}aj*b.<:?;@.<6!  :?;@:=;>7^)_XXWI}c 7P2  =)>V XXJ!A lA~6DlW=}> QQ5t ve ~6B < "e $e  XhM,N'  4,w$$,' 4< $Ktǁȃ$31ǁȃ'f $31߼NBe|I,  DU TU(# FfD( &d/s+DU D D 4FD CT 7d/s dB. D \hXPP V T7 P.oA$tp(#PABd+ 919HBDE5BGKuW]V8 HDHO FAAX IT. ]DE5BG+" !Y"/A9/Y8):Vif O4JH i~9.8 `: bC %//!"Y"~q$9sW][W]W!WxX" <0 VZr.<"b&)Vv `a!  %nwb.<UU.<?)@@VV ?@.<^)_VV ^_Z"b@`)a,PP?)@DPP^)_PP=)>@PP%r- L31#L2#rCL :=;> U5UW=}> QQrAr- 431UU ML 431#L 31 IQ(S5EUND|CKE2(E(5gr]\ \g- & 4L31#LBXJ LJ2rE Eg- &'&vH !v{g- qWR0V\qWRC0V\qWRqWR X \ ETR}}}|j* ^_W?}@JZ BHPQ 31 31 Y(S!iUkM|0xUUi0mVi d d(i` YzBCVTqC@\CMnznMz̈Q!MVXQ  &  & &vI  & & &I &vJ Q"HIMvg'H'.2 R!K"NT7 H  ] EX H ] HLI L ]ul`$l,/#udXfX<0G> ^WWTb Z>@V\ lnUWXJ@>X D LNJ0 <$<hjprtvx| 2nH:UW[ p08DLW@\M] 2346 Ny< h : @PJNTX YH i \  46BD8DD EHFHhTUY1 K"&`zjh  ` 548W$Le 'xV4!7} J} Q7=  gMx(>"HIJFZG`CNDREV "5_ 5G \ \X"7*5= +Z0G"!, 1i",` ,b aJDVQ5 W 6AX T{57`0WCwW'K @*&fTtFp7HF (&! Wlj*2/*<A )$cBpF7}gWwWHu W  wP@0cBpי؜*)/NJ~WT22)'%LDXPDH4LT{`0NHG| (2C h&4LT{NHGT (C @ ( M B)2: B5B[}FYWwWG e   3  8pT8 XP^/*</&8JIq.!.".J H/8M. G' ($> M B)@f8>r 8$OVhAffpUh H.CHbXWR#?NbI>8E AUUo>8CHbE 8$6qxMbI>-N & A! XW*oo2_u/*< )  . v: 0|JxOG -(Hl ( oE2ScN|/~*< l)A$XXx j"k aTD!, w~G,z0?q@ aeD@ njPPDQQh"i@PPK"L TPj"k eN3  nDē: ƐƓy l"mh"i@: “y K"Ld"4 a$D7N/ H<7 B  B   )A$vv ]  t. v]v A, f r  +k#v##[[[[u^2B5ppt#[}xM!0w}[  +  T $!nG DBW W z0@YY@j;k"jkz0 nd4l~mDUUd4j&l~m $@K~L Dh;iXXYY[ $@ DxO: y C n   K;Ln XX[&>3   lAkBDlKL QQk#1v v#]#p B\ > "p $p  Jv$M7N/ * H<7))))72/> *AX IT^: gGF(E1QG5!, & | HU;bU1t8;:S6,`4bSG*8#:b ,V&! yGsW][W]W&Wω JN3  :3 *X0 xOE'%~'% '% '%i '%G8$1xS64?x81OE@Z#?IHbIqHbV@]EZCH-64@-644- 6Fc(ITHE?@V X@>-N !F$]&!~E!HE!DN&xEP  _II_JPtttIttJt It_! L IM_^'/>C "d& A! ] aD Z@   g  ]EX Z g Z~LI L g\|$(*(|,/+d$XfX$0Xz0z0E+G59u&~#6#4` V<BQ Z>AHEH?  L N@$VR  @0Qa(DV8~HU1U!  AH WID Z  g WN{R:E,N{dN {v$cNEhT#Ig H Z.4 Z.& 6.c 6. 6.B*/ *?3 3 3 3 3 3 G G G ,: y : y  : y <: 3 wf2wK@K@BusLogic 9xxC SCSIunknown model!: unable to map I/O space : bha_find failed : couldn't map interrupt : couldn't establish interrupt at %s : %s, %s : can't map controller i/o space : can't map interrupt : can't establish interrupt at %s : %s %s``((`` Dell 466v1Dell 466v2Dell 438(Dell 466v3<HP 438<HP T5/T6<HP T7<HP 466#ELSI 523AMI(Dell<HPLSI: can't map controller pci space : can't map interrupt : can't establish interrupt at %s : %sAMI 428AMI 434%s %xunknown 0x%08x64b/lhc64b/hlc32b %s/%s %s: can't find mapping %s: can't map register window can't map interrupt can't establish interrupt at %s : cannot map DPMEM cannot map memory mapped I/O ports cannot map I/O ports cannot write to DPMEM cannot access DPMEM at 0x%x (shadowed?) DEINIT failed (status 0x%x) unsupported protocol %d initialization error couldn't map interrupt couldn't establish interrupt at %s %s Dell PERC 320/DCDell CERC-SATAAdaptec 2120SAdaptec 21610SAAdaptec 2810SAAdaptec 2610SAAdaptec 2410SAAdaptec 1210SA: %s can't enable bus-master feature memory window not available can't find mem space couldn't map interrupt couldn't establish interrupt at %s %s unknown command statusstale ACLin maintenace modenot mountedjukeboxbad typeserver faulttoo smalloperation not supportedbad cookienot syncbad file handletoo many levels of remote in pathstale file handlequota exceededdirectory not emptyfile name too longoperation would blocktoo many linksreadonly filesystemno space on devicefile too largeinvalid argumentis a directorynot a directoryoperation not supported by devicecross-device linkfile existspermission deniedtoo bigdevice not configuredI/O errornot foundoperation not permittedOKUnknown processorIntel GC80302 IOPUnknown PowerPCUnknown StrongARMPowerPC 603eStrongARM SA110i960RXi960HXi960CXi960JXunknown battery platformno battery supportoptional battery not installedoptional battery presentREQUIRED BATTERY NOT PRESENTrequired battery presentaac%s: cannot create ccb dmamap (%d)%s: can't allocate FIB structure %s: can't map FIB structure %s: RequestAdapterInfo failed %s: RequestAdapterInfo returned wrong data size (%d != %d) %s: %s %dMHz, %dMB, %s (%d) Kernel %d.%d-%d %s: FATAL: selftest failed %s: FATAL: controller kernel panic %s: FATAL: controller not coming ready, status %x %s: can't allocate common structure %s: can't map common structure %s: error establishing init structure %s: error probing container %d%s: container info response wrong size (%d should be %d)%s: out of bounds %u-%u >= %u BO$РO$РO$BO$РO$РO$РO$РO$O$РO$O$РO$РO$РO$РO$РO$РO$РO$BO$РO$РO$РO$РO$РO$РO$РO$BO$BO$РO$РO$hO$РO$РO$РO$РO$РO$РO$BO$РO$РO$O$РO$O$РO$РO$РO$РO$РO$РO$РO$РO$РO$РO$ЁO$uio move not yet supported AdaptecContainer #%02d %s: mode sense page %d not simulated aac_internal_cache_cmd got bad opcode: %d S$РS$РS$аQ$РS$РS$РS$РS$РS$РS$РS$РS$РS$РS$РS$РS$РS$РS$Q$РS$РS$РS$РS$РS$РS$РS$PR$S$РS$РS$РS$РS$РS$РS$РS$РS$РS$0S$%s: ** %.*s%s: unknown command from controller %s: I/O error %d (%s) aac_ccb@_$m_$_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$@_$m_$_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$m_$%s: aac_scsi_cmd: more than %d dma segs error %d loading dma map timed out |g$hh$0h$h$(g$0@/`21@/V22@/E23@/224@/"2@@ 22H@ 22P@ 22Q@ 22X@ 2Է2Smart Array 431Smart Array 4200ESSmart Array 4200RAID LC2Integrated ArraySmart Array 221Smart Array 3100ESSmart Array 3200SMART-2SLSMART-2/PF%s: can't map i/o or memory space : can't map interrupt : can't establish interrupt at %s : %s Compaq %s Polled Mailbox Command (0x%x) Timeoutisp_mboxcmdInterrupting Mailbox Command (0x%x) Timeout%s index %d=> %s %02x%s:0x%08x:%sw ww@wwww!w"w#w#: no mem for sdparam table : can't find i/o space : can't map i/o space : can't find mem space : can't map mem space : unable to map device registers : couldn't map interrupt : couldn't establish interrupt at %s : %s @ISR 0x%x SEMA 0x%xRISC2HOST ISR 0x%xt$t$pt$pt$pt$pt$pt$pt$pt$pt$pt$pt$pt$pt$pt$t$t$t$Wt$pt$ t$0t$@t$cannot malloc xflist arraycannot malloc dma map arraycannot create dma mapsmailbox dma setup failureread towrite from%d byte %s %p in %d segsseg0.[%d]={0x%lx,%lu}Request Queue Overflow++seg%d.[%d]={0x%lx,%lu}%sPCI Status Command/Status=%x 0 !"#$%: mpt_pci_lookup failed : unable to map device registers : unable to map interrupt : unable to establish interrupt at %s ?: %s : unable to allocate DMA memory linking with peer: %s222ڽ2ǽ2д2Р282C168 [10-100Mb/s]21143 [10-100Mb/s]21142 [10-100Mb/s]21140A [10-100Mb/s]21140 [10-100Mb/s]21041 [10Mb/s]21040 [10Mb/s]Ӿ2˾2з2г2Я2Т2К2А2z2p2f2P2Full Duplex 100baseFX100baseFX100baseT4Full Duplex 100baseTX100baseTXAUI/BNCExternal SIAAUIBNCFull Duplex 10baseT10baseTunknown"##$%!%&&(''2u2h2\2P2D282,2reserved #7reserved #6reserved #5reserved #4reserved #3target abortmaster abortparity errorG2/22 22ٿ2̿2link failurereceive watchdog timeoutreceive process stoppedreceive underflowtransmit underflowtransmit jabber timeouttransmit process stopped          %s%d: enabling %s port %s%d: link up $7$Ѕ$!$Ѕ$Ѕ$$И$д$$ܛ$8$t$ $И$д$ \$И$д$\ @@@@@x %s%d(phy%d): error: reset of PHY never completed! S$Ѐ$S$S$$$Ж$$Ж$Ж$$$И$$Д$ $И$$Д$$И$$Д$$И$$Д$ h$И$$Д$$И$д$Д$DEC DE500DE450ZNYX ZX3XX SMC 9332DST 9334BDT 9332BDT 8432Cogent EM100TX EM100FX EM440TX ACCTON EN1207 EN1207TX EN1203 Asante %s%d: can't find phy 0 $$$@$$$X$+X$$$)ܺ$$$$$UUframe too longalignment errorbad crc%s%d: receive: %s: %s 72|12896|256128|512160|1024%s%d: abnormal interrupt: %s%s (switching to store-and-forward mode) (raising TX threshold to %s), %s%d: system error: %s tulip_txput: compress called twice! tulip_txput: different mbuf dequeued!tulip_if_start: txput failed! tulip_if_start_one: txput failed! %s%d: %d system errors: last was %s %s%d: transmission timeout (invalid EESPROM checksum)%s%d: %s%s pass %d.%d%s address %s de: not configured; limit of %d reached or exceeded : not configured; 21040 pass 2.0 required (%d.%d found) de%d: not configured; 21140 pass 1.1 required (%d.%d found) : unable to map device registers : can't read ENET ROM (why=%d) (%02x%s%d: %s%s pass %d.%d address unknown, couldn't map interrupt , couldn't establish interrupt at %s: %s%s: warning: couldn't establish shutdown hook YRYQYPY: can't find i/o space : can't map i/o space :, couldn't map interrupt : couldn't establish interrupt at %s %s : can't find memory space! : can't map CSRs! : couldn't map interrupt : couldn't establish interrupt at %s : %s : initialization failed %s: warning: couldn't establish shutdown hook fpa: can't find I/O base : can't map I/O space : couldn't allocate memory for card : couldn't map memory for card : couldn't create dma map : couldn't load dma map : couldn't map interrupt : couldn't establish interrupt at %s : %s %s%2K} }}}%}2> > >>> > > >>%+2>K}  }}}} } > > > >  >> ! >> >: broken match/attach! : unable to map device registers : couldn't map interrupt ?: %s: couldn't establish interrupt at %s , using %dK of on-board RAM, can't map on-board RAM    &(`& 0&0 0 `"0 0  JtT4$   rq! 2r!qq! 0  S1B1SSA1B1B11qw!! RSQQP@064a28%"8%0%p%q%Йq%$%!$%J$%K$%Њ$%Ћ$%$%$%$%$%$% t (%t (%At (%it (%@\6%C6%F6%H6%I6%Ѐ<%1\D%q,%q,%I10%ГF%UJ% T%Y%)R]%d%d%d%d%d%3Mk%8Mk%0 k%0Mk%hMk%hbk%iMk%ibk%uk%uRk%urk%v3k%%%%% %z%z%z%z%м؅%e؅%T%Іd2"$2T22292 2222f2ZD2 @2X2pciide %s: device disabled %s: couldn't map %s cmd regs %s: couldn't map %s ctl regs %s: couldn't map native-PCI interrupt unknown interrupt%s: using %s for native-PCI interrupt %s: couldn't establish native-PCI interrupt at %s %s: unable to subregion %s ctl regs , unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers), (unsupported maptype 0x%x)%s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s:%d: unable to load xfer DMA map fordrive %d, error=%d %s:%d:%d: bus-master DMA error: status=0x%x %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x channel 0channel 1%s: %s cannot allocate memory for command queue%s: %s disabled (no drives) %s: no compatibility interrupt for use by %s native-PCIcompatibilityconfiguredwired, %s %s to %s: DMA (unsupported), (partial support): no DMAnot responding; disabled or no drives?other hardware responding at addresses%s: %s ignored (%s) %s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers %s: %s ignored (disabled) %s:%d:%d: multi-word DMA disabled due to chip revision : ATA33: ATA66: ATA100: ATA133 %s: bus-master DMA support present222CC @ @%s %s: can't allocate memory for command queue%s: %s %s to %s mode   "2": unexpected PCI function %d , (unable to map ctl registers): cannot allocate memory for command queue , %s %s to native-PCI compatibility 963962755752751750748746745741740735733730658655652651650648645DX645640635633630S630620550540530: %s: 5597/5598`M%`M%`M%аM%аM%N%unknown SiS IDE type %d %s:%d: error intr %s:%d: bogus intr %s: unexpected PCI function %d %s: no known timing values %s:%d: bogus intr (reg 0x%x) ]G4" w! %І%І%А%А%ppb %s: not configured by system firmware pcipci at %s bus %d: can't map mem space : can't map io space : couldn't map interrupt : couldn't establish interrupt at %s : %s3@``l)9: failed to enable i/o ports : can't find i/o space : can't map i/o space : couldn't map interrupt : couldn't establish interrupt at %s : %svr%s: reset never completed! %s: Using force reset command. C0ae01S0 3@ : failed to enable I/O ports : failed to find i/o space : failed map i/o space : couldn't map interrupt : could not establish interrupt at %s : %s address %s %s: can't alloc list %s: can't map dma buffers (%d bytes) %s: can't create dma map %s: can't load dma map %s: rx error (%02x): crc error frame alignment error FIFO overflow received giant packet received runt packet system bus error rx buffer error%s: rx shutdown error! %s: tx shutdown timeout %s: restarting %s: rx packet lost %s: receive error (%04x) no buffers overflow packet lost%s: initialization failed: no memory for rx buffers %s: initialization failed: no memory for tx buffers %s: watchdog timeout 245C@P0L%s: failed to send write command, status: %x %s: failed to send address, status: %x %s: adapter check: %x %s: network status: %x %s: got a dummy interrupt %s: bogus interrupt type %и%%%%% %@%%s: initialization failed: no memory for rx buffers %s: device timeout : failed to enable I/O ports : failed to find i/o space : failed map i/o space : couldn't map interrupt : could not establish interrupt at %s : %s%s: can't alloc list %s: can't map dma buffers (%d bytes) %s: can't create dma map %s: can't load dma map %s: failed to read station address address %s tlTYPHOON @l92- / P!П!|П!tП!lП{!`П``` \\ TT !</ <87?|40ޭި$ @4)m!@V$`L%k(8I7kF`(8 I@#Ak) 1AckiFc9A`bG((IkFacpG(pGpGpG!/!/!/!/@!/!/P!/!// /ဵOd(d 8c C8cIxccG K"kd/ h hIpGkOkB@h cAhKCA`Hk1c x*L !kd) ҹnI!lkB92R!dGxj9kFHb8k8 #rI l dIme x** Hm#@ J!(cdpGHh{` /`* `pG   Q    pG")O{/0;/I   B  pGljG@z8 8 ; 8 8G#h@'* Ji3a hhhW iC`8Gx*#h@'*JhR  Jj3bhh#:Ch. 8Gx*#h@$*Jh  Ji3ahh#:Ch(HF Gx*8ihA8hSC 9hyi@ihB *h C &C GkӸjk@ylC H #iCak1c#3iCaAj1Ab Gx*kA 90{(8S H@#iCak1c#iCaj1b Gx*k ,*90{(%Ѹj9l@#0Ch- L8( ШB KBЀ#iCa`k0`c#[iCaj0b Gx*kal j 2ЂXP0B`j#0ChF?C 8mkl@aj#1C hF 1B Ңj /C 8P)iiz lbl   C    A 8/C G").ЃG%Y1M@@k- $  ;,ѹ@@  B   B  pG 'IBSh##Ch X B 0(Hj Ho B8pG (@@ JFHX? HX HX LX##Ch!B BB pGUUUU: IXF;` XFZ` X2KXBJXKX#;Ch? B Hh1` pGKXF` P  @_-HzV`Ȑ@T,   P!    p      @T g   p_^  @0   $ $< </᠂ @ $ p$ ((,  , ??P/ /  B(  L @  B(  LL@/!00 /! /ဵ8(8v G8 (8h Gh:x$*"2B`D`:{{{C*#[BhCB`"``:{{{C*#AhCA`h1, C .:KB$%BhCE`{{CKB 3D˛@[B 3@C.9}{}C)!)CA`h1`!!`pGBh?hhY9x??/ 2``#CB`xa yKyC C Baz*#BhC* #BhC 3*@#BhC2*р#BhCB`zFvpG xF`KxC`xC`x C`pGHh &Ӹjh@#0Ch #Bxj9kFHb8k8m IFrIJlJdImeG x**Ѐ#ChC h #@C C  @CpG#Ch#@C  @CC#k@")F979{3)2)?kFJe-4-5"XFP2*ӂjFJcjFbz93Z@jFHbH'Bh*h*Bi* a`j) 0q  h*a`iFQea8GI"h+40bhjFbi{K7e7cc3Z3ri+a#ahIj 1Ac0:0B```88j08b8 G @1j-2#2Cjh yyC C 8 &%M4:4* #C+# 2Ch0Ch C0J0xk( #3C1:1` 8( #[C !8h#T0ChF`0G 4kj 53HjKYIB Ch #0Ch8)@ G(%jk@ql2+2:2jQi@3 ^X11Na0(jQi@1 "CR0()J "R`kC !k"R`kC jkJ  IFHb G)T𵍰 J5hb IF`j-4Hj7:79hKYI@#1C h0ChF #@ N(Y(khJ!i  (kyi@1 K33[iFP0( 1V#3ChP0( IBZZBЎH1h(8#Cq8@#CmG0(( ѸhA`(8#C8#C8xh0x`b (_ @ s#0Ch 1C h@ 8 !kK#3ChP1)! hJkF  #3ChnFP1)iF!JZZBXH1hA`(8 #C8#C81)) hJ`)9#C 9#C9)k#8ChF v#0Ch 5H*kFb)O!6Z61r ) I1C h  9#0Ch 1C h@ hJ`)Ѷ#1C h  `jF `  ~3(2(!LF`` (kjFb ( 0r3)2) q8(P G) @x*%HAh1A`$O1$jhFa"hF`"hFa2Z2zJ+ . 63#+@C#+@3ChFڃJkhFځ kFbb93JkFZ#hC`jh#T0ChF`Gx*,1j#E1C h '1J13+ыp2+ыp<8G p琴23'4J4jFp1A1lFOa9##Ch 1d#C h40v0ChCc h  CcpG2-52 7J7jFp4:4hF`a0``i#8ChCc h  Cc0 b0`b (vG7j#4#Ch#3#@k?;C `40##@7A7+< ##6imna3+#vjmb3+3Q3x3+#5+ChFK# 5+Ch{iFK# 5+Ch}i]#63Ch ;#Kˀc I#4#ChF # 4#Ch #0Ch 8j#@ C#@#CC`xj#@ C#@;CCakFckFdPlFHdlFdlFdlFe# GJ32#jF`#a #aQkFQk92Q#hC`Gx*L j( 78qh0)Bj*% ( j(=qh(8y(аG@j()`i(Hh`h(P #h@%((G#Hh@$(8j /88~h8jh9jF`8jF`HAh)h) Ai)9jF`A` 9jF`A`9jhF`9jF`  Lgh/8( `hhF``8 G I60x@-KBV-L8!*#@M)HjX!iC@#Ch %M(0x1z:h {!20x 0y9h@1 "CR0(!J "RxhC 9h"RxhC 9h IJ  1Hq!2QbG @)T @𵃰!XH2Qb!VJF`1Iy)SHhNHGhI4"xPMIjX#XC #1C h5+Ch#+@ EM+$1z:hBJ { x 0y9hA SnnFP0(2iF CZFR0(>+< :!SnnFP1)!xI :hjF!MV[F^S1)"Ij#I5+CnFh#3Chk@Mhs@ej#M1C hjF2ChQ@iQ@Ae xA!p( 8( JPhhFP`88rG) @ @𵂰iKjX#ZCI3x#4#ChCh#63ChCB#C `&6.@#[Btk + 3yFK{Lˀ$ 6#3Chvsa4,$6#3Chvb4,#Kˀ@#C `#kJ 3y3 {#54#ChFc#14#ChF d!#=4#ChFKd#94#ChFd#E4#ChFd#A4#ChF e; hi94,# (#  3zFK{FȀ  4##Ch{a0( 4##Chb0(G); mKF`RmFa`iFahFh HiFi ȀpGJ C`Ɉ Ca񵈰"jhI ''+ТIjX#cC#X9C h  )#CA) #C#C+ДIjX#cC#X9C h  )C)#C#C91K $$ -hFɈ}3rFsF:"qh[[x 3YG[ 5+rF+s.U-+*Ê;F1qdKjX#sC5#+Ch+[11#[@B;$ Fh;{@5+p+x3$ 2kЃ 3r]#+ChF3s+xF+sxxC+- --+CU-+FYr{.Fks3Fs+xY%=@4; 3q[[xY12; 7-CU-; 3q KjSX#sC5#+Ch+[11#[@B;$ Fh;{@4#p2FـQI3pa*IS2* G)pGHh1`8hFxhFhF HAhhFA`8Oh@ #ChFhF Gx*hFAhKC/hFl GjhF`@hFP`@2HhFhFЀHiFhFP~FsiFpGIh(pGhF `I hF``pG"O;3;w#48byb#rL%hk #h $h # OFb O KF``X``28d2@@GO8hGNGM#[(j0bDIF`CHAi)i1 {)#mC hFaiBl1d:8h(7HAi)i1 {)#mC hFaiBl1d8h(/ѻ#pz( pr00z(xh#@&@jBh0`(H{) 0A0@x(Ѹh| `b `8h( y4k #kCc8h08`( 8`G @ @,P,HI#B‰OB{* B{* NJBJFS`2BWGB"BljDBBsCsB‰FJFpGh@kF) gXFWP0(! YO=-Q)0( cXFSP0( p r`rr s`s)7iFx  9 -'-=(  x) "9rT0 xBx8?BhF 2!_ЋXFP1  BG KЁTXF|P0BؐpGx#'*p@xFp*Hz1r****pG8 @H#AiC Aa`!"Ra JF`#@i(OGHA1A @pG𵅰Ihy7( Ѹ(o@gHF` LbjHkcj#`bi B @IF`;X8 "Bxs:z3#i+s"/#`ih Kh 6vM;*#B٨r#1C hF 1  I 1  jJFiHCjFjF2i h#ChB0 B B (bh(`i0a iF`8cNIFy`ibk#kBjFybyj 1b!aI x1!9`9hF`AN`(0Fp` 0jB#kBq!bjFb!kp8kAhFy`hF`iF9a@iFxa8#8qBѹj82j@Ѐ0!k bkBjFaz(!ri8a8k]Hj( i LjBG @ IF`h(r @@*UUUU(@xj@!1@Hсl1dyjII Al1Ad HAj1Abxj9kFHb8k8 IFrG* @"a1 xjF@ @ 8T+Hk x@ CZ'Ne#[Bиi9kFah9kF`88`30(H # i)$}cI $-#k)-6R-#k81~(4@-#k(*8Gh i9kFah9kF`xj@ @ 8h@8888D G!k@jF`pG91   ja2 ) ݇=#+ChFQ0 B۰pG𵠰#!1C hF S1C h92Y:I# jC4i  "ihF94dd 4$$V.JF&hB2 BRU"$B"*ёC hF9`C hFy`1C hF` hFQ1C hF8cyb1C hFa1C hF`1C hF0ChF8h@8`8 8X G(UUUU90A8JBBBF :ʻj2JF2N0j2LmA8k3 rjm0jB e# mk'KFP&MkA@@c "JH){)i{)JFkK1 k0c( c 9kFexj9kFHb3#Ah)9kFA`9khFe9kF`G( D @hN%5OF5`8i88a|h, mFx` ! Hj GHy1q@ @ IF`pG8h Hj9b 0y( #0ChL!jB!C h  )" b jiB!C h Q!"jjB kbk8`G yjF`h#1C h   0Ѐ0IJk kBjpGhHh(Gh O8x( I (  8pJFHBhKh Gxi,5(D @ @IF`O!=0R#h( #ph( #HrG 7H#h5M)!)b2HlnB $(jBB*,JRk (jB 9B$>0%I(=#H,I:/b nMkkBKCjQ*k Hk1c (bGI$?"R:C.bMj nQ *kP J"Cj*k GHFf (-D @6 @HnJ0`#kCcpG < @𵄰 IF`'N3#(j(LhF!hF3(IHi0Ha I`{0`sy0qHhk(j7Bػ#z)!rG @ @ @O#"h+#;`3#{imF|ahF\`DhF`hFahFXaehB`(iFeaapG J3#i#h+;`imFapG!` JhK`@2)Бi!eapGhJhK`@2)Qi!ePapGh!JjK+лBX#cCI<##Ch+ pG1) )=Ji@j@_@@w@@iF@%iF,]2N&Ci@3SjFjFX@B>ъ@@c[#63Ch+,#Q63Ch@#I63ChB#M63ChB#Ch 2+* 3+*7B'5B C G)'Mhi(&Hh1G#L&h#O((j( 8q`((j( 8qh(8y(hh( `(hh(((j( 8q`((j( 8qh(8y(й) pGpGpG@ IF`#Ah@ a J!9jFyeAjFyglld!dk;mc9eBj 2QqymzomF`  I@#Ak9AcxoG*@ IF`[@h#@p IDjF`exjF`goci(8!2+ G*Kooch#iМ.YF>Qi3B;GFHi1aQ1e m@ 6Ҹm{C{C!Is Cs mFs3 Csm@ `h `h2KC`` 7%}``=d}d w8@#C8}b)HFb8D h#8ChFxd`h xn& 1B:dA#@ @`aah  B9dch @0a h c`;8~  h%xbb8< 9dGx*8lk !hA i* قV#3ChFPi0Bxnk #@ @`a h#8Chxlxd`h hB9dch @0a h c`;8V x ^Ghxb b8 9𵄰HAi1Aa ah@  hh{h;8*& x .`h@ ``0}N #h(%-#h(Ъ-#h 9"5-#h(kch}lC (Vk:n hzn 0`  C xahh"@ C"@CC8a #@aCF pph`(n0.8i0)Ix=x`h 9nA  zn  C6 hB `   C FA(1xi  C F(yi1CyaFP8i"@ C"@CC09izh9ah) iCFi `mAӀ `h8  C!hF `h 8  C!hFGx* 񵄰nM(i"@C(aCiIDkFh(&&eHAi1AaO(i0C(ahehBlB@bj&`b`b H#C  8_ `f` h8h ; 9*8hFxh0Cx`1!np anq   C   C FA ` `i  C F0ai1CaaFH`nF i"@ C"@CCq`!iI!ahI`ѱiCi8an8h 1`h8L xmAӀ xh8  C9hFȁ xh 8  C9hFHG<,*x* h&1@9J) ! " C@J)G2Z+:+pG&lFd kFLkg!hFahFhFIBmI!YIY='!I ++**&!)CC  aI. JFHmBm R&@( @F `F``F`84FDcFc /) JFHmBm % G(S 8h#8Ch8ChFx9h8`88 3G ! Ҋ!AGo@m2QqmF`:nF` HFAckIIc 8mG#CI h $^+hF9`A AhFy`hF`hF`07jB(1>) G!aI h*`JhFaH`pG<,Ih(iF `pG<,!gIh*ш`hFg`pG<,Ih(ЂoF`pG<, IF`(#Ah@ Q KK+;G++NHm1e* @ IF`( #C#C .GHm1e @"HF"HA3Amml h##ChB BYA ) (xjjF`jjFH`JFjHBm 9j8#C88@#C88UG8@#C8UUUU((@ ,IF`@h#@h@&ID #C A4@@ ll@d dk"mc ejF`e#xh@x`ah61)8#Cx`8 #Cx` a9hxh ; `8G8M(I@#Ak9Ac*'L k:c*jFcj7 /83#Aj) @IF`G Hh1`Ih(y0*:*ˆ* #oCgIF `!!!pG @ #i0sIy2ԉ`ЁU BSsЁP#:mChFaiBlIF`GxaHilCHa! `8i(иiiAxmA8i axmBa #!3B'!7n8-M(I0z#Cr)JF)HmBm + G i0 a#I0jQ1`j1b kamB#":C ~#" Can n"R Can  n+#"2Cann +w k amB@ c8D @(   IF` II0z'*r9II0z*r/G,P, IF`h0`H4!k 1hzhQd!k0hxhk#xhX@x` k0 c0@y(8G 9Hh(иjh  xo 1qGl/IF`j8!Ygb(  m h  zmB؉bhJl*JlJdjb8hjBkB!Adj9hIk@bhk@bhIl)ѹjkB:lB#X@`kFbh(8`8i(88a  "HjFah IkF `bhF`QxF HF 7j 3 FKFBӸB!h) FHq [(k0c 'h`aJFHmBmK >8\B {Hh(d8x@@(`08x#@Xj Bh(Ih(9".bh( и(Iht(нIhmzhFrahFa0I hb(0IIh[7jB 'hhKCh` a#hC`i(Ҩ a7jBl؜(h#hh@H@JxB 1ӂ /ӝHF Fx FP`hF`xhFb FdFcI@FPcPh60(8 a7jB(Xz ӅHF#"@K FP`hF`xhFb FdFcuI@FPc3* FHqPxC 7jB Pkk @ !:{Fd Fe#[hhCh` a 7jB q8x@@(i*(*8!yh 0IIIhAI (k0c FHq'h`a:JF9HmBm9K    ( FHq(hF& " 8 x B ( B0B @ @h#@ HF( ())  *#CChyH(D @*1X_!@۱  **)))!F :6h#@ @H"CHmBm  #@ @HCF :67jB hhk F B\ Bz_^x"RCh#@ #[C+ +))! (#C :x7(Шh#@ @WH"CSHmBm z jB  0 Bhh0C h`j{('h hh*Pk !:Fd Fcj1]hh0Ch`iB ah#@ /JF;*HmBm '# mChFaiB"i*A`mA ?i@aamB$@a!B i( `aHAil CBailCa! `iFa mChFaiB ( @0haG(R @ -IF`iDjoI 1Hqyh j$I@$Kh9`6m h"nF` Ny5#kCcjmF`j"nF`ai)ik1ic)hc k@@cxh #h) 9C88J  G 0y)!q8Vh( иhPl(иjAx 1RkB8BG8*xhkFb簵oF$M #@i(iFR #Ri8( 4@ #@i((8G LI" " h7" h 7K{-[{+#[C([CJh 9#G#C< @(h!aIJh*H`hFa`pGIHh(iFJ`pG#hX@`h:` i: aBkSkFb hYIlSlQdpGhRkB=0 hRRlh`#hX@`h2` i2@ a@kFbpG9 ) 1Hq`` aJFHmBmK fG(D @I h`#[BI y2 qpGP- @I h`#[BI y2 qpGP- @0I h`#[BI y2 qpGP- @HAy1AqpG @KXЉ ihL X@hBсBh$B فBhx0B Bx0B pG0JXЈ009izhB 9hF9ahzhB9hF`8i8aG! @  "@OX )0*00hzhB9hF`h`Hi( @  I0y"+ I0y+qyG<,,P,+I x)Ah)KCA`hI !  !  8Ch Ch[1@h#@L#hP0y(`h( q8#Ak9AcG8#k]c-3cbk1c!@"hC!`k)!cNph(6$hH`2h`1 {(Ӵ`(#k/!jKQ1bj k?c+b/'@;C7h;@3`Ck;Cc7 xh(G$'/K/J-j0bRi*iSaaAi1Aai*a)D`GinaaUi5Uai.a-T` O:ohy1-m[ Ӌ+;o+@gMF+`#` C8P`i2BJ Q a:g* $ @( IF`L%gi/hA`i?h(`hi/gaHm1ee` h("G @ pG#h@!+ K@$Chhh:` €`Bh#2CB`pGhS 4K@&Chh?h;` À`Ch#;CC`kcˀh`8?hF`Ch$ ##C;`@h Cx`n0fHn0Hf pGj#2Ch7;ChF`#;ChF`# Ch bkF b#iCakFaj1bkFb91J:JIk@2Q9hkF` pGGGGG G(G0G8G0@- H$H L@dQP P@0 PU PUU PP0@/0 16U0 T 0PG- h&h% @P@pČP0 P U PU U p  0 `p `F VpFČ`PPG/ U(( @h dXT/?@-OPT !P@ SY YYYEJK  0R<00/PU @ /  // / T@/ D/ H/L/P/ !@P@/?@^a/T/ /$/(/,/0/4/8</8</d 00S 0 0 0S<00/<Q</P-L*E==+ @#J[Ch[`[G                                                                                                                                /P- @0P R x tt @`0P R P LL @,0P R ( /|40ޭ@74D?@8HxGxG9xGcxGxG(am TuTT9U)De OPx!@#x!@9x!@Qx!@]x!@kx!@x!@x!@uy!@y!@y!@y!@y!@z!@z!@z!@5{!@!@q!@!@M!@Y!@!@!@I!@m!@!@Ղ!@!@-!@U!@e!@!@!@A!@!@!@!@!@u!@ͅ!@ !@m!@!@!@!@!@!@9!@C!@M!@W!@!@͇!@A!@K!@U!@_!@i!@s!@}!@!@!@!@!@!@!@È!@!@!@Q!@[!@e!@o!@y!@w!@!@!@5!@!@!@w!@݊!@!@!@=!@e!@q!@u!@y!@!@!@!@}!@!@w!@w!@!@!@w!@w!@w!@!@!@5!@M!@?{!@~!@~!@\@X@$ @$ @l@h@$ @$ @|@x@@@$ @$ @ $ @ @ @$ @!@m!@s!@!@g!@!@9/ !@---03:11:1107/23/0100001569Copyright (c) 2001 3Com Corporation @ S'}@d,P,=IOy$=;;LS?s!@Qu!@Q?!@)$R S0 @`tln!@ !@!@!@!!@!@!@ŗ!@1!@!@!@!@E!@!@Y!@!@ ) (Hx)!pHpG n!@$ @IB IFppG$ @n!@ J #-#Ha`c2``abHF`H`G 𵄰 #hI #8h(@"``zh"@:a A Q Ҁ `H hI 9iI h(p#TJ#C` y5$!OMh"@9ЊRNK\BKK[xB,IKxjBFbSh[#B ѕh^0hg(&,sX" A`JI'(!p`#Cb"(ӱhH` )  p"(!G#oCgNF0` p(J!H#oCg1` hC `p`!pQ!b# hC ` NFp`U#C py|!@  IFpH"!Gy|!@0Hhz#C#C#C#CB! `%Lh(##C!B  !9@HЀ#oC#oCg`Hjx  0C#3C CB IFbh)y #3@(G@ @  HAx)!Ap'H  8[瀼GiFiXHhFHjFhF! G@@iF8IJzXhF!~ GưLjiF3$cB x@#Cp ؀hF!H8 I( XpFFhFK FG$<ưiF8xx%(CB x@#Cp ؀3,hFhF 3!xx( @@0 (H xxB H v I08hF XphF!(FG$<𵄰'戢hGIy(..'.&%AH.f][D ##Ã#Ń#3y3#[B"m#[ #3C#C3B 0C*#C !C. (`#C* #C. (#3C*#C#C  !I / iF +x@#Cp ؀hF!3^(G Q!b pGOh(7#!C m#[!IC K #[ȃ##CA! C 8 G Oh(7##C m#[#[C  #[0#A#C !IC  G IjiF XhF! G@@#@Ij#[@CIFb pG@@@ Ij//?/'iFq_hF! G @ˆ @!#[B"#B"bbpGiF8F\ OmFhF!|mIFb G*IFHa pGiFHhXhF!W G@IF` pGiFh /x I@#x@#Cp XhF!+ G h */ iFx@#Cp ؀hF!3  GLjiFH 9Z( 9XE pI hF! G$<LjiFhHtJ 9q( K 9"jE p I(`hF! G$!@{!@<G pGˆK!I*k#C*k#CHa*hh ;@C a0 ( @7;C a0 ( pG@ˆh C HF`Oe#[ "C B`ڃ   C  `3# pG@ I h CJh Ch   C $ iF_( ChF! G@@h C IF` C a  C Ha pG@Kh   Ci :C[i ;C? #$;\p@Xـ8ChF! G@@ Ij!!;Yp@XڀhF G@IFb pG I j!!;Yp@XڀhF G@IFb pGI GuiF-HkXhF!e G 3G.G)G Oq#[qH @!I` 1p J#h @!+h h JF`GJFd !@@@ G( iF8HXhF! GiFqX H ‰C ChF! G)GGGGGGGGGG}GxGsGTiF XpiF GZGiF89H$)sDsh AhFh hF!sAsHXhF![ Gh'G"GGGGiF8$C#BKBHXhF!   Ch!YpFڀhF3 GiF8#CB KB HXhF! hF` G[8'_p ؀ HhFAhFhFiFiF8Ghhy G pGhFP!v\hF!GhFQ!d_hF!G pG pG'I hJk#@$*' : 'C 9 'CiF,_hF!f G@@iFHmXhF!O G*GpG pG pG pG Oq#[HqH @!I` 1pJ#h @!+h h JF`GJFd !@@@ pG pG pG XpIh') (hF FX!8G iF8 Xp$ Ih) JBKBѹh'B'8vhF! G $/4BِG K2 ! $K* @! * KB! K" D! " KF! K: H! : KJ! G{!@'?8bybbb H@kF( G@𵊰$iIhFhJh" @!fN*dJh h `aJFdaIh  )T!F`[IX*sЀ WHAXC$'%(8C QKC #CKIXC/Fp`(F`Fq`\y? /a $ ,17JQX)H!C!!1OyX) 8XF&#CI(# 1 ) C1)  C#C1yX) JhI h h F`JFd G@@@@@0n!@C n!@ Hh)@(hFj(Ѩ O( xkF( G#"! #C((8jyjjj| @ #[B &CMB=! AHAKBЀ%/=>JQiFiF#3C9KFYa#3C6KFa"`3Ji"a1J#3iCa"a!/4(HB0!**C 3]"H"IJhR !1 JF`( 8HBdvI8B(HAiCAaiCa"`iFaiCaa GP @ @ @ #[B }&@MB=! >H>KBЀ%/=;JQiFiF#C7KFYa#C4KFa"`1Ji"a/J#iCaa!! /3*C 3%H%IJhR !$JF`( 8HB 1*HBvdI8B(HAiCAaiCa"`iFaiCaa GP @ @ @pGI " p01h(pG @"B@2BpGB@BpG')' JCXc KYWXCPOhFW`hF` iFaKiFSahF`pG0(8Ы @Ű !!@_'y[JQXI 0y?/(L"@#!  XEB20(*OE+>рX@ "#!j!I *h FBh@ " #!0RH WH "#!0@I ) ?X@ " #!0*   CyJFPP0p` E+ ` !!@ )(0a(!00 1C@pa P!!@P)(`8HG Ы @#")ه\{@2BCpGư(A EAJQXK  Cv#[@C:J)a! ihE0!h 1ah@BѦh &!( 1' 7"1;9CH@ hB%-C" #!`h iF 9 C#C !#CC #!`h EJFPPCa```!aaaFGЫ @LB) 'C(!MC@** *i )iB)hB `hpGh iB8Ы @𵄰 !B,IX#C(@FTh!iB/<٠hh@! 1ahFhh@! 1! 1BF 0*h`]F0*;h`'/GЫ @𵃰 !B0IX$C(P  QTh`iB"i/E%Nhh@! 1ah@hh@! 1X#[CP" 2B*hu`!iB a00*;h`!iB a'/GЫ @ð 'C(A HEXk CGb "@h #!0, , ,, ?8Ы @I " T0`(pGЫ @W p ~G𵂰#3@@C  * S F(0ZnT (0aR (0    / p4?'G𵂰@C2S ( ( ( } z0wt(q/ x4k? b0_\(YSGpGOF`x8qG IFG Hh)"o CgIF `#oCg `"0`J`!pG II2 'P0(EL P0 (BJ P0 (ӧaaOee>MF/`o``a`/aoa I4K33L4c#cc#c0Kac0()H1(LFbak#bbQkFb!d%IF!e%I iFceM3e%fhFcfhFfKFf'gggK&gfaai3s#dKFeiFSeQ3e+fKiFSfiFfIFfgVgKgVaai0spG P,,< @\0(T|8T|!J#r#3#aY`r'sa#cKQ'b;`Dic<|`$Dc LF`jFbDi K`jFCbjFacQddefpG @"I#p #XrH'4e#7?/e#3#``a@ `aad f HF` Hkc He#[hFBhFʃhF pG < @< @@@@ IFs3:3aapJFePffpXp#rpG /I/JFa#Pa-HFbSb#cSc)J*O44?;a|a&OF9`ayab;c{dde"O6"My4aQ&7aiFta/gM 'u4|`=`LF! 2C@! 2B! 2 C/JD! JF! CJH! JJ! C(0C CC bFbbFb! HF`8/Ш/!`/!`G9!@n!@~(H/ hC `hI h h  H@j"2CIFJbHbGh#C`@@pGL!hHB #!m2B `t gr8'r HF`/'}1u0 G @JI1 x +# pxC pP0GppGI"h@ * h  h pG@ L8!M8#B ! Gg!@yzvH#vL)]ѢFBtz*zl*ЊBQFAxlkNFjX#ylYC@("2 "B#")i_Lj^KX#kC6#3ChXI2FB0TNFX hC!8eMK5-- B%2B܁≑Bz)/ylII yd*≑B'1F#xlC:NFcjylKYI@Y98KjylJRR9  `8Ja1  a≑Bc!*>$Lj#K]k[[6#3Ch N1Fp#0CIFȀh@@!8 qJRRjIȈy K5-- ]B%]1  B1 CG*)g!@#3@$0O 0J1M91+/QBN.Kj]k]msh66.Ή6΁@3!NvjFPS3SNjR`8FI(#O!."٫Bӫ+S3SX#>sCjh+ˉ3ˁ`8FH(/ pGʉ2ʁx*)!A`IJh*h*2y*Ji* шaHaGJi*шaHaiFP`a*H@i(L"h @''K1*"%LF a$LFLb$LFb#LFb#LF cOc"!LF a LFLb LFbLFbLF cLFLc@$̂OO!* ٌmj}@44eb1B)Ҋ22Wb1)I"G @(@#EgܺvT2 @gE#ͫ2Tv66660 @M1L#J 11# J )#J 9# J ! H2Qq!00AbG @u(@7JPi#0Ch 3K)Ih2KB>G#YUivG pG𵂰09(;8~F&(-05 i((x( hh`h@@ "hh `!i(( p6B 8vG8y1JkFc1 `"`JFJaa!0AppG!@ 60x4jEm!81x@  h* *xJ@*p0   h5Bhh@@axB 8y0k1` 0x00pG2x   jy3cx[j1 `xjF`KFKax~2BHHFa pG!@U!@!@ %~)0N~B ay0k1` U'-8( Gx?B&-807#V) Bh*hh`h( h((@BhB hB !hz`( p6B( Gy2AiFc~1 `2`JFJaJFa!0ppGY!@!@8hKB G!8y4( 8-1kF` 8z(xz( z( `khB 8i(KB 8~( snip@8*%0Ep4ahF( y0cc ``HF`aHFa(Gu!@;!@𵂰 y54jFa`bhkBa`*kB4fhFksjq&h*kB2hF* (jjjA3(aha`"hB ai8ѡi8ah*kBөkjcGiF8 22H!C4`3sy1hF bhFObhFbWhFbhFJcjj c{* **.2Rx* kF`%M"(i) zKjjMkB*Пђ kB`S XhFhF! G< @ ʀ8MhFh(X!~ G82hFh( X!e G8('# hC ``hC #hC` iC a hC ``hC``8G G$%'N !2x@? 45-8G9!@$ Ih)  J:! ?  GC B$   9!@':Kh+"$*#JSh +Ch *C CQ@1(C" K:! 8G  @@{!@"€JF`J2` J\F p01( " p1 K\Fp01( p1 J\F p01( ppG@ !EMy0Assd"B}!!A?H"&C=L97B0y0q8H"!B0y0qh/(/H}"!-M(,H,H+Nq#[*O y((8(8(0`y(#(8(8(I"h@ * h  h IF`IFdHH ]" @!!Y~!@ ,@@e!@HW IF`JHd!H"h @!*h h HF`GHFd%U(@@$O! 8h@ "M"L)9h 9h ` d #Ck1! 8h@ )9h 9h ` di! 8h@ )9h 9h ` dG@@!HJX\<`$F ) Iq#[qPq#[bIFHbHG!@ 1!@H|4G!@HVGHk)сkBk L#`iC`aiCa`iF8aJId JFK )2Hh)#`iC`a` #pG@ T!@d0D @@@!HFAb@!AbpGHAiKCAaiCa"`iFapG KJKHh KMKKB3B (!#aa(@DK `CNFa #CCB!A>NF1ai #;NFa;3b@BӸ#CCBA4KFف@8Xa 0B.Ni3a@B+I ci*KQgi0B$IFbX `C ", X#CCj0 `Bb̉`@ , C[j0 `ˉBOb i+هKjFQ i0BIj8(apG!@@  @) @ H#AiC Aa`!"Ra#Aa Y`pG  H#Za#BiCBaiC#a`iFa @apG I"_3#Zb0 (H"!3G =HGa"K!I(aYiSCAaiCa`iFapG_i#[CGa` a  L3#]jBjBћjB0 ( 3#[j+ 3#bbc_b0 ( ( CpG " O*3#[iB3#SjFSajFajFakFb"0 (K*ZhB!Y`pG C h ( I#[iC"aa@3#jFcSiCaa pG Ji!OiB  BِpG @aCB0ӄFR) xp@Iу:Ӱɸ:Ұ 2 p Cp p p xpI@R`FpG CCXPpGR\TpG pGtxp  : failed to enable bus mastering : failed to enable memory mapping : can't map mem space %d : couldn't map interrupt : couldn't establish interrupt at %s : %s address %s %s: reset hung : not waiting for host request TYPHOON: fw invalid magic %s: fw wait failed, initial : not waiting for boot : fw wait failed comm0 : fw not waiting for segment : fw invalid section address, section %d : fw truncated section %d : fw dma malloc failed, section %d : fw section %d, bad cksum (expected 0x%x got 0x%x) %s: fw wait failed, section %d %s: error 0x%x : can't allocate boot record : can't allocate host ring : can't allocate high tx ring : can't allocate low tx ring : can't allocate high rx ring : can't allocate low rx ring : can't allocate command ring : can't allocate response ring : can't allocate rx buffer ring : fw not running %s: no free cmd descriptors %s: 0x%x command failed %s: response error: id 0x%x %s: hello %s: unknown id(0x%x) [cmd flags 0x%x num %d id %d seq %d par1 0x%x par2 0x%x par3 0x%x] [rsp flags 0x%x num %d id %d seq %d par1 0x%x par2 0x%x par3 0x%x] [data flags 0x%x num %d totlen %d addr 0x%x/0x%x pflags 0x%x][frag flags 0x%x rsvd1 0x%x len %d addr 0x%x/0x%x rsvd2 0x%x][unknown(%x) flags 0x%x num %d id %d seq %d par1 0x%x par2 0x%x par3 0x%x] Fv PQUVXZEUPU`V`%s: chip is in D%d power mode -- setting to D0 : can't map i/o space : couldn't map interrupt : couldn't establish interrupt at %s: %s)0 I$567129:=PQ348;<>Y)Y$]$: can't map i/o space : couldn't map interrupt : couldn't establish interrupt at %s    &'(uvwxyz{|emem_probe: begin em_attach: begin %s: Allocation of PCI resources failed %s: Unable to allocate tx_desc memory %s: Unable to allocate rx_desc memory %s: Unable to initialize the hardware %s: EEPROM read error while reading mac address %s: Invalid mac address , address: %s em_attach: end ioctl rcv'd: SIOCSIFADDR (Set Interface Addr) ioctl rcv'd: SIOCSIFMTU (Set Interface MTU) ioctl rcv'd: SIOCSIFFLAGS (Set Interface Flags) ioctl rcv'd: SIOC(ADD|DEL)MULTI ioctl rcv'd: SIOCxIFMEDIA (Get/Set Interface Media) ioctl received: UNKNOWN (0x%x) %s: watchdog timeout -- resetting em_init: begin %s: Could not setup transmit structures %s: Could not setup receive structures em_media_status: begin em_media_change: begin %s: Unsupported media type '&Ё(&Ё(&P(&Ё(&Ё(&(&Ё(&Ё(&Ё(&Ё(&(&Ё(&Ё(&Ё(&Ё(&(&em_set_multi: begin Full DuplexHalf Duplex%s: Link is up %d Mbps %s %s: Link is Down em_stop: begin %s: Memory Access and/or Bus Master bits were not set! %s: Unknown MAC Type : mmba isn't memory: can't find mem space : can't find io space : couldn't map interrupt : couldn't establish interrupt at %s : %sem_hardware_init: begin %s: The EEPROM Checksum Is Not Valid %s: EEPROM read error while reading part number %s: Hardware Initialization Failedem_setup_interface: begin %s: em_dma_malloc: bus_dmamap_create failed; error %u %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_load failed; error %u %s: Unable to allocate tx_buffer memory em_initialize_transmit_unit: begin Base = %x, Length = %x free_transmit_structures: begin %s: Unable to allocate rx_buffer memory %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u em_initialize_receive_unit: begin free_receive_structures: begin %s: Adapter hardware address = %p %s:tx_int_delay = %d, tx_abs_int_delay = %d %s:rx_int_delay = %d, rx_abs_int_delay = %d %s: fifo workaround = %lld, fifo_reset = %lld %s: hw tdh = %d, hw tdt = %d %s: Num Tx descriptors avail = %d %s: Tx Descriptors not avail1 = %ld %s: Tx Descriptors not avail2 = %ld %s: Std mbuf failed = %ld %s: Std mbuf cluster failed = %ld %s: Driver dropped packets = %ld %s: Excessive collisions = %lld %s: Symbol errors = %lld %s: Sequence errors = %lld %s: Defer count = %lld %s: Missed Packets = %lld %s: Receive No Buffers = %lld %s: Receive length errors = %lld %s: Receive errors = %lld %s: Crc errors = %lld %s: Alignment errors = %lld %s: Carrier extension errors = %lld %s: XON Rcvd = %lld %s: XON Xmtd = %lld %s: XOFF Rcvd = %lld %s: XOFF Xmtd = %lld %s: Good Packets Rcvd = %lld %s: Good Packets Xmtd = %lld  (((((((((2222222<<<<<<<<<FFFFFFPPPPPPZZZZZZZZZddddddddddddddnnnnnnnnnnnnnnnnnnxxxxxxxxxxk&0k&k&k&0k&k&k&k&@k&@k&k&k&@k&@k&Pk&`k&Ѐk&`k&Ѐk&Рk&k&Pk&Pk&Pk&Рk&k&k&k&k&Ѐk&Pk&k&k&k&k&k&k&k&pk&pk&pk&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&k&аk&аk&аk&Аk&Аk&Аk&Аm&Аm&Аm&Чm&Аm&Чm&Аm&Аm&$&4&D&D&D&D&D&T&T&T&T&Е&Е&Е&Е&&&&&&&&&&%&@&c&%&@&c&%&@&¼&׼&&& &%s: chip is in D%d power mode -- setting to D0 : failed to enable I/O ports : can't find I/O space : can't map I/O space : couldn't map interrupt : couldn't establish interrupt at %s : %s,dc_pci_attach: unknown device: %x:%x tx: neither i/o nor mem enabled : can't map mem space : can't map i/o space : can't map interrupt : can't establish interrupt at %s : %s address %s : can't allocate memory for buffers %s: unknown card vendor 0x%04x %s: cannot allocate mbuf cluster DPE APE PTAPMA%s: PCI fatal error occurred (%s%s%s%s) %s: device timeout %d packets, reinitialization seems we can continue normally %s: ERROR! Unknown PHY selected %s: serial PHY detected (10Base2/BNC) %s: failed to init rings %s: can't stop Rx DMA %s: can't stop Tx DMA %s: can't stop TX DMA %s: WARNING! rx_desc is misbound or misaligned %s: WARNING! tx_desc is misbound or misaligned %s: WARNING! frag_list is misbound or misaligned  @@``Q `\]8 ^  <\!<@&  '<<{7!<T6! 4$$ # B$ 4!j!c+ <B4!bLrB$B0Lr@B@#B$')$8i!@*)%')%&)%%)%$)%#)%")%!PG!PF!PE!PD!PC!PB B1!Pb B1!PbjN1B0D@!P"%+"@!  $! +#@T!rbc$$! 0! b0!CB03>!PB*)%()%')%&)%%)%#)%")%$)%!PH!PG!PF!PE!PC!PB"#!PD!PB!PC B1!Pb B1!PbH1Q4b C$bThbB4bhj!(B0V@!0c$b$+"4@i$+)@T!H2%i$+)@$!H2"B0@)%`>$!!0+)@T!H2")%!(+)@T!H2)%+)@T!H2")%!(+)@T!H2")%!(+)@T!H2")%!(+)@T!H2">!(ebi$B0@$>$!!0#)%")%$)%!(!("#!(!(!(0!(b0!(bjB0@! # N! b2@P! ! ! 0P4bC$+#@T!rbC8c,B8B,%b`bB4bb $B0@d $ 8b' %+"@P0i'("$" $!B$O?Lr厐掔  @)!!!8+ !0!0Lr%M  N`@$C%c,B9B,%b$`0N8PB$! U0N4N bB$4N0NB$+T.?0NB$TP!0NB$0N0N8PB$! $N?0N8PB$! $b0N4NbB$4N0NB$T4NB$b:?`( B$((B,@PO?0NB$TP!0NB$0N0N8PB$! $$  @<$" @6T%b@??@@@AaBodgPesLLLLKKLLLLKetlAA noINecV CetlAA noINecV CBBBBT``!@ `  @@\m@op  bc$# s&b.@Be&*+@$,#`$#CC!X@$(#CC`X@c$*d@T! `DB*@$b0d"bc$# s&b.@B*b0@$,(`$#CC!X@$(#CC`X@c$*d@T! `DB*b@$b0@!LG!LB>,p8B,%b`! 2@$cb4cb!(c$b!bE,!@T$$P$!dBB02 @!P <+C@! @!($!(+@0!(b0 !(bHGBB( < @@E0@P4,J5,!(2@ C&b! `qbcd!"!#!$b c d!"!#!$$!"+@"2!b"2!b2@D&>!<4+@HB# B0@ D&B0#PBC&#P <+C @! B!BCD!! !+@HB# $!+@HB# $!+@HB# $!+@HB# !<$@,B1 @! d> $B0!""2!b$#Q!"!0!"12 R4,J5,.,B1@ $ 4DHDEDI@A! H!0 $ H!!(+H! ! @( <n C$b,@   <\n" ('  B4  1$! !(E '$!(E '$$ 'E !0@$$E !0@$$'E !0 $$E !0 $$"'E !0$$E !0$$E '$$E '$ $E !0@$ $E !0@$$E !0 $$E !0 $$E '$$E 'B0f@@<1> no bus space memio%s: pccbb_open_win: %s winlist insert failed %s: pccbb_close_win: %s winlist delete failed pccbb_winlist_delete: window 0x%lx size inconsistent: 0x%lx, 0x%lx %s: overlapping windows L727d CPHCH C%s: bad VPD resource id: expected %x got %x sk_vpd_read%s: phy failed to come ready %s: phy write timed out %s: failed alloc of %dth mbuf %s: can't alloc rx buffers %s: can't map dma buffers (%d bytes) %s: can't create dma map %s: can't load dma map %s: no memory for jumbo buffer queue! sk_jfree: can't find softc pointer!sk_jfree: asked to free buffer that we don't manage!sk_jfree: buffer not in use!: address %s %s: unsupported PHY type: %d %s: jumbo buffer allocation failed %s: unknown device type %d%s: no PHY found! sk port %c at %s port %c%s chip is in D%d power mode -- setting to D0 : unknown device! : failed to enable memory mapping! : can't find mem space : can't map mem space : couldn't map interrupt : couldn't establish interrupt at %s: %s %s: unknown ram size: %d %s: unknown media type: 0x%x %s: %s %s: watchdog timeout  22  %s: initialization failed: no memory for rx buffers %s: initialization failed: no memory for tx buffers skcskH+(ЫH+(8H+(6H+(зpwH+(ЅAH+(#H+(0H+(1T.(`s8h/(l0 ((b ((: can't map command I/O space : can't map local I/O space : can't map I/O space : bridge not ready : bridge timeout : failed bridge setup : can't map mem space : can't find PLX I/O space : can't map PLX I/O space %s: no PCMCIA card detected in bridge card : can't map TMD I/O space : couldn't map interrupt : couldn't establish interrupt at %s : %s %s: "%s, %s, %s"%s: unable to map registers %s: couldn't map interrupt : couldn't establish interrupt at %s : %s %s: unable to map registers %s: trm_init failed%s: couldn't map interrupt %s: couldn't establish interrupt at %s : %s pcscp: unable to map registers : couldn't map interrupt : couldn't establish interrupt at %s : %s %s: can't create dma maps %s: unable to allocate memory for the MDL, error = %d %s: unable to map the MDL memory, error = %d %s: unable to map_create for the MDL, error = %d %s: unable to load for the MDL, error = %d %s%s: error: DMA error detected; Aborting. %s: dma_intr: DMA aborted. pcscp dmaintr: DMA wasn't activedmaintr: discarded %d bytes (tcl=%d, tcm=%d) pcscp_dma_intr: empty esp FIFO of %d dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d %s: unable to load dmamap, error = %d %s: reset never completed %s: chip is in D%d power mode -- setting to D0 %s: failed to enable I/O ports! : can't find i/o space : can't map i/o space : couldn't map interrupt : couldn't establish interrupt at %s : %s: address: %s %s: can't alloc rx buffers %s: can't map dma buffers (%d bytes) %s: can't create dma map %s: jumbo buffer allocation failed %s: no PHY found! %s: can't load dma map %s: no memory for jumbo buffer queue! nge_jfree: can't find softc pointer!nge_jfree: asked to free buffer that we don't manage!nge_jfree: buffer already free!nge_jfree: buffer not in use!%s: initialization failed: no memory for rx buffers %s: watchdog timeout nge;;;DEFGHS]^ HD%s: eeprom read timed out %s: PHY read timed out %s: can't alloc rx buffers %s: can't map dma buffers (%d bytes) %s: can't create dma map %s: can't load dma map bge_jumbo_buf = 0x%08X %s: no memory for jumbo buffer queue! %s: no free jumbo buffers bge_jfree: can't find softc pointer!bge_jfree: asked to free buffer that we don't manage!bge_jfree: buffer not in use!%s: RX CPU self-diagnostics failed! %s: buffer manager failed to start %s: flow-through queue init failed %s: host coalescing engine failed to idle Map control/status regs %s: failed to enable memory mapping! pci_mem_find : can't find mem space bus_space_map : can't map mem space pci_intr_map : couldn't map interrupt pci_intr_string pci_intr_establish : couldn't establish interrupt at %s : %sbge_reset %s: chip initialization failed bge%d: failed to read station address address %s bus_dmamem_alloc bus_dmamem_map bus_dmamem_create bus_dmamem_load bzero %s: jumbo buffer allocation failed bcopy mii setup %s: no PHY found! if_attach ether_ifattach timeout_set %s: firmware handshake timed out %s: initialization failure %s: 5705 A0 chip failed to load RX ring %s: watchdog timeout -- resetting bgeire%s: PHY read failed %s: PHY write failed %s: bad phy register "(0(d(d(7(G(@(%s: reset never completed! inside re_diag re_diag: transmission started %s: diagnostic failed, failed to receive packet in loopback mode %s: diagnostic failed, received short packet re_diag: packet received %s: WARNING, DMA FAILURE! %s: expected TX data: %s/%s/0x%x %s: received RX data: %s%s: You may have a defective 32-bit NIC plugged into a 64-bit PCI slot. %s: Please re-install the NIC in a 32-bit slot for proper operation. %s: Read the re(4) man page for more details. leaving re_diag %s: can't create DMA map for TX %s: can't create DMA map for RX %s: chip is is in D%d power mode -- setting to D0 : neither i/o nor mem enabled : can't map mem space : can't map i/o space : couldn't map interrupt : couldn't establish interrupt at %s: %s%s: eeprom autoload timed out , address %s calling mii_attach %s: no PHY found! %s: attach aborted due to hardware diag failure leaving re_attach %s: can't map mbuf (error %d) %s: watchdog timeout stge))! @6=!@@6=!@@6!@6!@6І@?6T!?6Antares Gigabit EthernetD-Link DGE-550T Gigabit EthernetSundance TC9021 Gigabit EthernetTamarack TC9021 Gigabit EthernetSundance ST-2021 Gigabit Ethernet stge_attach: impossible: unable to map device registers : unable to wake up from power state D3 : waking up from power state D%d : unable to map interrupt : unable to establish interrupt at %s: %s, rev. %d, %s %s: unable to allocate control data, error = %d %s: unable to map control data, error = %d %s: unable to create control data DMA map, error = %d %s: unable to load control data DMA map, error = %d %s: unable to create tx DMA map %d, error = %d %s: unable to create rx DMA map %d, error = %d %s: address %s %s: WARNING: unable to establish shutdown hook %s: DMA wait timed out %s: Tx packet consumes too many DMA segments, dropping... %s: device timeout %s: receive ring overflow %s: transmit underrun, new threshold: %d bytes %s: excessive collisions %s: Host interface error %s: reset failed to complete %s: unable to allocate or map rx buffer %d, error = %d %s: interface not running %s: can't load rx DMA map %d, error = %d stge_add_rxbufbce%s: failed to enable memory mapping! %s: unable to find mem space %s: unable to wake up from power state D3 %s: waking up from power state D%d %s: couldn't map interrupt %s: couldn't establish interrupt at %s %s: unable to alloc space for ring descriptors, error = %d %s: unable to map DMA buffers, error = %d %s: unable to create ring DMA map, error = %d %s: unable to create tx DMA map, error = %d %s: unable to create rx DMA map, error = %d : %s, address %s %s: Tx packet consumes too many DMA segments, dropping... %s: unable to load Tx buffer, error = %d %s: device timeout %s: transmit fifo underflow %s: receive fifo overflow %s: receive descriptor underflow %s: descriptor protocol error %s: data error %s: descriptor error %s: general purpose timeout %s: unable to allocate or map rx(%d) mbuf, error = %d %s: timed out writing pkt filter ctl %s: timed out disabling ethernet mac %s: receive dma did not go idle after error %s: timed out resetting ethernet mac %s: while resetting core, reject did not set %s: while resetting core, busy did not clear %s: PHY read timed out reading phy %d, reg %d, val = 0x%08x %s: PHY timed out writing phy %d, reg %d, val = 0x%08x biosno bios: configuration mode %d (%s)pci_make_tag: mode not configuredpci_make_tag: bad requestpci_decompose_tag: mode not configuredpci_conf_read: mode not configuredpci_conf_write: mode not configuredpci_intr_map: bad interrupt pin %d pci_intr_map: no mapping for pin %c pci_intr_map: bad interrupt line %d pci_intr_map: changed line 2 to line 9 pci_intr_string: bogus handle 0x%xirq %dpci_intr_establish: bogus handle 0x%x%s: interrupting at irq %d pchbpci : bdnum=%x (reserved): Compatibility PB (bus %d): Auxiliary PB (bus %d) : disabled CPU-PCI write posting: rng active, %dKb/sec%s at %s bus %dpcib isaisa at %sichpcibgscpcibisa isaattach: can't map DMA controller #1isaattach: can't map DMA controller #2isaattach: can't map DMA page registersisaattach: can't map `delay port' port 0x%x/%d iomem 0x%x irq %d drq %d drq2 %d>>> probing for %s* %s%d: irq %d already in use >>> probe for %s* clone into %s%d %s: iosize not repaired by driver >>> probing for %s* finished >>> probing for %s%d >>> probing for %s%d succeeded >>> probing for %s%d failed nonepulsededge-triggeredlevel-triggeredisa_intr_typename: invalid type %disadmaisadmaattach: can not create DMA map %s: bogus drq %d %s: DRQ %d is not free isa_dmacascade%s: drq %d is not free isa_dmamap_create%s: drq %d is already free isa_dmamap_destroy%s: drq %d, nbytes 0x%lx, addr %p %s: drq %d, nbytes 0x%lx isa_dmastart: no DMA map for chan %disa_dmastartisa_dmaabort: %s: bogus drq %disa_dmacount: %s: bogus drq %disa_dmafinished: %s: bogus drq %disa_dmadone: %s: bogus drq %d%s: isa_dmadone: channel %d not finished isa_dmamem_alloc: %s: bogus drq %disa_dmamem_free: %s: bogus drq %disa_dmamem_map: %s: bogus drq %disa_dmamem_unmap: %s: bogus drq %disa_dmamem_mmap: %s: bogus drq %disa_drq_isfree: %s: bogus drq %disa_free: freeing unallocated memory isa_mappage: mapping unallocated memory kbc selftest: %x pckbc_attach: couldn't map %s: unable to establish interrupt for %s slot %s: using irq %d for %s slot +/Ш,p-.И.8/Аp)80x25P@W6Tp)p)p)\p)Јp)pcdisplay_init: cannot map memorypcdisplay_init: cannot map io pcdisplay_attach: display disappearedpcdisplay_free_screen: consolepcdisplay %s: can't map i/o space %s: bha_find failed 3.37%s: buggy VLB controller, disabling 32-bit DMA %s: couldn't establish interrupt %s: could not map I/O-ports aha(aha probe)%s: aha_cmd, host not idle(0x%x) %s: aha_cmd, cmd/data port full %s: aha_cmd, cmd/data port empty %d %s: aha_cmd, host not finished(0x%x) isapnpahaattach: aha_find of %s failed%s: mbi not in round-robin order %s: bad mbi ccb pointer; skipping %s: bad mbi status %02x; skipping %s: can't malloc ccb ahaccb%s: exiting ccb not allocated! should call debugger here (aha1542.c)%s: host_stat %x %s: target_stat %x aha_find: illegal drq setting %x aha_find: illegal irq setting %x 1542C%s: unlocking mailbox interface parityno paritysyncasync%s: %s, %s %s targ %d: sync, offset %d, period %dnsec aha_init: could not allocate mailboxunknown15401540A/1542A/1542B16401542CF1542CP: model AHA-%s, firmware %s )S)S)S)S)S)S)S)S)S)S)S)S)S)S)S))) ) )0)@)ahawaittimed out AGAIN a6%`6(`6`6``6- `6._6/_6/`_6. _6,^6FUTURE DOMAIN TMC-950FUTURE DOMAIN CORP. (C) 1992 V8.00.004/02/92FUTURE DOMAIN CORP. (C) 1986-1990 V7.009/18/90FUTURE DOMAIN CORP. (C) 1986-1990 V6.0209/18/90FUTURE DOMAIN CORP. (C) 1986-1990 V6.0105/31/90FUTURE DOMAIN CORP. (C) 1986-1989 V6.0A7/28/89FUTURE DOMAIN CORP. (C) 1986-1989 V5.0C2/14/89SEAGATE SCSI BIOS SCSI BIOS 2.00 (C) Copyright 1987 SeagateST01 v1.7 (C) Copyright 1987 Seagatesea%s: board RAM failure %s: scsibus %s: parity error %s: done? %s: resetting %s: can't malloc scb seascbtimed out AGAIN %s: wrong state 0x%x %s: polled reselection was not for me: 0x%x %s: expecting IDENTIFY message, got 0x%x %s: target %02x lun %d not disconnected %s: timeout waiting for STAT_REQ %s: arbitration lost %s: arbitration timeout %s: after successful arbitrate: no STAT_BSY! %s: parity error detected %s: !STAT_BSY unit in data transfer! no data address! sea: command aborted by target %s: message_reject received %s: unknown message in: %x %s: sent message abort to target sea: unknown phase %s: timeout in data transfer )0)0)0)У)0)0)0)О)0))0))0)œ)"))@)@)Ф)))А) uha_attach: bus_space_map failed!uha_attach: u14_find failed!%s: couldn't establish interrupt u14_find: illegal drq setting %x u14_find: unknown model %x u14_find: illegal irq setting %x u14_find: board timed out during reset %s: uha_start_mbox, board not responding should call debugger here (uha_isa.c)%s: BAD MSCP RETURNED! wds%s: scsibus %s: can't map i/o space wdsattach: wds_find of %s failed%s: mbi not in round-robin order %s: bad mbi scb pointer; skipping %s: unrecognized interrupt type %02x%s: can't malloc scb wdsscbwdsbuf%s: Is this an error? %s: VENDOR ERROR %02x, scsi %02x wds?%s: failed reset!!! %2x %s: waiting for controller to become ready.. failed %s: no request slot available in getvers()! : version %x.%02x %c%s: reset! %s: UIO is untested and disabled! %s: DMA beyond end of ISA %s: wds_scsi_cmd, more than %d dma segs %s: wds_scsi_cmd, I/O too large for bounce buffer timed out AGAIN %s: couldn't map registers %s: can't allocate memory for command queue%s: can't create map for drq %d %s: can't map i/o space %s: can't subregion i/o space NE1000NE2000NE2000 (RTL8019)%s: where did the card go?! %s: %s Ethernet %s: couldn't establish interrupt handler we    isapnp%s%d: changing IRQ %d to %d : can't map nic i/o space : can't subregion i/o space : where did the card go? : can't map shared memory 168: %s (%s-bit) %s: configuration failed %s: can't wildcard IRQ on a %s %s: can't establish interrupt %s: failed to clear shared memory at offset 0x%x we_write_mbuf: negative lenWD8003SWD8003EWD8003EBWD8003WWD8013EBTWD8013WWD8013EPWD8003EPWD8013WCWD8013EBPWD8013EPCSMC8216/SMC8216CSMC8216TSMC8416C/SMC8416BTSMC8416T)А)))))))))))))))))))))))))))))))))а)Р)))) )4)4))elink_reset: can't allocate state storagePP0 ec %s: can't map nic i/o space %s: can't map asic i/o space %s: can't map shared memory 168%s: 3Com 3c503 Ethernet (%s-bit) %s: configuration failed %s: wildcarded IRQ is not allowed %s: invalid IRQ %d, must be 3, 4, 5, or 9 %s: memory test failed %s: can't establish interrupt ))))А)З)Р))))Ј)%s: failed to clear shared memory at offset 0x%x ec_write_mbuf: negative leneg%s: can't map i/o space : ROM v%d.%02d %dk address %s %s: configure card command failed egstart: no header mbuf%s: invalid packet size %d; dropping %s: device timeout el: address %s %s: invalid packet size %d; dropping %s: device timeout ep_isa_probe: can't allocate state storageep_isa_probe: can't map Etherlink ID port ep_isa_probe: ignoring model %04x ep_isa_attach: can't map i/o space:UnknownEtherExpress 163C507StarLAN FiberEN100StarLAN 10ie%s: %s does not have soft configuration %s: can't find shared memory %s: msize mismatch; kernel configured %d != board configured %d *3COM*3c507 probe: can't map Etherlink ID port %s: can't map 3C507 RAM in high memory %s: irq mismatch; kernel configured %d != board configured %d %s: maddr mismatch; kernel configured %x != board configured %x ieprobe mapped memory size out of range ieprobe mapped memory address out of range : address %s, type %s R%d %s: device timeout %s: receiver not ready ietint: command still busy! %s: send aborted %s: late collision %s: no carrier %s: lost CTS %s: DMA underrun %s: too many collisions %s: receive descriptors out of sync at %d iestart: no header mbuf%s: tbuf overflow %s: abort commands timed out %s: disable commands timed out %s: TDR command failed %s: transceiver problem %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status %x %s: multicast address setup command failed %s: configure command failed %s: individual address setup command failed exex: WARING: board's EEPROM is configured for IRQ %d, using %d ex: invalid IRQ. : address %s, connecter TPE BNC AUI ??? PCnet-ISADEPCANE2100BICC Isolanunknown%s: address not found %s: could not map I/O-ports: %s Ethernet %s: failed to clear memory %s: couldn't allocate memory for card %sNo-maskable interrupt, may be parity error ; stopped loggingstray interrupt %d%s irq %d level %x mask mismatch: %x vs %xintr_alloc: bogus type%s: isa_intr_establish: can't malloc handler info %s: isa_intr_establish: bogus irq or type intr_disestablish: bogus irq %dintr_disestablish: handler not registeredisaattach: ISA bus already seen!_isa_bus_dmamap_load_mbuf: not implemented_isa_bus_dmamap_load_uio: not implemented_isa_bus_dmamap_load_raw: not implemented/usr/src/sys/arch/i386/compile/RAMDISK_CD/../../../../arch/i386/isa/isa_machdep.c%s:%d -- Already 0! clock_batteryROM_cksumconfig_unitmemory_sizefixed_diskinvalid_timeRTC BIOS diagnostic error %b clockrtcWARNING: NVRAM century is %d but RTC year is %d WARNING: Setting NVRAM century to %d WARNING: preposterous time in file system WARNING: invalid time in clock chip WARNING: RTC time at or beyond 2038. WARNING: year set back to 2037. WARNING: CHECK AND RESET THE DATE! WARNING: file system time much less than clock time WARNING: clock time much less than file system time WARNING: using file system time npxnpxdna vector not initialized%s: WARNING: Pentium FDIV bug detected! : using exception 16 : error reporting broken; not using npxintr: p = %lx, curproc = %lx, npx_type = %d npxintr from nowhererecursive npx trap; cr0=%x Unimplemented FPU Opcode at eip=%p : %02x %02x (%02x+%d) /%d INTERNAL BUG in wm-FPU-emu version BETA 1.4invalid operationdenormalized operanddivide by zerooverflowunderflowloss of precisionstack underflowstack overflowFP emulator: Unknown Exception: 0x%04x! FP emulator: Internal error type 0x%04x math emulator called from supervisor mode*Ѓ****7*`*Ї***Ј**†*ׅ*$*Р*p*д*д*д*6**Є***<*<*<*7*0**P*`*p*Ѐ*Ў*Ў*Ў*Ў*А*Р*а**Ы*****Ў* *0*7*`*Ў*g*Ц*Ў*а**Ь***p*pccomisapcmciaisapnpcomattach: io mapping failedcomattach: impossible: unknown uart : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, 16 byte fifo : st16650, no working fifo : st16650, 32 byte fifo : ti16750, 64 byte fifo : xr16850 (rev %d), 128 byte fifo comattach: bad fifo typecomattach: IRQ but can't have one%s: console @*P*`*p*Ѐ*а***G*G*G*G*G*G*G*G**comprms%s: %d silo overflow%s comcninit: mapping failedwsdisplay%s: screen %d-%d added (%s, %s emulation) %s: screen %d deleted wsdisplay at %sdmuxwsdisplay_common_attach: no memory: console (%s, %s emulation), using %s wsdisplaytty() on ctl devicewsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wswaitwsmoused_sleep   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000wscons: copybuffer memory malloc failed vt100U+U+Јc+@u+V+W+wsemul_vt100_output_c0c1: ESC in kernel output ignored [+[+[+[+[+[+[+tZ+ЄZ+аZ+Ѐ[+Ѐ[+Ѐ[+РZ+0[+@[+[+[+[+[+[+[+[+[+[+[+[+P[+^+^+^+^+^+^+^+^+Х^+Х^+Х^+Х^+^+е^+е^+е^+^+^+^+^+^+^+^+@\+а\+^+^+^+^+ ]+0]+^+^+^+^+^+G]+@]+^+^+Ј]+^+^+^+^+^+]+]+`^+^+^+^+^+^+^+^+^+^+^+\+^+^+^+^+^+^+^+Ё^+^+^+^+^+^+^+^+^+^+^+У]+]+^+^+^+^+^+^+^+^+^+^+^+^+]+а]+З]+_+`_+`_+`_+`_+`_+`_+`_+`_+`_+`_+A_+`_+`_+`_+`_+`_+`_+`_+`_+`_+`_+`_+3_+`_+P_+`_+`_+_+ _+Ч_+`+`+`+`+`+`+`+`+`+`+`+`+`+`+_+_+_+`+`+`+`+`+`+`+`+`+`+а_+`+_+`+_+`+`+`+`+`+_+`+`+`+`+`+_+_+`+`+`+`+`+`+_+`+b+b+Рa+b+b+Зb+Hc+Hc+Pc+Hc+Pc+Hc+Pc+Pc+Pc+Pc+Pc+Pc+Pc+Pc+Pc+c+c+c+c+c+c+c+c+c+c+Pc+5c+Pc+Pc+@c+@c+[>24;20;0cP2$u/%s%d\P0!u%5\[?62;6c[%d;%dR[?13n[?21n[?27;1nSo+to+o+o+Ѐo+Ѕo+o+Аo+o+o+o+o+o+o+o+o+o+o+o+o+o+o+Еo+o+Рo+Хo+o+аo+o+o+еo+еo+еo+еo+еo+еo+еo+еo+o+o+o+o+o+o+o+o+o+o+@p+Pp+.q+.q+.q+.q+.q+.q+.q+.q+Јp+.q+.q+.q+.q+.q+.q+.q+.q+.q+Дp+Рp+wsemul_vt100_handle_dcs: bad type %dr+r+r+r+r+r+r+r+r+r+r+r+r+r+r+r+r+r+r+"s+Ps+`s+`s+`s+ps+Иs+t+t+t+t+t+t+t+t+t+t+t+t+t+t+t+t+t+жs+t+t+t+t+t+t+t+t+t+t+t+t+t+t+t+t+s+t+t+t+t+t+t+t+t+t+t+t+t+t+t+t+t+t+t+t+t+t+t+t+t+t+t+  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_[34~[33~[32~[31~[29~[28~[26~[25~[24~[23~[21~[20~[19~[18~[17~[15~[14~[13~[12~[11~OSOROQOPOyOxOwOvOuOtOsOrOqOpOIOMOjOkOlOmOnOo[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCu+@v+@v+@v+u+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+@v+u+u+v+v+v+v+wsevent_readwskbdwskbd at %s (mux %d ignored for console) mux %dcannot load keymap: console keyboard, using %s wskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s ++++++++++++++++++++++++++++++++++0+Ѐ+Ѐ+Ѐ+Т+Т+Т+Ď+Ď+Ď+++P+++V+p+C+0+А+а+0+А+++0+0+0+0+0+0+0+0+0+0++ABCDEFGHIJKLMNOPQRSTUVWXYZh+Ѕ+а+ŗ++wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux_setmax: no memwsmux_setmax: no memorywsmuxwsmux: attach out of memory wsmux_attach: error=%d %s%d%s: connecting to %s %s: disconnecting from %s @+Є++|++ܰ+\6pckbdprobe: reset response 0x%x pckbd_enable: command error pckbd_disable: command error pckbd 1!2@3#4$5%6^7& 8* 9( 0) -_ =+! qwertyuiop[{]} as d!f"g#h$j%k&l';:('")`~*+\|,z-x.c/v0b1n2m3,<4.>5/?67*89 :;<=>?@ABCD E F G7H8I9J-K4L5M6N+O1P2Q3R0S.W X  / ,-.2"36&7/{ 8([ 9)] 0=} ?\ qQ@z+*'() +#',y2mM3,;4.:5-_V<>| '`+*~)^2"@3#4$6&7/{ 8([ 9)] 0=} +? |'()+'*3,;4.:5-_V<>\ '`|^~ +?\'()V<>| '`|^~ \'()|V<> \`^~&12~"3#'4{(5[-6|7` _8\ 9^ 0@ )] =+}az$q'm(%)+*,w2,?3;.4:/5!V<> 2"34$5%6&7/ 8( 9) 0= '? ^{[+*}]'@(#)\|+3,;4.:5-_V<> 1!2"34$5%6^7& 8* 9( 0) -_ =+('@)``+#~V\|2"6&7' 8( 9) 0 -= ^~@`[{';+(:*)+]}ps\_y{}\|1!|2"@3#4$~6&7/ 8( 9) 0= '? [+*]'({)\+}3,;4.:5-_V<> !1@-2_/3#;4$:5,6^.7& =8* [9( ]0) ?+' xX%eE{wW}!'(")`~+qQ|-34fF5\9 &1|2@"3#'4(56^7 !8 9{ 0} ) -_az[$*]q'm(%)+`,w2,?3;.4:/5=+~V<>\ `~)<> W  FE7JG7H8I9K4L5M6O1P2Q3R0S.-N, [{ ]}'",<.>pyfgcrl/?=+o e!u"i#d$h%t&n's(-_,;:-q.j/k0x1b3w4v5z:; <=>?@ABCDW X 6^6,7&7.qQwWeErRtTyYuUiIoOpP[{]}aAsS dD!fF"gG#hH$jJ%kK&lL';:('",zZ-xX.cC/vV0bB1nN2mM3,<4.>5/? 6^6,7&7. -_ =+qQwWeErRtTyYuUiIoOpP[{]}aAsS dD!fF"gG#hH$jJ%kK&lL';:('")`~+\|,zZ-xX.cC/vV0bB1nN2mM3,<4.>5/? 1+|2"@3*#46&7/ 8( 9) 0= '? eEz[!]'({) +$},y3,;4.:5-_V<>\ '? ^`~!]['({2"@3#4$6&7/{ 8([ 9)] 0=} '? <>+*'()\|+3,;4.:5-_V<> 1!2"3#4$6&7/ 8( 9) 0= '?\ qQ@+*~'({[)|+}]3,;4.:5-_V<> 1!2@3#4$5%6 =+[{'()'"+]}5;:S.V\|s/?2'3^#4+$5%6&7/{ 8([ 9)] 0=} *?\ -_qQ@I~'(i)"+,;345.:V<>| ''+,;`eEoOaAsS&lL,zZ-xX.cC1nN 1'~2"3+^4!5%6/7=` 8( 9) qQ\wW|zZiIQP!fF["gG]$jJ'$()0+qp,yY>-xX#.cC&/vV@0bB{1nN}3,?;4.:5-_*V< 1!~2"3#^4$5%6&7/` 8( 9) 0= '? +*qQ\wW|zZ!fF["gG]%kK&lL'()+,yY/vV@0bB{1nN}2mM3,;4.:5-_V<> $6O46 Ң6Z6F6r6J6M:64ԥ6 6 6 6 6CX6Kި6t6@#~6t6t6 t6t6H@t6 J<6 [6ĩ6(6X6 d6 |6 d6E6iЦ6J6=6W*6 د606 N6V6fdcfdcattach: couldn't map I/O ports drive %dfdcresult: overrun %s: %sinvldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b cyl %d) ctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_damend_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_am (st0 %b st1 %b st2 %b cyl %d head %d sec %d) 1.2MB/[1024bytes/sector]2.88MB360KB/x720KB/x720KB360KB/PC360KB/AT1.2MB1.44MBfd: %s %d cyl, %d head, %d sec : density unknown u+Ѐ+Ї+А+З+Р+%s: drive %d: unknown device type 0x%x soft error stray interrupt++Ш+U++Р+Ј+2++e++++P++Р+timeouthard errorctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_damend_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_aminvldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) floppy diskfictitiousfdformFEATURES = 0x%x, FLAGS = 0x%x, CHIP = 0x%x BUGS =0x%x Attempt to queue invalid SCB tag %x:%x ahc_isa_irq: illegal irq setting %d ahc_isa_idstring: BIOS biffed it at 0x%lx 0123456789ABCDEFADP7756ADP7757ahc_isa_match: irq mismatch (kernel %d, card %d) ahc_isa_probe: can't allocate slot markerahc_isa_attach: could not map slot I/O addressesahc_isa_attach: could not read ID stringahc_isa_attach: ahc_isa_irq failed!Adaptec AHA-284x SCSI (BIOS enabled)Adaptec AHA-284x SCSI (BIOS disabled)ahc_isa_attach: Unknown device type %s: %s aic7770 >= Rev E, aic7770 <= Rev C, %s: %s%s: couldn't establish interrupt %s: Reading SEEPROM...checksum error done. %s: No SEEPROM available eisa%s at %s slot %d %s: can't map I/O space for slot %d %s slot %d not configured by BIOS? 0123456789ABCDEF%sdevice %sunknown %s device %s%sahb%s: board not responding should call debugger here (aha1742.c)ADP0000ADP0001ADP0002ADP0400ahbattach: could not map I/O addressesahbattach: ahb_find failed!Adaptec AHA-1740 SCSIAdaptec AHA-1740A SCSIAdaptec AHA-1742A SCSIAdaptec AHA-1744 SCSIunknown model!: <%s> %s: couldn't map interrupt (%d) %s: couldn't establish interrupt at %s %s %s: BAD ECB RETURNED! %s: unexpected interrupt %x %s: host_stat %x %s: target_stat %x C+C+А+А+А+А+А+А+А+А+А+А+А+Ѐ+А+А+А+А+А+А+А+А+А+А+А+А+А+А+А+А+++%s: can't malloc ecb ahbecbself test failed, val = 0x%x .illegal int setting %x +Ч+а+з++++%s: done? %s: ahb_scsi_cmd, more than %d dma segs timed out AGAIN FEATURES = 0x%x, FLAGS = 0x%x, CHIP = 0x%x BUGS =0x%x Attempt to queue invalid SCB tag %x:%x ahc_eisa_irq: illegal irq setting %d ADP7770ADP7771ahc_eisa_attach: could not map I/O addressesahc_eisa_attach: ahc_eisa_irq failed!Adaptec AIC-7770 SCSI (on motherboard)Adaptec AHA-274x SCSIahc_eisa_attach: Unknown device type %s: %s %s: couldn't map interrupt (%d) Level SensitiveEdge Triggered%s: Using %s Interrupts aic7770 >= Rev E, aic7770 <= Rev C, %s: %s%s: couldn't establish interrupt at %s %s: interrupting at %s ATT2408NEC8200DPTBC01DPTA701DPTA502DPTA501DPTA420DPTA412DPTA411DPTA410DPTA402DPTA401DPT2402: can't map i/o space HBA on invalid IRQ (%d) can't map interrupt (%d) can't establish interrupt at %s %s: readcfg failed - see dpt(4) USC024UltraStor 24f SCSIunknown model!: %s uha_attach: could not map I/O addressesuha_attach: u24_find failed!%s: couldn't map interrupt (%d) %s: couldn't establish interrupt at %s %s: interrupting at %s u24_find: illegal irq setting %x u24_find: board timed out during reset %s: uha_start_mbox, board not responding should call debugger here (uha_eisa.c)%s: BAD MSCP RETURNED! +,+++T+66@66н6@6е6а6@6Ш6Т6@6К6А6Є/SMART-2/ECPQ4030SMARTCPQ4020IEASCPQ4010IDA-2CPQ4002IDACPQ4001: can't map i/o space : controller on invalid IRQ : can't map interrupt (%d) : can't establish interrupt at %s %s: Compaq %s TCM5090TCM5091TCM5092TCM5093TCM5094TCM5095TCM5098TCM5920TCM5970TCM5971TCM5972: can't map i/o space3Com 3C509-TP Ethernet3Com 3C509 Ethernet3Com 3C579-TP Ethernet3Com 3C579 Ethernet3Com 3C509-Combo Ethernet3Com 3C509-TPO Ethernet3Com 3C592 Etherlink III3Com 3C597 Fast Etherlink TX3Com 3C597 Fast Etherlink T43Com 3C597 Fast Etherlink MIIunknown model!: couldn't map interrupt (%u) : couldn't establish interrupt at %s : %s, %s,eisa_intr_map: bad IRQ %d eisa_intr_map: changed IRQ 2 to IRQ 9 eisa_intr_string: bogus handle 0x%xirq %deisa_intr_establish: bogus handle 0x%xPNP00A0ahaADP1502aicADP1520aicADP2015aicPNP0500comPNP0500pccomPNP0501comPNP0501pccomPNP0600wdcPNP0E00pcicSCM0469pcicAEI0218pcicPNP80D3nePNP80D4nePNP80D5nePNP80D6nePNP80D8lePNP80F7epPNP80F8epPNP8123wePNP8124wePNP8125wePNP8126wePNP8127wePNP8128wePNP812AwePNP81C3wePNP81C4wePNP81C5wePNP81C6wePNP81C7wePNP81C8wePNP8200lePNP8201lePNP8231lePNP828ClePNP828DlePNPB000sbPNPB001sbPNPB002sbPNPB003sbPNPB006mpuPNPB02FjoyPNPC000comPNPC000pccomPNPC001comPNPC001pccomCSI2203leUMC9008ne@@@1980neSMC8416weTCM5051efAWL4800an@P@0001joy@P@1001joy@P@2001joyAZT3001joyCSC0001joyCSC000FjoyCSC0101joyCTL7002joyESS0001joyESS0005joyOPT0001joyCDC0001joyASB16FDjoyESS1868essESS1869essESS1878essESS1879ess@X@1001mpuAZT2001mpuCSC0003mpuOPT0002mpu@@@2001sb@X@0001sbADS7150sbADS7180sbAZT1008sbCTL0001sbCTL0031sbCTL0041sbCTL0042sbCTL0043sbCTL0044sbCTL0045sbASB1631wssCSC0000wssCSC0100wssCSCA800wssOPT9310wssCDC0000wss@@@1001ymYMH0021ymMFRAD10rtAZT0500wdcCSC0004wdcCTL2011wdcESS0002wdcisapnp%s: Too many pnp cards 0123456789ABCDEF %s 0x%x/%d,%d "%s, %s, %s, %s" at %sportmemmem32irqdrqcompccom%s: error in region allocation (isapnp probe)%s: bus map failed: no cards found : read port 0x%x resource conflict not configured %s: card %d violates PnP spec; byte %d %s: Maximum tag size exceeded, card %d %s: No current device for tag, card %d Too many tag errorsResource timeout%s: %s, card %d : can't allocate memory for command queue : couldn't allocate memory for card :ef: address %s efstart: no header mbuf%s: adapter failure (%x) %s: eeprom failed to come ready %s: device timeout %s: can't subregion i/o space NE1000NE2000NE2000 (RTL8019)%s: where did the card go?! %s: %s Ethernet %s: couldn't establish interrupt handler biosPCPC/XTPCjrAT/286+PC/XT+PS/2 25/30PC ConvertiblePS/2 386+: %s(%02x) BIOS, date %c%c/%c%c/%c%c, BIOS32 rev. %d @ 0x%lx apmpcibios%s: ROM list:! 0x%05x/0x%x%s:%dF,PF,@F,0F, F,F,F,E, I,0I,@I,PI,`I,pI,%s at %s function 0x%xapmpower management disabledreal mode interface already connectedinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateNo pending eventsNo APM presentunknown error code?apm0: APM %s: %s (%d) get capabilities1O,ЃO,P,P,P,P,eP,P,P,@O,O,P,Q,get eventpower management enableapm0: APM engage (device %x): %s (%d) set power state: Power Management spec V%d.%d system defaults faileddisconnect failed%s: disconnected get power statusapmlk%s%s: failed to create kernel thread, disabledapmev%s: dev %04x state %04x ioctl get power statuscpu pcibiospcibiosprobe: 0x%lx:0x%lx at 0x%lx[0x%lx] : rev %d.%d @ 0x%lx/0x%lx [2][x][1]%s: config mechanism %s%s, special cycles %s%s, last bus %d %s: Warning, unable to fix up PCI interrupt routing %s: interrupt fixup failed %s: PCI bus #%d is the last bus %s: PCI IRQ Routing Table rev %d.%d @ 0x%lx/%d (%d entries) %s: bad IRQ table checksum %s: bad IRQ table size %s: unsupported IRQ table version %s: no memory for $PIR %s: PCI IRQ Routing information unavailable. %s: PCI BIOS has %d Interrupt Routing table entries pcibios_get_statuspcibios_get_intr_routingpcibios0service not presentfunction not supportedbad vendor IDdevice not foundbad register numberset failedbuffer too small%s: %s - unknown return code 0x%x %s: %s - %s %s: PCI Exclusive IRQs: %d PIR Entry %d: Bus: %d Device: %d INT%c: link 0x%02x bitmap 0x%04x 4,Іq,І.,Іp,І$,І@$,ІL$,І$,І$,І$,EX`,EP,f,f,,,,t0,1,9@," t,"t,й3,йC,pciintr_link_alloc: bus %d device %d: ignoring link 0x%02x pciintr_link_alloc: bus %d device %d link 0x%02x: ignoring PIRQ 0x%02x pciintr_link_init: no PIR table pciintr_link_init: bus %d device %d link 0x%02x: bad irq bitmap 0x%04x, should be 0x%04x pciintr_guess_irq (stage 1): guessing PIRQ 0x%02x to be IRQ %d pciintr_link_fixup: PIRQ 0x%02x is already connected to IRQ %d pciintr_link_fixup: PIRQ 0x%02x not connected, assigning IRQ %d pciintr_link_fixup (stage 2): assigning IRQ %d to PIRQ 0x%02x pciintr_link_fixup: piirq 0x%04x pci_intr_route_link: PIRQ 0x%02x: no IRQ, try "option PCIBIOS_IRQS_HINT=0x%04x" preserved BIOS setting failedpci_intr_route_link: route PIRQ 0x%02x -> IRQ %d%s pci_intr_post_fixup: PCI IRQs: %d; ISA IRQs:Interrupt not connected; no need to change.pci_intr_header_fixup: no entry for link 0x%02x (%d:%d:%d:%c) WARNING: ignored WARNING: missing fixed up WARNING: preserving%d:%d:%d %04x:%04x pin %c clink 0x%02x irq %d stage %d%s irq %d %s: no compatible PCI ICU found: ICU vendor 0x%04x product 0x%04x%s: PCI Interrupt Router at %03d:%02d:%01d (%s)PCI bridge %d: primary %d, secondary %d, subordinate %d [%s]----------------------- device vendor product register space address size -------------------------------------------- --------------------------[%3d devices bogus] I/O APICLocal APICBIOS PROM666PCI I/O memory spacePCI I/O port spaceSystem BIOS SettingWARNING: can't reserve area for %s. Physical memory end: 0x%08x PCI memory mapped I/O space start: 0x%08x PCIBIOS fixup stageWARNING: unknown PCI device header. portmem %02xh %s 0x%08x 0x%08x NGOK [%s] No available resources. fixup failed pci_addr_fixup: fixup failed. (new address=%#x) new address 0x%08x Resource conflict. %03d:%02d:%d %04x:%04x ,м,,Є,, ,,,Ќ, ,,x,м,$,Ф,,H,l,̌,Ф,,Ѐ,Ь,,Ф,,, ,`,,м, ȑ,,D,,Ј, Ȕ,,8,Е,P,@,\,и,Ф,,    cardslot slot %d flags %x cardbus at %s subordinate bus %dpcmciabus at %s%s%s: unable to create event thread for slot %d create_slot_managercardslot_eventcardslotevno cardbus on %sno 16-bit pcmcia on %scardslot_event_thread: unknown event %dcardbus: bus %d device %d cacheline 0x%x, lattimer 0x%x %s: failed to map memory ,a,a,a,a,a,a,a,a,a,a,a,a,a,@,a,a,a,a,a,a,a,a,a,a,,,,no room for cardbus_tagcardbus_attach_card: failed to read CIS , %s (manufacturer 0x%x, product 0x%x) %s at %s dev %d function %d "%s%s"%s: cannot detach dev %s, function %d cardbus_io_find: bad requestcardbus_io_find: expected type i/o, found mem cardbus_io_find: void region cardbus_mem_find: bad requestcardbus_mem_find: expected type mem, found i/o cardbus_mem_find: expected mem type %08x, found %08x cardbus_mem_find: void region cardbus_mem_find: 64-bit memory mapping register cardbus_mem_find: reserved mapping register type io alloccardbus_read_exrom%s: bad header signature in ROM image %u: 0x%04x %s: out of memory %s: bus_space_subregion failedno memory for rbus instancerbusrbus rootWP6WQ66WRV6`evr6bev_6deVL63c656C-TX Ethernet3c656B-TX Ethernet3c656-TX Ethernet3c575C-TX Ethernet3c575B-TX Ethernet3c575-TX Ethernet: can't map i/o space xl_cardbus_attach: impossible: 3Com %s%s: unable to map function status window : couldn't establish interrupt at %d: irq %dfxp_cardbus_attach%s: failed to allocate mem and io space: %s %s : couldn't establish interruptat %d irq %dVadem VG469Vadem VG468Cirrus PD672XCirrus PD6710Intel 82365SL rev 2Intel 82365SL rev 1Intel 82365SL rev 0Unknownpcic%s controller %d: <%s> has sockets A and B A only B only pcmcia0,00,11,01,1pcic_create_event_thread: unknown pcic socket%s,%s%s: unable to create event thread for sock 0x%02x pcic_create_event_threadpcicevpcicsspcic_event_thread: unknown event %dunknown pcic socketpcmcia at %s controller 0 socket 0 controller 0 socket 1 controller 1 socket 0 controller 1 socket 1pcic_queue_event: can't allocate eventpcic_attach_card: already attachedpcic_chip_mem_map memt is boguspcic_chip_mem_unmap: window out of rangepcic_chip_io_map iot is boguspcic_chip_io_unmap: window out of range: can't map i/o space : can't map mem space %s: irq %d, %s: no irq, polling enabled : can't map i/o space : can't map mem space %s: PCI interrupts not supported %s: couldnt map interrupt %s: irq %d, %s: no irq, polling enabled %s: can't map high i/o space %s: irq %d pcmcia pcmcia_card_attach%s: error %d detaching %s (function %d) , "%s%s (manufacturer 0x%x%sproduct 0x%x)at %s function %d "pcmcia_function_init: function is enabledpcmcia_function_enable: function not initialized%s: CIS checksum failed @,,,,,,,,,,С,Р,Р,,В,%s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: , %s %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecifiedmulti-functionmemoryserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus Adapterunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace- %lx%s%lx; memspace@ %lx%s%lx%s%lx; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS ,,, ,0,@,P,`,p,Ѐ,А,Р,а,pcmcia_parse_cis_tupleV1-1FD605 PCMCIA EtherNet CardSVEC%s: using CIS quirks for , %s %s: couldn't establish interrupt : function enable failed : unexpected number of memory spaces %d should be 0 : unexpected number of I/O spaces %d should be 1 : can't allocate i/o space : can't map i/o space port 0x%lx/%dep_pcmcia_attach: impossible, couldn't establish interrupt:j 7a 7zZ 7S 7 K 7B 7; 74 7- 7& 7- 7 7 7 7 7@ 7 7@ 7 7; 7л 7г 7@3 7Т 7 7Ђ 7} 7lk 7Ъ 7W 7H; 7Ъ 7R 7B 7@ 79 7; 7, 7* 7& 7`; 7 7 7Ъ 7 7; 7Ъ 7 7 7HT 7Ъ 7GC77л 77; 77 77; 7и7HT7Ю7Р7@7Ъ 7 7 7 CGCZ)IeI7`7B7ZIZIIIII0I0PI0- 7;7I0E- 707]I0E- 707PI  I(7!7- 7;7@"77л 7-/7777777е77Н77Ї77q7 ")Am7T7u M78717,7@&  @& 3BI0E@I0EHTI0E- 707@I@(#01.00CFE-10CompactCard EthernetXircom8041TX-10/100-PC-Card-V2SMCcorega FEther PCC-TXDFEther PCC-TXFcoregacorega FastEther PCC-TXcorega EtherII PCC-TDcorega EtherII PCC-Tcorega Ether PCC-TDcorega Ether PCC-Tcorega K.K.PCLAI-O DATAE-CARDLINKSYSDFE-670TXDDE-650Ver 1.0EtherFast 10/100 Integrated PC Card (PCM100)LinksysPCMCIA LANFast EthernetETHER-C16Fast-Ethernet10/100 Ethernet CardiPortEthernet CardR01NIC-2000pGVCTAMARACK004743118001ANDCLNT-10TN1.0VFastEthernetNE2000DCN40BC EthernetCNetP/N: EEN10B Rev. 00Seiko Epson Corp.V1-1FD605 PCMCIA EtherNet CardSVECAdapterEthernetW89C926ETHERNETEN2212ACCTONEP401 Ethernet NE2000 CompatibleRPTICISV100EP400RPTI LTD.DE-660+DE-660D-LinkUE2212PCMCIADEPCM-XXDIGITALPE-200PMX AMB8002TAmbiCom Inc: unexpected I/O space configuration : no suitable config entry : can't get subregion for asic : function enable failed : can't map NIC I/O space : can't map ASIC I/O space port 0x%lx/%d: can't match ethernet vendor code no irq %s: couldn't establish interrupt %s: can't alloc mem for enet addr %s: can't map mem for enet addr %s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase : can't alloc i/o space : function enable failed : can't map i/o space port 0x%lx/%d: unable to detect chip! : couldn't establish interrupt MODEM XJ2288MEGAHERTZ: can't allocate i/o space : function enable failed : can't map i/o space port 0x%lx/%d, couldn't establish interrupt%s: couldn't establish interrupt : unknown uart : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, 16 byte fifo : st16650, no working fifo : st16650, 32 byte fifo : xr16850 (rev %d), 128 byte fifo comattach: bad fifo type9-:-:- :-0:-S:-e:-г:-г:-г:-г:-г:-г:-г:-г:-г:-Ј:-PCCARD-IDE/ATAPI AdapterSHUTTLE TECHNOLOGY LTD.F1PnPIDEEXP NinjaATA-Portable CD-ROM DriveDigital Mobile Media CD-ROM: can't handle card info : function enable failed : can't map first I/O space : can't map second I/O space port 0x%lx/%d,0x%lx/%dcan't allocate memory for command queue couldn't establish interrupt handler %s: couldn't enable PCMCIA function %s: couldn't establish interrupt handler : function enable failed : can't allocate i/o space : can't map i/o space port 0x%lx/%d, unable to get Ethernet address : couldn't establish interrupt %s: couldn't establish interrupt handler xe: card unsupported : function enable failed : io allocation failed : can't map io space port 0x%lx/%d, unable to get ethernet address , couldn't establish interrupt : address %s Q-Q-Q-Q-Q-Q-Q-%s: interrupt for dead card %s: device timeout xe_start: no header mbufVw77777Щ77З7Ѝ77w7i7PttVe7\7i7VR7w7i78VN767(7V!7777i7V77(77Х7Ѝ7Л7oo PM7`7k&h= = sPs!LA4111 Spectrum24 Wireless LAN PC CardSymbol TechnologiesEval-RevAPRISM 2_5 PCMCIA ADAPTERIntersilRoamAbout 802.11 DSCabletronAWP-100 Wireless PCMCIAAddtron11Mbps Wireless LAN PC CardNTT-MEVersion 01.01Wireless Card CMZ-RT-WPNECNANOSPEEDSMC2632WSMCVersion 01.02HFA384x/IEEEINTERSILISL37300PWL PCCL-11coregaWireless_LAN_PCCB-11corega_K.K.Wireless LAN PCCA-11Wireless LAN PCC-11corega K.K.: function enable failed : can't alloc i/o space : can't map io space port 0x%lx/%d%s: couldn't establish interrupt %s: already detached -4-L-D-x-@-Д--Ш-ray : failed to enable the card: can't alloc shared memory : can't map shared memory : card failed self test: status %d : unsupported firmware version %d NETWORK_NAME%s: firmware version %d %s: supported rates %0x:%0x:%0x:%0x:%0x:%0x:%0x:%0x %s: 802.11 address %s %s:%s: card failed self test: status %d %s: unable to correct, disabling %s: unexpected failure resetting hw [%d more] ray_intr_start%s: dropping tx packets device busy ray_recv: bad ccs index 0x%x %s: failed to update a promisc %s: intr: unknown command 0x%x P-Б-Ч-А-Y-ж-ж--Н-Y-Y-Y-Y-%s: intr: bad cmd index %d ray_download_params busyray_download_params issuecmd in usewaiting cmd: function enable failed : can't alloc i/o space : can't map i/o space no irq%s: already detached 2.01.11.0pre 1.0unknownusbLP-\-М-,-: USB revision %s, not supported %s: root device is not a hub %s: root hub problem, error=%d %s%s: unable to create event thread for usb_create_event_threadusbtaskunable to create task thread usb_create_event_thread taskusbevtusbtskusb at %susbreausbdet%s: event thread didn't die usbd_transfer: not doneusbsynusbd_start_next: error=%d usbdetusb_detach_wait: %s didn't detach 7 7 7 7п 7й 7Я 7У 7М 7Д 7Є 7{ 7r 7j 7[ 7S 7H 7@ 74 70 7XXXINTERRUPTEDSTALLEDSHORT_XFERTIMEOUTNOT_CONFIGUREDIOERRORTOO_DEEPNO_POWERSET_ADDR_FAILEDNO_ADDRIN_USEBAD_ADDRESSCANCELLEDNOMEMINVALNOT_STARTEDPENDING_REQUESTSIN_PROGRESSNORMAL_COMPLETION%dvendor 0x%04xproduct 0x%04x%x.%02x%s %s, class %d/%d, rev , addr %dusbdlyiface descout of data0 lengthusbd_fill_iface_data: bad descriptor(s): %s %s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. %s, %s port %d configuration %d interface %d%s: at %s (addr %d) disconnected XngejBBp@ f(  ptQF" b ' P       m uhub<- -Ь.. %s: %s %s: hub depth (%d) exceeded, hub ignored selfbuss%s: %d port%s with %d removable, %s powered %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s %s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: strange, connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d hid_start_parseBAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d # .& .0 .s .Ѐ . . . . . . .0 .@ .P .b .p .Р . .P .Ј .а . . . . . ...uhidev`. .Ќ.,. %s: %s, iclass %d/%d %s: could not read endpoint descriptor %s: unexpected endpoint %s: no report descriptor %s: %d report ids %s: no memory uhid at %s reportid %duhidev_intr: bad repid %d .Ш .p.Ь.8.(37ukbd.8... %s: attach failed, %s %s: was console keyboard This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). bad modifier sizetoo many modifier keyskey code size != 8too many key codeskey codes not on byte boundarymultiple key code arrays abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *+ , --_.=+/[{0]}1\|2#~3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,LMN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c..d\|e 2"#6&$7'%8(&9)'0--=.^~/@`0[{2]}3;+4:*5\_\|9mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/02'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$2*3m4%56;.7:/8!d<> 2" 3!4$"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]13@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~4'@5``d\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-`?./[0+*]1}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]2`3m4%56;.7:/8=+~d<>\ 1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?.eEz/[0!]34{5 2$}y6,;7.:8-_d<>\ -'?.^`~0!]/[34{ *7V-74,7V-7O`-7 -7Z/7V-7F.7.7J/7Mf07 .7 .7 .7 /7 J17XJ27 27 37 27 [17umass #.Ь#.L(.<).+.+.Ь,.2.Д2.Ќ3. %s: %s CBICBI with CCIBulk-OnlyunknownRBCSCSIUFIATAPIISD-ATA%s: using %s over %s %s: could not read endpoint descriptor %s: unable to get Max Lun: %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed $.$.$.$.$.$.`%.p%.g%.V%.w%.Р'.а'.а'.Р'.'.inout%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: Unknown state %d,.Ѐ-.-.А..-.А..S1.А1.1.%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s 3.Ђ4.p5.p6.а6.7.67.r7.%s: Get Max Lun failed: %s ( @ v @  @ @  W 1 Q `@  8.@  0 2 A` @  @  @ @ @ @ P0@ P@  A @ @ h@ } @ } } } @@ @ 85@   8.  L+ L ,9.L2@ D@   O  {@P9.o ! umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cbAZPZPZPurioPp>.а>.0@.A. %s: %s %s: setting config no failed %s: getting interface handle failed %s: couldn't get ep %d %s: missing endpoint uriorsuriowrF  @@@ @ @AA@:F:FP  !      @ @ @ @ A n n@n @nn@0f @  Q k k"k"k"k"k @^z F |aueN.0O.R.S.%s: EEPROM read timed out %s: MII read timed out %s: reset failed %s: %s %s: setting config no failed auemii%s: getting interface handle failed %s: couldn't get endpoint descriptor %d %s: missing endpoint %s: address %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: watchdog timeout %s: abort rx pipe failed: %s %s: close rx pipe failed: %s %s: abort tx pipe failed: %s %s: close tx pipe failed: %s %s: abort intr pipe failed: %s %s: close intr pipe failed: %s  {&"F@=n axeg.,h.Ьk.m.axe%d: read PHY failed axe%d: write PHY failed axe%d: getting interface handle failed axemii%s: %s axe%d: couldn't get ep %d axe%d: Ethernet address: %s %s: no memory for rx list -- packet dropped! sc->axe_udev/usr/src/sys/arch/i386/compile/RAMDISK_CD/../../../../dev/usb/if_axe.c%s: usb errors on rx: %s axe%d: usb error on tx: %s axe%d: rx list init failed axe%d: tx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s axe%d: watchdog timeout axe%d: abort rx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close intr pipe failed: %s cue..|.0.%s: read MAC address failed %s: reset failed %s: %s %s: setting config no failed %s: getting interface handle failed %s: couldn't get ep %d %s: address %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: cue_send error=%s %s: tx list init failed %s: rx list init failed %s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: watchdog timeout %s: abort rx pipe failed: %s %s: close rx pipe failed: %s %s: abort tx pipe failed: %s %s: close tx pipe failed: %s %s: abort intr pipe failed: %s %s: close intr pipe failed: %s dϼWg($g"  Yg$ϒWW WVp  W@Y@ b WRVWV `YYW Wx,VH 7hW b' pDP g H ' H7 `!7>#W?g0L0 H Qϟhϟ7 pPgpߟWWz nb'4' 6W W w W w w /B w zBz'P4w y'P4w y`0PP0zBzW. \'^ϟLiW3'ز'Ҵg`' 'ߗ rbdd$'r'd$ WbpWd d02 dbWdp r'xb'r@ 0d QWj j'j'Rljl`ϟh b r'rϗ ',wW" '' Ag0 0  @YIJg P |wwLdwww w~dPTp\p\`0    Sxd Ȃ ςd‰0`xω Sy‰0zߗ f h f h d02  b7Wh=$ dgw*f0 w f'w f  'wfD'F`'bhW  h lPgl dbWbpߗ  $ dg zfwW P'RW W wX'Zwp'rw' wd'fw@\'^w76'W WP'RT'V 4wW''.W ߗ nb'n'Rpnph?3WR      X T  D'''tD' | LH'Vr W IC `J |gQ Ibuߧ$"  ,  f$("` 4 >   ( ( ' W* 7* Ҳ < W* '  ''\'AgP gZ' ^ `ZAQϟ  Y' |Y  IZ` HAPYYW&~\AgZ' ^\ `ZAQ W~ @'' ' "AgZ^'\\ `ZPY`X I JX@D' }D@A7PW'vA@D't vA؟D'(g$Wz "g>. > T'R  @ x ''|  ~) } 'jjl'nnp'x'b'd t vr @zQ  v zQWR W 2g&  W#@@W @ @ ߟϟ w w  "g"w g"g"w " W Wz w   f  gw dWșgL  7 AHdwA`qWC!C!C!d$.,>DHP\`flpvtz~ $"*06<NRX\ &l *.4:DNZ^jr08<@HFT^dtx,0JVZ &.4HRd $*2808<DBH    $ ( 2 F J P T Z ` |       $ , 2 < F L P T Z ^ f l r x ~ |  $ @ D H N L R h l p v $ ( 0 6 < @ J P X V \ ` d     " 0 ~ ,>LP^d@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0kue|...Ѐ.%s: warm boot, no firmware download %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s %s: reset failed %s: %s %s: setting config no failed %s: loading firmware failed %s: getting interface handle failed %s: couldn't get ep %d %s: missing endpoint %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: address %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: kue_send error=%s %s: tx list init failed %s: rx list init failed %s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: watchdog timeout %s: abort rx pipe failed: %s %s: close rx pipe failed: %s %s: abort tx pipe failed: %s %s: close tx pipe failed: %s %s: abort intr pipe failed: %s %s: close intr pipe failed: %s {%1cdce\.,.x.X. %s: %s %s: no union descriptor %s: no data interface %s: could not read endpoint descriptor %s: unexpected endpoint %s: could not find data bulk in %s: could not find data bulk out %s: address %s %s: abort rx pipe failed: %s %s: close rx pipe failed: %s %s: abort tx pipe failed: %s %s: close tx pipe failed: %s %s: watchdog timeout %s: tx list init failed %s: rx list init failed %s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: no memory for rx list -- packet dropped! %s: usb error on rx: %s %s: usb error on tx: %s uplh..<.. %s: %s %s: setting config no failed %s: getting interface handle failed %s: couldn't get ep %d %s: missing endpoint %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: upl_send error=%s %s: tx list init failed %s: rx list init failed %s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: %u usb errors on intr: %s %s: watchdog timeout %s: abort rx pipe failed: %s %s: close rx pipe failed: %s %s: abort tx pipe failed: %s %s: close tx pipe failed: %s %s: abort intr pipe failed: %s %s: close intr pipe failed: %s url P.А.Ќ.Є. P %s: %s %s: setting config no failed urlmii%s: failed to get interface, err=%s %s: couldn't get endpoint %d %s: missing endpoint %s: read MAC address failed %s: address %s %s: tx list init failed %s: rx list init failed %s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: no memory for rx list -- packet dropped! %s: url_send error=%s %s: usb error on tx: %s %s: %u usb errors on rx: %s %s: watchdog timeout %s: abort rx pipe failed: %s %s: close rx pipe failed: %s %s: abort tx pipe failed: %s %s: close tx pipe failed: %s url_int_miibus_readreg%s: %s: bad register %04x url_int_miibus_writeregg h!3v 7 B6"  0k"^nFA|"wi_usb| .`...%s: setting config no failed %s: %s %s: getting interface handle failed %s: couldn't get endpoint descriptor %d %s: rx list init failed %s: tx list init failed %s: open pipes failed %s: already detached %s: abort intr pipe failed: %s %s: close intr pipe failed: %s %s: abort tx pipe failed: %s %s: close tx pipe failed: %s %s: abort rx pipe failed: %s %s: close rx pipe failed: %s invalid packet len: %x memsz %x max %x %s: wi_usb_send error=%s wi_send_packet%s:%s: invalid packet id sent %x read_record buf size err %x %x .Ї.А.З.з.з.Р.Ч.з.з.з.з.з.з.а.write_record buf size err %x %x ...Я... .Я.Я.Я.0.wiTXsync%s: usb error on tx: %s UGH RX UGH TX %s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: %u usb errors on rx: %s wi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet F.R.`.p.Р.Р.Ѐ.А.wiIDLwitxlwiusbthr  %c  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzOpenBSD3.6RAMDISK_CD#378 @(#)OpenBSD 3.6 (RAMDISK_CD) #378: Fri Sep 17 13:04:04 MDT 2004 OpenBSD 3.6 (RAMDISK_CD) #378: Fri Sep 17 13:04:04 MDT 2004 deraadt@i386.openbsd.org:/usr/src/sys/arch/i386/compile/RAMDISK_CD d'(TfX ` @ 04 Pp@     P  ` @ @@ @ @  l/e/a/]/U/Q/M/D/?/;/6/1/+/%/!//// / / / / / / / / /    cde%gh .!")*'+,&R-f6#$TiSjklYXWVUOIHD<;opqFGC:9@A>?wx0yz{12mn7[\]abLJK8Z^`(MNSS`x70{7(S@S`x70{7TSlS`x70{7SИS`x70{7SS`x70{7SS`x70{7SS`x70{70SHS`x70{7\StS`x70{7SРS`x70{7SS`x70{7SS`x70{7 S$S`x70{78SPS`x70{7dS|S`x70{7SШS`x70{7SS`x70{7SS`x70{7S,S`x70{7@SXS`x70{7lSЄS`x70{7SS@u7z7J8SPS\x7{7KxSАS\x7{7KSS\x7{7KSS`x7{7N|SДS`x7|{7PSS\x7|{7P8SPS@u7.{7dS|S`x7{7ZSț7\x7{7`S 7\x7{7`S,7\x7{7`SР7\x7{7`$TР7`x7{7cST7\x7{7`SА7\x7{7`Sд7\x7{7`S,7\x7{7`SМ7\x7{7`TS\x7{7`(T7\x7{7`TЈT\x7{7`LTd7\x7{7`P%Td7`x7{7cT7\x7{7`TL7\x7{7`T4T\x7{7`HT7\x7{7`HT7\x7{7`0T7\x7{7e`TxT\x7{7`Tl7\x7{7`(&Tl7Lx7{7hT07\x7{7`,TDT\x7{7` T T\x7{7` T7\x7{7` T7\x7{7`( T@ T\x7{7`T Tl T\x7{7` TИ T\x7{7` TЀ7\x7{7`'TЀ7\x7{7o T7\x7{7`(T7\x7{7o T T\x7{7`x T7\x7{7` TШ T\x7{7` T T\x7{7` TЀ7\x7{7``1TЀ7\x7{7e T T\x7{7`, TD T\x7{7`X T7\x7{7`p T7\x7{7` T`7\x7{7` T T\x7{7`TмT\x7{7`TT@u7|7qT7\x7{7`2T7\x7{7eT7\x7{7`,T 7\x7{7``TxT\x7{7`TT\x7{7`TT\x7{7`(T@T\x7{7`XTpT\x7{7`TРT\x7{7`T0T\x7{7`HT`T\x7{7`tTЌT\x7{7`TиT\x7{7`TT@u7{7ZDT\Tw7{7rpT7w7{7rTț7w7{7rTмTw7{7rTд7xu7{7rTд7u7{7rTд7w7{7rTh7\u7{7r<TTTxu7{7r<TTTu7{7rTШTu7{7rTД7xu7{7rTД7u7{7rTTu7{7r$TSu7{7r$TSv7{7r<TЀ7 v7{7r<TЀ7-_ { }xYYvw E--   <<cr39AAAAEEEIIIIDOOOOUUUYaoybuiltin@ `P0p/@/Ѐ//@////Ѐ// $( ,|RRSxS8TS@ 7///////////и/а/Ш/&///// `/@0/Ѐ//@/ /`/Ѐ/Р/p/ \/Q/@/B 3/ ./ )/ $// /// % /0+/@2/P8/`>/pD/"eYj$@@h>@@h@<`>` Bh@xM0Lp90j^Q 1W jvQ^Q09`0pj^r0@~100MW@ 1eX` @xj"` x@ h x jjjxP0jHj]jjHj]j&z=znx=z=1=21NyeXfxf1f21f|@fhie AWe@aj^Q q xe@z=zx=z jeAe^e@ h j "xee>00  0T0xee4T4x 44 x4@ 10z0?|eX y0jp]@j>] y j]]x0 yjp]e@@le "|e 0e]?*d# e]?*d"De"deBD@je 0e]?s@j:0jteAdjj]dldtdtjbtdt#dJtd^taj^e]QqeBD\|Qj`]Q\dT|^lAj^e^D!j^e^DjV]0eAX| 1f fQ4L=(d|e> 10eeLj"j eeTj"j eeeLj"jeeUj"jl0QuQ]Q 1e6E?>6ue^Pefj Bnj jDj^ j];&1;\nj ee^eTf &eFjj `nbn|n|n|ndd0fpffv`f=d(e`F& ~nbe^e^e^e^00000004l21l21l21l21l21l21l21l25~& nj nB~1jv4jv e BfAfj^jA 10jvFB 14A~14e"1jj xxx x  x x xxx xlx"Xx%0Dx%0x* x- x1 x20x2 x3x50x7 x80x< x=0xG xH0xK xL0xO xPDx[$@x] x^x`xixm xn0xn xoXxp xtxuxw xxXxyXxЃ|xЗxШwЭ xЮ0xй xк0x x0x xDxT xx x x0xm0x) ww9x. x/0x2w70x8 x:w>w@ 00x@ xAlxF xGxKlxR @XxRDxSxTwUlxe0wexkwuxzwzXx| w}0xЀlwЇwЌ%00xЍ xА 0xИ xО% wОwЧ wЩ0xЫ xЬXxЭXxЮDxЯ 0lxа xб0xвwг wгwе%@0xе0xм xо00xо xп x Xx) xDxax x00x x x x00x x x x%p0x`Xw xXw xxlx xlx xDw%xH xI,wLDxNxPxV xXx[ x\0x]0w^x`Xwi xkXwo*0xq"xy& xz"xЄ xЅXwІ xЇ xЉxЊxЍxЏxБ xГ xЕxИxЛXwПXwТxШlxЫ xЬXxиBxR0x x0x xlxw:Xx0x cXw xw x0w x x#0lw/K xAxYxZ x]w^xa3 Z]agikkm7/FE`7=/=/=/=/>/`>/:>/#>/ >/Ѐ=/D?/@3?/ ?/` ?/Ѐ>/Р>/>/ >/>/>/xdY0 xdY3^Y3`::hM5x412!`513!`M 4@PK:h1;p0Q1-pQ1)`(30Q2b:@!;p@KihY@Ki KiBDx@Dx] MHx]0? 0P`JR@J^XvXX@3^Y3RxXP1 oxPKjh:tdY%_hv[^@^Y0~h\Y^Y\y "^Y"x, 2yhxxZ Y2`^x03`6(3P6Z XV|2 x@2={-`)`@WxUhSTPR1VHxP0`00  0@xZ @1 TU"m3 I2Z^1i=) 1P11qX7!q"Q1\3D6@2D6Mi@Hi-Ma)p(U2ZD0D1(Q1`1a1=a11VTU"Aq@q @i@Q1$A1 ZQ2$0RA,Q10RAZ51 150 04 0 0 Q1L(wyk0d@:tvX3^Y30? 0xa ?i?xy~^Y0NQ5~^YNQ5JAyWss#rr[dYHrHbI0BD1Bl23^Y3L:(d16_Y60z[bzjdYBdYB\D1Bv : ;QR 0: =)1@1r1P1C9sD1[9s<9c9s F2cR [{:1c;1#sRk2C9s3{% r -k2~Yz\BdYBdYBz9I{9jIk@9jO{ dY n[CPKVk:t1 2e3g"M523^Y3HQ1h{kwkk{(3P6sR[ 3I-cX2\6@1.Q13\69j% k@1: ;QR 0: =)11P1WD1kr L{xLh dY D1 9z[B{I`03A79s k3^Y3~YBBkAkA{BkAkA{B{LkAxD1B{LkAx <b 1F5D5n6|Z L :lx2lh &|"|  0  ZLxZ YLxx0003X  # ##1]|L 6022ԙPL 0I q|H602I 3}lLL VYl9|dY 9|ldYDl2l3^Y3=zB|=z6_Y60 dY Blh\ 9sl2|~\vXXZX6_Y60 l\l2||lDKlL|Bl \9zB]lvX6_Y60|]|h7 |l  ##  h7Xٲ ٲRH1 &} [&}4}@}2`[@mL} 2ٲٲ[8m[Bm [2m[bmdY"m\ٲnh\l]!ٲR[PUQmdYXE062_}dY]ٲ 062]ٲ|}VY [mBv}@xm Mz}]mlVY [mmB}@m Mx]x2[@1\[ \ \mmVYx ~!ckI@[mVY@[m]~~ Mx@[~]~~!ckVYxVYm@[}m2x%bC}@[}mBxmdYBx@m Mx@[mx!0? 0`@KhR n! BndYB dY B!dYR[ZD^2VY2~D^2@[8nZ8~ Mx @[~!ck@0A1 B C 10 p 0p pp 0p ppp p\p$pp- p.p5 p6pp; p<pp? p@ppC pDHptppЯ pв4pдppн pо pп p0pp ppp p\p p \p4p@ pop p p p pp ppp po' p)pS pTpp\ p]pp` papg phpj pko~oЁoЃoЏpЙ pКpМ pНpХ pЦppг pдop ppp po po xodoPo p 0A0I0&`H@?@@I0M00N0P0Q0Q0 Q0Q04Q0`R0THIS is A memory TEST patternDS0@S0ЮT0T0l\0'IT4д5?Ќ8?? 2T:И5d6Ш39??,2А> %+2>_0}4dPgЄZD[\[[, lp`pМ0lh`ootqЌql{Pp|pДqиql(zlmЀnаolИ{uЀv(wwly @ @   ) 2b0     TXXpЈ@t|ФЄаܺ$М<hػ(T0T $Pܽ ШDиМ @ @   ) e0hH`x@ Dpи (T Ш(4<D,ЈРLXdl t @ @ @   )h0  ##$`U`Ug(hDhРhPX{<|TFЀPNRRCEāSTPNM}~CLP0PLP0RE@RRCEāSTPSLl|RRCEāSTPER\CEāSTP7p70l@7@Ѐ7@7Ь7д@7мЀ77@7l@7@Ѐ7L7 7XЀ77L7@@7`Ѐ7@7@7@@7АЀ7Ќ77Р@7@vЀ7Ьv77@7аk@7Ѐ7707P7@Ѐ7Ј0Ul7Ѐ7А@7мЀ77@@7@vЀ7Ьv77Ѐ770,UМ7Ѐ7P@7мЀ77@@7@vЀ7Ьv77Ѐ770Ѐ7Ј4U7@@7 Ъ@74@7native@!*7@0!native@!*780!/z0#z0z0j 0  hTj,wzjHgf s 0@ j j?X,_F@@j  D   |\la\j?jT0Aj UAlYpJJjZxZ "`x  gjjjj0jjОܞj Ĩ jj l0AH?A <jj jjj(j dX&j L   j KjjX! ||j jjjZj j jj Rpj < ` (0jF$F|jjvtj jjjjjjAaj jjjjjjjjjjjljjj!jjjjjjjjjjjjjGlHGjjjjjjj PN j{Ѝpy?jjjjjjjjjjjjjjjjjjjjjjj@jjjjjjjjjjjjjj ,P -@ 8@ jjj xdhbLcp`mjrll (jjjjjjj B HC D Ej \[jj}PP~ rjjj $ИЌ и|(7(7(77$7 t7@ 0 HkpkЬk87@7H7H7d@B|70z0l07 Мt" 0Ћ0І0Є0}0{0s0q0j0h0c0a0\0Z0U0S0N0L0F0D0?0a0:080/0-0%0#0!0S0 0 0И3(6,:а:|=L;;=T>=А>?4?X?Д@LЬAAttyclsttyopnttybgttyinttyoutlYY\ZZ BT^4`ДetB4^Ѐ^t@_t@_t@_t@_t@_t@_ 07P7PhpаV0`d7М7عАع<ЀP 0ffsP5@0ext2fsv0cd9660Ј0msdos47<78|88d7М7$7Д77\7Ш7а808и8$2lockf@` 0Ј0Ѓ0~0y0t0n0h0c0 7p7L7TW@7WЀ7L77Ѐ7LX70V7<<Lh0p07}07 0$7 0d7 07 07 0$7 0d7 Ǥ07 Ӥ07ܤ0$70d7 0707 0$70d707%07 00$7 90d7 D07 N07 X0$7 d0d7 p07 }070$70d707 07 0$7 0d7ɥ07֥070$70d707070$7*0d77@7Ѐ777@7Ѐ777@7Ѐ777@7Ѐ777@7Ѐ777@7Ѐ777@7Ѐ777@7Ѐ777@7Ѐ777@7Ѐ7777p7@7Ѐ777L@7Ѐ777@7L7|7м7L7@7Ѐ777@7Ѐ777@7LЀ7L747@7Ќ@7ȬЀ7̭777Ѐ7L0VL7Ѐ7p7p@7Ѐ77Ј7D@7Ѐ777@7ЀЀ7L77h@7$Ѐ77L7@7Ѐ777@7Ѐ777@7Ѐ777@7 @7Ѐ7H77Ф7Ѐ7L0Vl7ȵLdevopndeviodevwaitdevindevoutdeviocdevcls7p7а@7Ѐ77ȷ7@7Ѐ777Р@7Ѐ7L7t7@7lЀ77д7@7Ѐ777@7Ѐ777@7Ѐ7L77@7Ь@7dЀ7(77d7Ѐ7Ј0V7. .. 7p7а@7Ѐ Ѐ7@7t7|@7(Ѐ7Д77@7Ѐ7L787D7h7Ь@7$Ѐ7T7Ѐ$7'@7д(Ѐ7(7Р07Р@7Ѐ7H7Ь070@7(1@7Д1Ѐ7|2717$372@7Ј1Ѐ7Ј2VЀ7 A\B20123456789abcdef^^33330Ь#$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@BC =D$E =F$cde@B@KLا@Bpp@@@@j j j  77hа`@0Ѐ77,276)H*57C`7,xX|Оا<7LАN8P8Q7АN8P8Q l7АN8P8Q7)АN8P8Q7@АN8P8QX,7LАN8P8QL07t7 dX7и7777}E#(D<8Q @X,7Д7М77Ќ7А7Д7И77`77d7h7l7p7t7x7Ѐ7|7Є7Ј72(@AAA==(A* dd%(i  @@@@@@@@@77` WT W7Ѐ777 74787(7$777Ѐ 0 0 0 0Ш#Р!dhЀ/Ѐ7p7e@7xЀ7Ѐ70y7y7z@7zЀ7h{7}7R@7UЀ7L77@7PЀ77TZ7,@7Ѐ7܆7 7@7РЀ7t7$7Р@7|cЀ7p\7Ј7д@7\@7Ѐ77707И@7Ѐ7Ј0 Wм8Ѐ7А7@7zЀ7h{7}7@77TZ@7|cЀ7p\7Ј7дЀ77, W8Ѐ7P7P@7zЀ7h{7}7@7$7TZ@7|cЀ7д\7Ј7дЀ77Ѐ7Ј4 WЄ8 ... ...ĤĤ\ĤЀа808и87p7t@7pЀ7М77z@7HЀ7И7 7P@7ЌЀ7L77@77,7@7ЀЀ777 @7, Ѐ7X7 7Р@7Ѐ7t7Ј7д@7а@7Ѐ77707H Ѐ7Ј0 WЈ8Ѐ7А7@7HЀ7И7 7@77,@7Ѐ7t7Ј7дЀ774 Wи8Ѐ7P7P@7HЀ7И7 7@7$7,@7Ѐ77Ј7дЀ77Ѐ7Ј, W88x'Ф'd(+@.0,2822м2\88Р8и  H 48WEVrdrootWEVh   082KA g <  2KAr"Ø  c/mntp=46@@<@`bT 082KA g <  2KAr"Ø  }@@<@`bTU 2KA c&8 aѵюA 2KA2KA502KA50_F?A2KAh 2KAf2KAf/qA2KAh 2KA2KAA2KAh 2KA6&2KA6&A2KAh 2KAh 2KAh ф:A2KAh 2KAh 2KAh A2KAh 2KAh 2KAh 7%:A2KAh 2KA502KA50.C2KAh 2KAh 2KAh 3tA2KAh 2KAh 2KAh ߦA2KAh 2KA92KA9[A2KAh 2KA+S 2KA+S VOA2KAh 2KAh 2KAh " A2KAh 2KAh 2KAh A2KAh 2KA2KA ىA2KAh 2KAh 2KAh A2KAh 2KAh 2KAh qdC2KAh 2KAh 2KAh *scA2KAh 2KAh 2KAh hA2KAh 2KAh 2KAh ^UA2KAh 2KAh 2KAh p?J2KA 2KAI2KA50 (08@HPX`hpx0 f 2KAh 2KA82KA8!!2KA %2KA %2KA %Fd!2KA %2KA %2KA %yH!2KA %2KA %2KA %,!2KA%&2KA%&2KA%& ;!2KA%&2KA%&2KA%& 8E!2KA%&2KA%&2KA%&C!2KA%&2KA%&2KA%&5!2KA%&2KA%&2KA%&)Ea!2KA6&2KA6&2KA6&  !2KA6&2KA6&2KA6&A,!2KA6&2KA6&2KA6&+g$!2KA6&2KA6&2KA6&5vW!2KA6&2KA6&2KAF7!2KAV'2KAV'2KA [r!2KAV'2KAV'2KA21)o!2KAV'2KAV'2KAr7Da2KAV'2KAV'2KA^Ua2KAV'2KAV'2KA1ka2KAc'2KAc'2KA !2KAc'2KAc'2KA PY!2KAc'2KAc'2KA kS5!2KAc'2KAc'2KA ,a2KAc'2KAc'2KA;XOi^!2KA(2KA(2KA;X"Q/a2KA(2KA(2KA;X<!2KA(2KA(2KA;Xa2KA(2KA(2KA;X3%d!2KA )2KA )2KA;Xw:#a2KA )2KA )2KA;X|!2KA )2KA )2KA;Xa2KA )2KA )2KA;XA|!2KA )2KA )2KA;X8-a2KA')2KA')2KA;XL!2KA')2KA')2KA;Xra2KA')2KA')2KA;X=?a!2KA')2KA')2KA;Xa2KA')2KA')2KA;XV!2KAQ*2KAQ*2KA;XQUa2KAQ*2KAQ*2KA;Xv 7!2KAQ*2KAQ*2KA;X:Na2KAQ*2KAQ*2KA;X P!2KAQ*2KAQ*2KA;X  a2KAT*2KAT*2KA;X )!2KAT*2KAT*2KA;X gIa2KAT*2KAT*2KA;X .!2KAT*2KAT*2KA;X 4bLa2KAT*2KAT*2KA;X n`G!2KA+2KA+2KA;X Ma2KA+2KA+2KA;X ,!2KA+2KA+2KA;X v}a2KA+2KA+2KA;Xல!2KA+2KA+2KA;Xya2KA,2KA,2KA;Xo!2KA,2KA,2KA;XGa2KA,2KA,2KA;XY!2KA,2KA,2KA;Xٱa2KA,2KA,2KA;Xj!2KA,2KA,2KA;Xfa2KA,2KA,2KA;XOP!2KA,2KA,2KA;Xby3a2KA,2KA,2KA;XӷF!2KAL-2KAL-2KA;X)a2KAL-2KAL-2KA;Xu]y!2KAL-2KAL-2KA;XWa2KAL-2KAL-2KA;Xԟt!2KAL-2KAL-2KA;XD+[a2KAD-2KAD-2KA;XT9!2KAD-2KAD-2KA;X%Da2KAD-2KAD-2KA;Xg0!2KAD-2KAD-2KA;X`Qa2KAD-2KAD-2KA;X!2KA}.2KA}.2KA;X+H+a2KA}.2KA}.2KA;XGda!2KA}.2KA}.2KA;X0a2KA}.2KA}.2KA;Xï!2KA}.2KA}.2KA;Xެa2KAq/2KAq/2KA;XϏ(!2KAq/2KAq/2KA;Xa2KAq/2KAq/2KA;X{!!2KAq/2KAq/2KA;XYaa2KAq/2KAq/2KA;Xc!2KA/2KA/2KA;Xsa2KA/2KA/2KA;X!d!2KA/2KA/2KA;Xw6a2KA/2KA/2KA;XC!2KA/2KA/2KA;X;4a2KAG02KAG02KA;X !2KAG02KAG02KA;X *a2KAG02KAG02KA;X!@!2KAG02KAG02KA;X!a2KAG02KAG02KA;X"ү!2KA502KA502KA;X"6Za2KA502KA502KA;X#z]܆!2KA502KA502KA;X#Xa2KA502KA502KA;X$ !2KA502KA502KA;X$Xva2KAx12KAx12KA;X%%Ru!2KAx12KAx12KA;X%~a2KAx12KAx12KA;X&HBE!2KAx12KAx12KA;X&Ma2KAx12KAx12KA;X'ں!2KAb22KAb22KA;X'Zca2KAb22KAb22KA;X(!2KAb22KAb22KA;X(:a2KAb22KAb22KA;X)nI!2KAb22KAb22KA;X)(a2KA22KA22KA;X*dh!2KA22KA22KA;X*̡a2KA22KA22KA;X+i!2KA22KA22KA;X+jma2KAB32KAB32KA;X,,<_!2KAB32KAB32KA;X,*ya2KAB32KAB32KA;X- =!2KAB32KAB32KA;X- a2KAB32KAB32KA;X.h6!2KA%32KA%32KA;X.|ha2KA%32KA%32KA;X/%j!2KA%32KA%32KA;X/+a2KA%32KA%32KA;Xv*!2KA%32KA%32KA;X iXa2KAs42KAs42KA;Xg!2KAs42KAs42KA;X pa2KAs42KAs42KA;X !2KAs42KAs42KA;X Oa2KAs42KAs42KA;XTŐ!2KAR 52KAR 52KA;X Aa2KAR 52KAR 52KA;XD!2KAR 52KAR 52KA;X {_a2KAR 52KAR 52KA;X!2KAR 52KAR 52KA;X +9xca2KA52KA52KA;X|!2KA52KA52KA;X a2KA52KA52KA;XZJ!2KA52KA52KA;X a2KA52KA52KA;X y]!2KA=62KA=62KA;X  a2KA=62KA=62KA;X [B!2KA=62KA=62KA +xa2KA=62KA=62KA;X Wxɵ!2KA=62KA=62KA $?a2KA62KA62KA;X 5!2KA62KA62KA 2\a2KA62KA62KA;X ;!2KA62KA62KA {3a2KA62KA62KA;X #!2KAn72KAn72KA *a2KAn72KAn72KA;X!2KAn72KAn72KA qXa2KAn72KAn72KA;XP3!2KAn72KAn72KA }a2KAC82KAC82KA$ !2KAC82KAC82KA &-*a2KAC82KAC82KA!2KAC82KAC82KA @xa2KAC82KAC82KA3!2KAٟ82KAٟ82KA _Ya2KAٟ82KAٟ82KAqa!2KAٟ82KAٟ82KA 3a2KAٟ82KAٟ82KAe# !2KAٟ82KAٟ82KA 46Da2KAp892KAp892KA<&!2KAp892KAp892KA e3a2KAp892KAp892KA1V!2KAp892KAp892KA F0ba2KAp892KAp892KAoK!2KA92KA92KA !=Da2KA92KA92KAz!2KA92KA92KA a2KA92KA92KAZ;!2KA92KA92KA \a2KAi:2KAi:2KAc3!2KAi:2KAi:2KA a2KAi:2KAi:2KAH(!2KAi:2KAi:2KA "%_a2KA3;2KA3;2KA!!2KA3;2KA3;2KA +a2KA3;2KA3;2KA!2KA3;2KA3;2KA a2KA3;2KA3;2KA !2KA2KA2KA tLa2KA2KA2KA)!2KA2KA2KA f5a2KA2KA2KA /1!2KA2KA2KA !a2KA2KA2KA!.!2KA2KA2KA! QH`a2KA2KA2KA"~bV!2KA2KA2KA" Ҏ<a2KA2KA2KA#%B!2KA-12KA-12KA# >@la2KA-12KA-12KA$ !2KA-12KA-12KA$ uZa2KA-12KA-12KA%*v!2KA-12KA-12KA% c Ua2KA2KA2KA& j!2KA2KA2KA& eG a2KA2KA2KA'!2KA2KA2KA' {a2KA2KA2KA(h=R!2KAZb2KAZb2KA( Ra2KAZb2KAZb2KA)@9!2KAZb2KAZb2KA) %i'a2KAZb2KAZb2KA*%!2KAZb2KAZb2KA* Lfa2KA2KA2KA+1j!2KA2KA2KA+ 1a2KA2KA2KA,~!2KA2KA2KA, 1a2KA2KA2KA-+!2KA2KA2KA- [NYa2KA2KA2KA.IYM!2KA2KA2KA. wOa2KA2KA2KA/18!2KA2KA2KA/ 0Ua2KA,2KA,2KA!2KA,2KA,2KA/܂;a2KA,2KA,2KAɎ!2KA,2KA,2KA/:a2KA,2KA,2KAHdP!2KA2KA2KAD(a2KA2KA2KA2F!2KA2KA2KAg!2KA2KA2KAR@Bu!2KAJ]2KAJ]2KAh 5Bu!2KAJ]2KAJ]2KAh ĔBu!2KAJ]2KAJ]2KAh ~mBua2KAJ]2KAJ]2KA4,!2KAJ]2KAJ]2KAa2KA2KA2KA06!2KA2KA2KARga2KA2KA2KA!2KA2KA2KAa2KA2KA2KA ho!2KAw2KAw2KA]6!2KAw2KAw2KAw-&!2KAw2KAw2KAw-хC!2KAw2KAw2KAw-7ʀ!2KAw2KAw2KAw-,!2KA'2KA'2KA'-6!2KA'2KA'2KA'N,!2KA'2KA'2KA'm2KA! 2KA! 2KA! 7zm2KA 2KA+S 2KA+S \jfm2KA+S 2KA 2KA H P X ` h p x T׆m2KAX 2KA 2KA  2KA 2KA 2KA P7o, 2KAN2KAN2KANگN#)2KA2KAI2KAI;2KAI2KAI2KAIme 2KA2KA %2KA %X] 2KA %2KA %2KA %/tmp/disktab.shadowd2KA%&2KA%&2KA%&/tmp/fstab.shadow"i2KA%&2KA%&2KA%&/tmp/resolv.conf.shadowV 2KA6&2KA6&2KA6&/tmp/hostsz2KAV'2KA(2KAq/2KA(2KA')2KA')p#[q 2KAQ*2KAQ*2KAQ*6@92KAT*2KA+2KAq/yA2KA,2KA,2KAq/ r<hr2KAL-2KA}.2KA}.    :3!|W<=) fg%;Z 8B'4 S~T15^S92E,|{#<<鑽T$y+1QSocμ\߷VZ)@]/vuݳkG/NhF{B-З]h{l>pGR(@W3is@bŮɘۤsS z~)CS em"ME]鿝8 }XcJh~@z|csPx behK)}=}U~V@B-<CAt8 3p* cU_  x0[p}ONf((Nhɹ~dy2kmc . .. catchmod cp paxcpio tar dd df ed ln lsmkdir mv rmhostnameB= ksh shsleepsttychgrpȎмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxU . .. ppp group=spwd.dbdisktab.shadow protocols$servicesN$ disktab fstabr resolv.confH hostsr ... ... ... . ..chmodchown disklabel=dhclientB=fdiskdmesgfsck_ffsB=fsckreboothaltifconfigB=initmknodmount mount_cd9660r mount_ffs= mount_msdos mount_ext2fsrpingnewfsrestorerouteumount kbddhclient-script wicontrol= ancontrol= . .. bin dev etc mntmnt2 sbin tmp usrvarinstbin.profile install.mdupgradeinstall install.sub ... . .. bin mdecsbinshare . ..grepegrepfgrep ftpgzipgunzipgzcatlessmore\sed . .. installboot biosbootN$  mbr bootB= . .. . ..misckeymaps . ..termcap ... . .. tmp db runempty ... ... ... ...; esac done } R "$@" list="$RMlist" for mode in $modes; do list="$list;${mklist[$mode]}" done for group in $groups; do list="$list;${grplist[$group]}" done list="$list;$MKlist" if [ "$eo" = "echo" ]; then $eo "$list" else echo "$list" | sh fi ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 RMlist="$RMlist $1$2? r$1$2?" [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 M r$1$2$d c $4 $(($n+$count)) 640 let count=count+1 done MKlist="$MKlist;chown root:operator $1$2? r$1$2?" } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist="rm -f" MKlist=":" mkl() { [ "${mklist[$1]}" ] && { mklist[$1]="${mklist[$1]};mknod -m $1 $2 $3 $4 $5" } || { mklist[$1]="mknod -m $1 $2 $3 $4 $5" modes="$modes $1" } } M() { RMlist="$RMlist $1" mkl ${5-666} $1 $2 $3 $4 mklist="$mklist $1" G=${6:-wheel} [ "$7" ] && { MKlist="$MKlist;chown $7:$G $1" } || { case $G in wheel)g=0;;kmem)g=2;;operator)g=5;;tty)g=4;;dialer)g=117;;_lkm)g=61;; esac [ "${grplist[$g]}" ] && { grplist[$g]="${grplist[$g]} $1" } || { groups="$groups $g" grplist[$g]="chgrp $G $1" } } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 fd0 wd0 wd1 wd2 sd0 sd1 sd2 tty00 tty01 rd0 R st0 cd0 ttyC0 random wskbd0 apm ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 22 0 M stdout c 22 1 M stderr c 22 2 M ksyms c 50 0 640 kmem M drum c 4 0 640 kmem M klog c 7 0 600 M xf86 c 2 4 600 ;; ttyc*) M ttyc$U c 38 $U 660 dialer uucp M cuac$U c 38 $(($U+128)) 660 dialer uucp ;; xfs*) M xfs$U c 51 $U 600 ;; wdt0) M wdt$U c 55 $U 440 operator ;; uk*) M uk$U c 20 $U 640 operator ;; tuner*) M tuner$U c 49 $(($(($U*2))+16)) 644 ;; tun*) M tun$U c 40 $U 600 ;; systrace) M systrace c 78 0 644 ;; ss*) M ss$U c 19 $(($U*16)) 640 operator M nss$U c 19 $(($(($U*16))+1)) 640 operator M enss$U c 19 $(($(($U*16))+3)) 640 operator RMlist="$RMlist scan$U" MKlist="$MKlist;umask 77;ln -s ss$U scan$U" ;; speaker) M speaker c 27 0 600 ;; ses*) M ses$U c 24 $U 640 operator ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 45 $n 644 n=$(($n+1)) done ;; rmidi*) M rmidi$U c 52 $U 666 ;; radio*) M radio$U c 76 $U MKlist="$MKlist;[ -e radio ] || ln -s radio$U radio" ;; pf*) M pf c 73 0 600 ;; pctr) M pctr c 46 0 644 ;; pci) M pci c 72 0 600 ;; music*) M music$U c 53 $U M sequencer$U c 53 $(($U+128)) MKlist="$MKlist;[ -e music ] || ln -s music$U music" MKlist="$MKlist;[ -e sequencer ] || ln -s sequencer$U sequencer" ;; lkm) M lkm c 28 0 640 _lkm ;; joy*) M joy$U c 26 $U 666 ;; iop*) M iop$U c 75 $U 660 ;; hotplug) M hotplug c 82 $U 400 ;; gpr*) M gpr$U c 80 $U ;; gpio*) M gpio$U c 83 $U 600 ;; fd) RMlist="mkdir -p fd;$RMlist" n=0 while [ $n -lt 64 ];do M fd/$n c 22 $n;n=$(($n+1));done MKlist="$MKlist;chmod 555 fd" ;; crypto) M crypto c 70 0 ;; bpf*) M bpf$U c 23 $U 600 ;; bktr*) M bktr$U c 49 $U 644 ;; audio*) M sound$U c 42 $U M mixer$U c 42 $(($U+16)) M audio$U c 42 $(($U+128)) M audioctl$U c 42 $(($U+192)) MKlist="$MKlist;[ -e audio ] || ln -s audio$U audio" MKlist="$MKlist;[ -e mixer ] || ln -s mixer$U mixer" MKlist="$MKlist;[ -e sound ] || ln -s sound$U sound" MKlist="$MKlist;[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 21 0 644 M apmctl c 21 8 644 ;; uscanner*) M uscanner$U c 77 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 61 $U 660 ;; urio*) M urio$U c 65 $U 660 ;; ulpt*) M ulpt$U c 64 $U 660 ;; uhid*) M uhid$U c 62 $U 660 ;; ugen*) n=$(($U*16)) for j in 00 01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 do M ugen$U.$j c 63 $(($n+$j)) 660 done ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 66 $o 660 dialer uucp ;; uall) R ttyU0 ttyU1 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 R uscanner0 urio0 usb0 usb1 usb2 usb3 ;; lpt*|lpa*) case $i in lpt*) n=lpt f=0;; lpa*) n=lpa f=128;; esac M $n$U c 16 $(($U+$f)) 600 ;; wsmouse*) M wsmouse$U c 68 $U 600 ;; wsmux|wsmouse|wskbd) M wsmouse c 69 0 600 M wskbd c 69 1 600 ;; wskbd*) M wskbd$U c 67 $U 600 ;; tty[C-F]*) U=${i##tty[C-F]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; esac case $U in [0-9a-f]) M tty$n$U c 12 $(( 16#$U + $m )) 600;; cfg) M tty${n}cfg c 12 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 5 $(($off+$n)) M pty$nam c 6 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 81 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 8 $o 660 dialer uucp M cua$U c 8 $(($o+128)) 660 dialer uucp ;; wt*) name=wt n=$(($U*8)) m=$(($n+4)) M $name$U b 3 $n 640 operator M r$name$U c 10 $n 640 operator M n$name$U b 3 $m 640 operator M nr$name$U c 10 $m 640 operator ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 5 $n 660 operator M ${pre}rst$U c 14 $n 660 operator n=$(($n+1)) done ;; ch*) M ch$U c 17 $U 660 operator ;; vnd*) dodisk vnd $U 14 41 $U 0 dodisk svnd $U 14 41 $U 2048 ;; rd*) dodisk2 rd $U 17 47 $U 0 ;; mcd*) dodisk2 mcd $U 7 39 $U 0 ;; fd*) typnam=$U${i#fd[01]*} case $typnam in 0|1) typnum=0;; # no type specified, assume A *A) typnum=0; typnam=0;; *B) typnum=1;; *C) typnum=2;; *D) typnum=3;; *E) typnum=4;; *F) typnum=5;; *G) typnum=6;; *H) typnum=7;; *) echo bad type $typnam for $i; exit 1;; esac case $U in 0|1) blk=2; chr=9;; *) echo bad unit $U for $i; exit 1;; esac nam=fd${typnam} n=$(($(($U*128))+$(($typnum*16)))) M ${nam}a b $blk $n 640 operator M ${nam}b b $blk $(($n+1)) 640 operator M ${nam}c b $blk $(($n+2)) 640 operator M r${nam}a c $chr $n 640 operator M r${nam}b c $chr $(($n+1)) 640 operator M r${nam}c c $chr $(($n+2)) 640 operator ;; cd*) dodisk2 cd $U 6 15 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R gpio0 gpio1 gpio2 bktr0 ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 R vnd3 sd0 sd1 sd2 sd3 sd4 cd0 cd1 rd0 tun0 tun1 tun2 tun3 R bpf0 bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 fd1 R fd1B fd1C fd1D fd1E fd1F fd1G fd1H fd0 fd0B fd0C fd0D fd0E R fd0F fd0G fd0H xfs0 ss0 ss1 ch0 ses0 hotplug ptm gpr0 local R wscons pci iop0 iop1 uall rmidi0 rmidi1 rmidi2 rmidi3 rmidi4 R rmidi5 rmidi6 rmidi7 tuner0 radio0 music0 speaker audio0 R wdt0 wt0 uk0 random joy0 joy1 lpa0 lpa1 lpa2 lpt0 lpt1 lpt2 R lkm tty00 tty01 tty02 tty03 ttyc0 ttyc1 ttyc2 ttyc3 ttyc4 R ttyc5 ttyc6 ttyc7 apm crypto pf pctr systrace wd0 wd1 wd2 R wd3 raid0 raid1 raid2 raid3 std st0 st1 fd mcd0 ;; wd*|sd*|raid*|ccd*) case $i in wd*) dodisk wd $U 0 3 $U 0;; sd*) dodisk sd $U 4 13 $U 0;; raid*) dodisk raid $U 19 54 $U 0;; ccd*) dodisk ccd $U 16 18 $U 0;; esac ;; *) echo $i: unknown device ; . ..MAKEDEVconsoleklogB=xf86B=bpf0B=ttyC0=wskbd0 tty nullB=!zeroB="stdin=#stdout$stderr% mem&kmemB='ksyms=(drumB=)fd0aB=*fd0bB=+fd0cB=,rfd0a=-rfd0b=.rfd0c=/wd0aB=0rwd0a=1wd0bB=2rwd0b=3wd0cB=4rwd0c=5wd0dB=6rwd0d=7wd0eB=8rwd0e=9wd0fB=:rwd0f=;wd0gB=<rwd0g==wd0hB=>rwd0h=?wd0iB=@rwd0i=Awd0jB=Brwd0j=Cwd0kB=Drwd0k=Ewd0lB=Frwd0l=Gwd0mB=Hrwd0m=Iwd0nB=Jrwd0n=Kwd0oB=Lrwd0o=Mwd0pB=Nrwd0p=Owd1aB=Prwd1a=Qwd1bB=Rrwd1b=Swd1cB=Trwd1c=Uwd1dB=Vrwd1d=Wwd1eB=Xrwd1e=Ywd1fB=Zrwd1f=[wd1gB=\rwd1g=]wd1hB=^rwd1h=_wd1iB=`rwd1i=awd1jB=brwd1j=cwd1kB=drwd1k=ewd1lB=frwd1l=gwd1mB=hrwd1m=iwd1nB=jrwd1n=kwd1oB=lrwd1o=mwd1pB=nrwd1p=owd2aB=prwd2a=qwd2bB=rrwd2b=swd2cB=trwd2c=uwd2dB=vrwd2d=wwd2eB=xrwd2e=ywd2fB=zrwd2f={wd2gB=|rwd2g=}wd2hB=~rwd2h=wd2iB=ڀrwd2i=ځwd2jB=ڂrwd2j=ڃwd2kB=ڄrwd2k=څwd2lB=چrwd2l=ڇwd2mB=ڈrwd2m=ډwd2nB=ڊrwd2n=ڋwd2oB=ڌrwd2o=ڍwd2pB=ڎrwd2p=ڏsd0aB=ڐrsd0a=ڑsd0bB=ڒrsd0b=ړsd0cB=ڔrsd0c=ڕsd0dB=ږrsd0d=ڗsd0eB=ژrsd0e=ڙsd0fB=ښrsd0f=ڛsd0gB=ڜrsd0g=ڝsd0hB=ڞrsd0h=ڟsd0iB=ڠrsd0i=ڡsd0jB=ڢrsd0j=ڣsd0kB=ڤrsd0k=ڥsd0lB=ڦrsd0l=ڧsd0mB=ڨrsd0m=کsd0nB=ڪrsd0n=ګsd0oB=ڬrsd0o=ڭsd0pB=ڮrsd0p=گsd1aB=ڰrsd1a=ڱsd1bB=ڲrsd1b=ڳsd1cB=ڴrsd1c=ڵsd1dB=ڶrsd1d=ڷsd1eB=ڸrsd1e=ڹsd1fB=ںrsd1f=ڻsd1gB=ڼrsd1g=ڽsd1hB=ھrsd1h=ڿsd1iB=rsd1i=sd1jB=rsd1j=sd1kB=rsd1k=sd1lB=rsd1l=sd1mB=rsd1m=sd1nB=rsd1n=sd1oB=rsd1o=sd1pB=rsd1p=sd2aB=rsd2a=sd2bB=rsd2b=sd2cB=rsd2c=sd2dB=rsd2d=sd2eB=rsd2e=sd2fB=rsd2f=sd2gB=rsd2g=sd2hB=rsd2h=sd2iB=rsd2i=sd2jB=rsd2j=sd2kB=rsd2k=sd2lB=rsd2l=sd2mB=rsd2m=sd2nB=rsd2n=sd2oB=rsd2o=sd2pB=rsd2p=rd0aB=rrd0a=rd0cB=rrd0c=cd0aB=rcd0a=cd0cB=rcd0c=tty00=cua00=tty01=cua01= st0rst0B=nst0B=nrst0=est0B=erst0=enst0=enrst0randomsrandomurandomprandomarandom apm apmctlELF4@4 (LFtMQQfh @]ff`Rf1fѱfRf1ұAf[Xֈ1۸faf@ ðRBrù fP(fffXfffsftS1C[5!Loading ERR ? U.symtab.strtab.shstrtab.text.data.bss!',X0 k [)09ELQYbfs_bsize_sforce_chsnblocksfs_bsize_p_startinodeblk__bss_start_edata_endfsbtodbinodedblp_offset`Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     errornopSp]pqpqqrZuuwlwaxxDyhy6z@zzPzq inflate 1.2.1 Copyright 1995-2003 Mark Adler  #+3;CScsLB !1Aa  0@`@@ '0 ;p^@iaJx 0$$\%h%%&"8VSVVYYYYZTZZ`\H%.shstrtab.text.rodata.data.bss    pp $ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: dialer:*:117: nogroup:*:32766: nobody:*:32767: dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs # emacs-style command line editing rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi qp120at|Quantum Peripherals 120MB IDE:\ :dt=ESDI:ty=winchester:se#512:nt#9:ns#32:nc#813:sf: \ :pa#13824:oa#0:ta=4.2BSD:ba#4096:fa#512: \ :pb#13824:ob#13824:tb=swap: \ :pc#234144:oc#0: \ :ph#206496:oh#27648:th=4.2BSD:bh#4096:fh#512: pan60|Panasonic Laptop's 60MB IDE:\ :dt=ST506:ty=winchester:se#512:nt#13:ns#17:nc#565:\ :pa#13260:oa#0:ta=4.2BSD:ba#4096:fa#512:\ :pb#13260:ob#13260:tb=swap: \ :pc#124865:oc#0: \ :ph#97682:oh#26520:th=4.2BSD:bh#4096:fh#512: mk156|toshiba156|Toshiba MK156 156Mb:\ :dt=SCSI:ty=winchester:se#512:nt#10:ns#35:nc#825:\ :pa#15748:oa#0:ba#4096:fa#512:ta=4.2BSD:\ :pb#15748:ob#15748:tb=swap:\ :pc#288750:oc#0:\ :ph#257250:oh#31500:bh#4096:fh#512:th=4.2BSD: cp3100|Conner Peripherals 100MB IDE:\ :dt=ST506:ty=winchester:se#512:nt#8:ns#33:nc#766: \ :pa#12144:oa#0:ta=4.2BSD:ba#4096:fa#512: \ :pb#12144:ob#12144:tb=swap: \ :pc#202224:oc#0: \ :ph#177936:oh#24288:th=4.2BSD:bh#4096:fh#512: cp3100new|Conner Peripherals 100MB IDE, with a different configuration:\ :dt=ST506:ty=winchester:se#512:nt#8:ns#33:nc#766: \ :pa#15840:oa#0:ta=4.2BSD:ba#4096:fa#512: \ :pb#24288:ob#15840:tb=swap: \ :pc#202224:oc#0: \ :pe#15840:oe#40128:te=4.2BSD:be#4096:fe#512: \ :pg#15840:og#55968:tg=4.2BSD:bg#4096:fg#512: \ :ph#130416:oh#71808:th=4.2BSD:bh#4096:fh#512: floppy288|3in|3.5in High Density Floppy, 2.88MB:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#36:nc#80:\ :pa#5760:oa#0:ba#4096:fa#512:ta=4.2BSD: \ :pb#5760:ob#0:\ :pc#5760:oc#0: floppy|floppy3|3in|3.5in High Density Floppy:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#18:nc#80:\ :pa#2880:oa#0:ba#4096:fa#512:ta=4.2BSD: \ :pb#2880:ob#0:\ :pc#2880:oc#0: floppy5|5in|5.25in High Density Floppy:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#15:nc#80:\ :pa#2400:oa#0:ba#4096:fa#512:ta=4.2BSD: \ :pb#2400:ob#0:bb#4096:fb#512:\ :pc#2400:oc#0:bc#4096:fc#512: maxtor4380|Maxtor XT4380E ESDI :\ :dt=ESDI:ty=winchester:se#512:nt#15:ns#36:nc#1222:sf: \ :pa#21600:oa#0:ta=4.2BSD:ba#4096:\ :pb#21600:ob#21600:tb=swap: \ :pc#659880:oc#0: \ :pe#216000:oe#53200:te=4.2BSD:be#4096:fe#512: \ :ph#398520:oh#269200:th=4.2BSD:bh#4096:fh#512: miniscribe9380|compaq38|Miniscribe 9380 ESDI :\ :ty=winchester:dt=ESDI:se#512:nt#15:ns#35:nc#1223:rm#3600:sf: \ :pa#21000:oa#0:ba#8192:fa#1024:ta=4.2BSD: \ :pb#42000:ob#21000:tb=swap: \ :pc#642075:oc#0: \ :pe#21000:oe#63000:be#8192:fe#1024:te=4.2BSD: \ :ph#556500:oh#84000:bh#8192:fh#1024:th=4.2BSD: ida4|compaq88|Compaq IDA (4 drives) :\ :ty=winchester:dt=IDA:se#512:nt#16:ns#63:nc#1644:rm#3600:\ :pa#20160:oa#0:ba#8192:fa#1024:ta=4.2BSD: \ :pb#80640:ob#20160:tb=swap: \ :pc#1659168:oc#0: \ :pe#201600:oe#100800:be#8192:fe#1024:te=4.2BSD: \ :pf#20160:of#1310400:bf#8192:ff#1024:tf=4.2BSD: \ :ph#1008000:oh#302400:bh#8192:fh#1024:th=4.2BSD: \ :pg#302400:og#1330560:bg#4096:fg#512:tg=4.2BSD: fuji513|Fujitsu M22XXXX: \ :ty=winchester:dt=ESDI:se#512:nt#16:ns#63:nc#954:rm#3600:\ :pa#20160:oa#82656:ba#4096:fa#512:ta=4.2BSD: \ :pb#40320:ob#102816:tb=swap: \ :pc#961632:oc#0: \ :ph#656208:oh#143136:bh#4096:fh#512:th=4.2BSD: rdroot|ramdiskroot|RAM-disk root FS image:\ :ty=ramdisk:se#512:nt#2:ns#128:nc#16:\ :pa#3510:oa#0:ta=4.2BSD:ba#4096:fa#512:\ :pb#0:ob#0:tb=swap:\ :pc#3510:oc#0: #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet alias $alias_ip_address netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } if [ -n "$new_network_number" ]; then echo "New Network Number: $new_network_number" fi if [ -n "$new_broadcast_address" ]; then echo "New Broadcast Address: $new_broadcast_address" fi case $reason in MEDIUM) ifconfig $interface $medium ifconfig $interface inet -alias 0.0.0.0 $medium >/dev/null 2>&1 sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface inet 0.0.0.0 netmask 0.0.0.0 broadcast 255.255.255.255 up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || \ [ "$reason" = REBOOT ] || \ [ -z "$old_ip_address" ] || \ [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet -alias $new_ip_address $medium delete_old_routes exit 1 ;; esac exit 0 MDFSTYPE=msdos MDFSOPTS=-s MDXAPERTURE=2 MDSERIAL="pccom com tty0" ARCH=i386 md_set_term() { local _tables ask_yn "Do you wish to select a keyboard encoding table?" [[ $resp == n ]] && return while : ; do ask "Select your keyboard type: (P)C-AT/XT, (U)SB or 'done'" P case $resp in P*|p*) _tables="be br de dk es fr it jp lt no pt ru sf sg sv ua uk us" ;; U*|u*) _tables="be br de dk es fr it jp no sf sg sv uk us" ;; done) ;; *) echo "'$resp' is not a valid keyboard type." resp= continue ;; esac break; done [ -z "$_tables" ] && return while : ; do cat << __EOT The available keyboard encoding tables are: ${_tables} __EOT ask "Table name? (or 'done')" us case $resp in done) ;; *) if kbd $resp ; then echo $resp > /tmp/kbdtype else echo "'${resp}' is not a valid table name." continue fi ;; esac break; done } md_installboot() { echo Installing boot block... cat /usr/mdec/boot > /mnt/boot /usr/mdec/installboot -v /mnt/boot /usr/mdec/biosboot ${1} echo "done." } md_checkfordisklabel() { local rval=0 disklabel -r $1 >/dev/null 2>/tmp/checkfordisklabel if grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 fi >/dev/null 2>&1 rm -f /tmp/checkfordisklabel return $rval } md_prep_fdisk() { local _disk=$1 ask_yn "Do you want to use *all* of $_disk for OpenBSD?" if [[ $resp == y ]]; then echo -n "Putting all of $_disk into an active OpenBSD MBR partition (type 'A6')..." fdisk -e ${_disk} << __EOT > /dev/null reinit update write quit __EOT echo "done." return fi cat << __EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. The 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} cat << __EOT Here is the partition information you chose: $(fdisk ${_disk}) __EOT } md_prep_disklabel() { local _disk=$1 md_prep_fdisk $_disk cat << __EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT md_checkfordisklabel $_disk case $? in 2) echo "WARNING: Label on disk $_disk is corrupted. You will be repairing it.\n" ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -f /tmp/fstab.$_disk -E $_disk } md_congrats() { } in/vi ] && EDITOR=vi export EDITOR fi [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat << __EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b #!/bin/ksh MODE=upgrade . install.sub resp= while [ -z "$resp" ]; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} if [ ! -b /dev/$resp ]; then echo "Sorry, ${resp} is not a block device." resp= fi done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV > /dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(< /tmp/myname) ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat << __EOT The fstab is configured as follows: $(< /tmp/fstab) For the ${MODE}, filesystems in the fstab will be automatically mounted if the 'noauto' option is absent, and /sbin/mount_ is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up :1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= resp= while [[ -z $resp ]]; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" if [ "$_password" != "$resp" ]; then echo "Passwords do not match, try again." resp= fi done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done < /etc/fstab questions echo -n "Saving configuration files..." ( cd /var/db [ -f dhclient.leases ] && mv dhclient.leases /mnt/var/db/. ) ( cd /tmp hostname > myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done < hosts > hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2> /dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up . ..chmodchown disklabel=dhclientB=fdiskdmesgfsck_ffsB=fsckreboothaltifconfigB=initmknodmount mount_cd9660r mount_ffs= mount_msdos mount_ext2fsrpingnewfsrestorerouteumount kbddhclient-script wicontrol= ancontrol= ccdconfig=ping6rtsol apm zzzapmd#!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while : ; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat << __EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp ( cd /tmp; rm -f host* my* resolv.* dhclient.* ) cat > /tmp/hosts << __EOT ::1 localhost 127.0.0.1 localhost : (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ ELF`4H4 ( ,,0<<<<$7$7$H$8<$8<@H@H<@H< 444OpenBSDOSQRD$ LT$QRPUVSu E<tYj/Sl8<u8<@8< <v8ÐU WVS} t8uj/7Ds pu7D<t&t'PVS u;tuWuCVh ӋE؃OEhvuhvI<IPvP uPhu3hR< KD7DP;uEDP3h<贡 ǨEv3hO< ; ExJ<|uE9E}*‰߰эA;E~EèJuރ} E |tEPEPV(EPEPVj U WVSjEP 19}31ۃEPEP u]CT èF9|1e[^_ÐUVSuj</hYut4SC  v@Fj,P諮 ue[^_ÍvU WVS]u ta;t\߰҉щMQr ǃu jj~ VSht$FS/u /F/tӀ>uK;/uu >FF} 9gf;tVSpVs 9r81;u -=@<tSh0hC P35 C!= <h18< <uDh>8< ÐUhh<=<tSh>щ1u %thAupdC<=D<t`C h;p<~PhDtN>/uCW:Ãu'jW0WÃS K/F>ue[^_ÐU WVSU ɈNVPSE;  C@thhHu>uUR@} t$hMt& ;uλW<=W<t93W5 uC#FF CFF  ;u1e[^_ÐUWVSEM ] ]G0PW>P7ho[J<Dž,=J<v}tWG08 7hx[<,d)SE(Pm G0PWPhx[7j5< E}5]<3P js3rP tEPV tVh@]Shc<& .Shd< Sh@d< Sh-`< <SB[<vu/K[A A A ùƉ׃=0<t;} RPRPh`e<- jWVUR | h hruF<(ruF< aUhfhjdedPh Ãul<߰ҿ<э<W ƃuhl<胶 1h6 jj26 jj&6 }%e[^_ÉUS]hDl G<9CvEPhp  S|9|`Ph}ruFhh@< ,h < h< h`j/S ƃtxF>rurFPShB49F4u6B89F8u.B<9Fjjj5Z6jjj5Z<-Z } h<)y'=Z<~hƃ}9RPW \ =L<t?=<t6\ |==L<t)=<t 5\}˃}u"=\<tsh3)Ѝ)¡4Z<t ~9s$uu C=,Z<uj ,Z<u4j(? />3)Ѝ)¡4Z< ˃Vo u,t s$Vh6 É%<<)ʍ)ȉ)¡8Z<V u+t s$Vh6P*ÃjjGFP * % ‰jjGNP)ÃjjGVP) % ‰0jjGfP)jjG^P)ÃCSVCn)ƒ1RP; %=uP TuFdž Ɔ PT1)ӉȉڃOV|8PT1)ӉȉڃRP} V2e[^_ÉU|1U<chÐUWVSU PPa&{jjGFP% R3&MjjGNP1P&-jjGVP0% R%jjG^PUR%jnMQ|@]SFP|)؃n)ƒ1RP}h }CxPh < n 0j>rP|R2 ?% P|P =P<ux j=P<u=\<u =\<t3jxP|эAP|RX=\<u =\<t#jx8@|R1ҋE; 9s?u C9s;t9u6}~)jRPURy }E Ph<t&mU}t }u<<1ۅt];tht&=w=}v= ǃ=\<8@xZL bU ƿ<u/U jPU }"{ jPE b}^ }tEPUEMM 1t&n<hE M H$Z<}u3 jP SuS! =<&5j,VR ǃtj=V; Ãtj J ƒt2CZB1tw=Z<uZ<&Zv1e[^_ÍvUWVS]jEPS= u M9 kt%btimt'wt2]É CvÉ 3vÉ#vÉֹE‰UEU9`u9wZE}xt KtK*uBÉփGPEUEEE‰UEEEU9u9v11ҍe[^_UVS]EPSH ƃuC fƒV WBt<\uB:uu)R V1 PhBF:tzt&7&B:uF=|\<u 5|\< \8=|\<tVjSh CP-ƃt t u#j Ph PƃuM=<tBSFƃu2t t uh  P PUe[^_ÍvU WVSU /uCI+u ~SEPhVtP@'Lu,PRPLFC9su9u+>t&}tyPDRhuDRh<t&PDRhu<эYt |/uKuCP$ <uh3)؍)á\< t&91tAIuj{ uh3)Ѝ)¡\<t9u1v@uÉUVS];=\<u+jh=M \<uh<v<#t/<\u{#uCS* uSh 3)؍)á\< t 91tEIuj uh`3)Ѝ)¡\<t9u 1&@uÉU WVS}E1ۅt?uh<t&j/Wb ƃtF?tGPЀ v6<,u}u AE1<.u uWhu CNC>tBujp C?t'SW}WhA<<&K}tvE8tnCPEP^}'EPh] vS[t,9Ku9CutC3 S e[^_ÉU WVS=\<tG1ɋ\<yt+vv3Y SP u ~e[^_ÍvU=\<t 1jhGqD \<uhuvjFV RP5\<5 ;Fu;V thD< 0j!OWS5\\<F41kt&h< 0j 7h3)؍)Ë It 91utF} t>j t1A\<A h 3))Ƌt%9{uE 9Ct[t9{uU 9Suulj ÃtJu t*E C{EC EC\<Ct&S h3)Ѝ)‹tI S[t:9su9{ut,CS ESE3} St 1e[^_ÍvUS\tRjhy<P臢 t5jjPSÃhVc9u<1e[^ÐU WVS޿< 1t RuUֿ<tRSh/u!ǀ!@ǀ$vt&Uǂ!UPTEUӁ1)ډӁUEUM>/u}1e[^_ÍvUWVSU tOjhy<Pg u2jjP3ÃhVC9u 1 &e[^UWVSu EhVk} U׋E(EUǂ$‰UYt)h YPQr EU/BE<v?Vh< +EPR}Ph]ÐUVSu ]}t |<=L<t3=<t*5\< hPFu1ۃh4' FuE9v;Ph Sh<2 th= <tWjh t5 <jjStj <} ]<]<]ÉUVS]5]< <}hr0uVv <DPxtI #<t D$1tEC9}#<3|3ƒt D%1u9u,}uuVSh<" CVSh<" 2h  5vE EShi5 <脸uh E; uSRh$< SRh$ FAJ<Ѕ};<|<><h e[^_ÐU,WVSuE ^<}1EEEPEPh#+4 e[^_U4W t&= <t  <`%= <t < <= <t  <`P= <t  <:= <t <%= <t  <  <t SWVt&Shd_ <<};<|<*<hU09 Ph0 ƒuh56< e[^_U\WVSU  PPh7<6{tAEPv mPj.EPh| 0 Ph9<Ѻ 4ppjj)5x& < th'> tPR^Ph=t ;0t$EPh"CVr~fp& <=& <jSFP ffCffBRQbۅxE<ݝ@܅ݕ0a<0a<݅8a<8a<݅ a8tPPQh`DVFf=p& t&hE<_~C POt&hEvt9z)uzuu B (t&$ Q FF19wˉڅu[^UVSu1҃~ vCV>vt9z)uzu u B %t&$ Q FF19wˉڅu1[^ÍvU1ÐUSUM AZ)É؉B} @BB)[U)jjj- P' j蓺 vU5\& h@J<.hIJ<hRJ<h Eh@J<.hIJ<hRJ<h Et%#ƃP~<1)9w/U1ۍU9}M}t&BC9|E;Evd& <u@hO<m1ۃ9}UPhOt=t# u1􍅔Pϻ ‹E; u݃PhR>u݅uPhR <h`S<,Cƒt:t > <58 <t>hpS<ϏhsS<hvS<赏hyS<訏h|S<hS <u=> <ujhS<#諅6jj& j`uJHt j0j1e[^_ÍvU WVSuӃjSǃSVW贲 e[^_ÉUu u ujhS <jC=,c<t== <t .j课S Ut&f(<.t&f(<t&f(<t&f(<E0> <E > <E\> <%h T<~> < > <~=L> <&hT<~ L> <t&L> <hT <hT < } D> <D> <,> <> <$> <<>

<(> <~ > <Dž`' <u2=> <u)ShU<+ <tt8uDc<x+ < > <ShT <t h+ <hT u;u-Dc<'t&;tVǃS9|e[^_ÐU WVS}u] SuFu EE0Su $uSh!U< uT <uh5> <5+ <`{=> <uh5> <5+ <;{@c<ÍvU=@c<tQ=> <uh5> <5+ <uh5> <5+ <5h+ <uÍvUh5> <5t+ <thj5|+ <t tXc<| + <9}t > <+ <{WG B W GB GWGUK GDG  x < + <  OEUMUut ;Uum;Evh+ <t6}u蝕EEPhU<шjE= ? <+ <9;tNGBW_x;WG B W GBUK GDG  x < + <$;GD8e[^_US]t=Tc <u+ <,( ÐU + <  $ÐU+ < A9uA9 u$;AsDt<+ <$wA$& ǂ$ÉU+ <$tH$jt&  u5t, u* RP^uR+ < ǀ$+ < A9uA9 u$;AsDUU} Xc< B}BXc< Xc<U+ < uǂ(ǂ,9t@@9u+ <-< + <(,ǁǁǁǁ ǁ$( ,uǁ(ǁ, jjj+ <;q uujhU<ÐUh j' tB+ <AAPQP HPQPQ PJ H1UVS1ɻ?&+ <TTKy[^ÍvU"+ < BAJR + <9uա+ <ǀÍvUjjju p 1ɃutÍvUVSu] 5$c <|+95- <)‰9}J+ <tAPCǰэt- <L> <)‰9};u+ <- <- <:Se[^_ÐU WVS- <+ <1)&KP ǰэt- <L> <)‰9}+ <9| ,v߰эT F9u- u։ȉ[^ÍvU+ <ÐU-,qÐU WVSE] }ud. < S(VWe[^_ÉU1d. <; > <=t. <t. <= <= <t> <> <F9> <]ÍvUWlc <t => <t+=h> <t"5$c<1u j> <T=. <t0=. <u'эA';L> <t jci= ? <ueuzƃ= ? <uet e=d. <tUVxV~t=d. <t0V1>$at&EffEUEEPR`ÃEt Pt:Cc! $l[<&jjhZ <t. <. <u,p. < u!=l. <v. <. <u,p. < u!=l. <v. <. <u. <. <h> <= ? <ut&jjjb'= ? <t`> < ? <2p. < u=l. <t l. <= <=> <u. <. <ShZ <t=h> <t j5p. < u=l. <vZ<X <;5 > <t k bVJQjjh3[ <+;5 > <   V6KjhZ <&> <L> <L> < p. <9 u9l. <d> <<p. < u=l. <t l. <> <&> <L> <L> <d> <=d. <4.jjhJ[ <t. j j- Ãt$VW{{U1 t&e[^_ÍvUu uhe<}jh ]<_ÍvUu uhe 5. <5$c<P5f <ubEPuOu t=EEEPh^ <Su c <~EEEPh]<5WEP] 1e[^_U,WVS]WESEEPR1oWe EPEEP21ۃ *S:u}u5$c<ESEPÃuEP7] WEPǃw}uV?5$c u}UBUC:uEe[^_Uhj^te<#t<%uR;uv8FtH8FtF<%t1<#u (c< $cujE@PEËu>tw<#t<%ud;uv8FtZ8FtX<%t1<#u (c< $cuEe[^_ÍvULWVS]  <.EPEЍUԉURjhP6H E1;u}Ct&EEPÃt߰MăSR F;u|ƒjUR\E1;u}n&EEPÃtFSh^<}̰эAU)R}̰ыU̍D Pw SR F;u|E@URTEPQ URQ E̍e[^_ÍvU,WVSE=> <=> <j`h^t1e[^_ÍvUWVSE=> <Jt Ph^<EǰӋ} ֋})Ӎ\]jPBEE}1ۃv}_U<%uV|suOE}uMQE PURE } URMQEPE }эtC UFC}эA9wURÃMQN t Sնe[^_ÐUVS1u<ÃEPS |E%=@SBN x[^ÉU|WVS1uÃS t4߰эyjWƃWSV[[ Wh$f <uJE%=t;߰эy)jWSƃWSVZ Wh@f <u謷iÍvUVS=`> <u7 ? <u.j|GÉփut 9u 9uh> <tl> <UWVSu }]EEEt > <|9E~> <=> <tO> <t =pf<t萶蓵 jZF9u 9u >HtOGWVFE> <u=pg<ul> <.t&=> <u6==@> <t=> <tM=`> <t h> <}t ? <u h> <}u }tW pf<j&e[^_ÍvUWVS}] uEE9}t> <(vVSDE}u8<Ox!VSÉփuƒu}u"}u t&}ty j%e[^_ÍvU WVS} => <t-=h> <t$jj jDCÉփt> <tVDt 11W&jjjBRPjojBÉփuth> <vjuWVSu]e[^_ÐU WVS} jnBÉփu$utSPBщƒ uuWVSue[^_ÐU=lf<t1,t&> <}=> <u'&> <ÐUjh^ <u0=`> <tPf<@RPVSeY VSu( VS. VSص HÃux1 t u~wRPStS=> <u =t> <~.à tu謷Éָ> <Fv菷Éփ10褷 ? <T t nZÉָPp=> <t9t5 ? <Jà t tt贷É։؉e[^_ÍvUWVS} }=> <uFjEU RPf<@;U u;EwM] )Ӊȉ 11RPW EU EU RPEU d=> <t`ql t u@  ? <,¶Ã t tuƉ׃, ? <脶à tуu˵Ɖ׃WVmEu}@u}WVUMQR0 s&lRPSntC=> <u =t> <~E> <fjP˵j9} uA9uv<+Ãt  ? <tR( _EMQEUe[^_ÉUVS]u ut.VS>uO衴t< t t0c<54c<聴t t u8c<5 <t VS5x> <t VS,uVSe[^ÐUWVS]u u~:EVSu9ǃ |P+}~)jjjj7RPW{jjjj7RPWAVStjh_<5jQ7EUjA7EU }u}t9uu 9]1;}}b}u}t4;u/u;]w(jjjEURP> <+EDPVSÉփutG;}|nh> <l> <d> <)}URjjVS> <tijC]t&G> <VSx6jjVS> <t . <. <ÐU,WVS]u  <uVS0E܉U=> <tqf<. < 0c <j]SE܋URP /߰эySWh_<. <f<)Rf <H> <(> < D> <1UEtt/tt#> <t&<> <P> < ,> <1ÐUVSUu =\c<t%=tu lvR˯t1U. <~f<D9tPJXt#. <u ;t1SWMƃ=> <t S‰. <Ѓ;L> <f<9. <|Bt . <~~t:f<| u.f<|u"S9~. <. <+. <`g<~ f<;\|+f<ؙ=dg<dg<)H|;}Iy f<)ىWVEPj u. <u. < . <5. <1bt&VSW]át> <9p> <}?L> <L> <9. <~'f<. <p> <t> <)‰P|؍e[^_ÉU WVS]uY> <t t(E URPjj=. < . <. <H. < \c<%=ua. <~Vf<:\uKU MQRjf<. <P/. <. <0V%=t=. <uo%=ua. <~Vf<:\uK&!E URPjf<. <P. <. <t&. <~q%=t=. <uZ%=uLf<:\uAU MQRjf<. <P . <. <tI~E%=u7f<|u+ uE URPjt&U MQRj=f<. <88uD_uhg <~ $E URPS藧> <t uuU MQR&SË5`c <K;tmE URPVP=u-. <9} )PL> <9. <|=X> <t=T> <u => <u$f<. < f<. <. <f<. <f<. <=> <t=. <~f<*f<t p> <]UUM =. <t`<=> <t`<f<f<ÐU. <p> <ÍvU WVSEU }utRP u vÃuq&1f<FJà tuщ)&f <}u } } u}w 15. <. vjVSÉփ ? <u UEU9u u9]wlg<VSEURP;u ;]EUUMQR蓗uDD5 <N^M]^v 9jVSÉփ ? <u u u118EU;u u;]wlg<VSEURP <|كu u]uVSa;]u ;uue[^_ÐUWVSE8-u@E.謍h!`<MQh#`<Ej舋j}jO:j?EjBjh%`<2 }EP?1h.`<ܼE8t~M9u P|fEPƃtT}҉э\ jS{ǃVPEPh4`EP"j9j|} t3M Q#h@`< rj c臉d> <EPj8e[^_ÐU14ǀ5 <ǀ5 <IyUUBw p/ <$BvjhQ`<1 3 <ÉUSE' $t,.t[^u}`5 <? <藑ÐUE|~ uT+ÉUEt|{vϤo,c<ha<hm<hb<h@b<hb<hb<hc<jvvUWVSU c<@װѸ)PװэD P C;`g<|hAc<@װѸ)PװэD P蠂 5dg <uUt|OJjhc<49jsMz<2,c<jj1sÍvU> <> 9|4jCt t&CEEPsi tC t d> <e[^_ÐUE} tt&ÍvUu7Phetn>$tt_PS uK<$t < t < t <-uF5j)CPUkU SWPU F>ue[^_UWVS} uE0DkE;-uEC< v <t=;du8CCC C> <u0u l<t&l<=l<~ ji}_8ut&؍e[^_ÉUEPr EÐU WVS_00 Ƌ}ʉ)ӃjSphǃVEPho <119]t"t.tt" <l<8 <]US]=> <t> <u=l<< >%tPFE_FF <=,c<t== <trqrD> <\:ep;L> <| d> <]ÉUVSu] mqqSVFhl< q> <e[^ÍvUS=,c<t== <tqu u+ Ã=,c<t == <uj "t&o1;L> <| d> <N؋]ÐUUtt,u'> <> <} l<ًTDTC;> <|> < l < l <}l<DB;> <|US< <9> <~}=l<tEP5l< EEj5> <^l<> << <9}T9u9 vH @9|[^_ÍvU> <9}.l< <> <9|BHÐUh p<\? <|݃u ut]ÐUWVU E6$ r <Eh> <;5$c<ƿr<> <1=> <st&  > <v1RutT{sFuIvE>&1R%щƒ t&MsuvRPщ t:#s1Ƀut 5$c<1e^_ÍvU WVSU E6$s <QBrӃuSQƉ׃> <L> <)‰+,>

<? < > <ÍvUD> <L> <)‰+,> <u ÐUM9t3t# <t= <u jt&1WWÉփut <u =l> <t1gWÉփutLGP9uu69]v1ut ;Uu ;EvVSձW@` G> <u@0c <tK}u == <u <= <8ÉUEP}u}t+jjRPEURPfj,ÉU= <=> <uÍvUVSu@t>t11&cbc=> <t!1tSt&5x> <}GSu6u1C;> <|&u!uKxScuuKye[^U,WVS]u VS[EU]܉ut& ? <t }u}t 9uu 9]v} u}(E(p} ~M Et1]uEPډQRÉփE Et5EU+EPVSEUÉփE EtEUu(u#}(tE܋UM(QE&=> <t"+Ey=~VSEURP]܉uǃWEPP jEPEPux1ɋU@ uut uEt"WuuuUMQR xM}k=> <uWuuuEURPs}$tEUM$Q1e[^_ÐUWVS] }t ;ujh@u <u jz=> <u== <t= <= <vSƃ=> <ujSSEPS!} %5= <t = < > <= <=> <tj= <=> <u,UREU}u5]u-}}jhu <u~j떋Uu5x> <u j1e[^_ÍvU,WVS]u= <= <tAL> <5> <tDP=lg<t6lg<=> <u d> <> <jhu<3e[^_ÍvU(UE EEEEPEPRLuuEÐUjhu<? <} ? <ÉUÍvUSt&jEP5? <Ãt$} j@}uEuE]ÐUuu u1ÐU58vhwj Ãu jjAEMKUS‰C ؍H[^ÉU WVS]u 3C3^Kt s It&Stt"yyr 1Sz CuCuC C 1e[^_ÐU0VS]u C @ 1҉EUmI4ۆ$< <3hc<} C mt#(<$pp0hm<َ؃h<Ȏ1e[^ÐUME ƀƀƀ8ƀ\fǀ`Uƀ]ǀ@ǀ<ǀDQ JLQ RJHQ RPj<PQPÉU WVS] {u ofEUCS UMKE Pf`u ƾSEURPUMQRVMQ $Oy֍e[^_U WVS} uofU`PE P,]u ƾVURRPUBR RPS7 $OyՍe[^_ÍvU WVS]} `Ph&<Wjj31 WSV$F~e[^_ÐU WVS}] u jVSWE 9u9uhuWM=u1e[^_U WVS}] u jVSW 9u19u-huWU=ujhsd W%1e[^_ÐU|WVSU] X U; j肶E <tE <<װэAPR7|&5<_LC <E <FE < \C </E <hE <E < &E <E <LC <&hE <E <PC <E <TC <<ߑ<ǹu ,<a<ǹu ,<Bґ<ǹu ,<#h^uEǃKE <{ ~Rjhm<P u3jhu<CP輋 uCǃC@P‰M1sPR C1Ƀ ;K;9t#t6t>u؍e[^_ÐU WVSjEPiÃujjyt&1Kxm[4jZh<ETP1 t5EDPGtETPtXKye[^_UWVSU KW@EuWh̛KWEuWh̛<t&>Kj EPW+ E8"t}|E8tWhKWẼ}Wh!<&PE܃uh<KWQMԋE܉FtFu<t&<<u @9|-HPv19}t&<u @9|Qhh,<1Dž+9fF^P@h<uit8LtJ&ot" lt)rvt+i}uhuSRh˱< SRhѱ<$FC <<};<|<<<t&h FAJ<Ѕ};<|<><he[^_ÐUS]hױfUtZhxEC Ce[^ÉU WVS}];*{u3h@C sLl t H D0FP=+Pht&k <.t&k < t&k <@t&k < k <=n <u =l <t k <=l <t l <uh]ÍvU,WVS] EȻt&M0&M &M&M@&M&M&M&Mu @Pj3j Mu @Pj3j}Mu @Pj3j[Mu @Pj3jE4Mu @PmEP3jEUMu @Pǃuht2it;btAt+Nt&t>?U4U/%U &UzuztUU:tH T X}t't UBGEPPh< t- l < l <WgPh< l < }t,}t UBUBEP/Ph Vj>2e[^_ÉUVSu< tVP= uCe[^USEM  9s/CL}t @;EuEPE PST9rуV_,e[^_ÍvUS]} th@u$hhu=Uu E$vV.vVPFPht&B4t&鍶ރٍGBu   F@;.wE荶Fv t&u'}u!}u}u}u<t&th,F] } <,tY]<.t<:u/}EEP4U fBF]BB< w|9sxFC<,uF] } *M fA]}9s:SCVƋE f@t<,uۋU fzufB>uY1XF] }M fyt!}v>,t9s׃SCV0ƃ>uE fxuE )ËU fZe[^_USU] :\u B=ĺ <t5@ <@ <h=ĺ <t5@ <@ <h}E ph&<48<<6u,jE ptl9$| DžXP1ҋE 9Hu 9xtRuE pph0=ĺ <t5@ <@ <h`ƒcvu>hj=ĺ <t5@ <@ <hSEUWVSE] @C@C<~*3h<5 <蹃 4 <3<1t E=ĺ <t55@ <@ <E 0h<'t@ <5@ t5 h <5 <{ 4 <_E phX<<u>=4 <u2=؛ <t5 <5 =4 <u2=؛ <t5 BA;>u}},}]E<\uC~}$ujCt#tBA;>u}tUCAt<,t<]d;u5 BA:u14<|.t T.܍};>tBA;>uEAC;=t <tt <Ex[^_ÍvU1=؛ <tuM<<5( <=؛ ht&j/VOt @1=, <t+RVSWPRh<5 th$t?u;Dž+<DžPj= <:t :uDž$=؛ <t&Pu.Dt&VW5 5 5 <蠙 u.؍)=vPQh <艽t%4 <;t1t  <Pj=4 <t uuA=<t%P2ttj҃ E; P t&jj$<u?<1t t= <uj"u?<u= <t j= <u(Eu.E PEPh<t~Yj>= <P= <EuvE PEPhE}dzEC<9u E0vEjh <ƃ} :t9<t&<tֿ<u[ # <ÃB$<<r<c <D <Jt& <6 H <, <# <@ < < <<ƿ< "uAt&\uAt$@AɊt"uA뻈@At@ < @ t.эA=v$j?]PVhD;t0} t1;ss4v^F;sr3c^SW^e[^U WVSu} 1;^s(W4(lu  t&C;^r1e[^_UVS=h <t5D h&<57|= <Dž|ut&= <unh <11 &@;ț <}K4< <u݃hh9uۋ 4 <Q)ƒtt  <} t= <Pl؛ <( 2} t,=, <u#5 jh < < < < <<< < <jP诠= <\ <p < t << < X h<Ѹ)PэDP ~X <\ <+<<-p <ܵ߭ܥٽff f٭۝٭ų )tQhy<h~<Ѹ)PэDP&ų )ʉ))É<ؙSы )Ph<װѸ)PװэD P芰 װэAPR <@P}uhjj ?}u9j <BHJȅ|  Rj 5 Ee[^_ÐUWVS]E;dh-uFEEEE <E`<u <EdEPHBDB,VURe[^_ÐU WVSEX(SHUBM9A,B8CszUBttt ur|PhxuwPEPh=<sv&E|E5VEEũUR~Euhh<t&MQh< h e[^_ÍvU,WVSE 84E P61E4>4E P]Ã} w^E $  ]ÐUWVSu} ]VEEP4I$d< PV *SV P SV P SV P SV P jPVrtGPVO[hUR.Hh4<ÃuhAu ,k;tvhN<5PQh<5R8hƃ>tD&6>u4&hjÃuhƀ4ƀFz9~Ƃ ƁWRPDžtt)@lSPWл؃:8@08@~$l 󥃭tS9}E)Ë,SPRS؃?l@?~E; UD)vUULWRQ誹)t0tq=~;u};E~M(!;u };E ~ U (ʈD>;E E9A[^_U\WVSU tNQh#<]߰э\ эA)Eă}~XE@;E} }:t CMĉEȋU9wE@;E} MÈ CMă}~E̋U9>`E <&hX<Ãu ho h6#hP< j虶UWuhh@ <E Ph@ <%u0~mu*FEPPhp$'t&{uF;ut u WS(WEPue[^_ÐUS]SEP;uh3E})EE0UR赣]ue[^_ÐU WVS]}E1M 9-uEAu|90ulyxug&AwLt# tF> u+]~h90~FtKvj3PIuh:<C<3t~&C~1ۉA$‹u3C~X <t&tHj3Puh:jjjSEPTC %;EuVQG6;= <~1e[^_ÐUWVSE}ue5 <{;<tGjEPq Eu6it&h;<h;|2~Pt !uh;!uS|-S蠓}Vh;<*W;<=l<u; d<p<t j:Gp<jG?t ~Ut&t <uE0 ?p<t j?V5 <5p<ej>Vv<< d5~t-<<<l<2S\<&t&E 05>j7j[V thjhܰjjjwh,jhh@ <ǃ t'hP< <=#<A < <tŠD$1t9 ut%#!u h?<$1ɋ <thVh!thVW d<Sp<t jp<0j !<9t.tPzI5!thVW`u=<u h?<5 <5 <>@<}Wu<@ d<Vp<t j; p<3j $t5t <G^t d<p<t j p<ju 90 < d<zp<t js p<Wj% Et&e[^_UWVSEE @1; <R/EEP ƃ ;u VGǃ EF <9d<=}S5<9Bu_j0Hh7BpUB8BGZ <9E} <)‰EEt <= <tW6M < dE < <)ЍpEt <99)Ѝp)ىMdh7B@@C; ,C9t< u+= d<*p<t jp<jmt5t <螜G^t d<p<t jCp<j90 d)T <9d<=}S5 <;)u\j2/h@Cv=<tttL<эQ<<=(%=@u=<u =<t 1VPU RWPUS]j/Swu.vxu$H9r/t9r/t vH9r8/u@]UWVShTuu!Eu jj E|B:tt9M& uA|wfPwhE<&|phE/t {/t/C-<E=~VhE%=@u/|rhDžؿ=<uH9w8u9w(=<~h`KuEU)EUmm M<$hlMuURUMIMEEURUN0M~4UEEEv $ W<~u)} MUEBUvڋMEB))9EtMA W<fmE;F jjjiFUB8MtE1 } MUEBUvڋEUЋUeEFUB8E1~ u-EMAUQEUQMN0~4! jjjFUB8}  ~t5m)(} MMEEvۋEFmOEtr t(t/=5t&V t&UB W<mt&m)σw&}6 MMEEvۋUҋE59V8E1^8o;]v];]v]SURMQL)]])]])^8t&}MUEBU vڋEFXmUJN\mUVTm=F`R}MUEBUvڋF`V.(FdFDFL EPFLP^dSvXFhPj E܃ DFdFHFPMQFPPSv\FXDhPjm E܃  ^LH#EVDUЋ3}DMMEEH#EMЋ9wtlugU"}MUEBUUEE H#E‹FD9wm)߉m)ωF8u  t @tUB W<V@ V@tC9s)}/MMEE9rܐt&N@H#EF8m) ^PH#EVHUЋ9}MMEEH#EMЋ9wufU!}MUEBUUEE H#E‹FH9wm)߉m)@N<V@ V@tH9s(t&}MMEE9r܋N@H#EFw9EM;At.&URMQ\tE@)EUR)UEMAQ UQQV~ttRA)PvFMA8F4~t@>u耋UB4}u}t} u }uEE܍e[^_US]tC$tS,u+@,t Ps0҃s$s0C,C$1]ÐU WVSu}t ^$t;t&jjjWU RP ;Ct gt&vVt BS 9vE )ЃRPs,C C$S,)WE PR{$C 1e[^_ÉUWVS}u ]191v =t u B<1t 1)ЉA9sv[^_U WVS}t Ex$u Exu4w&?tRG4g0)ȉG41҃vG0D*Bo0G4G4wG`REPG`PEp0G`P‹E)PPP `u0XpPEX@ p@1e[^_ÉUEtP$u t&1:u z4ÐUWVSu }tt^$t F(t~,u hjv0ЉEut&E{,t;jKPv0F(ЉEuEPv0F,и}}CD)$U(BDCH)$(BHCd)$(Bd}tKPs,MQUEP,MA$1e[^_ÐUWVS1UfzGvEE9EsMu NfBAM}9rEEEf}uMt EUf*hG\u1;hG\t@qh_ s‹CBsshWJ=5<t"hsWhkhYl Shnvhʅ}J{U t v@`х}J)ʸHF,;s8uH,;F80BF|ÍyU tDT @T,F|֋ы,șPщЙ~U t @XٍXf,$,y8Éم}KRl)øH~Hs$}GxU t  @`}G$),+K8!jVRS0,B8 Nj$9 b,$[hRlBDž 11^v tAt,$9~1ɉt  BDž G;~p|t,$9~A$AA A,P߹t?h`q @\0U t(9v(@\!_9tn1ېsW(xU t 8v(@\r)L,Phq<C(Q~;4#1;0t&U t(; (@`0xU t 8v@`!O9tn1ېsW(xU t 8v(@\r)L,Phq<C(Q~;0#U t( (\{U t ށ v\<tvhr‹9| A9|h{<v{h ~ h|<5م}K)ø < Mʅ}JExU t  E@`х}J)ʸ F;u|Eh<ÍvUEEMAEEE@4-s 3- S'-]ÉU WVSE@ 8xtzj,i,Ɖ1 F E E8эYS2,FU2hwt&<<,.t&<u"P0h <~ u"P1h`<=<u<9Ãtt3hu]}Zj`UVSUu  ujhhEPh@<h謱E; Ãu hz<*jj\VSktS4-htV4,&}th<ht73EE <$h <)C9}<3uσh <e[^_ÉU WVSu h<1ۃ9}7~vUPh <ǀ9}h%<賀C9|σh'<螀e[^_ÉUShSfDžfDžPSh*Ph<~jVPh <~jXPh<~jZPh-<~j\Ph<Ph<|jDPh/<|FNt h@{jFbPXh<#{ FrffjSh*rCfuhPhSt.=d <t 8tSh_u1ۃ>j6pHVUH;v8/t}tEPW6j}KDW6|v*W6u6hhSvU|WVS}EEhtE|8u%EtE PWtPW8tFWhE%=@t!jÆPWh=#<t%D$1tEHMxt @vʃRh<\t }}t EF>u ENPh?<ɐt9\CzЋM At;xvRhI?+]]E+E=U҉URMQEEhhh SzF u -0vPSht(w t%D$t&1u҉߰эQэA9th#u~nu \<<<5<诊p<l=L<u<8#uxnu \<OL<Ät t-G&p<<;X(<  A<L<t&|<6]Shht@jcuf{t C|< |<<1>^&;=|<|hy\tE <<} ;<| t<<h <<};<|<$<hZPhX=H<t5C8u@9L}tMQh<&t0 PPSh<j趺|E<8tjP}W E8/u?}tP,hÃu]t SogjSEP vh-~Ft1-J~u?<6$uE:EPjVE}uVh<ShD11Ҋ<w0XFB#<w\荶N\\AAF}܉}?t AE܃8Ut A}t3DE<@jupuut&+]EE<|;Eu MEu}~TSVEPa}9tURt&w8&E.&E&E&ED<tE E!E+ uU܋U!UE-EPhDǃvE؍WU̅ttE%@t tE}u '}E܅ t}t}!}h[<Cthd<thh<Cthl<thp<C@tsht<f;}shz<Cth&E.& EE<E&EhtS6VP6W豇à u E t$hEu}tFW]S t$hEtjV贰8tVh`<E<@@LuhyuD<Ã;uVjjjQǃ;t9j=3Gt@jURP3\Qt;ulje[^_ÐUE8f%ÍvUVS]Ez;u1e[^_U WVSuhD<tEPS(u EMShF<ͽvEEȍe[^_ÉU,WVS}E 0j]S,EEt&?t :t$2pu+G#vuh<`uh 19}E<P4`C;]|1ۋUt CBu>uGE 0e[^_UWVSM<<=@t@FE;t5E:Cu%SVM2uSuBv ;u1e[^_ÉUWVSu]}}u 1 E H#$<;%;%;!tCS} Dž! E<tƒxvjSjS}jSmEPSCEPS蓪1EPSE%=1EPSE%=@t&1EPSE%= wt&1EPS_E%=`Gt&1EPSa/E%=t&1EPSCE%=t&1EPSE%=t&1EPSE1EPS|Em1EPSYEJ&1EPSa/E̅}t&PS]uDž1tP 1EPSD<9E1EPS|9EitjWSoWSV.tjWS%CWS*.%*t&WS .WS-%t&jPS~tjPWeuE $<9%9%l&9%L&9%,&9% &9%&1EPSC PW(…uGH9E@:v1 PWumEPS…u H9E|}KD1EPSu. PW誥u 9Eu$9EhTD<EEȉM}u Ext h#u811ҹ9}"t<1#t12B<1 %A9|ދE1_19}<1 uGA9|;E | 7t&K|&<1 uJ2#J12Iy#E8[^_ÐUWVSE}kE PUR ƃN}ujM 1\ ƃ1vG;}}jU P7 9~;}EBu;>"<\u C9}C9}$};Bu;<'t<"t <`t<=t<:uʉ])u}NI|.Ut%#/tvA9} E</u9U:]3Ee[^_ÐUWVS] }EPWuuSmƃ EuEEut1NtEPVSMQ҉…u E 1}$tEM$EM E70Ѝe[^_ÐU WVS} E}1E<PGPu7>tY;\u {tC><*t<<[t8~u}t 7*D>e[^_ÍvUWVS}1QE װI;E}11ҋu PUF) F9tI>Ph<u>PEPutʃVWU҃tEt}u SWU҉EEe[^_ÐUWVSEU <<‰<<<<< <<<E<<<<1ÉU WVS1 <<9uj1t& <=<ǡt&ڋ W5<ƃ|&<)Ѐ^uHPi(VjWƃt&QE}h9<W |'ҡ<} jE; ^uHP@$;=E9~@?tр^@K &@C;ue[^_ÉUS]ȅ}A) <( >ȅ}A) <1e[^_ÍvU WVShY2E>}E j[E PEtW@<*t<@uLUz]uC1ۃM QEP-ƃ  tEtf&tCvuP*t@u E<@X8E PQ-PS0E =<ЉU}эY=4E<tu}uU Rh<-XME<Pj S譺PUt&E11ۊE<u^:uE1ۀ~u^ӸE<P t  ]3@u}t,-]<1uD9uM}u}u΋UEEU *t@uj}%t #t=tE<@xu!M<@/%@HUJ@B@j[E PE@<*t<@Uz]|}% # =E<PhgEE耉EM QFCP+ƃ tbtVE;Er7U)E<PPRgE؉E؉EV-‹EEvuEU)u6E<My@uE<PRg;Er3E<PPRMgEЉEЉEEEEUBBMy@fJ Q}=uU EE<rjM Q)UBP,M }E<@u3}} U8u M9F8F8u}F tvBtRh&E<|tECE< E<E< jEPjE؃;t78ujpjhjhh< PE&E<5j W E E Wh<;E x u{E EE x 1jhD<) t&h1e[^_ÐUVSu] D<XEtC<uuht<;P= 8u Vh<PPhD<'(hd u%Eu 1h<!vS&EPUz(uB' UBj EPTPUR" ƒ Ex(tjjPGvE@t RPEPRWPURj]US]U E$lxtSh~

WC)PhE<Ѕtj\`u\\DE<t"\t= <u\&G\\$ \"t0\\\`u`xt "G\\\)uO`B~ HB DE<t\t= <uÃ)T\(`A\\uTDE<t\t= <u \ 2\\G\G\'uW` `T;JuQR``DžXG <&\"u` DžX G~G\Gl\"uG` DžX >\\usDE<t!\t= <u\\\$t0 \"t%\\t\`t\tG\GG\G\)uB G``;huQTP|``Xe\|u GV\( G G` `T;AuPQ`` DžX DE<t\t= <u\ \\pH)…~RWpP`(ǃvL9`th<t&X u DžXt\X)t$>FEE<}E<Pjǃu FЉ\>ƒ DE<t\t= <u9\t\ue\>u GG G DE<t\t= <uCÃ-u`O f&u%\u GG\>u|u O@vS_GG G|tC=E<p9X|R\)g5\&tB\ 9\('\;t \|  DE<t\t= <u&;\uA\;t(\|t,\&uv\\|u&uzDž\w[Mo :t&=9E<uH DE<t\t= <u  t&'Ã(u Dž\ S \t&)G|t)WPEUBBu 5DEP=7E<tjjjh8tjjjPE 0u#h<{P~P0tthu^=)E<t-FtE(D<Àtu21;Ee[^ÍvU WVSE EUt1-t+u%xu-u=6E<uBE<F*t?uEt&[u<E~~!u~~]u~y]utp}uF1f}/؃Ph <#tEtE8E3|ut*}u$1B)utms }tMF;u 1}tu }%e[^_U WVS}t6}t0UBU1ҋM 9MsME<t9x1MAM=)?ty *t:[tD=%v====rtREPEdWU9UMMQEPURM QEP xEE;E rjURMQjEMExu'URMQEPU RMQ }jEPWƋ]U 9wuMQFPWSEP> tPURMQEPU RS 9]t'MQEPEPU RS C;] v;u]jMQEPoEMUzu'MQEPURM QEP }&jURWƃ]M9MuG] BEPFPWSUR: t$MQEPURM QS C;] v;uE눃jEPURE!M]M 9&}jEPW^ƃURFPWSMQ0u2;uu1u'URMQEPU RSk t4C;] vMA9E9ESU 9U%e[^_ÐU WVSM] 1M19u A9!tAA<uA}<t  u(u 1[uqEl9u:y-u4yuy]t(AuA}t9~ 11t&9t 99vy]l19tA[^_ÉU WVS]} 19sO&;u>C<)ur<|u}t uC&}Ph < tFC9r1e[^_ÉUUuE PRU WVSE +E;U<֋M M9s436U҃u܍t&} ύ&9}vqM17U҃uMՐt&~<9uM믋MM^E9uV+UE )9|"EPU RGP] vMQSEP}UM}e[^_Uu u ÉUEU @@P @@ÍvUWVS}] StDEtC-u$x-uxuBCKt-t C t+u @EuCC$C-u  & CC}?t3}:t-};t'},t!}#tuVEPuuQE8:uECCCEPC  < tE)PjV>ǃu})SVEPb];urEE)EE؍e[^_ÉU WVSuU }~)װэY;]|]KSRVR3e[^_U WVS}1At&uSG8#t G8#u?GW< xGEPE PWtuƃ|e[^_ÍvUS]jjS#|.u 1+$PjS| &]ÉU WVSu} u"E<PhÃWSǃu/ut&@)/FD>+~PVRƃ&WSVhSp5  }#A8t:1Fr/tSVP}ƃtƋE; Fƃ=X!<tX!<=\!<|tj\!<|tX!<؍e[^ÉUVSj2ƃt&tu!jjV&uPƃ ;tE}u u0t&ujVEPj^EjVwjLGǃ}X!<Ee[^_ÐUVS=X!<u&X!<u\!<=u=\!<t1X!<5E<^؃% PhWtU)E<PPRnE؉E؉E&EEE<PUE)$PRZnFE;Er8U)E<PPR(nE؉E؉EEEE<PUE)$PRmF)E<PuDnE<Pu0ne[^_ÉUVS=X!<tX!<\!<j /\!<Áu &{u }t&jjƃj Se[^USj hnjÃjlCu j4 C؋]ÐUS=X!<tX!<\!<j,U\!<=t =tEjÃu.jjÃjC /C X!<1]ÍvU WVS=X!<tX!<\!<j 趂\!<Áu {u}j*11"Seu ƉGFƃ=X!<u%X!<h8\!<9u9\!t'EE<u:=uVh<B:uڃjÉsf{DE<@Ctj j{MX!<E<Bƃ fBjCjQCE<PjCh‹CPE<Pj(h‹C@C@C@@:C@@C@@E<Pjg‹CPC@C@u E<`؍e[^_ÉUSE<Pj@gEE@E=X!<tX!<\!<j S~\!<=te;X!<E;Er7U)E<PPRTgE؉E؉EUE<E=X!<tX!<\!<t&j}\!<=w t;t j3EU)uE<PR6g1d;Er5E<PPRfEЉEЉEt&EEE<PUE)$PRZf]ÐU WVS] u}uXpxe[^_ÉUSj hE؃VPh<~USM] P!<T!<QP!EF EEFu:Ft=(Dt 1 1ҋC C@t u1 1Ct)t =)E<t($ωCu C Ct&jRSte[^ÐUS1`PhtWPF>uWj){FbWj$eWj(ZWj(OWPF>uWj),Wj)!F EWj"EWj"Wj$F<{uWj{FWSFut&F<}Wj}3WPFWj(t \Wj| t&Wj)U=e[^_ÐUEPuu uH1UDSU]SuBPu R EPujSS~]ÐU WVS}UBU%UPE:z$EPwW1duj ЅtPęÃtK-uF;URPC;uEPU RwUBt;uRj;EPj yURj ] uF~EPj n~KURj QK3&wE PUR URPuFUuCe[^_ÍvU WVS}u 1E Pj fGNjUfBfGf: uE Pr[t&U REpzGEPuGZt&ӋuE P)PFGƋUZE P3;uEPu G\ӍuE P)PrFGƋUZE P3s;uUB tU RP1G E PUrGE PUrlGUBGe[^_ÉU WVS]u jS")߃VWEWSPe[^_ÐU WVS]} 1C wV$<Cu獶FCu׍Cu$tt&FCC9uu,{ uN뤍vCPhSPF>uvSj$տSj(ʿSj( SPF貿>uSj)蟿Sj)~&Sj$腿F<{uSj{pFSPVFuF<}Sj}3SPFSj( Sj| t&Sj)e[^_ÐUWVS]uE P+]PICEU:ME ME PjCEU}uExtU RpMAUB tM QPUB MAtU RPMAEEU<XM؍e[^_ÐU WVS}u Gt VPCGt3Ã;t&V3B;uVwBGt,Ã;tV3B;uVwBG t VP/VwHVw<VWjBe[^_ÉU WVS} uP&Ct WP7BC t WP#BCt WPBWSBue[^_ÐUu uHÉUu jurUVS<|PO<G<jjh<误Ã}uG<Z0PhE< BuCC<t&@CB@CCDCHjSCPtjSCPeEE<PS>e[^_U WVSj hEPSxvS  t Sq ]UWVS]ECt S~ uC u &C U CCÅu< EEC=#<-uE#u2u}$EE‰ME<tmt D$1t=t D$1t ©"t&t D$1Ʌu|9} EЉE %C'}t]UE e[^_ÐUVS]EPu jƃu1L%uss 5EC {us t S~ ؍e[^ÐUWVSu эyUBtzuzEPt&E<PZSm4EU]f 7z <I9v,At%#0uF>0tVWWh"q:<t&LVB:<h"<5L"<[t, t&:MQRP]hE<5;<u >Ds=;<=;<5;culFct9t SW >ytSWt*cx:<:<:Nuh:t?=#<t%D$1u: ut1ɉB:ulj:<:<::0;P@ ;<0;< E9 ;uS2IjX1t&]ÐUU}=?E<t~u@ÍvUS]=?E<t}hd$<:~uj^V:@SG:]ÉU5;Uuu u ÐUWVSuU j`@US]E jjPSujj(uS(t%h!'<h?'EE}tEtE PSAǃhEtaaPSEPh-ƃtI>0uDEPhz.ƃu&u}.ƃuփUREPǃt2E| uD@P6-Eh}tUR-EPAe[^_ÍvUWVS X<9E uE;Tt|&:EtCFtd:Eut[StT1:UuM:UuE:UuE:Ut:Ut :UtMtCCFCF;u}IM} tUM Ee[^_ÐUWVSEM  (<EZ<Ɖљƅ~*Ec Ey3<E}3Ec E4<'E4<Ec E2<E2uAt,t%#:5-="Zt &B:uCtBIu[^K:̀rÐUWVS}] U ‰UE1HPE @P#,E @t&B< w ƒЉEPJwE=B<w ɉE%u t&u<vw G wS$|=<}Ȉ>%G}?~E`[<><[<]Ȉ3[<}G}7~E ?<[<] \E}/~Et&E}}؋EEe BU <]<}<<EU1ۋMBuȿ^<7 _<}̉7_| B<~|FB< &t U[^_ÍvU WVS]} uE$C2CaC$PhCE`T&}u}u h8"tu9u9EuU9UvE}}t EM)‹D/}tEEEЋUԍe[^_Ð ̀rùre<̀rU\WVS}WjwEMh )ʍUEE]ĉ )ًUUBWj|~E<] )ٍUBE<]ĉ )ٍUB j]Shu&E<[ )ٍ &e[^_ÐU(UE EEEJv 0<]܅t'VEPM Qss tʋ[uۃu-e[^_ÍvU VSMu ]U <@u!PEPjFPlڃDWVPs%:D1ҋE; `xa<5a<.a<%b< b<-b<Eb<bb<Ð!̀rR̀r'̀rUWVS}U cc9hSW#A=@uW@cuEPƃ\~.u~ tۋF%=.t̃F@PURFP~bEP`R˓ t*lu lvt&9]i9}`F]+]}t@9|v&9}ht\h+}ttPURqEÉ]thW)SURa]}u ME/F)EPURFPtaEPU Ey8uluttEPp`t`Rp}t EP[1H[^_Ð.̀rÐU\WVS]̋EP BUȋH$M@tEut} }EE}URUM MϰыUL MM9Ms 2uv G&UB9Eu RMAt`]S9Usu܀~ uGuF9EEMAt%]D$ &1u܀~_9UUt%MD$1]܀;_t&uF9EuFtJ9EE܊ uGu1Mt%]D$1m_dE܋u;FU@t%UD$1uLM܀y_tC%EuEMQ]u%=uEE}u&E9E}uU9UE(MMBu%U=Xw)=H'w =8tB=P.=p`w=h=xf]UBÃ| u | E \)E)9EE܋u~ ωىEPE @Mً]9t Eu9uʋE@tt&EPURE@PMQuVEP? U܋MD .]CU܋uTU܋E@FuMAU܋u;uE@Nuu܋M4QEPE)@PURVMQ XU܋E@MMAu\3EPSQURMQuVo P%=CK%Ë%=uK룁UBLUMU܋M+Q TEPURE@PMQuVEPUBUML1lMATL UMU܋M+Q TT EPURE@PMQuVEPkuUBUMTL 1e[^_ÐUWVSE EEU;BtHMEMeEPhPURQM1EEE ]EUE;Pt ME9EuUU11 u M@uuE@u Up,} u M@u}u%E@uuNjUp0t(~&MQWQEPURM1E Nځt7tË# G&UB9Eu RMAt`]S9Usu܀~ uGuF9EEMAt%]D$ &1u܀~_9UUt%MD$1]܀;_t&uF9EuFtJ9EE܊ uGu1Mt%]D$1m_dE܋u;FU@t%UD$1uLM܀y_tC%EuEMQ]u%=uEE}u&E9E}uU9UE(MMBu%U=Xw)=H'w =8tB=P.=p`w=h=xf]UBÃ| u | E \)E)9EE܋u~ ωىEPE @Mً]9t Eu9uʋE@tt&EPURE@PMQuVEP? U܋MD .]CU܋uTU܋E@FuMAU܋u;uE@Nuu܋M4QEPE)@PURVMQ XU܋E@MMAu\3EPSQURMQuVo P%=CK%Ë%=uK룁UBLUMU܋M+Q TEPURE@PMQuVEPUBUML1lMATL UMU܋M+Q TT EPURE@PMQuVEPkuUBUMTL 1e[^_ÐU,WVSEX(P,U@0EU UEE;PtRUUpjS<EShSURPE0NËU,pSEP5EUUEUE;PtEEދ}J1t uEE11} uBu}uE@ur,} uBu}u E@uur0t$~"SWSUREPU2pà Nށt:}}tE#=E@ 1e[^_ÐU}tˎ/uuu ÐU WVSuE EF0=F+EPhVF+EPURVjhVjFHPVjhV VCNj;FsR8,uMPPt#Ӄt#u[VU RtGE @4EU B4>]-<;uSVE P,tU;C~ًu~e[^_ÐU WVS]{u+u t;CPSZS ECЋM MQRPse[^_US]{u1C9C|@@PSSC M M C]ÉUWVS}_uu WG ]G E_HUUE]u;E|@uu;E|@IyكG+EPW MPD PG Uue[^_ÉUEM xuP % EÉUVS]u 9s}-Ps u j SC se[^ÐUVS]u CFCPs rFuj SMC Fe[^U WVSE} x1ۋO&%=Xt=w=t$=Htk\=ptbw =htYJ=xtAuqCD %=`t=t=uG=u;_@~u_@1ہ`G@t]@P Gt t&FO>uPhmƿhx<)f}tEPhm{u(f~}u!f~u,E1EPWVS0tj{S:ÃuكWVe[^_ÍvUWVSM] 9tf9ufDžqf>tnf[u7f]tftt&f]tfuf>u.*t&f{u f}utf>uuf>u#EPR(UDž9[t ,tn{tE}tNكf]tft!f]tfuf;vtntf;,t_~9svf9rFft&ffuEPRUK9 E1[^_U WVS} Ef8~E@ ~EtG]9s#UBA9sftf/u?u3uh&ntj]VRb uf[!f[!uf!شff>-u^]tf-شf]uNjE H f]5U J f?'E H 9tf*tf*شffPU RPRuqU ;u3B u %=uPU REP81U B u&h j+PBBPz1[^_ÐUUE 02ÉUEf8tuuu PEPRPR1U|WVS}uEffE P]SEPt1$E @ t`f/tYE%=@t.=uCE PSEPvu+E%=@uG;Ev f/fE @E$PE PEPt&f/t3f}EC;Ewfftf/uӃ}u0߉f>/W;Ukff>/tE$PE PEPQPVEPWE PEP x[^_ÉU<WVSUM ]u %e[^_ÐU WVS}WtAG4Ktt&t P9sw#Ge[^_UVSEM  I81vVF$utVSI8 V<1e[^_ÉU WVS}G% |V>fF>ujVW fF:KN:ugAfw^jVW fF:fG$jjhMn<F }SHFfF:\N<Vt&ftG$@tGG 9C0t?C<ts UGtP GfC:&Gt^tW$Py Gt:sjSW tRGCK<wt=F@Fvu+jWPGuG% n1t&wGvPbf~8u0G$uwStO% 릉VWF>ftfuZjVWfF:fu;G$u5jjhMn<F }FFfF:t&N<fF>OFP$@|/uT /BF(@PFDPRpP|f~8uVi(FWF$f~8uG$wQgvF<tHG$u2v Qt Ev lSE-t&v SS&vuhOn1v7EÉU WVS}] ttE7DG% F:f uF&fGt Pju O%f~8uF8/tG$tSW\GN&jjhMn<ƃ|+SW,GVFP uVQG1e[^_ÐU0Swu> t&wSwit O>G1 C%=@ui O0SW,C G4D.u"EtGD%=.u kGfx8|;P,u;H0t6@fx8}:t&=u '=t &x[^_U WVSu} ];^~?C(FPvu Ft PuFFTFNSUt @uv jSv~N9]tt&ABKu@e[^_ÍvU WVS}wHE@$uVUÃu1BVjSUBC{(fC>B$u D;I$C@CDWu P؍e[^_ÉUS][Pl؅u]ÉUS]U C9s,Ct P0C;?9SRseuCt PCC1]ÉUSEXPtBDJ9t+JىJZRuU fz8|-t&BDJ9t+JىJZBuBfz8}[ÐUWVSu1ۃ>t#t&>эQ9vӃ>uC[^_ÐU|WVSEu ]@$t1}%jjuÃ} xEPSt 5t&E9F0uE9F,tw:SkFǃW:0}} SG>:0x[^_ÐU VSu] tD58-tKRSQPURhdnu}tEԠn-tKRSQPURhou}tE-p&]t.0C4t&]t9}-CA}99|뵉 륐t&[^_ÐUWVS}uu u1qt&)uE1u _v}GuEE&S7EP])ރWe u_9wӃV7EP̻)w7Ee[^_ÐU WVSE@UZ09u?hƅtkEp0@4ڊ7OyU21DEx4?URSZƃt 7WVS+Ep0UP41e[^_UVSu] =<uC u.tJt"S"u6c CCK {0t-C49C|St]PPCJc ߋCt9vB9uJC)CC<C8C@C0C4SBCBCe[^Ð)4̀r$OpenBSD: fork.S,v 1.3 2003/06/02 20:18:30 millert Exp $3̀rJ!Ð3̀rÐUWVSEEEvw:tF>:u^FPu+^e[^Ðm̀r]`̀rM̀rUE@(Ð1̀rÐUVSuCvC<v9C<v2C< v+Phx<u.u>.u 1t&Fue[^ÐU\WVS] ~.h:>~.ht%##tj#V藯ÃthkytDȃ)ËE)ȍS9}" P6M>ue[^_ÍvU-ÍvU|WVSh!Ѝe[^ÍvUVS |:8:t9u0t%#SDPDHDTLDD!1E9}ǍC1҃8t((A9|<tS1W&VS`D<tjDP{VTt>L1RPDRTPURֿ ;DtWTPVeL1RPURjjDPj=T u'Dž@4$CCfCC@ t8u׃PTt&)HP9G,0 48T83V8Rct'>_FP8PcGCG $<tJr <tJ<tPRG=tt !=tC.C(t&CCt&CCt&CG uCfCC@@~ t 8,0Ht+&F<:tt< j}u<cv=$<uh$<?}t9EPEP}эAPURh<5$<3ǃ GM QhE MȉA.j6t_hu1JjGÃt2VVt =<u(u1e[^_ÐUWVS]SE P3tS)Shb<SE PKj1EPSEP t|EE}u]WVS^t tTt1t׍t&u])3vE 

:tSh<p :tjWh@<p ::M t :;S(M .t&u'l E| uHEUB=w#tj#V!Ãt5B$L<<҉<2e[^_U WVSEu5<1 < t2A9ruytABQMy>Q)A<)ƅu =Ĵ<ttjVW7 uVǃtS + <<9s <C9r=Դ<t VhW}t$=<uE<t&URe[^_ÉU,WVSUBwEEE.EEEEEE$jjEPEPjEPtmE܅uf_t&EE=Et&I(jjEPEPREPetU܉ÐUWVS < t< PPP< t< tꋝP< ٍu܍dA9t't%#< t< P PPP< t< tꋝP< <;{|h2t%##</#< #<ʋE; ~N`<&A9t$t%#,VPUPhǃ u=H<EPZPƃ u5HJyA}} +E@E? ‹u;ur;u sEE +E9E|FT}}+uuE[^_ÐUWVS]} }EEEE}t@M MECt7MM9t EM9uMMOt&EC։Å&}tcEPMQEPCPq|#W;U z 3CM}tE9EsM9MGt&.t̃\u3Ct;}s(G3Cu܉)ЍHu.>v}t)E 6;}r}t M G+} e[^_ÉUVSu] 9s(@t ʁt t ܍&@9w ) &[^ÍvUMw0t#u E )EEEE9E=e[^_USM.AtXA.tG.t .tuBv1Bv)BЃ v!1*BvBv BЃ v-u߉Љڅu[UE8*uP.uu  vPWÐUSM1ۀ9uUAt7B߃]w4(1\uAtB߃]wu؃.u݃.t1 t&Q]ÉUU ߃]v1 BuÐUEff@ ÍvUU B B B UM UfQÉUMU BBJÐUUw <DPÐUVSu] CCC t{u"SRt7 NC);S|SZu1KB;St C t u SvZue[^ÐU WS}] }эQUEPEEEPSNe[_ÐUUBЃ wBBÐU WVSu} E.+/уv1t##tj#VsÃt5Cj EPVU9: =f%<<<<ƃh:tX t&ulj]ċu1U%Et3tX &u uEE]G ~UUЋEE9EzEEE؃uMEP_Y]E+EU܍EPXEuMQ YEEډUU܉USjQ#KEEfEUԉUЃMЀyuA _AA fEʉ˃TUŰMJUЋBMACUЃ\PREPCCUCDEEMA UBTPSMQC EЀxTtBT$E EEeEMA}uЃDEEUt&fEwt&f}gEʋMf9A t賻vf}GUB:M̋AUBABBuЃEu1Ut&G 5%UЅBt>t XuƉ]ċu1%UЅB>tX t&tt htIaEMA SVP?MUJ>uEPjQHUU"SVMQUEPSVRA]G KEMEU‰UЋEE9eMQ1VEE9ErUMEURU1e[^_ÍvUuUÐUEM Ut t%t&RQ*$t&RQt&W/ÉUWVS}EEuEeShRYp))Dž<DžjPS3S肫u-jjjE@t|jjP >tgFu`}fEjEjhh%<]EPXjjS6sà u6k FE; +E; ƒu1!:/uBCPRuC Ћ]ÍvU,WVS} uEEu;Q)ڍ9u)ٍ9uEtTt ftl_NQ)EEvu};QEV)EEvudMMF PNMEFEvu~/EE<Ӌ)EKuM *)R)q}IQ)Ӎ)v4Egfff)T ȅ}Љڅ}S )$I))Љ)yM)y;]}/QEEuD<;0}C;]}Q;0|)EEEE[^_ÉU|WVSEEẼ}t/ǰIMċu΁vEECUR-ƉuċM)Mă}>EPVƃtpE PhH<Ãt U >uȃVƉuM)M}v$t(<,t$<;t EPVƃuCEEЀ>u tS<<,t<;zF]SVƃtF<,u]SVƃt>uU BBMىLǂPE@TMى`ǂdǂh׃ցEEEuԍEPURMQuЍEPURMQ 9~FFFEEu<Q])ڍ9Eu)ٍ9EuEM@<)EE}19ME1ۋUBUE H9}dE Pƃ<2uE LډU2&C9}&E <0uU L؉EE19}cE E Pƃ<2tE LډU.vC9}&E <0tU L؉E19M Mu PEЉEUԉU1M EM PM E M\u(1tE XuE+EE+EM D9M Lڃ<0tUvUCE ;XuMًU LǂPǂTE؉`ǂdMhBBt&EE @@UډLǀPǀTMAMUE P }tMċUD M A E x ] LURMQS;]}tE@PEPS;1x[^_ÉUS]Sh<tjShtOэA@w9} t3U :t+װэA@w}t}t }~ PvUMEEЃURVKt  tIэA@w3} t-U :t%װэA@w}t }~ U ME$UM؉MȃEPVrt U |EEEE E܋UUjjF0P^LS謂EPSˀu~trE0f`FPS@ЉFHFPxt S@Ѓh h VuuS/G$RMffM )UB ffMDEE|ffDfft89\>RMffM)yrÍvz뻅}r5z-&E[^_ÐU WVS 7. ' ÐUME EUB EjjEPQjRt1ÐUEPuuEÍvU,WVS]EE t%#E=w4 ?w E=wMw Uv1.t&  ƃ} tffE 0[^_ÐUVS]C fus= &tS'1C tsЃ}{ }sVS0tC@9t R<C0CDtP"CDfC CCe[^ÐUVS]jjSt'E URPjSjhƃjSe[^ÐUS]SIt K]ÐUUB f t 1RÐUS]=<uCC uuIu; K @t"Suc CCK 2S0t+C@9t RC0Ct{ uShh 3a?StLE t!@U@t!}}"Q2 2Ot3Ct Pt P@S1[^_ÐU WVS}jj7@Ãt=f{u';u"f{uS7[?1jt&181j]S7[>ƃt~jS7E>Ãth}ubCCfCfCC jVjV7@jS7@1 &e[^_ÍvUWVS C} t.Ct& Ѓt1+tS"t3l>u ]U VSujj6<ÃtZEb1EEEE %EjEPSjS6g=1ve[^ÐU WVSEX{tjs3,=C}t-&EPu S ƃu_}uj63<Dt&jPujjVSF#ǃ !@tj63<Ce[^_ÐUWVSE] } uS EUBBCBCECCEUBCBCBCECCEUBCBC BC EC C EUBC BC BCECCfEECECCfEECECCfEC 1f;u8CEUUMME܉E}֍ EfEEDSEDSUEMAABABEBEMAABABEBt?BE܋MAABABE܈BE؊GGBGBE؈BfFf;uC[R1f;uFCEUЉUM̉MEȉEUĉUMM}֍ EfE֊E׈DSEֈDSUEЋMAABABEЈBE̋MAABABËB BtMEȋE@E@BE@BEȈBEċE@E@BE@BEĈBtAEMAABABEBEGGBGBEBfFf;uh[^_UWVSEu } uVt&FfEF 5fEẺtUȉxMĉ|]]EEUUMf9M^]EEUUMM}UM 0EE@E@AE@AEAEE@E@AE@AEAtEAEE@E@AE@AEAEGGAGAEAM fEEDVEDVfE]f9]+ỦtMȉx]ĉ|UUMM]]ZfEEf9EGVUMM]]EEU܉UM؉M}U]S 0E]CCACAEAE]CCACAEAAtMEE@E@AE@AEAE܋E@E@AE@AE܈AtAE؋]CCACAE؈AEԊGGAGAEԈAMQfEҊEӈDVE҈DVfE]f9]E̋tBBFBFËFFEȋxAFAFAFEȈFFEċ|CFCF CF EĈF F EUBF BF BFEFFfEMAFEFFfE]CFEFH[^_ÍvU$SMEUBBABAEAYAEUBABCBCECYAEUBABCBCECY A EUBA BCBCECYAEUBABCBCECYAEUBABCBCEC[ÐULWVSMU t&U9tFEjV7 *jU27K(U %e[^_UWVSEEEEPE PEP Ãu1}}uj3E0)uEE;SE PEPCPWE PEPjE  t<GuWEP+jWE0(ESG9bSG9uEC.CPWE PEPƃtuCfuEfKftSE PEPtGtKjWE0G(}l1GjWE0 (*jWE0(WEP&e[^_ÍvUWVSfj6E0&ÃvfuEESU4FtF PEP<ǃDCu`;u fCUfCC SMQ SEP"> C؃)VPPf{UM4уEf9sffHfuCf+EvQf9sffHufCjSE0v&+E,M9t B1vU :u.jRM1.&1NjSE0&7v1ۃU RMQuE PURw!t؍e[^_UWVS}UB($ <u/9Bu(B;EuEPWu Rt EO:EMCtC PUR"Ct  PEPC pG)SPP詪fwUEыEf9sffHfuG+EQf9sffHufGUB($ <u9Bu B;EvfJ1e[^_UWVS}gEE  } u@UUEUfPjjj]SSPEP E] }t6UU]EHfCSU REPX u O<t&UBH9Es/U]E@fCSU REP u O}uoUBtejPE0!ƃu]FHfCSU REP u OjVU2-#UBH9EBjPE0I!ƃuu]fCSU REP' u,OjVU2"ECfGP&jVE0"UUUEfB}ujjjGPPRURuO1e[^_ÐUVSu] Ct,jP6j ƒt3CBjR6!Ct7jP67 ƒu&CBjR6!1e[^ÐUWVSE]p~tjv6!FCw7$ vߋFEjuE0ƃt]E9vÃSFPWjVU2SE)؉E u1e[^_ÉUWVSE UMEUxMMEE]URMQÃut&ECCC fCfCu9vVEPCP,}tUBjRM1oU)[jSM1K1e[^_ÐUVSu] jSEP这jSEP譙ju6Rƒu WB tjR6>ju6ƒt)]BERV59]w1e[^ÐULWVSE fEE 8uUR}WuV]SPMQ3 ]S}WuV]SE PURa E؃}DMU؃]C+EfCfJC]ËE }(UBM Cr2SuHt&UBMAECr2SBUZMq1S+ ] ;uUE }*uuSP.jURM1Vuu] SEPU,UMMԋEEЃj3U2SE؃SBfUMЋA t>w t]C؉E8 MAȉE܋8 EtgMAu^E؃xufvOUBDBЋMQ EU܋UBE܃ ERQӉẼ $9sEvMQK)ʍG9s^] ;u"WEPURMQSEP#WURMQ]SE PUR E؅UEDAf9Es*%U)PЋM؍DAPЍDAP]fCEUЋB tpw t#" &MU؃]C)fCfJEB]ÃWEPSvUЋCMU؃]C)fCfJEB]Ã}u U܋vM̉ UЋE܊H CE̅uU܋PE܃ PSMAEq ]S> %t&f}tEU؃DB]ÉEPTPu؃EP& UԋCUMA)fAfVEFÃEP UЋC f}tEU؃DB]ÉEPTPu؃MACU]C)fCfVEF]ËUBC &}M 9u9] }uuQS]vuuE PURtujMQ]3 jEP3 U;EtHt&1ۅFju]3T ju3E 1ajEPU2- jMQ]3 juE0 juU2 Mqee[^_U WVSEPEPǃu1~MfGUfG] CGGC G {u9]] C9u#KfGEfU];EOƃujWU2 1]hVΜU FBFfFfFZ ^ Bt>jPE0 Ãu VH1kCjSU2 u]SWVE PURÃEVU R9u] VU EE8؍e[^_ÐUWVS}EPWƃtEPWÃu1jEEFCCFfCfFfCfFU B C F uuSVRW‹E0EЍe[^_ÉU WVS] }UfCfCC4G t G WFCfCfCC4E@ t BEP=UFfCC $ C jSE0 1e[^_ÉU WVSu UMfFfFF0CF tuUBNj $N)fFfFF0C7G PS躎Gt\w EPuEeMQʋ F)fFfFF0QRSgUCi fFF $ F jVM11e[^_ÍvUM M9Au1Bf;Er@fBf9zs UMAMMAf)zEf9EwfEUU&MMEf)8fEf;}U Uf9}u fEfEM A t=w ttKt\tt&NjUBu Ƌ \&NjMAu ƋF X6NjUBu ƻNjMAu ƋGEE؋UMA)fAMfJSVUBPъfEf;} EMfAfAUf9UufAEe[^_US]ju 3/tH jP31v]ÉUWVS}11Gf9s_t&C48fBf9r[^_ÐUMU BB jR18ÉUVS]u t2jP3_ƒtB  jV3e[^ÐU|WVSEPE P=uE%=t1rh(jÃt[u1C@IyE WVEȋURP蝙UE ؍vx[^_ÐUSEU M] $[ÍvUVS]u uh&sVC.CPV u1CPV{ e[^ÐUVSu] SV t?tt%2CPV3 tCPV CPV 1e[^ÐUVSu] SV t5CPV t!{ujh\!ucSVy tRCPV% t>CPVQ t*C PV= tCPV) &1e[^ÍvUUE w>$<?& 0 ( @PÉUUE tt @PÉUVSu] Ftt"0Fu mSP2 t&Sv FCtw t 0t& t%FCFFCFCF Ce[^ÐUUM Et B!< t&B!BQPPt ƃVJfu5~"փu tNt1B7t&9|֋tF& p)t&pᄈQƅ-E tFtA8xLt&t<tB@t?tAf8tA8|t& tZr&t5tXst&@t5t_2vtY11tX1Dž<DžxtIu Dž<|:WjPfSt+9;0װэq t_wt&t6tYtt&@t6tY3t&tX1t&Dž<t&Dž< tYqvt6tYtt&@t6tY3t&tX1t t ƅ|E u*$t|r4t&$$P0 uޅ!0O0 ℈0jj VSP0jj VS`Éօwu w0&℈؃ uFt&Dž<װэq℈^+pQƅᄈ9}tt +@"jjjhjVj34ÃE 07S3U 27: E )PjR>U 21e[^_ÍvU,WVSE]M}u fuetEuCEu-EPEPWSR$}mgtGuEtH fu90uE@tCD@uU t&0EE9r؋E$U)ʉȍe[^_ÍvULWVSM] U uM;uv>t]UZE PUR^]C]EE}E܉Eu]]%] ]m%)EE})UU}fWfE9Evu>uM;uv>t]UZEe[^_UWVS]EU EU@Ejj EP+E GUR]S|0E܃EPSÃUREPEx uPUREPu#}uEu}9tq~E܊Uzt&|uP}uJEuD~;jEPXEURS6ƃ  uEܨt E܃}:tU~&}9uE9@EU‹]E܋UBU;}{Gjj ]SEGEPUR50E܋]C];}|ƒjEPEURSnà  uJEܨtCMU:9ut&|9]tME89tUBU!Eȋ|1C]ME80t@EUR}t2}t]9]tEPUR؃]S|9Eu0@EEUE@]} t] |X[^_Ð$OpenBSD: flt_rounds.S,v 1.2 1996/08/19 08:12:20 tholo Exp $<$$ U=$#<#<&1ۍ8t jjXPRW. uC~1[^_ÉUSEX}uuu jS PTǃ,]ÉUSEUXt$tTǃ,DvuSǃ,uu uPSo]ÉUSEX}vSǃ,3tju jS( gSǃ,]ÐU,WVSEp URUM MjjRQP PEP4@EuUU%t&MMIEXE9UCfv0)9uuuMyNjMsEfu#jEPPUR?E}fwEPURMQEPUR7E MMEPEP8f ju%PUR?E_XEMq } w/} r)URMQEPUR' E`$Ub} r&} t} MaEXUf|SwjMQRPEP8UDS؋MECDK)‹MQt&EPURMQ uEPURMQEP&tNUbIMQEPUR t(*bMaE` Ub1e[^_ÐU WVSEUpt)t$tCPdž,$|udž$dž(dž 1 uZ$ Cdž(;^(w#jjSV<ƒt zf?t͉$;^(~dž$:z(f|Gu;jR(GPV< ƒ,zdž(ftf?udž $2f?((f|Ow%jEPM QRV)9t&O BU OfvDO)ЋM At&N )ыE HTG QMGDG)‰Qff;vdž $dž( É(1e[^_ÐUWVS]C(PS(ЉEEC0!EKu;|bS9|)<WPPt"{jss‹uSC(@P:C 9~ SDK C,9Ev C0 EC,UREPSe[^_U WVS} ]S ƃt2WE0Vp)Sj7PE0^E0e[^_ÍvUS]uu #C,;C(~#C0]ÐU WVSujvortjNE POrǃuLVL)1;] } NC;] |1e[^_ÍvUS]M CCACAACACACACAC AC A C A CA CA CA C AC ACACACACACACACACACACACACACACACACAC#A C"A!C!A"C A#C'A$C&A%C%A&C$A'C+A(C*A)C)A*C(A+C/A,C.A-C-A.C,A/C3A0C2A1C1A2C0A3C7A4C6A5C5A6C4A7C;A8C:A9C9A:C8A;C?AA=C=A>CUP?P@UMQP@QPAQPBUPC]PG}BECBCBCBEAfEGAENy[^_ÐUSE 1ҋMXwy$<&AAAAAAAAKu[UWVS}]}t$uE PUR;l1tUbEGEEEGEEEG ESEPhjwSjhjj ƃ ^t(t!GGƃ €ʀ }u  l}EjjjlRkukufE8u\E I! h]u081e[^_ÐU WVSuU >B\N)Ãr2PiGfFEf+Xp0PGGfFf>E)fLFf\Fe[^_ÍvUWVSE pUMf|NwP]S#}t UDVMA Nj]f+|^EHUfU9tu\FڋM QщMMDN)PR]SM;M:NBfufBfBt&fZfB;M~DFUfVf|Vf|VMf]K8E H1e[^_ÉUЍ[^_ÍvUWVS]fELSfMD{fEM AtS)ft{q1PEf+pf4{p0PMf EfD{fD{MAM fAM)fLSftCe[^_ÐU WVSu} ;}Ov 8t0jjjxPRV u 3Z1e[^_ÐUWVSEU zM@EEEURU.ЋE9~fEDGf+EfE]SMQEPѲ)]]7FEfwFf7uM)fLWUfTGfwM QEP'E h7}Dwftv%U9~fU;Eu MU;JtTDwf+EfE]SUREP])]Mf wfDwUf)TGfLG fDwM yIDGf}t&%U9~fU;EuUE;PufMDGf+EfE]SMQEPn)]]7FEfwFf7uM)fLWUfTG}t5fwM QEPE u3U z fwM IDGf}1e[^_ÍvUWVSu u1NEPvDYNjV%PEPƃtWURgt]O}t fyt%QBfwEfuf|Yt]DYUJ~fAfAFBvE@ڃf‰E]UZ )ËUf\Q]C fDQEHt VSt9t WUR]K81e[^_UWVSE XUUMMUSMQ )‰;UuMf|Kujt&MK4}ulU)UjE PUDSPMQ E tRXECUJ );Uf{t;MuUS4}t&Ee[^_ÉUVS]u jQDPPS{t)Afxuۃtfuǃ $zjU RDFPS @f8uK$ǃ 9jE PDFPSiƒt[EPEEPRSǃ~@EU 9B u)EPFBP]UR$t&e[^_UVSu]uuju VCt 1e[^ÐUWVS}E pFW )‰UE @ fE]FffwPt PSUREPjU RW t:{jE PDFPWt_URURSPWEà ~CEU 9B u,EPFBP}URש&e[^_UWVSujEP]SVEP u`suUR8;EЉUEPEPU fB ft.juB PEP+U But&E @E }tEHpX|CLC3F֋EfSFfCf3f|CfLCEU E BEXHfvGsLC|CfƒfLCf|CuUR5fsE}tU U B1e[^_ÐUM19s@9rÐUWVSuEE}t#EXtU 9S t1ۃ}uMED~O#} NE 苖EÃEEu 0uEuXEPU RV|Ãt'jEP}%PU RsVt1@}u8U ڋE+CBSCC؍e[^_UWVS}fEuFtujGƃt.jhVw #F uV蘿1w hv謱rHfFBV~ u FGNf9t DAfEFtjPv QW& sFEt@_KF !ËO苗0tUut  FFCE;C Kf9t DBfECtjjs QWx C CCBS@CXCStCBu E;B hE F F}tEpF &FFF0e[^_ÉUSUB E HJ}[U WVSuuÍ9C …uCt(}t!CtjPRsV u} tICtv jPsۼ CBSSrkv1e[^_ÉUS]E @@ @PQHRPBP[/instbin%s: %s not compiled in Usage: %s ..., where is one of: %shostnamedmesgzzzapmmvsleep-shshkshsedmkdirrmancontrolapmdnewfsinitfsckfsck_ffschownchgrpchmodgzcatgunzipgzipcpeddhclienthaltrebootmount_ffsftprouteinstallbootwicontrolmknodccdconfigmount_msdosumountfgrepegrepgrepfdiskmorelesskbdping6rtsollsifconfigcatpingtarcpiopaxdisklabellnsttyrestoremount_ext2fsmountdfmount_cd9660dd<<<<<@@<< <0 <<< > << > <<<<< ><< ><~< >?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxstdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffer%s: end of device%s: short write on character device%s: short write on tape device%u+%u records in %u+%u records out blockblocks%u odd length swab %s %u truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summary.A%sskip reached end of input<<<<<<<<<<<< <updateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaegjo:Rrealpath %scd9660%s: Filesystem not supported by kernel%s on %smain0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 $ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0  0 0 0 0  usage: mount_cd9660 [-egjR] [-o options] special node ,needsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'hiklnPt:only one -t option may be specified.-i is incompatible with -Pretrieving information on mounted file systems%s%s is not a local file system%s mounted as a %s file system $`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$`$##`$#$`$$`$`$`$`$`$0$empty type list %lld %6s%-*.*s %*u %8u %8d %5.0f%% %7u %7u %5.0f%% %s Y@ SizeFilesystem%-*.*s %s Used Avail Capacity1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s Y@ df: %qd: %s usage: %s [-hiklnP] [-t type] [file | file_system ...] ffsext2fsunionsoftdepsyncsynchronousroot file systemroread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasyncasynchronousffsAadfo:rwt:uvforceonly one -t option may be specified.updaterwrqnoautogetmntinforealpath %sunknown special file or file system %s.root_devicecan't find fstab entry for %s.malloc%s has unknown file system type.:@nfsr/var/run/mountd.pid%dsignal mountdmain33233333333333333333333333333333332332323333333323323#3`333,/usr/sbin/sbin/statfs %salready mounted%s on %s type %.*s: %s exec: mount_%s %s fork%s/mount_%sexec %s for %sno mount helper program found for %swaitpid%s: %smountfs%s on %s type %.*s (, %s%ss%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnwsize%s%s=%drsizerdirsizetimeoretransmaxgrouplistreadaheadmfssize%s%s=%lu %sadosfsgiduid%s%s=%u, %s=%umask%s%s=0%omsdosshortlongnowin95gemdirexeccd9660norripgensextattprocfsversion %dlinux) prmountempty type list%s,%s-o[-dfruvw] special | node[-Aadfruvw] [-t ffs | external_type]special node[-dfruvw] [-o options] [-t ffs | external_type]usage: mount %s %s mount %s mount %s ufs%s: fstab uses outdated type 'ufs' -- fix please%s: fstab type %s != disklabel type %s<<<<<<<<<<<< <updateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:realpath %sext2fsmount table fullspecified device does not match mounted devicefilesystem not supported by kernel%s on %s: %smainusage: mount_ext2fs [-o options] special node ,needsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'$OpenBSD: main.c,v 1.15 2004/07/17 02:14:33 deraadt Exp $./restoresymtableTAPE/dev/rst0TMPDIR/tmp/b:cdf:himNRrs:tvxyillegal blocksize -- %sblock size must be greater than 0%c and %c options are mutually exclusiveillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specified.Begin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure mainO0P0P0PpO0P0P0P0P0P0P0P0P0P0P0P0P0P0P0PN7OFO0PUO0P`OpO0P0P0PO0P0P0P0PpOOpO0PP0PpO!PR>T>T>T>T>T>T>T>T>T>T>T>T>T>T>T>T>T>T>T>T>T>T0Q>T>T>T>T>T>T>T>TVQ>TS>T>T>TSusage: %s -i [-chmvy] [-b blocksize] [-f file] [-s fileno] %s -R [-cvy] [-b blocksize] [-f file] [-s fileno] %s -r [-cvy] [-b blocksize] [-f file] [-s fileno] %s -t [-chvy] [-b blocksize] [-f file] [-s fileno] [file ...] %s -x [-chmvy] [-b blocksize] [-f file] [-s fileno] [file ...] option requires an argument -- %c$OpenBSD: interactive.c,v 1.20 2004/07/17 02:14:33 deraadt Exp $/addcd%s: not a directory delete%s: not on extraction list extracthelp directory is used If no `arg' is supplied, the current help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%slspwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help runcmdshellZ]]]]\]]]]]]]]]]]]]]]]]]]]]]]]]]]]W]fXYY]]Y]]]Z]]]Z@[]\]][P\b[%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! getcmdcommand lines cannot be continued missing %c ../..ls: out of memory directory reopen failed %s: %s/%s%s: name exceeds %d char printlistWarning: undefined file type %d @g&g0gg@gg0ggUgg gg&gg6g%*d %srestore interrupted, continue$OpenBSD: restore.c,v 1.13 2004/07/17 02:14:33 deraadt Exp $leafdir %s%10d %s %s: not on the tape ./%uaddfileMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %d) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state spqqspdpqssstrspstr|NIL|ONTAPE|INOFND|NAMEFND|MODECHGFind unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %d: bad first %s: not found on tape expected next file %d, got %d unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links createlinksCheck the symbol table. incomplete operationsWarning: missing name %s missing inumber %d type should be LEAF$OpenBSD: dirs.c,v 1.28 2004/07/17 02:14:33 deraadt Exp $Extract directories from tape %s/rstdir%d-XXXXXXXXXXwcannot create directory temporary %s%s/rstmode%dcannot create modefile %sopendirfileRoot directory is not on tape extractdirs%s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %d char treescan/pathsearchlsMangled directory: reclen not multiple of 4 reclen less than DIRSIZ (%u < %u) reclen name too big (%u > %u) putdirbad seek pointer to rst_seekdir %ld error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopencannot open mode file %s set owner/mode for '.'cannot find directory inode %d error setting directory modes Cannot find directory inode %d named %s %s: cannot create filewrite error extracting inode %d, name %sreadwrite error extracting inode %d, name %s writegenliteraldirno memory directory table $OpenBSD: symtab.c,v 1.14 2004/07/17 02:14:33 deraadt Exp $addino: out of range %d duplicate inumdeleteino: out of range %d deleteino: %d not found lookupname%s is not a directory %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTcannot find entry in parent listbad name no space for string table Check pointing the restore wfopencannot create save file %s for symbol table fwriteoutput error to file %s writing symbol table Initialize symbol table. no memory for entry table .opencannot open symbol table file %s statcannot stat symbol table file %s cannot allocate space for symbol table readcannot read symbol table file %s lowhighIncremental tape too %sinitsymtable called from command %c $OpenBSD: tape.c,v 1.29 2004/07/17 02:14:33 deraadt Exp $-r/dev/ttycannot open %s/dev/nullCannot allocate space for tape bufferVerify tape and initialize maps %sTape is not a dump tapeConverting to new file system format. .cannot stat .bad block size %ldTape is not volume 1 of the dumpheader read failed at %ld blocks no header after volume mark! Cannot find file removal listmaxino = %d no memory for active inode map Cannot find file dump listno memory for file dump list Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%sYou have read volumes: %s%ld, Specify next volume #: Volume numbers are positive numerics Mount tape volume %ld Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) noneCannot open %s tape is not dump tape Wrong volume (%d) Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %d sSkipping %ld duplicate record%s. active file into volume 1 getvolEnd-of-input encountered while extractingWarning: %s %s Cannot have multiple dumps on pipe inputioctl MTFSFDump date: %sthe epoch Dumped from: %sLevel %d dump of %s on %s:%s Label: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special fileextract fifo %s %s: cannot create fifo%s: cannot create fileran off end of tape not at beginning of a file Missing address (header) block for %s at %ld blocks getfilewrite error extracting inode %d, name %s writeseek error extracting inode %d, name %s lseeksymbolic link name: %s->%s%s; too long %luunallocated block in symbolic link %shole in map mid-media short read error. partial block read: %ld should be %ld Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %d continuecontinuation failedEnd-of-tape encountered partial block read: %d should be %d tape read errorTape block size (%ld) is not a multiple of dump block size (%d)Tape block size is %ld Note: Doing Byte swapping 8l4s31l528b1l192b2lNote: Doing Quad swapping gethead: unknown inode type %d gethead``oldnewVolume header (%s inode format) begins with record %dDumped inodes map headerUsed inodes map headerFile header, ino %dFile continuation header, ino %dEnd of tape header; predicted %ld blocks, got %ld blocksֹunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks findinodeлCûChecksum error %o, inode %d file %s l$OpenBSD: utilities.c,v 1.14 2004/07/17 02:14:33 deraadt Exp $mktempname: called with TMPNAMEmktempnamenot on ino listRSTTMP%s%ld%dcannot rename %s to %srename %s to %s newnode: not a node%sMake node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s cannot create symbolic link %s->%scannot create hard link %s->%slinkit: unknown type %d symbolichardCreate %s link %s->%s cannot create whiteout %sCreate whiteout %s delwhiteout: not a leafcannot delete whiteout %sDelete whiteout %s bad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s NODELEAFentry type: %s inode number: %d flags: %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump core$OpenBSD: dumprmt.c,v 1.22 2003/07/28 06:13:26 tedu Exp $Lost connection to remote host.tcpshellshell/tcp: unknown servicewho are you?malloc/etc/rmtinvalid user name: %sO%s %d rmtopenC closeR%d readrmtreadW%d writermtwritermtwrite0L%d %d seekrmtseekS statusI%d %d ioctlrmtioctl%s: %sProtocol to remote tape server botched (code "%s"). rmtreplyProtocol to remote tape server botched. (rmtgets got "%s"). !L<L< L<L<L<L<L<K<K<K<K< K<K< K<K< K< K<K<werasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscardhL<bL<\L<rprntflushbrkoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d :%lxcflagiflagispeed%ldlflagoflagospeedttyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingekdeccookedcolumnscolscbreakallillegal option -- -%soption requires an argument -- %s%d %d %d TIOCSETDTIOCSTARTTIOCSTOPQ<Q<Q<Q< Q<Q<P<P<P<P<P< P< P<#P<3P<#P<3P<2P<3P<3P<#P<@P<@P<@P<@P<P<xP<oP<hP<`P<-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5S<S<S<S<S<S<S<yS<sS<lS<eS< ]S< WS<@PS<@JS<CS<=S<6S<0S<)S<$S<S<S<S< S<S<R<R<R<R<R<R<R< R< -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrkW<W<W<W<~W<tW<nW<gW<aW<ZW<SW<KW<CW<:W<0W<%W<W<W<W<W<V<@V<@V<@V<@V< V< V< V< V<V<V<V<V<V<V<@V<@V<zV<sV< kV< gV-aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZmainusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.10 2003/06/02 23:32:08 millert Exp $Ffhns.%s`p%s: is a directory%s/%slinkitusage: %s [-fhns] file1 file2 ln [-fs] file ... directory @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.90 2004/08/08 19:04:25 deraadt Exp $RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedntfsadoscd9660lfsmsdosffsBEf:NRWb:cdenp:rs:tvwbckmg%srioctl DIOCWLABELmain00000000000000000000$0000000000P`p0000000 000(STQunknown disk type: %s/usr/mdec/%s%sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.Erase the previous contents of the disk? [n]: lseekreadioctl DIOCSDINFOwriting label to block %lld (0x%qx) writeioctl DIOCWDINFOwritelabel%s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskcan't read master boot record# using MBR partition %d: type %02X off %u (0x%x) size %u (0x%x) warning, DOS partition table with no valid OpenBSD partitionreading label from block %lld, offset %lld disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%lxioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO%s%sboot%sboot%sNONEbootstraps: xxboot = %s, bootxx = %sBootstrap doesn't leave room for disk label\ :%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u: %c: %*u %*u %c: %*.1f%c %*.1f%c %8.8s%8d %5u %5u %5.5s %5u %5u %5hu %22.22s # %s # (Cyl. %4u- %u0i~# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %hu interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d %hu partitions: offsetsize# %*.*s %*.*s fstype [fsize bsize cpg] w # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: editsh-cEDITOR/usr/bin/vifailed to start editor%s %sfork/bin/sh # line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sgetasciilabelsector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dpartition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %dboot overlaps used partition %cmarked as FS_BOOTwarning, boot overlaps partition %c, %scannot install boot programcmplabel [-b boot1] [-s boot2]usage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) disklabel -B [-nv]%s disk [disktype] (boot) disklabel -Bw [-nv]%s disk disktype [packid] (write) disklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. /etc/disktab`disktype' is an entry from %s, see disktab(5) for more info. `packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. fdisk(8), installboot(8)For procedures specific to this architecture see: %s usageRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedntfsadoscd9660lfsmsdosffsout of memoryYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk. Initial label editor (enter '?' for help at any prompt)> unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lesswunable to execute %sIn no change mode, not writing label.No label changes.yWrite the modified label to disk?Write new label?unable to write labelRecalculated free space.Name of the file to save label into.Filenamecannot open %sNothing to undo!Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) editor)4444444444444444444444444444444444444444444444444444`*4444 ,44444444#04444444444444444444*`++,-4-`*4444u.R/4/012424Q3(4@4No space left, you need to shrink a partition Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. The letter of the new partition, a - p.partitionPartition '%c' already exists. Partition must be between 'a' and '%c'. Please re-enter an offset and size for partition %c. editor_addThe letter of the partition to name, a - p.partition to nameCommand aborted Partition '%c' is not in use. You cannot name a filesystem of type %s. The letter of the partition to modify, a - p.partition to modifyWarning, need %u sectors but there are only %u free. Setting size to %u. Please re-enter an offset and sizeThe letter of the partition to delete, a - p, or '*'.partition to deleteYou may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. device: %s type: %s disk: %.*s label: %.*s bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u free sectors: %u rpm: %hu %hu partitions: offsetsize# %*.*s %*.*s fstype [fsize bsize cpg] The letter of the partition to change size, a - p.partition to change sizePartition %c is currently %u sectors in size (%u free). Size of the partition. You may also say +/- amount for a relative change.new sizeInvalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk %s: [%s] %s: [%u] %dRounding to nearest cylinder: %u getuintY@? Error, partitions %c and %c overlap: size offset fstype [fsize bsize cpg]Disable which one? (^D to abort) [%c %c] has_overlapChanging device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).disk typeIDE"%s" is not a valid disk type. Valid types are: "%s", 15 char string that describes this label, usually the disk name.label nameThe Numer of sectors per track.sectors/trackThe number of tracks per cylinder.tracks/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).sectors/cylinderThe total number of cylinders on the disk.number of cylindersThe total number of sectors on the disk.total sectorsYou may want to increase the size of the 'c' partition.Not enough free space to shrink by %u sectors (only %u sectors left) The rotational speed of the disk in revolutions per minute.rpmThe physical sector interleave, set when formatting. Almost always 1.interleaveedit_parmsfailed to sort partition tablesdrzwdfdFLOPPYxdxyhdCCDVNDsvnd?Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %shhhiVik k kk k%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocksget_physUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again ar_nextcould not pipecould not fork-c-dccould not exec$OpenBSD: ar_subs.c,v 1.28 2004/04/16 22:50:23 deraadt Exp $listCannot chdir to %sCan't fchdir to starting directoryextractUnable to open %s to readCannot mix current archive format %s with %s%s: Reading archive to position at the end...done. appendarchivedirectory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %scopyPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.$OpenBSD: buf_subs.c,v 1.20 2004/04/16 22:50:23 deraadt Exp $Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache table%lu$OpenBSD: cpio.c,v 1.17 2004/04/16 22:50:23 deraadt Exp $TRAILER!!!cpio_endwrCpio file name length %d is out of rangeCpio file name in header is corruptedCpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt070707File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %scpio_wr070701070702File is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %svcpio_wrFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sbcpio_wr$OpenBSD: file_subs.c,v 1.27 2004/04/16 22:50:23 deraadt Exp $Unable to create %sUnable to close file descriptor on %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfUnable to link file %s to itselfUnable to remove %sCould not link to %s from %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)node_creatqQ@ qqqUnable to remove directory %sCould not unlink %sUnable to obtain file stats %sAccess/modification time set failed on: %spaxUnable to set file uid/gid of %sCould not set permissions on %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %sset_crc$OpenBSD: ftree.c,v 1.25 2004/04/16 22:50:23 deraadt Exp $Unable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s Can't fchdir to starting directoryCan't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s55555  55Ignoring unterminated pathname at EOFIgnoring too-long pathname: %s$OpenBSD: gen_subs.c,v 1.17 2003/06/13 17:51:14 millert Exp $%b %e %Y%b %e %H:%M%s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == => ls_list%s%s %s ls_tty$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $%s: unknown option %c %s: %c argument missing $OpenBSD: options.c,v 1.61 2004/04/16 22:50:23 deraadt Exp $ustartarsv4crcsv4cpiocpiobcpiopaxab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZ0Invalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedDVVVVVVVVVVVVVVVVV7VVEpVVVVVVVVVV 2VVVVVVcpVVVVV(PV@RdvV(ub:cef:hmopqruts:vwxzBC:HI:LOPXZ014578Unable to allocate space for option listcompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8-I-rUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPE000 00000000050000 000007000000000000000000000(0APp0/%sabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin 0@` $3BQ`p22e%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-cdnvzO] [-E limit] [-f archive] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdiknuvzDOYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvzHLOPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-o options] ... [-U user] ...[-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-diklntuvDHLOPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory usage: tar [-]{crtux}[-befhmopqsvwzHLOPXZ014578] [blocksize] [archive] [replstr] [-C directory] [-I file] [file ...] usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list $OpenBSD: pat_rep.c,v 1.28 2004/06/11 03:10:43 millert Exp $Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %srep_addEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistentRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s tty_renameFile name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s rep_name@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.27 2004/04/16 22:50:23 deraadt Exp $.Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.can not gzip while appending     Cpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal maskUnable to set up signal handler$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]7TTTTTP$OpenBSD: tables.c,v 1.21 2003/08/16 17:31:55 deraadt Exp $Cannot allocate memory for hard link tableHard link table out of memoryqvqvCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memorychk_ftimeCannot allocate memory for interactive rename tableNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to create temporary file for directory times: %sUnable to store mode and times for directory: %sUnable to store mode and times for created directory: %sUnable to set mode and times for created directoriesproc_dir$OpenBSD: tar.c,v 1.33 2004/04/16 22:50:23 deraadt Exp $ustarwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %star_wr@/P/c///v/////6666666666666666666666666666666666666666666666666$6$655`5@566666666666666666666p6p6Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %sustar_wru8889P9909P9P99$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $/dev/ttywrFatal error, cannot open %s%s: : %s@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.67 2004/05/03 20:55:46 millert Exp $socketDI:LRS:c:dfi:l:np:qrs:T:t:vw:number of packets to transmit is %s: %s%sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %stos value is %s: %sttl value is %s: %smaxwait value is %s: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommainA{Gz?.A8ADDDDADDBDDDDD`CACDDDDDDDDDDDDDD@PAD`ADDBDDBD'CD3CQCpCCDDWD`Dping: sendtoping: wrote %s %d chars, ret=%d pingerpacket too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %x --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet loss round-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms summaryY@Echo Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set (MTU %d) frag needed and DF set Source Route Failed Network Unknown Host Unknown Source Isolated Dest. Net Administratively Prohibited Dest. Host Administratively Prohibited Destination Net Unreachable for TOS Desination Host Unreachable for TOS Route administratively prohibited Host Precedence Violation Precedence Cutoff Dest Unreachable, Unknown Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo Request Router Discovery Advertisement (%d entries, lifetime %d seconds) Router Discovery Solicitation Time to live exceeded Frag reassembly time exceeded Time exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply (Mask 0x%08x) Unknown ICMP type: %d \__\^^__^^^^0_______\\\]]@]P]`]p]]]]]]]]Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xusage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host benstuvusage: %s [-benstuv] [-] [file ...] stdoutdeedeeeeeeeedeeeedddestdin-r%s%6d malloc@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ifconfig.c,v 1.112 2004/08/08 19:04:25 deraadt Exp $<|<|<|<|<|<|<|<|<D|<D|y<D|s<l<d<{]<Y<xT<tN<G<=< 2< #<Ȉ<{<| <<}<}<}<}<}<~<~<<<<<<<7<<<<<<h|<xw<ȷr<l<Xe<(]<T<J<ܾC<9<y2<y%<l{<w<|<| < |<| <@| <| <T <Ď <  <t <t < <{ <{hy|descrdescriptiontimeslotinstinstance-mediaoptmediaoptmedia-link2link2-link1link1-link0link0destroydeletetunneltunnelgiftunnelmaxupd-syncpeersyncpeer-syncifsyncifstatevhidpassadvskewadvbase-vlandevvlandevvlanEtherIIsnap802.3802.2tr802.2phaserangeeui64vltimepltime-tentativetentative-anycastanycastprefixlenipdstbroadcastpowersavesleep-powersavepowersave-nwkeynwkeynwidmtumetricnetmask-groupgroupdelete-aliasalias-debugdebug-arparp-trailerstrailersdownup< Hi i@@ < <<L0i ix` < <<dhi i@ < <<ȱi i@@ < <<, i i@@ < <ipxnsatalkinet6inet-a-A-ma-am-mA-Am-minterface name '%s' too long-Ccreateextra address not accepted'%s' requires argument'%s' requires 2 arguments64encapsulation routingSIOCDIFADDRSIOCAIFADDRmainsocketSIOCGIFFLAGSSIOCGIFMETRICgetifaddrsstrdup%s: no such interface SIOCIFCREATESIOCIFDESTROYSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for names%serror in parsing address string: %ssource and destination address families do not matchinvalid sockaddrSIOCSLIFPHYADDRsettunnelSIOCDIFPHYADDRSIOCSIFDESCRNote: trailers are no longer sent, but always received SIOCSIFFLAGSsetifflagsinvalid %s %s: %s%s not allowed for the AFinterface index is already filledcould not determine link local addressmetric %s: %sSIOCSIFMETRICmtu %s: %sSIOCSIFMTUsetifgroup: group name too long SIOCAIFGROUPsetifgroupunsetifgroup: group name too longSIOCDIFGROUPunsetifgroupbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xSIOCS80211NWIDsetifnwidpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYsetifnwkeySIOCG80211POWERSIOCS80211POWERsetifpowersavepowersavesleep %s: %ssetifpowersavesleep nwid: nwkey: %d: powersave: on (%dms sleep) offieee80211_statusSGIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mediaopt' commandsonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sallSIOCSIFTIMESLOT < <@<@<`<<<TDMIEEE802.11FDDItokenTokenRingetherEthernet<<<<#<#<#<#<$<$<$<$<%<%<%<%<&<&<'<'|<(r<(l<)b<)\<*R<*L<+A<+:<,0<,,<,&<-<-<-<. <.<8<2<+<$<<<<<<<<<<<<<<<<<e3-g.832e3-g.751e3t3-m13t3e1-ami-g.704e1-amie1-g.704e1t1-amit1OFDM72OFDM54OFDM48OFDM36OFDM24OFDM18OFDM12OFDM9OFDM6DS22DS11DS5DS2DS1FH2FH1CDDIMMFMulti-modeSMFSingle-mode16UTPUTP/16Mbit4UTPUTP/4Mbit16STPDB9/16Mbit4STPDB9/4MbitHPNA1HomePNA11000TX1000baseTX1000T1000baseT1000CX1000baseCX1000LX1000baseLX10FLFL10baseFL10STPSTP10baseSTP1000SX1000baseSX100T2100baseT2100VG100baseVG100T4100baseT4100FX100baseFX100TX100baseTX10AUIAUI10base5/AUI10base510BNCBNC10base2/BNC10base210UTPUTP10baseT/UTP10baseTnonemanualautoautoselect<< < <<<<<<<@<@<@<@<@v<@q<`e<`a<[<T<O<C<;<0<,<< <<framerelay-ituframerelay-ciscoframerelay-ansippphdlc-crc16monitoribss-masteribsshostapadhocdasdual-attachALLRAllRoutesSRCRTSourceRoutingETREarlyTokenReleaseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplexunknown %s media subtype: %sunknown %s media option: %s%s media %s%smediaopt %s instance %d6 physical address inet%s %s --> %s phys_status S! %s netmask 0x%x SIOCGIFBRDADDRbroadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime 0infty vltime in6_aliasSIOCGIFADDR AppleTalk %d.%d range %d-%d phase %d--> %d.%d broadcast %d.%dat_status ns %s SNAP<<<S$<7< ipx %s frame %s %s: bad valueprefix %s: %s%s=%o%s=%x%s: %sAppleTalk does not use netmasks%u.%u%s: illegal address%u-%u%s: illegal net range: %u-%u12%s: illegal phase atalk %d.%d range %d-%d phase %d AppleTalk address is not in rangeAttempt to set XNS netmask will be ineffectual Attempt to set IPX netmask will be ineffectual usage: ifconfig interface [address_family] [address [dest_address]] [[-]alias] [[-]arp] [broadcast addr] [[-]debug] [delete] [up] [down] [ipdst addr] [tunnel src_address dest_address] [deletetunnel] [description value] [[-]group group-name] [[-]link0] [[-]link1] [[-]link2] [media type] [[-]mediaopt opts] [instance minst] [mtu value] [metric nhops] [netmask mask] [prefixlen n] [nwid id] [nwkey key] [nwkey persist[:key]] [-nwkey] [[-]powersave] [powersavesleep duration] [[-]anycast] [eui64] [pltime n] [vltime n] [[-]tentative] [vlan vlan_tag vlandev parent_iface] [-vlandev] [vhid n] [advbase n] [advskew n] [maxupd n] [pass passphrase] [state init | backup | master] [syncif iface] [-syncif] [syncpeer peer_address] [-syncpeer] [phase n] [range netrange] [timeslot timeslot_range] [802.2] [802.2tr] [802.3] [snap] [EtherII] ifconfig -A | -Am | -a | -am [address_family] ifconfig -C ifconfig -m interface [address_family] ifconfig interface create ifconfig interface destroy vlan: %d parent interface: %s vlan_statusvlan tag %s: %sSIOCGETVLANSIOCSETVLANsetvlantagmust specify both vlan tag and devicesetvlandevunsetvlandevMASTERBACKUPINITSIOCGIFGROUPgetifgroups groups: getifgroups carp: %s vhid %d advbase %d advskew %d carp_statusSIOCGVHSIOCSVHsetcarp_passwdvhid %s: %ssetcarp_vhidadvskew %s: %ssetcarp_advskewadvbase %s: %ssetcarp_advbasesetcarp_stateSIOCGETPFSYNCSIOCSETPFSYNCsetpfsync_syncifunsetpfsync_syncifonly IPv4 addresses supported for the syncpeersetpfsync_syncpeerunsetpfsync_syncpeermaxupd %s: %ssetpfsync_maxupd pfsync: syncif: %s syncpeer: %s maxupd: %d pfsync_status%dd%dh%dm%ds%luCOLUMNS1ACFLRSTWacdfghiklmnopqrstuxCct 0@GVeq %s: %s: %s: directory causes a cycle%s: %sfts_read%u-%lu%qudisplaytotal %lu %*u %*qd %s %*u %-*s %-*s %-*s %3d, %3d %*s%*qd printlongtotal %llu %s%s/%s ls: %s: %s -> printlink%*s usage: %s [-1ACFLRSTWacdfhiklmnopqrstux] [file ...] adDFadDfFm1kernel is configured not to accept RAskernel is configured as a router, not a hostfailed to open a socketmainfailed to initilizatoin interfacesfailed to initialize %sfailed to setup for probing routersselect: %s 000000000000000000000000000000000000000000000000000000failed to get link layer information for %sifconfiginterface %s was already configuredmemory allocation failedlink-layer address option has null length on %s. Treat as not included.make_packetmemory allocation failed for %stimer expiration on %s, state = %drtsol_check_timer%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %ld:%08ldBTillegal interface state(%d) on %srtsol_timer_updatestop timer for %sset timer for %s to %d:%d usage: rtsol [-dDF] interfaces... usage: rtsol [-dDF] -a usage: rtsold [-adDfFm1] interfaces... usage: rtsold [-dDfFm1] -a <%s> %swarnmsgmultiple interfaces foundreallocstrdupprobing %smalloc for receive msghdr failedsockopenmalloc for send msghdr failedff02::2inet_pton failed for %ssocket: %sIPV6_PKTINFO: %sIPV6_HOPLIMIT: %ssetsockopt(ICMP6_FILTER): %ssend RS on %s, whose state is %dsendpacketsendmsg on %s: %ssendpacketrecvmsg: %srtsol_inputfailed to get receiving interfacefailed to get receiving hop limitpacket size(%d) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpeced IF(%s)received RA from %s on %s, state is %drtsol_inputioctl(SIOCGIFFLAGS): %sinterface_upioctl(SIOCSIFFLAGS): %schecking if %s is ready...get_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedinterface_upioctl(SIOCGIFFLAGS) on %s: %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sinterface_statusunsupported link type(%d)lladdropt_fillsocket(SOCK_DGRAM): %sget_llflaggetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflagmalloc failedprobe_initsocket: %sshutdown: %sdefrouter_probelo0ioctl(SIOCGDRLST_IN6): %sdefault router list contains a non-link-local address(%s)defrouter_probeprobe a router %s on %ssendprobesendmsg on %s: %ssendprobea:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwWinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dtoo many intermediate hops%sgetaddrinfo failedsocketbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_HOPOPTS)setsockopt(IPV6_DSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't set the last flagUDP socketUDP setsockopt(IPV6_PKTOPTIONS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_PKTINFO)setsockopt(IPV6_HOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> %s pollrecvmsgnew path MTU (%d) is notified main.A"P P P P P P P P P P 4 P P P P P P P P P cpP 0P P qP P   P   @@sendmsgping6: wrote %s %d chars, ret=%d .%c\%03odnsdecodeinvalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%g ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%x%d bytes from %s: refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOP???,%s%s (refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%lupr_pack@@ HbH Options: Dst Options: Routing: -%u %uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap truncated no address ? %s(TTL=infty)(TTL=%u)pr_nodeaddr --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's duplicating packets!%.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms Y@IPv4 addressDNS labelIPv6 addressUnknownRefusedSuccessNo Route to Destination Destination Administratively Unreachable Destination Unreachable Beyond Scope Destination Host Unreachable Destination Port Unreachable Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceeded Frag reassembly time exceeded Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirect Destination: %s New Target: %sNode Information Query, NOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(%s)(invalid), invalidNode Information Reply, %sBad ICMP type: %dpr_icmph0@1`11555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555C2P2`2p22222225P3 50001133333V5`5p555Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESP TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ... 788888S88888888888888888888888888888888888888788888A88888888&887patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02x ff02::2:0000:0000nigroupusage: ping6 [-dfHmnNqtvwW] [-a [aAclsg]] [-b sockbufsiz] [-c count] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-h hoplimit] [-g gateway] [hops...] host usage: %s -l or %s [-q] name lq_gsckbd_keydesctab_hilkbd_keydesctab_sunkbd5_keydesctab_sunkbd_keydesctab_zskbd_keydesctab_akbd_keydesctab_ukbd_keydesctab_pckbd_keydesctabgschilsun5sunlk201adbusbpc-xt/pc-atsipltrnlbrlaltptsfsguarubehuesnosvjpukfritdkdeususermachdepiopenermetaescdvorakswapctrlcapslk401declknodead/dev/wskbd%dWSKBDIO_GTYPEList not available; sorry. kbd_listunknown encoding %sunknown variant %s%s: unsupported encoding %s on %s WSKBDIO_SETENCODING: %skeyboard mapping set to %s kbd_setLESSSECUREmore-E-G-L-mMORELESS--WARNING: terminal is not fully functionalCannot allocate memoryraw_modeLESS_TERMCAP_ltget_envLINESliCOLUMNScokrklkukdkPkNkh@7kD'J@JVJpJJJJJJKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKTERMunknownhcamxndadbutsgpcksketitececdcl cmsesoueusmemdmbvbbsbcho|^ll alsrget_termNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread error%sch_ungetchar overrunseek error to 0%cESC^%c*s<%X>jjiiEjj5jjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjj5jNon-match First-file EOF-ignore Keep-pos Regex-off /?_-(P)+!mVnVnVnVnmVnVnVnVnmVnVnVnVnVnVnVnVnVnVnVnVnVnVnVnVnVnVnVn%n@nVnVnVnVnVnVnVnVnVnVnnn6p6p6p6pon6p6p6p6p6p6p6p6po6p6p6p6p6p6pn6p6p6p6p6p6p6p6p6p6p6p6p6p6p6p6p6p6p6p6p6p6p6p6pnpp%p%p%p%pp%p%p p%p%p%pp%p%p%p%p%p%p%p%p%p%p%p%p%p%p p%p%p%p%p%p%p%p%pp%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%pp [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found:%s helpCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]vBvy0{up~P~Pyvuxzzwy~`||yp0}zhy~Pz3wwzPu$vggP}P|ww{p{{{Q~DxPz~PPFtWarning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar-%s"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c/%s%s%sHOMEbin_fileSHELLr%s %s %s%s LESSOPEN-LESSCLOSE-c...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSm%*s plinenum~ Calculating line numbers! /dev/ttySHELL%s %s %ssh (press RETURN)Invalid mark letterCannot seek to end of fileMark not setMark not in current filelLine number is required after -l/%sxph`less Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops ,%d and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for help%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH@@@@@@@@@@There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeDon't use keypad modeUse keypad modeHorizontal shift %d positionsHorizontal shift: Show tildes after end of fileDon't show tildes after end of filequotes: Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminal0123456789,Tab stops: Highlight first unread line after any forward movementHighlight first unread line after forward-screenDon't highlight first unread linePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modeChop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters directly, processing ANSI sequencesDisplay control characters directlyDisplay control characters as ^XNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptUse the LESSOPEN filterDon't use the LESSOPEN filterDisplay a status columnDon't display a status columnPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesQuit if end-of-file on first screenDon't quit if end-of-file on first screenOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileAssume dumb terminalAssume intelligent terminalRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffersMax buffer space per file: %dKMax buffer space per file (K): Search skips displayed screenSearch includes displayed screenBe less helpful in promptsBe helpful in prompts%s: %spostoalinenumtoainttoaiprint_intiprint_linenum?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataap_posap_linenumap_int?-  PcpfileppFs2@SpNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned off/dev/ttyusage: %s [-ieu] [-f mbrboot] [-c cyl -h head -s sect] disk -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry `disk' may be of the forms: sd0 or /dev/rsd0c. /usr/mdec/mbrieuf:c:h:s:Cylinder argument out of range [1..262144].Head argument out of range [1..256].Sector argument out of range [1..63].Please specify a full geometry with [-chs].Can't get disk geometry, please use [-chs] to specify.%susing builtin MBRmainPPPPPPPPPPP P\y<Vyy<4y<2y<@(y<GigabytesGMegabytesMKilobytesKSectors BytesbAbort program without saving current changesabortQuit edit of current MBR, saving current changesquitExit edit of current MBR, without saving changesexitWrite loaded MBR to diskwritePrint loaded MBR partition tableprintSelect extended partition table entry MBRselectUpdate machine code in loaded MBRupdateFlag given table entry as bootableflagEdit given table entryeditEdit current drive statsdiskSet the identifier of a given table entrysetpidRe-initialize loaded MBR (to defaults)reinitShow entire OpenBSD man page for fdiskmanualCommand help listhelp Do you wish to write new MBR? Do you wish to write new MBR and partition table? ----------------------------------------------------- ------ ATTENTION - UPDATING MASTER BOOT RECORD ------ ----------------------------------------------------- MBR is unchanged USER_initEnter 'help' for information fdisk:%c%d> ?Invalid command '%s'. Try 'help'. Writing current MBR to disk. Aborting changes to current MBR. USER_modifyOffset: %d USER_print_disk~<~<~<~<~<~<~<~<~<@~<GigabytesGMegabytesMKilobytesKSectors Bytesbeof ask_cmd%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) '%s' is not a valid number. '%d' is out of range. ask_num%s [n] %s: [%u] Rounding to nearest cylinder: %u getuint?NNN@NNN N0NNNNNJ<<<<<<~<t @$<<<<<<<<<@<GigabytesGMegabytesMKilobytesKSectors BytesbSignature: 0x%X MBR_pcopy܂<ւ<Ԃ<̂<ʂ<<<<<@<GigabytesGMegabytesMKilobytesKSectors Bytesbunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB HPFS/QNX/AUXAIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech Thinkpad Rec Willowsoft $NEC DOS 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootBSDI filesy*BSDI swap CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT Choose from the following Partition id values: %02X %s %02X %s %02X %s %02X %s Warning CHS values out of bounds only saving LBA values Starting Ending LBA Info: #: id C H S - C H S [ start: size ] ------------------------------------------------------------------------ %c%1d: %.2X %4u %3u %2u - %4u %3u %2u [%12u:%12.0f%s] %s @Start of partition #%d after end!|<v Invalid partition number. Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorStarting sector for this partition.offsetSize of the partition.sizePartition %d is not an extended partition. Loop to offset 0! Not selected. Selected extended partition %d New MBR at offset %d. Writing MBR at offset %d. Xwrite %s %s Machine code updated. Partition %d marked active. /usr/bin/lessPAGERwbin_file(standard input)(fd %d)%sinvalid file typeusage: %s [-AB num] [-CEFGHILPRSUVabchilnoqsvwx] [--context[=num]] [--binary-files=value] [--line-buffered] [-e pattern] [-f file] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxyunix-byte-offsetsline-regexpword-regexprevert-matchno-messagesrecursivesilentquietline-numberfiles-with-matchesfiles-without-matchignore-caseno-filenamefileregexpcountbyte-offsettextversionbinarybasic-regexpfixed-stringsextended-regexpdevicescontextbefore-contextafter-contextline-bufferedmmaphelpbinary-files$^%s[[:<:]]%.*s[[:>:]]%sr%scontext out of rangegrep version %u.%u without-matchUnknown binary-files option#1#1#1#1#1#1#1#1#1#144444441114P2p222444244424324434444444444403@34P334334434344 430444@4P4`43444444p4444%s: %s(standard input)r%s%s:%u %s Binary file %s matches -- [[:<:]][[:>:]]mallocrealloc%d%lldaFfh:t:vonly one -t option may be specified.nfsK L L L L L L L L L L L L L L L L L L L L L L L L L LK L L L LK LK L L L L L L L L L L LK LL/%s: not currently mounted%s: not a directory or special device%s: unmount from %s %sCannot MNT PRCBad MNT RPCumountfsgetmntinfoempty type listumount -a[fv] [-h host] [-t fstypelist]umount [-fv] [-t fstypelist] special | nodeusage: %s %s <<<<ۗ<З<ʗ<Ɨ<<<<< <updateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaGsl9xu:g:m:o:realpath %sstat %smsdosfilesystem not supported by kernelmount table fullnot an MSDOS filesystem%s on %s: %smainUPVPVPVPVPVPVPVPVPVPVPVPVPVuUPVPVPVPVPVPVPVPVPVPVPVPVPVPVPVPVPVPVPVPVPVPVPVPVPVPVPVPVPVPVPVUPVPVPVPVUVPV0VPVPVPVUPVUPVPVUunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-o options] [-u user] [-g group] [-m mask] bdev dir ,needsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'/etc/ccd.confCCDF_OLDCCDF_MIRRORCCDF_UNIFORMCCDF_SWAPcCf:gM:N:uUv[p\p\p\p\p\p\p\p\p\ \0\p\p\p\p\p\p\P\p\p\p\p\p\p\p\p\p\p\p\p\p\[p\p\\\p\p\p\p\p\p\p\p\p\p\p\p\p\@\`\\ ]\ ]P]invalid ccd name: %s%s unconfigured %s: bad line: %dinvalid interleave factor: %sinvalid flags argument: %sno memory to configure ccd%s: %sccd%d: %d components %c%s%c, %d blocks interleaved at %d blocks concatenated rfopen: %s no memory to configure ccdsdo_all/dev/%s%c/dev/%sopen: %sCCDIOCSETCCDIOCCLRunknownioctl (%s): %soption not supportednone0x00no memory to parse flags,dev [...]usage: %s [-cv] ccd ileave [flags] %s %s -C [-v] [-f config_file] %s -u [-v] ccd [...] %s -U [-v] [-f config_file] [ccd [...]] %s -g [-M core] [-N system] %s mkfifom:invalid file mode.node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%susage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p @(#) Copyright (c) 1997, 1998, 1999 Bill Paul. All rights reserved.@(#) $OpenBSD: wicontrol.c,v 1.54 2004/08/25 17:16:44 mickey Exp $<<<{<f<Q<<<'<<< < < < < <<<<<<p<p<p<p<_<_<_<_<!I<"I<#I<$I<&<<PRISM3 (USB)PRISM3 ISL37300P(PCI)PRISM3 ISL37300PPRISM2.5 ISL3874A(PCI-bridge)PRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3873PRISM2 HFA3842(EVAL)PRISM2 HWB3163(EVB2) SST-flashPRISM2 HWB3163 SST-flashPRISM1 HWB1153PRISM2 HFA3842(EVB3)PRISM2 HWB3163 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3763 rev.BPRISM2 HFA3841(EVB2)Lucent Embedded WaveLAN/IEEESony WaveLAN/IEEELucent WaveLAN/IEEEsocketSIOCGWAVELAN (0x%x)wi_getvalSIOCSWAVELANwi_setval[ %s ]must specify stringstring too longmust specify addressbadly formatted addressno WEP option available on this cardencryption key must be no more than 26 hex digits longencryption key must be no more than 13 characters longonly 4 encryption keys available[ 0x%02x ]Unknown PRISM chipUnknown Lucent chip[ %s, Firmware %d.%d.%d ][ %s, Firmware %d.%02d variant %d ][ %d ][ On ][ Off ]:[ Firmware WEP ][ Software WEP ][ Unknown ]AP Information ap[%d]: netname (SSID): [ %s ] BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Beacon Interval: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] Capinfo: [ ESS IBSS PRIV ] DataRate [Mbps]: [ %2.1f ] AvailableRates [Mbps]: [ %d.%d &@@@Card info: Intersil Prism2-based card: Enhanced Security mode: Max sleep time: Power Management: Access point density: Roaming mode(1=firm,3=disable): Microwave oven robustness: Antenna diversity (0=auto,1=pri,2=aux): Create IBSS: RTS/CTS handshake threshold: Maximum data length: TX rate (actual speed): TX rate (selection): MAC address: Port type (1=BSS, 3=ad-hoc, 6=Host AP): Process 802.11b Frame: Promiscuous mode: Comms quality/signal/noise: Current channel: IBSS channel: Channel list: Current BSSID: Desired netname (SSID): Current netname (SSID): SSID for IBSS creation: Station name: NIC serial number: Encryption keys: TX encryption key: Authentication type (1=OpenSys, 2=Shared Key): Encryption algorithm: Encryption: %s dyypyyyypzzzzzzzTransmitted unicast frames: %u Transmitted multicast frames: %u Transmitted fragments: %u Transmitted unicast octets: %u Transmitted multicast octets: %u Single transmit retries: %u Multiple transmit retries: %u Transmit retry limit exceeded: %u Transmit discards: %u Transmit discards due to wrong SA: %u Received unicast frames: %u Received multicast frames: %u Received fragments: %u Received unicast octets: %u Received multicast octets: %u Receive FCS errors: %u Receive discards due to no buffer: %u Can't decrypt WEP frame: %u Received message fragments: %u Received message bad fragments: %u SIOCHOSTAP_GETALLs%d station%s: %02x:%02x:%02x:%02x:%02x:%02x asid=%04xAUTHASSOCPERM, flagsESSIBSSPOLLABLEPOLLREQPRIVACYSHORT_PREAMBLEPBCC8CHNL_AGILITY, caps1M2M5.5M11M, rates, sig=%d/%dwi_dumpstationsusage: %s [interface] [-olL] [-t tx rate] [-n network name] [-s station name] [-e 0|1] [-k key [-v 1|2|3|4]] [-T 1|2|3|4] [-x 0|1] [-F 0|1] [-c 0|1] [-q SSID] [-p port type] [-a access point density] [-m MAC address] [-d max data length] [-r RTS threshold] [-f frequency] [-M 0|1] [-P 0|1] [-S max sleep duration] [-A 1|2|3] [-D 0|1|2] [-R 1|3] [-E 0|1|2|3] wi0a:c:d:e:f:hi:k:lm:n:op:q:r:s:t:v:x:A:D:E:F:LM:S:P:R:T:SIOCGIFFLAGSget_if_flagsSIOCSIFFLAGSset_if_flags%s=%o%s=%xbss1adhocad-hoc3ibss4hostap6unknown port type %s_nblocks_inodedbl_inodeblk_p_offset_fsbtodb_fs_bsize_s_fs_bsize_pusage: %s [-nv] boot biosboot device vnopen: %sboot: %s proto: %s device: %s disklabel: %sbad disklabel magic=%0x8xdisklabel type unknownproto %s bad size=%ldproto bootblocks too bigstat: %s%s: not a character devicecan't read master boot recordbroken MBRusing MBR partition %ld: type %d (0x%02x) offset %d (0x%x) no OpenBSD partitionwrite bootstrap%s%s: read failed%s: bad magic: 0x%02x%02x%02x%02x%s: %u ELF load sections (only support 1)%s: can't read header%s: entry point %#x proto bootblock size %ld %s: devread: lseek%s: devread: readstatfs: %sffsufs%s: not on an FFS filesystemfsync: %sfstat: %scross-device installsuperblockBad magic number in superblockBad inopb=%d in superblockinodeNo blocks to load%s is %d blocks x %d bytes fs block shift %u; part offset %u; inode block %u, offset %u %s: no such symbol%s already set%s not set%s: symbol %s not found%s: %s: wrong type (%x)%s: symbol out of range (%u)%s: bad symbol size %d@(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: route.c,v 1.73 2004/09/07 10:14:43 markus Exp $route: botched keyword: %s usage: route [ -nqSv ] cmd [[ - ] args ] keywords: get, add, change, delete, show, flush, monitor. route: %s: %s nqdtvS/dev/nullsocketp2@`PKKKA`must be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) route: write to routing socket: %s got only %d for rlen %-20.20s done 4CP`pP@0`p0assuming route to if old usage of trailing 0%s,%sold usage of trailing digit, assuming route via gateway netmask missingdefaulthostnet%s %s %s: source %s: gateway %s (%s) not in tableentry in userouting table overflow: %s К›МtМ``0R@GƜМppМММ М"М pw64128inet6_makenetandmaskinternal error%s: bad value %s: resolved to multiple values %s: not a network%s: bad address%d: bad address family%prefixlen is not supported with af %d actual retrieval of interface tablegot message of size %d on %smonitorso_dstso_gateso_maskso_genmaskso_ifpso_ifaso_srcso_srcmaskso_labelwriting to routing socketroute: read from routing socket: %s """""RTM_IFANNOUNCE: iface arrival/departureRTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routeunknownrouting message version %d not understood %s: len %d, if# %d, downuplink: %s, flags:metric %d, flags:if# %d, name %s, what: arrivaldeparture#%dpid: %ld, seq %d, errno %d, flags: route to: %s message length mismatch, in packet %d, returned %d RTM_GET: %s (errno %d) destination: %s mask: %s source: %s gateway: %s interface: %.*s flags: label: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8d%c %8d%c sockaddrs: locks: inits: sockaddrs: %s%s: link %s; %s: inet %s; %s: inet6 %s; %s: ipx %s; sodumplabel too long$OpenBSD: show.c,v 1.33 2004/07/05 02:19:03 pvalchev Exp $UGHRBD M@dmCXLS1@2 3csroute-sysctl-estimateout of space sysctl of routing tableRouting tables Address%-*.*s InterfaceMtuUseRefsFlagsGatewayDestinationSource%-*.*s %-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s %-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s SA(Address/Proto/Type/Direction)ProtoPort%-18s %-5s %-18s %-5s %-5s %-22s default%-*s %-6.6s %6d %8ld %6ld -%6s %.16sp_rtentryInternetInternet6XNSIPXX.25EncapAppleTalk %s: Protocol Family %d:                       %s p_flags(%d) %sroutenameinvalid%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%dillegal prefixlen %s/%dnetname6af %d: %s0123456789abcdef*.**.0x%XHany*%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%slink#%dxresolvex25staticssthreshsrcmasksrcshowsendpipesarttvarrttrejectrecvpipeproto2proto1prefixlenosinostaticnetmasknetmtumpathmonitormasklockrestlockllinfolinklabelipxinet6inetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpiredstdeletecloningchangeblackholeadd/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.typeWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPElocal-filesusage: %s local-files mputContinue with%s: not foundmputr+wwusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files mgetmgetonoffand logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Macros: %s usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdusage: %s remote-file DELE %smdeletefrom-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s-usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:usage: %s remote-files local-file SHELL/bin/shsh-c%sTry again latershellusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. userPWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1modefile-nameusage: %s mode file-name SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. filenameusage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". PAGERmore|%sCan't allocate memory for $PAGER?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrenameregetrecvquotequitpwdputproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendmputmoremodtimemodemlsmkdirmgetmdirmdeletemacdeflslpwdlesslcdimageidlehelphashglobgategetftpformexitepsv4disconnectdirdeletedebugcrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. domacroExtra `@' characters in usernames and passwords should be encoded as %%40unknownCan't allocate memory to parse URLhttp://ftp://file:url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %s-Can't open %sCan't allocate memory for transfer bufferWriting %sReading from fileSuccessfully retrieved file. host %s, port %s, path %s, save as %s. %d%s: %s(unknown)Trying %s... socketconnect%sr+Requesting %s (via %s) User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s Requesting %s Can't allocate memory.80GET /%s HTTP/1.0 Host: [%s]:%s %s GET /%s HTTP/1.0 Host: [%s] %s GET /%s HTTP/1.0 Host: %s:%s %s GET /%s HTTP/1.0 Host: %s %s Writing HTTP requestReceiving HTTP replyreceived '%s' 301302200Error retrieving file: %sContent-Length: Location: Redirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'*?[]{}cdRetrieving %s/%s %s/%sgetmgetauto_fetchCan't allocate memory for URL decoding:/unknownftp%dftpgatehttp%s: bad port number `%s'%s: %sTrying %s... socket(unknown)connect to address %sconnect%sgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopthookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT%c%c%c421 Service not available, remote server has closed connection. %s:getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s -local: %s%s: not a plain file. STORAPPEREST %ldr+w%s %snetoutsendrequest receive aborted waiting for remote to finish abort. receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)bindlistenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnSTOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s abortresetrunique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteftphttpFTPSERVERPORTftpgateFTPMODEpassiveactivegateautounknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpTERMdumbemacssu46Aadegimno:pP:r:tvV--r requires numeric argumentRetrying... maindvwsvwwwwwwwwwwvwwwwwwwwwwwwwwPwwwwwwwwwwwwwwwwwvwwvwwvwvwwwvvw1ww`wwwwwftp> sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. !$Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadegimnptVv] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] macdefmachineaccountpasswdpasswordlogindefaultHOME%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %sruserpassstringlistAlready connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamfile8binarySYSTRemote system type is %s. 215 UNIX Type: L8Using %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. anonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$initftp_loginsorry, arguments too long. (%s) TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.remglob%s %s? Interactive mode: off. Prompting off for duration of %s. n, y, p, a, are the only acceptable commands! confirm%s: not foundSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. KMGTP %3d%% *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************|%.*s%*s| %5lld %c%c %2d: %02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeter.AMKs%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d ptransfer.A>P?<<<<<<<<}<x<q<k< e<@`<Y<R<L<D<softdepforcereloadupdatesyncasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:realpath %sffsmount table fullspecified device does not match mounted devicefilesystem not supported by kernelfilesystem must be mounted read-only; you may need to run fsck%s on %s: %smainusage: mount_ffs [-o options] special node ,needsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'haltdlnpq%sreboot???halted (with powerdown) by %shalted by %srebooted by %sshutdown~SIGTSTP init/etc/rc/dev/consolerevokesetsidopensh/bin/shSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): main`fppusage: %s [-dn%sq] /etc/dhclient.confking bula sez: len mismatchFAILalias_routehandlerc:dl:qucallocInterface name too long/var/db/dhclient.leases%s.%sasprintf%s: no link . giving up got link /dev/nullcannot open %s: %m_dhcpno such user: _dhcp, falling back to "nobody"nobodyno such user: nobodypipecan't open and lock %s: %mPREINITAF_ROUTE/var/empty/chroot/chdir("/")can't drop privileges: %m%sгusage: %s [-dqu] [-c conffile] [-l leasefile] interface ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.REBOOTREBINDRENEWBOUNDold_new_bound to %s -- renewal in %d seconds.BOOTREPLY from %s rejected.DHCPOFFERDHCPNACKDHCPACK%s from %s rejected.BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSENDdhcpoffer: no memory to record lease.dhcpoffer: no memory for option %dInvalid lease option - ignoring offerdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.DHCPNAK from %sDHCPNAK with no active lease. No valid media types for %s!Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. EXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %dwcan't create %s: %mlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } buf_open: %mbuf_add: %mbuf_close: %mscript_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbininterfacemediumreasonip_addressnetwork_numberbroadcast_addressfilenameserver_nameprepend optionno space to %s %sappend option%dexpirypriv_script_write_paramsunexpected msg type %ureceived corrupted messageREASON=NBIfork: %mwait: %mexecve (%s, ...): %mpriv_script_goscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sdaemonInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%x@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@GGGGGGGGGGGGGGG@GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG@option_as_string: bad code %d \%03odhcp option too largecannot fork%s [priv]poll errorrno memory for client state.no memory for client config.Corrupt lease file - possible data loss!not allowed here.hardware address parameter %snested interface declaration.expecting a statement.semicolon expected.&1@P`p Hpexpecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal dataexpected option name.%s: unexpected option name.%s: too many options.expecting semicolon.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.Insufficient memory to record interface %sno memory for state on %s no memory for config for %s no memory for lease. unterminated lease declaration.expecting lease declaration.T ev@expecting identifier after option keyword.no memory for vendor information.expecting identifier after '.'no vendor named %s.no option named %sno option named %s for vendor %sexpecting string.overflowoption data buffer %soption data buffer overflowexpecting number.expecting identifier.trueonfalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.parse_option_decl00000000000000000000000000000000000000000000QExpecting media options.no memory for string list entry.expecting IP address.no memory for reject list!parse_reject_statementgetifaddrs failedno space to remember ifp%s: not founddiscover_interfacesCan't allocate poll structures.No live interfaces to poll on - exiting.poll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %minterface_statusCan't allocate timeout structure!can't allocate protocol struct for %sCan't create socketinterface_link_statusCan't add %s to hash table./dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfsend_packet: %msend_packetcSclarger than bufferoption %s (%d) %s.Many bogus options seen in offers. Taking this offer in spite of bogus options - hope for the best!rejecting bogus offer.Can't allocate storage for option %s.Can't expand storage for option %s.cons_optionspretty_print_option: bad code %d %s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of array\%03o%ld%d%xtruefalseUnexpected format code %cdhcp option too largepretty_print_option`eeeeeePeePeeeeeeVeeeeeeeeeeeee`ee`eeeeePeeeeeeV6F`0v`Discarding packet with invalid hlen.do_packetno memory for cons.eof in string constantstring constant larger than internal buffernumeric token larger than internal buffertoken larger than internal bufferlways-reply-rfc1048ppendllowliasbandoneduthoritativeackoff-cutoffootpootingoot-unknown-clientslassiaddrlient-identifierlient-hostnameomainenyefault-lease-timeynamic-bootp-lease-cutoff-lease-lengththernetndsxpireilenameixed-addressddiroupet-lease-hostnamesostardwareostnamenitial-intervalnterfaceeaseax-lease-timeediaumameserveretmaskext-serverotptionne-lease-per-clientrependacketangeequestequireetryenewebindebootejectearchtartsubnethared-networkerver-nameerver-identifierelect-timeoutendcriptupersedeimestampimeoutoken-ringser-class-host-decl-names-lease-addr-for-default-routeidnknown-clientsendor-class@())*+c++%,,0202,,p--2.02t.p/011102022%s exiting.exiting. %s line %d: %s%s^^ subnet_numberbroadcast_addraddr_eqpiaddr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetseoption-endoption-254option-253option-252option-251option-250option-249option-248option-247option-246option-245option-244option-243option-242option-241option-240option-239option-238option-237option-236option-235option-234option-233option-232option-231option-230option-229option-228option-227option-226option-225option-224option-223option-222option-221option-220option-219option-218option-217option-216option-215option-214option-213option-212option-211option-210option-209option-208option-207option-206option-205option-204option-203option-202option-201option-200option-199option-198option-197option-196option-195option-194option-193option-192option-191option-190option-189option-188option-187option-186option-185option-184option-183option-182option-181option-180option-179option-178option-177option-176option-175option-174option-173option-172option-171option-170option-169option-168option-167option-166option-165option-164option-163option-162option-161option-160option-159option-158option-157option-156option-155option-154option-153option-152option-151option-150option-149option-148option-147option-146option-145option-144option-143option-142option-141option-140option-139option-138option-137option-136option-135option-134option-133option-132option-131option-130option-129option-128option-127option-126option-125option-124option-123option-122option-121option-120option-119option-118option-117option-116option-115option-114option-113option-112option-111option-110option-109option-108option-107option-106option-105option-104option-103option-102option-101option-100option-99option-98option-97option-96option-95option-94option-93option-92option-91option-90option-89option-88nds-contextnds-tree-namends-serversoption-84option-83option-82option-81option-80option-79option-78user-classstreettalk-directory-assistance-serverstreettalk-serverirc-serverfinger-serverwww-servernntp-serverpop-serversmtp-servermobile-ip-home-agentbootfile-nametftp-server-namenisplus-serversnisplus-domainoption-63option-62dhcp-client-identifierdhcp-class-identifierdhcp-rebinding-timedhcp-renewal-timedhcp-max-message-sizedhcp-messageBAdhcp-parameter-request-listdhcp-server-identifierdhcp-message-typedhcp-option-overloaddhcp-lease-timedhcp-requested-addressx-display-managerfont-serversnetbios-scopenetbios-node-typenetbios-dd-servernetbios-name-serversvendor-encapsulated-optionsntp-serversnis-serversnis-domaintcp-keepalive-garbagetcp-keepalive-intervaldefault-tcp-ttlieee802-3-encapsulationarp-cache-timeouttrailer-encapsulationstatic-routesrouter-solicitation-addressrouter-discoverymask-supplierperform-mask-discoverybroadcast-addressall-subnets-localinterface-mtuSApath-mtu-plateau-tableLpath-mtu-aging-timeoutBdefault-ip-ttlmax-dgram-reassemblyIIApolicy-filternon-local-source-routingfip-forwardingextensions-pathroot-pathswap-serverdomain-nametmerit-dumpSboot-sizeXhost-nameresource-location-serversimpress-serverslpr-serverscookie-serverslog-serversdomain-name-serversien116-name-serverstime-serversIAroutersltime-offsetIsubnet-maskpaddhcpCan't allocate dhcp option hash table.semicolon expected.filename must be a stringno memory for string %s.expecting a network hardware typehardware address too longexpecting semicolon.Expecting numeric lease timecan't allocate space for numeric aggregatetoo few numbers.unexpected end of fileexpecting numeric value.no temp space for number.can't allocate space for numeric aggregate.Bogus number: %s.Bogus number: %s: digit %d not in base %d-value %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dnumeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.short write: wanted %lu got %ld bytesconnection closedbuf_read: %mshort read: wanted %lu got %ld bytescorrupted message received%mbuf_open: %mbuf_add: %mbuf_close: %mreceived unknown message, code %ddispatch_imsgcannot seek temp fileout of memorycannot read temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keyword]] ]8]P]h]]]]]F^F^F^F^F^F^F^]]^^$^5^F^F^F^F^F^F^F^F^F^F^F^F^F^F^F^F^F^F^F^F^F^F^F^F^F^F^]]^^$^5^bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read filecbc_decodeinvalid pattern delimiter p unexpected end-of-file& no previous commandout of memoryrcannot open input filecannot close input file%lu newline inserted newline appended out of memorycannot read input filewcannot open output filecannot close output filecannot write fileunexpected end-of-filestdincannot read stdin%d \  \abfnrtv\@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. *usage: %s [-] [-sx] [-p string] [name] HOMEp:sx ? interrupt? invalid filename%s warning: file modifiedscript, line %d: %s unexpected end-of-filenumber out of rangeinvalid address@րրրրրրրրրր@invalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiteraw%d ! unknown command0G`G%@G0S7@`CcG#no matchfilename too longout of memoryshell access restrictedno previous command invalid mark charactered.hup/ed.huphandle_hup..invalid pattern delimiterno previous patternout of memoryunbalanced brackets ([])trailing backslash (\)number out of rangeno previous substitutionout of memoryno matchinfinite substitution loop out of memorynothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s"8`p%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_read%soverwrite %s? readlink: %sunlink: %ssymlink: %scopy_linkmkfifo: %smknod: %sutimes: %schown: %schflags: %slchown: %susage: %s [-R [-H | -L | -P]] [-fip] src target %s [-R [-H | -L | -P]] [-fip] src1 ... srcN directory G n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     errorS]pZlaD h 6 @  P  inflate 1.2.1 Copyright 1995-2003 Mark Adler  #+3;CScsLB !1Aa  0@`@@-Y<"Y cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock.fs_fpg %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot allocate memory for inode cache cannot increase directory listcannot find inode %d DIRFILE%s %sCLEAR (CLEARED) I=%u OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%u BAD STATE %d TO BLKERR CG %d: BAD MAGIC NUMBER @(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.25 2003/06/02 20:06:15 millert Exp $dfpnNyYb:c:l:m:numberAlternate super block location: %d conversion levelmodebad mode to -m: %o ** lost+found creation mode %o usage: %s -p [-f] [-m mode] %s [-f] [-b block#] [-c level] [-y] [-n] [-m mode] [filesystem] ... EEEEEEEEEEEEEEEEEEEEE6E`EEpEEEEEEEEEEDEEEEEEEEE-%c flag requires a %s ufsffsrwrostarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) %d files missing %d blocks missing The following duplicate blocks remain: %d, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** / ***** REBOOT NOW ***** checkfilesys$OpenBSD: pass1.c,v 1.15 2003/10/11 01:43:45 tedu Exp $phase 1, inode %d/%dPARTIALLY ALLOCATED INODE I=%uCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:cannot read symlink convert symlink %d(%s) of size %llu bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWCONTINUE%sINCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%ucheckinodeBADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.$OpenBSD: pass1b.c,v 1.9 2003/08/25 23:28:15 tedu Exp $phase 1b, inode %d/%dDUP$OpenBSD: pass2.c,v 1.19 2003/10/11 01:43:45 tedu Exp $phase 2, directory %d/%dphase 2, parent directory %d/%dROOT INODE UNALLOCATEDALLOCATE%sCANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..'pass2YZ[[`ZZ.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDDUP/BADZERO LENGTH DIRECTORYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (REMOVED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d pass2checkgSihhgg$OpenBSD: pass3.c,v 1.8 2003/06/02 20:06:15 millert Exp $phase 3, directory %d/%ld$OpenBSD: pass4.c,v 1.10 2003/10/11 01:43:45 tedu Exp $phase 4, inode %d/%dUNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d 3mallallm$OpenBSD: pass5.c,v 1.17 2003/10/11 01:43:45 tedu Exp $phase 5, cg %d/%dDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ld FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSpass5xwwwww$OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $%s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. %s (%s)/r/Can't stat root Can't stat %s %s is not a character device malloc failedrealloc failedstrdup failed$OpenBSD: setup.c,v 1.21 2003/09/25 04:19:39 deraadt Exp $RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedntfsadoscd9660lfsmsdosffsCan't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO FSCK_FFS TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d clean = %d f** F%sile system is clean; not checking ** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED) IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for cylinder group summary area BAD SUMMARY INFORMATION%scannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead setupMAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEsuperblock mismatches offset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATE%s: BAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) ioctl (GCINFO): %s %s: can't read disk label $OpenBSD: utilities.c,v 1.20 2003/08/25 23:28:15 tedu Exp $bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [yn] cannot allocate buffer pool deadlocked buffer pool PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK CANNOT %s: BLK %dProgram terminated UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) SEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:CG %d: BAD MAGIC NUMBER /?..returning to single-user after filesystem check catchquit%s (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d /dev/tty: catchinfoffs_isblockffs_clrblockffs_setblockffs_isfreeblock?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@init: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/bin/sh-sh/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/binPATHcan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartingsingle_usersh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modereboot~session database close: %ssession database open: %sinsert %d: %sdelete %d: %s /dev/%s%s%s %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %m01getty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %d shutdowncan't exec %s for %s %s: %msome processes would not die; ps axl advised ,needsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'updateasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotamfsinsane maxpartitions value %dP:T:a:b:c:d:e:f:i:m:o:s:NOS:T:a:b:c:d:e:f:g:h:i:k:l:m:n:o:p:qr:s:t:u:x:z:%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count spacetime%s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad total tracksffs%s: bad sectors/track%s: bad spare sectors per cylindernewfs_%s/sbin%s/newfs_%s/usr/sbin%s not foundswap/dev/%sr%s%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %d%s: no default #tracks%s: no default #sectors/track%s: no default sector sizeWarning: changing optimization to space because minfree is less than %d%% disagrees with disk labelWarning: calculated sectors per cylinder%s (%d) %s (%lu) Number of cylinders restricts cylinders per group to %d. stat %smfs:%dstatfs %swaitpid%s: mount: %sabnormal termination/main 0apAr6gsBioctl (GDINFO)ioctl (WDINFO)%s: can't rewrite disk label-z tracks/cylinder-x spare sectors per cylinder-u sectors/track-t file system type-s file system size (sectors)-r revolutions/minute-p spare sectors per track-o optimization preference (`space' or `time')-n number of distinguished rotational positions-m minimum free space %%-l hardware sector interleave-k sector 0 skew, per track-i number of bytes per inode-h average files per directory-g average file size-f frag size-e maximum blocks per file in a cylinder group-d rotational delay between contiguous blocks-c cylinders/group-b block size-a maximum contiguous blocks-T disktype-S sector size-P src populate mfs filesystem-O create a 4.3BSD format filesystem-N do not create file system, just print out parametersusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s forkchdir%s%s: exitedcannot stat %s%s: not a dir or a block devicepax-rw-pe.rmdir %sunmount %smount %s %s/bin/paxcopy %s to %s failedcopy/mntTMPDIR/tmp/tmp mountpoint %s busytmp mountpoint %s too longtmp mount point too longmntXXXXXXXXXXmkdtemp %sgettmpmnt%s: initializing cg %ld/%d siginfocallocmmappreposterous size %dpreposterous ntrak %dpreposterous nsect %dillegal expected average file size %dillegal expected number of files per directory %dblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %dno block size to support this diskminimum bytes per inode isWith a block size of %d %s %ld Minimum bytes per inode is %ld With %d bytes per inode, minimum cylinders per group is %ld With %d sectors per cylinder, This requires the block size%s to be changed from %d to %d and the fragment size %s to be changed from %d to %d CylinderWarning: cylinder%s groups must have a multiple of %ld cylinders panic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %ld cylinders!mapcramped && !inodecrampedBlock size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder (not %d) File system performance may be impaired. and ntrakrotational layout tables with nsectWarning: insufficient space in super block for %s %s %d %s %d.%sinode blocks/cyl group (%ld) >= data blocks (%d) must be increasednumber of cylinders per cylinder group (%d) %s. filesystem must have at least %d sectorsWarning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated cg summarycylinders%s: %d sectors in %d %s of %d tracks, %d sectors %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %ld, %sfsinit failedmkfs>panic: cylinder group too bigcg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 cg 0: bad magic number (0x%06x != 0x%06x)fsinit: inode value %d out of rangerdfs: read error on block %dwtfs: write error on block %disblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d COLUMNS/dev/apmctl/var/run/apmdevusage: %s [-adempqs] [-f devfile] [-S sockfile] [-t timo] : %merrorcan't disable driver messages, error: %mbattery status: %s. external power status: %s. estimated battery life %d%% (%u minutes)battery status: %s. external power status: %s. estimated battery life %d%%cannot fetch power status: %mcannot create local socketcannot connect to APM socketcannot set socket mode/owner/group to 660/0/0bind_socketclient accept failure: %mclient size botchclient reply botchhandle_client/dev/speakerspeaker device /dev/speaker unavailable: %mcannot open /dev/speaker: %msending %d tones to speakero4ccAA```A``````A``$``A/etc/apm/suspend/etc/apm/standbyqadsepmf:t:S:cannot open device file `%s'cannot set close-on-exec for `%s'cannot set close-on-exec for the socketkqueuekeventapmevent %04x index %dno! sleep! till brooklyn!/etc/apm/resumesystem resumed from APM sleep/etc/apm/powerup/etc/apm/powerdownkevent loopPp`C 0!"!7!7!"!`!!"!0!"!7!do_etc_file(): cannot access file %sfailed to fork(): %m%s exited with status %d%s exited abnormally.highlowCRITICALchargingabsentunknown (absent?)invalid battery statenot connectedconnectedbackup power sourcenot knowninvalid AC status@(#) Copyright (c) 1997, 1998, 1999 Bill Paul. All rights reserved.@(#) $FreeBSD: src/usr.sbin/ancontrol/ancontrol.c,v 1.1 2000/01/14 20:40:57 wpaul Exp $socketSIOCGAIRONETSIOCSAIRONET[ %.*s ][ %u ]%2.1fMbps ?%02x: ]MAC address: Operating mode: [ configured MAC ON RX ON synced associated error ] Error code: Signal strength: [ %u%% ] Signal quality: Current SSID: Current AP name: Current BSSID: Beacon period: DTIM period: ATIM duration: HOP period: Channel set: Current channel: Hops to backbone: Total AP load: Our generated load: Accumulated ARL: OUI: Product number: Manufacturer name: Produce name: Firmware version: OEM MAC address: Aironet MAC address: Radio type: [ 802.11 FH802.11 DSLM2000 DSunknown (%x) Regulatory domain: Assigned CallID: Supported speeds: RX Diversity: [ antenna 1 onlyantenna 2 onlyantenna 1 and 2 TX Diversity: [ Supported power levels: Hardware revision: Software revision: Software subrevision: Interface revision: Bootblock revision: RX overruns: [ %u ] RX PLCP CSUM errors: [ %u ] RX PLCP format errors: [ %u ] RX PLCP length errors: [ %u ] RX MAC CRC errors: [ %u ] RX MAC CRC OK: [ %u ] RX WEP errors: [ %u ] RX WEP OK: [ %u ] Long retries: [ %u ] Short retries: [ %u ] Retries exhausted: [ %u ] Bad ACK: [ %u ] Bad CTS: [ %u ] RX good ACKs: [ %u ] RX good CTSs: [ %u ] TX good ACKs: [ %u ] TX good RTSs: [ %u ] TX good CTSs: [ %u ] LMAC multicasts transmitted: [ %u ] LMAC broadcasts transmitted: [ %u ] LMAC unicast frags transmitted: [ %u ] LMAC unicasts transmitted: [ %u ] Beacons transmitted: [ %u ] Beacons received: [ %u ] Single transmit collisions: [ %u ] Multiple transmit collisions: [ %u ] Transmits without deferrals: [ %u ] Transmits deferred due to protocol: [ %u ] Transmits deferred due to energy detect: [ %u ] RX duplicate frames/frags: [ %u ] RX partial frames: [ %u ] TX max lifetime exceeded: [ %u ] RX max lifetime exceeded: [ %u ] Sync lost due to too many missed beacons: [ %u ] Sync lost due to ARL exceeded: [ %u ] Sync lost due to deauthentication: [ %u ] Sync lost due to disassociation: [ %u ] Sync lost due to excess change in TSF timing: [ %u ] Host transmitted multicasts: [ %u ] Host transmitted broadcasts: [ %u ] Host transmitted unicasts: [ %u ] Host transmission failures: [ %u ] Host received multicasts: [ %u ] Host received broadcasts: [ %u ] Host received unicasts: [ %u ] Host receive discards: [ %u ] HMAC transmitted multicasts: [ %u ] HMAC transmitted broadcasts: [ %u ] HMAC transmitted unicasts: [ %u ] HMAC transmissions failed: [ %u ] HMAC received multicasts: [ %u ] HMAC received broadcasts: [ %u ] HMAC received unicasts: [ %u ] HMAC receive discards: [ %u ] HMAC transmits accepted: [ %u ] SSID mismatches: [ %u ] Access point mismatches: [ %u ] Speed mismatches: [ %u ] Authentication rejects: [ %u ] Authentication timeouts: [ %u ] Association rejects: [ %u ] Association timeouts: [ %u ] Management frames received: [ %u ] Management frames transmitted: [ %u ] Refresh frames received: [ %u ] Refresh frames transmitted: [ %u ] Poll frames received: [ %u ] Poll frames transmitted: [ %u ] Host requested sync losses: [ %u ] Host transmitted bytes: [ %u ] Host received bytes: [ %u ] Uptime in microseconds: [ %u ] Uptime in seconds: [ %u ] Sync lost due to better AP: [ %u ] Access point 1: Access point 2: Access point 3: Access point 4: SSID 1: [ %.*s ] SSID 2: [ %.*s ] SSID 3: [ %.*s ] Operating mode: [ ad-hocinfrastructureaccess pointaccess point repeater Receive mode: [ broadcast/multicast/unicastbroadcast/unicastunicast802.11 monitor, current BSSID802.11 monitor, any BSSIDLAN monitor, current BSSID Fragment threshold: RTS threshold: MAC address: Supported rates: Short retry limit: Long retry limit: TX MSDU lifetime: RX MSDU lifetime: Stationary: [ On ][ Off ] Ordering: Device type: [ PC4500PC4800 Scanning mode: [ activepassiveAironet active Probe delay: Probe energy timeout: Probe response timeout: Beacon listen timeout: IBSS join network timeout: Authentication timeout: WEP enabled: [ mixed cellfullno Authentication type: [ noneopenshared key Association timeout: Specified AP association timeout: Offline scan interval: Offline scan duration: Link loss delay: Max beacon loss time: Refresh interval: Power save mode: [ constantly awake modePSPPSP-CAM (fast PSP) Sleep through DTIMs: Power save listen interval: Power save fast listen interval: Power save listen decay: Power save fast listen decay: AP/ad-hoc Beacon period: AP/ad-hoc ATIM duration: AP/ad-hoc current channel: AP/ad-hoc DTIM period: Radio type: [ RX Diversity: [ TX Diversity: [ Transmit power level: RSS threshold: Node name: ARL threshold: ARL decay: ARL delay: usage: ancontrol [interface] [-AChINST] [[-v 1|2|3|4] -a AP] [-b beacon_period] [-c channel] [-v 0|1 -d 0|1|2|3] [-e 0|1|2|3] [-f fragmentation_threshold] [-j netjoin_timeout] [-K 0|1|2] [-v 0|1|2|3|4|5|6|7 -k key] [-l station_name] [-m macaddress] [[-v 1|2|3] -n SSID] [-o 0|1] [-p tx_power] [-r RTS_threshold] [-s 0|1|2|3] [-t 0|1|2|3|4] [-W 0|1|2] [-QZ] bad diversity setting: %uunsupported power level: %dmWbadly formatted addressunknown actionC=???`=?????=?>x===>>>>>??B?????5.5Mbps not supported on this card11Mbps not supported on this cardunsupported speedg@p@w@@@[%d/%d]: %02x:%02x:%02x:%02x:%02x:%02x, %s, sig: %d encryption key must be no more than 18 chars longencryption key must be 0, 5 or 13 bytes long WEP Key status: Key %d is unset Key %d is set 40 bits Key %d is set 128 bits Key %d has an unknown size %d The active transmit key is %d i:an0a:b:c:d:e:f:j:k:l:m:n:o:p:r:s:t:v:w:ACIK:NQSTW:Zbad modifier %dmust specify RX or TX diversitysHKHKKKKKHKHKKHKKHKHHKKHKKHKKKKKKHHIXIhIIIKIKIIJJ'JJJJJJJKJJHHII IdfiPRrW@LpLPLpLpLpLpL`LpLpLpLpLpLpLpLpLpLpLpLpLLpLLpLpL&LpLpLpLpLpLpLpLpLPL%s: %s%sfts_readM3N3NM3N'NM3N3NM%s: is a directory%s (inode %u): not overwritten due to multiple links%s: mallocrm_overwriteremove %s? override %s%s%s/%s for %s? check"." and ".." may not be removedusage: %s [-dfiPRrW] file ... m:pinvalid file mode: %s%s/%s: %susage: %s [-p] [-m mode] dirname ... $OpenBSD: compile.c,v 1.20 2004/07/10 11:41:26 otto Exp $unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %sread commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command\][$\\4Y#__^]Q`Fa\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])RE error: %scompile_re123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'compile_flagstransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthcompile_trcompile_textunterminated regular expressionexpected context addresswhitespace after %sundefined label '%s'DmPmmmmmmmmmmmmmmmmDmmPmmmmmmmmduplicate label '%s'unused label '%s'$OpenBSD: main.c,v 1.9 2003/06/10 22:20:50 deraadt Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %soooooooooooooooooooooooooooooooooo`oooopoooooooooor%s: %s"%s" ..."stdin$OpenBSD: misc.c,v 1.6 2004/07/20 03:50:26 deraadt Exp $%ssed: %lu: %s: $OpenBSD: process.c,v 1.12 2003/11/07 02:58:23 tedu Exp $%s %s: %s%lu V}V}V}@}V}V}V}V}V}V}qxV}V}y`yV}V}V}V}V}zV}zV}V}V}V}V}V}V}V}V}V}V}V}V}V}V}V}w&x4xxV}V}x@yyV}V}yV}yV}`z{P{{{V}V}||}V}wV}V}\%d not defined in the RErstdout: %sflush_appendsCOLUMNS\ \ \abfnrtv%03ofirst RE may not be emptyRE error: %sunable to allocate memoryLPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s can't get current directory - %sRnprsu,ne-p: %s-u: %s: %s:DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDpvpvV%s is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*$0×Ֆ×L#R#UZ#fi#lprtuxponly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s %s[%d]=ASeqЙdprtUx<<-taunaliasalias: -r flag can only be used with -t and without arguments alias %s alias not found gggggggggggggggggggggPgggggggggggggg ggggggggggg0g@gGggg`adtno argumentslpnzbgjob control not enabled%%%*d %*s %s%*d %*d %sbad signal `%s'--ls:Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %d %s%s%s: arguments must be jobs or process IDs%s: %smissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGlm<<<<<< c <<<-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]-tinternal error: unknown opp P&@PP`0RR0pPunexpected operator/operandmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorQ"'`\@V<A< 0< "< <<<`<T<<0<<< <<p<|}<tp<d<,X< L< ?< 5</<&<<|<0<<$<<t<4<<X<< <0<\ z<a<DG<8< '<!<<< <l < <( <@ < < < <$ < <commentset-argupcase-worddowncase-wordcapitalize-wordexpand-filecomplete-listyankexchange-point-and-markversiontranspose-charsstuff-resetstuffset-mark-commandsearch-historysearch-character-backwardsearch-character-forwardprev-hist-wordup-historyno-opnewline-and-nextdown-historynewlineforward-wordforward-charend-of-linebackward-wordbeginning-of-linebackward-charyank-popprefix-2prefix-1quotelist-filelist-commandkill-regionkill-to-eolauto-insertmacro-stringgoto-historyerroreot-or-deletelisteotend-of-historyredrawkill-linedelete-word-forwarddelete-char-forwarddelete-word-backwarddelete-char-backwardcompletecomplete-filecomplete-commandbeginning-of-historyaborthb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /.&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD I-search: x_search_hist nothing to yank yank something first%s%s = %s '%s' cannot bind, not a tty%s: no such functionCPOSIXsubstituteexpand(NULL)%S%s: bad substitutionparameter null or not set%s: %s  @ N      1 p   F c       ` v v v v v v v v  v  ` v v v v v v v v v v v v  v v  v  v v v v v v v v v v v v v v v v v v v v v v v v v v v ` v ` v v v v v v v v v v v v v v v v v v v v v v v v v v v v v  v    %s: parameter not set%Rfunny $() command: %s%s: cannot open $() input.*+?@! HOMEPWDOLDPWDPS4%s%s%scoprocess already exists%s: %sp4 4 4 5 7 7 $8 P8 8 8 ; : 9 9 : < ; 7 ; ; < 6 _builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not foundC C C C C  C  C C EXECSHELL/bin/sh%s: %s: %sshcomexec: %sFPATH%R%s%s opencreatedupcannot %s %s: %scould not finish (dup) redirection %s: %sN 6N N N 'N N here document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %s}>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %sX TY `Y pY Y Y missing )zero divisormissing :$] 5] ^ p\ \ \ \ \ \ \ F] T] `] \ \ \ ] \ ] p] ] p\ \ \ \ \ F] T] `] ^ ^ missing ]history functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sHd Hd Hd Hd Hd Hd Hd Hd Hd Hd d d d d d k d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d c d (d d d d d 0d d 8d d d d @d c substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE t Pt 0t 7t @t Gt %s.%dhist_shrink3v v Pv `v pv v %s: internal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againbad file descriptorfd not open for readingfd not open for writingillegal file descriptor nameno coprocess/tmp%s/shXXXXXXXX<<<`<argument must be %job or process idambiguousno such jobj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlexchild: XPIPEI and no last_job - pid %d%Tfork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last procwaitlast: no last jobwaitlast: not startedjw:waitlast%s: %sjw:waitforjob not job-controlled[%d] | %s%s1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumerunning and stoppedYou have %s%s%s jobs jobsnotifyasyncj_async: job not startedj_async: bad nzombie (%d)zombiej_waitj: tcsetpgrp(%d, %d) failed: %scheck_job: job started (flags 0x%x)checkjob%d RunningDoneDone (%d)[%d] %c %s%5d (core dumped)%s%s |%-20s %s%s%s%s%5d %-20s %s%s %s%sj_print`                                     `      `  g                   remove_job: job not found (%s)no closing quote @      7 2  c `   P    ( here document `%s' unclosed 0 0   A `  V PS1%dPS2missing ]   W   " MAIL_you have mail in $_%s IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }KSH_VERSION<<<<<<<<<<<<<<<@<<<<<<<<<<Cannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENV<<<<<include: %d        shell: %dUse `exit' to leave ksh  @  @   @        alloc: %s0123456789 |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF Error handlerERRUser defined signal 2USR2User defined signal 1USR1Information requestINFOWindow size changeWINCHProfiling timer expiredPROFVirtual timer expiredVTALRMFile size limit exceededXFSZCPU time limit exceededXCPUI/O possibleIOStopped (tty output)TTOUStopped (tty input)TTINChild exitedCHLDContinuedCONTStoppedTSTPStopped (signal)STOPUrgent I/O conditionURGTerminatedTERMAlarm clockALRMBroken pipePIPEBad system callSYSMemory faultSEGVBus errorBUSKilledKILLFloating point exceptionFPEEMT trapEMTAbortABRTTrace trapTRAPIllegal instructionILLQuitQUITInterruptINTHangupHUPSignal 0EXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-vars# #no-args# ( %T) %T| %T%;||&&%T%s %T! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi whileuntil%s %T%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T%s7 08 C8 P8 `8 `8 8 8 9 8 9 W: 0; 0; W:  < ; ; ; < !8 ; < <<- << >> >| > <> <&>&%s u= = = = = = @ ?  ? V? ? ? @ "@ p@ @ @ @ PB B B B B B B B B B B B B B B B B B B PB B B B B A 4B B B B B B B B B B B B B B B uA A B B B B B B B B B B B B B B A B A wdscan: unknown char 0x%x (carrying on)`E QE QE !E !E E E 0E @E PE TE TE E E E E 0F E E F F F G G /dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s<< <<<o<h<_< V< O< H< C<9<0<)<!<<<LINENOTMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNS%s: subscript out of rangebad substitutionO QO 2O O QO QO QO QO QO QO QO QO @O QO QO QO QO QO QO QO QO QO QO QO QO QO QO QO QO QO %O 0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyz%s: bad number%s: is read onlysetstr: %s=%s: assigning to self%0*s%.*s%*s%.*s%-*.*sENVSHELL%s: restricted` %a Qa Qa Qa ` a Qa Qa Qa Qa Qa Qa Qa 4a a a c b Gc `c tc c b b  c b !c b c 0b c  Bd d d d d d d d d d d d d d d d d @(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QB/?h j j Wk l n n n @j 4l l s s s s s s s s s s s s s s s s s s s s s s s s s s s  s ^y$fc -e ${VISUAL:-${EDITOR:-vi}} --%s %d%s    Ҁ   `u  4z  hz  `u                         4z  hz  7}                 } pu v   y Gy   y  z     P}  x  z w  |   `| @w      }  v  Ew Ew   y  y 4z hz   P}  hx  z {  | P{  | Ew                                          '               '          ԁ                  !       P    c                           grabhist: bad history arrayM-usage: %s seconds if%s: destination pathname too longmain%soverwrite %s? override %s%s%s/%s for %s? rename %s to %scannot resolve %s: %scannot rename a mount pointcan't remove %sdo_move%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set times-PRpmv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmusage: %s [-fi] source target %s [-fi] source ... directory usage: %s [-v] [-z | -S] [-slbam] [-f socket] usage: %s [-z | -S] [-f socket] invalid reply from APM daemoninvalid send to APM daemonSuspending system... cannot create local socketcannot open connection to APM daemonopen_socket/var/run/apmdevlmbvasSzf:zzz/dev/apmcannot get reply from APM daemon%d 1 Battery state: %s Battery remaining: %d percent Battery life estimate: %d minutes A/C adapter state: %s Power management enabled System will enter suspend mode momentarily. System will enter standby mode momentarily.                    s                   S                G    ` highlowCRITICALchargingabsentunknown (absent?)invalid battery statenot connectedconnectedbackup power sourcenot knowninvalid AC status_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUF%susage: dmesg [-M core] [-N system] ssethostnamegethostname%s mainusage: %s [-s] [name-of-host] $Id: logout.c,v 1.7 2004/05/28 07:03:47 deraadt Exp $/var/run/utmplogoutRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedntfsadoscd9660lfsmsdosffs%s/dev/%sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labelreadlabelfs$Id: login_tty.c,v 1.6 2004/05/28 07:03:47 deraadt Exp $r/dev/%s%s%s%c%s%s%s$NetBSD: getrawpartition.c,v 1.1 1996/05/16 07:03:33 thorpej Exp $r/etc/fbtab /dev/%o(null)%s: bad entry: %s:%s: %s: %m/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...login_protect$OpenBSD: fmt_scaled.c,v 1.3 2004/05/28 07:03:47 deraadt Exp $0B%lld%c%lld.%1lld%c$Id: logwtmp.c,v 1.7 2004/05/28 07:03:47 deraadt Exp $/var/log/wtmplogwtmp$NetBSD: getmaxpartitions.c,v 1.1 1996/05/16 07:03:31 thorpej Exp $$OpenBSD: fparseln.c,v 1.5 2004/05/28 07:03:47 deraadt Exp $\\#TERMCAP/usr/share/misc/termcapTERMPATHHOME.termcap /usr/share/misc/termcap%s/%stgetentOOPS ? ? ? ? ? P ? ? V ? ? ?   ? ? ? ? ? ? ? ? ? ? 8 ? ? ?  ?  ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?  ? ? ? ?  ? ? ? ?  ? ? ?  acosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error ynynfyn: DOMAIN error lgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10log10flog10: SING error log10: DOMAIN error powpowfpow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanhatanhfatanh: DOMAIN error atanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error G?     B l         9  3  3  k     `  7   p    / O o     ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` `      B l         9  3  3  k     `  7   p    / O o     IN-ADDR.ARPAgetnetanswerbf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpagetnetbyaddrgetnetbynamer/etc/networks : xxswufsswap ,rwrqrofstabscan/etc/fstabrfstab: : $OpenBSD: strtok.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: rand.c,v 1.7 2003/06/02 20:18:38 millert Exp $$OpenBSD: auth_unix.c,v 1.16 2003/09/20 00:39:39 deraadt Exp $authunix_create: out of memory authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problem$OpenBSD: heapsort.c,v 1.6 2003/09/08 16:24:05 deraadt Exp $$OpenBSD: nice.c,v 1.6 2003/06/02 20:18:34 millert Exp $$OpenBSD: strncat.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $4 f S Y     @    4  ! ! ! ! ! !        ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! !  %s: $OpenBSD: bsearch.c,v 1.4 2003/06/02 20:18:37 millert Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$%s%.*s$md5crypt$OpenBSD: readpassphrase.c,v 1.16 2003/06/17 21:56:23 millert Exp $/dev/tty readpassphrasetcsetattr./$OpenBSD: strtofflags.c,v 1.4 2004/05/18 02:05:52 jfb Exp $U<uU<nU<cU<\U<RU<EU<= 0 && n <= 15/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 9$OpenBSD: assert.c,v 1.7 2003/06/11 21:03:10 deraadt Exp $assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" $OpenBSD: md5.c,v 1.7 2004/05/28 15:10:27 millert Exp $MD5Pad$OpenBSD: strspn.c,v 1.4 2003/06/11 21:08:29 deraadt Exp $0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL Ծ Ծ Ծ @ Ծ @ @ Ծ Ծ P Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ @ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ v  Ծ  Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ Ծ  0 [:<:]][:>:]]v                    %x.0.%x%02x^ ^ ^ ^ ^ ^ ^ ^ ^ c c c c c c c Y Y Y Y Y Y c c c c c c c c c c c c c c c c c c c c c c c c c c T T T T T T %8xH.%02x:%02x:%02x:%02x:%02x:%02x.%uHOMEglob3.g_opendirg_lstatg_stat...%s: %sns_addr%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3d{ w w { { { { { { { { T T w w w w w w w d d d d d d w p w w w w w w w w w w w w w w w ` w w w w w w w w d d d d d d w p w w w w w w w w w w w w w w w ` //dev/nullipx_addr%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3d                                                                            __svfscanf                                                                               V                          8     ( ]          v   @ P                                                 2                                2                           0                                0 RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedntfsadoscd9660lfsmsdosffs/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdx$OpenBSD: getcap.c,v 1.22 2004/05/18 02:05:52 jfb Exp $%s.dbtcgetentr|:cgetnext0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 $OpenBSD: gethostnamadr.c,v 1.60 2004/07/29 03:09:40 itojun Exp $gethostby*.getanswer: asked for "%s", got "%s"-_/gethostby*.getanswer: asked for "%s %s %s", got type "%s"getanswerbf%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.arpagethostbyaddrr/etc/hosts %u.%u.%u.%uhosts.byaddr_yp_gethtbyaddrhosts.byname-csh/bin/shexeclexecleexeclpPATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin:.execvp: : path too long sh/bin/shexecvpU  V  V  V  V  V PU  V  V  V  V U  V  V  V  V  V  V U U  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V  V U U $OpenBSD: strsignal.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: __strsignal.c,v 1.8 2003/06/02 20:18:38 millert Exp $libcUnknown signal: m~}<1}<}<}<|<|<|<|<|<|<4<'<<<<ڇ<‡<<<<4<'<<<<ڇ<‡<<< @ 0> @ @> @ P> @ `> @ p> @ > > > @ > @ > @ @ @ @ @ @ @ @ @ @ @ > @ > @ @ > ? @ @ @ @ @ @ @ @ @ ? @ @ @  ? @ 0? @ @ @ @ @ @ @ @? P? `? @ @ @ @ @ @ @ p? @ ? @ @ @ @ @ @ @ ? @ @ @ @ @ @ @ ? @ @ @ @ ? ? ? ? ? @ @ @ @ @ @  @ @ '@ @ 0@ @ 7@ @ @@ @ G@ @ P@ @ @ @ @ @ @ @ @ @ W@ @ @ `@ @ @ @ @ @ @ @ g@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ p@ w@ @ @ @ @ @ @ @ @ icmpigmpggpsttcpuclegpigpnvp-IIpupchaosudp@ @ @ A @ @ @ @ @ A @ A A A A A A %s;; res options: %s;; ->>HEADER<<- opcode: %s, status: %s, id: %u; flags: qr aa tc rd ra UNUSED-BIT-ON ad cd; Ques: %u, Ans: %u, Auth: %u, Addit: %u;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: ;; ...truncated ;; ...malformed __fp_nquery__p_cdnname.__p_fqname %lu %s %s ; proto %u, port %u " "\"?" ;; *** Warning *** OS-type missing ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %u %u %u "%.*s" %u %u %u %u %s %s ( 0x%04x %u %u ( ) ; BAD BASE64 ; LABELS WRONG (%d should be %d) ( %s %u ?%d?;; packet size error (found %ld, dlen was %d) __p_rrK L Z Z L N L L L Z U L L T 3P Q T 3P P L 3P bS Z X W `P Z vS S Z Z Z `T Z S Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z TU U U <<<<<ANYHESIODHSCHAOSIN <<< <<<<ɡ<á<<<<<<<}< z<;<'<"<<ޟ<џ<͟<ğ<<<<`< ?< ?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ZONEREFZONEINITUPDATEMAUPDATEMUPDATEDAUPDATEDUPDATEA8765NOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14131211109REFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERROR  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~%u.%u.%u.%u%u.%u.%u.%uinet_ntop4%xinet_ntop6$OpenBSD: strcasecmp.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~$OpenBSD: _yp_check.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: yp_get_default_domain.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $r/etc/services ,/$OpenBSD: fgetln.c,v 1.4 2003/06/02 20:18:37 millert Exp $$OpenBSD: strpbrk.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: strtol.c,v 1.5 2003/06/02 20:18:38 millert Exp $01234567890123456789abcdef0123456789ABCDEFinet_pton6$OpenBSD: strtoul.c,v 1.5 2003/06/02 20:18:38 millert Exp $syslog: unknown facility/priority: %xsyslog_r: unknown facility/priority: %x<%d>%h %e %T %s[%ld]Error %d /dev/console vsyslog_r/dev/logconnectlog_r$OpenBSD: strftime.c,v 1.13 2003/06/04 21:47:58 deraadt Exp $B<><:<6<2<.<*<&<"<<<<<<<<2<<<<ޯ<֯<ͯ<į<<<<<<<<<<<<' prompt will exit the editor. At prompts that request a size, `*' may be entered to indicate the rest of the available space. The editor commands are as follows: ?? [_c_o_m_m_a_n_d] Display help message with all available commands. A _c_o_m_m_a_n_d may be specified to get more detailed help. There is also (simple) context-sensitive help available at most prompts. aa [_p_a_r_t] Add new partition. This option adds a new BSD partition. If no partition letter is specified (a-p), the user will be prompted for one. bb Set OpenBSD disk boundaries. This option tells ddiisskkllaabbeell which parts of the disk it is allowed to modify. This option is probably only useful for ports with fdisk(8) partition ta- bles where the ending sector in the MBR is incorrect. The us- er may enter `*' at the ``Size'' prompt to indicate the entire size of the disk (minus the starting sector). This is useful for disks larger than 8 gigabytes where the fdisk partition table is incapable of storing the real size. cc [_p_a_r_t] Change the size of an existing partition. If no partition is specified, the user will be prompted for one. The new size may be in terms of the aforementioned units and may also be prefixed with `+' or `-' to change the size by a relative amount. DD Sets the disk label to the default values as reported by the kernel. This simulates the case where there is no disk label. dd [_p_a_r_t] Delete an existing partition (or `*' to delete all parti- tions). If no partition is specified, the user will be prompted for one. The `c' partition cannot be deleted. ee Edit drive parameters. This option is used to set the follow- ing parameters: disk type, a descriptive label string, sec- tors/track, tracks/cylinder, sectors/cylinder, number of cylinders, total sectors, rpm, and interleave. gg [_b|_d|_u] Set disk geometry based on what the _B_I_O_S, _d_i_s_k, or _u_s_e_r thinks (the _u_s_e_r geometry is simply what the label said before ddiisskkllaabbeell made any changes). MM Display this manual page. mm [_p_a_r_t] Modify parameters for an existing partition. If no partition is specified, the user will be prompted for one. This option allows the user to change the filesystem type, starting off- set, partition size, and mount point for the specified parti- tion. If expert mode is enabled (see XX below), then block fragment size, block size, and cylinders per group can also be modified. Note that not all parameters are configurable for non-BSD partitions. nn [_p_a_r_t] Name the mount point for an existing partition. If no parti- tion is specified, the user will be prompted for one. This option is only valid if ddiisskkllaabbeell was invoked with the --ff flag. pp [_u_n_i_t] Print the current disk label. If a _u_n_i_t is given, the size and offsets are displayed in terms of the specified unit. qq Quit the editor. If any changes have been made, the user will be asked whether or not to save the changes to the on-disk la- bel. rr Recalculate free space. This option should really not be nec- essary under normal circumstances. ss [_p_a_t_h] Save the label to a file in ASCII format (suitable for loading via the --RR option). If no path is specified, the user will be prompted for one. uu Undo (or redo) last change. Entering _u once will undo the last change. Entering it again will restore the change. ww Write the label to disk. This option will commit any changes to the on-disk label. XX Toggle ``expert mode''. By default, some settings are re- served for experts only (such as the block and fragment size on ffs partitions). xx Exit the editor without saving any changes to the label. zz Zeroes out the existing partition table, leaving only the `c' partition. The drive parameters are not changed. In the restore form of the command (fifth form), the prototype file used to create the label should be in the same format as that produced when reading or editing a label. Comments are delimited by _# and newline. As with --ww, any existing bootstrap code will be clobbered if --rr is specified and will be unaffected otherwise. The sixth form of the command (protect) is used to control write access to the label area of a disk so that the label cannot be inadvertently overwritten. The --NN and --WW options are only available on architectures that support this feature, such as vax, hp300 and some sparc models. The final three forms of ddiisskkllaabbeell are used to install bootstrap code on machines where the bootstrap is part of the label. The bootstrap code is comprised of one or two boot programs, depending on the machine. When installing bootstrap code with the --BB flag, if the names are not ex- plicitly given, standard boot programs will be used. The boot programs are located in _/_u_s_r_/_m_d_e_c. The names of the programs are taken from the ``b0'' and ``b1'' parameters of the disktab(5) entry for the disk if _d_i_s_k_t_y_p_e was given and its disktab entry exists and includes those param- eters. Otherwise, boot program names are derived from the name of the disk. These names are of the form _b_a_s_e_n_a_m_eboot for the primary (or only) bootstrap, and boot_b_a_s_e_n_a_m_e for the secondary bootstrap; for example, _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d if the disk device is _s_d_0. The first of the three boot-installation forms is used to install boot- strap code without changing the existing label. It is essentially a read command with respect to the disk label itself and all options are related to the specification of the boot program as described previously. The final two forms are analogous to the basic write and restore versions ex- cept that they will install bootstrap code in addition to a new label. Note that when a disk has no real BSD disklabel, the kernel creates a de- fault label so that the disk can be used. This default label will in- clude other partitions found on the disk if they are supported on your architecture. For example, on systems that support fdisk(8) partitions the default label will also include DOS and Linux partitions. However, these entries are not dynamic, they are fixed at the time ddiisskkllaabbeell is run. That means that subsequent changes that affect non-OpenBSD parti- tions will not be present in the default label, though they may be updat- ed by hand. To see the default label, run ddiisskkllaabbeell with the --dd flag. ddiisskkllaabbeell can then be run with the --ee flag and any entries pasted as de- sired from the default label into the real one. FFIILLEESS /etc/disklabels Directory for backup labels. /etc/disktab Disk description file. /usr/mdec/_x_xboot Primary bootstrap. /usr/mdec/boot_x_x Secondary bootstrap. EEXXAAMMPPLLEESS Display the in-core label for sd0 as obtained via _/_d_e_v_/_r_s_d_0_c: # disklabel sd0 Create a label for sd0 based on information for ``sd2212'' found in _/_e_t_c_/_d_i_s_k_t_a_b. Any existing bootstrap code will be clobbered. (Normally you do not want to use the --rr flag though.) # disklabel -w -r /dev/rsd0c sd2212 foo Read the on-disk label for sd0, edit it and reinstall in-core as well as on-disk. (Normally you do not want to use the --rr flag though.) Existing bootstrap code is unaffected. # disklabel -e -r sd0 Restore the on-disk and in-core label for sd0 from information in _m_y_l_a_b_e_l. Existing bootstrap code is unaffected. # disklabel -R sd0 mylabel Install a new bootstrap on sd0. The boot code comes from _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and possibly _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d. On-disk and in-core la- bels are unchanged, but on some systems other information may be de- stroyed. Use with care. # disklabel -B sd0 Install a new label and bootstrap. The label is derived from disktab in- formation for ``sd2212'' and installed both in-core and on-disk. The bootstrap code comes from the file _/_u_s_r_/_m_d_e_c_/_n_e_w_b_o_o_t. # disklabel -w -B /dev/rsd0c -b newboot sd2212 DDIIAAGGNNOOSSTTIICCSS The kernel device drivers will not allow the size of a disk partition to be decreased or the offset of a partition to be changed while it is open. Some device drivers create a label containing only a single large parti- tion if a disk is unlabeled; thus, the label must be written to the `a' partition of the disk while it is open. This sometimes requires the de- sired label to be set in two steps, the first one creating at least one other partition, and the second setting the label on the new partition while shrinking the `a' partition. On some machines the bootstrap code may not fit entirely in the area al- located for it by some filesystems. As a result, it may not be possible to have filesystems on some partitions of a ``bootable'' disk. When in- stalling bootstrap code, ddiisskkllaabbeell checks for these cases. If the in- stalled boot code would overlap a partition of type FS_UNUSED it is marked as type FS_BOOT. The newfs(8) utility will disallow creation of filesystems on FS_BOOT partitions. Conversely, if a partition has a type other than FS_UNUSED or FS_BOOT, ddiisskkllaabbeell will not install bootstrap code that overlaps it. SSEEEE AALLSSOO disklabel(5), disktab(5), scan_ffs(8) CCAAVVEEAATTSS On i386 machines, installboot(8) is normally used to install boot code. The --BB option to ddiisskkllaabbeell can still be used to install old style boot code, but this usage is deprecated. On some machines, such as the sparc, partition tables may not exhibit the full functionality that is described above. ddiisskkllaabbeell only supports up to a maximum of 15 partitions, `a' through `p', excluding `c'. The `c' partition is reserved for the entire physi- cal disk. By convention, the `a' partition of the boot disk is the root partition, and the `b' partition of the boot disk is the swap partition, but all other letters can be used in any order for any other partitions as desired. BBUUGGSS When a disk name is given without a full pathname, the constructed device name uses the `a' partition on the tahoe, the `c' partition on all oth- ers. In --EE mode, ddiisskkllaabbeell is far too quick to shuffle partitions around; it should keep a free block list and only move partitions around with the user's permission. Also, in --EE mode, partitions outside the OpenBSD portion of the disk should be changeable. OpenBSD 3.6 October 27, 1997 6  abcdfiklnoprstuvwxBDEGHLPTUXYZ0<4 ܟ<L ܟ<n ķ ܟ<nĴ ķз ܟ<(*+( /((ܟ+}<(2p2,3(2T7((ܟP<8t<.? ɚ;@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.16 2004/05/21 02:11:33 jolan Exp $7P < < <

> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)f <o<`o<btg<@> <@o< o<Btg<> <n <`n<'n<n <m <m <fm < m <l <#l<l<HA> <k <k <Bk< k<Jtg <j <j <j <qj<`j<@j <j <i<@i<i <h <h <h < h <`g<8g<ytg<> <!g<g<ztg<> <f <f<\f<?tg<#tg<> <If<+f<.tg <f<f<8 < (press RETURN)... (interrupt to abort)@qUu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxU@|<(.|<'|<)|<{FDISK(8) OpenBSD System Manager's Manual FDISK(8) NNAAMMEE ffddiisskk - DOS partition maintenance program SSYYNNOOPPSSIISS ffddiisskk [--iieeuu] [--ff _m_b_r_n_a_m_e] [--cc _c_y_l_i_n_d_e_r_s] [--hh _h_e_a_d_s] [--ss _s_e_c_t_o_r_s] _d_e_v_i_c_e DDEESSCCRRIIPPTTIIOONN In order for the BIOS to boot the kernel, certain conventions must be ad- hered to. Sector 0 of a bootable hard disk must contain boot code, an MBR partition table, and a magic number (0xAA55). These MBR partitions (also known as BIOS partitions) can be used to break the disk up into several pieces. The BIOS loads sector 0 of the boot disk into memory, verifies the magic number, and begins executing the code at the first byte. The normal DOS MBR boot code searches the MBR partition table for an ``active'' parti- tion (indicated by a `*' in the first column), and if one is found, the boot block from that partition is loaded and executed in place of the original (MBR) boot block. The options are as follows: --ii Initialize the MBR sector. --ee Edit existing MBR sectors. --ff _m_b_r_n_a_m_e Specifies an alternate MBR template file. --uu Update MBR code, preserving existing partition table. --cc _c_y_l_i_n_d_e_r_s, --hh _h_e_a_d_s, --ss _s_e_c_t_o_r_s Specifies an alternate BIOS geometry for ffddiisskk to use. The DOS ffddiisskk program can be used to divide space on the disk into parti- tions and set one active. This ffddiisskk program serves a similar purpose to the DOS program. When called with no special flags, it prints the MBR partition table of the specified device, i.e., # fdisk fd0 Disk: fd0 geometry: 80/2/18 [2880 sectors] Offset: 0 Signature: 0xAA55 Starting Ending #: id cyl hd sec - cyl hd sec [ start - size] ---------------------------------------------------------------------- *0: A6 0 0 1 - 79 1 18 [ 0 - 2880] OpenBSD 1: 00 0 0 0 - 0 0 0 [ 0 - 0] unused 2: A7 0 0 2 - 79 1 18 [ 1 - 2879] NEXTSTEP 3: 00 0 0 0 - 0 0 0 [ 0 - 0] unused The geometry displayed is the BIOS geometry unless another geometry has been selected using the --cc, --hh, and --ss options. This disk is divided into two partitions that happen to fill the disk. The first partition overlaps the third partition. (Used for debugging purposes.) _# Number of partition table entry. A ``*'' denotes the bootable partition. _i_d System identifier. OpenBSD reserves the magic number 166 decimal (A6 in hex). If no 166 partition is found, it will use an older FreeBSD partition (with a magic number of 165 or A5 in hex). _c_y_l_/_h_d_/_s_e_c These fields provide the starting and ending address of the partition in BIOS geometry. _s_t_a_r_t_/_s_i_z_e These fields provide the starting sector and size in sectors of the partition in linear block addresses. _N_O_T_E: The sectors field is ``1 based'', and the start field is ``0 based''. The CHS values will need to be in the BIOS's geometry for the system to be able to boot and use the drive correctly. The --ii flag is used to indicate that the partition data is to be initial- ized. In this mode, ffddiisskk will completely overwrite the primary MBR and partition table, either using the default MBR template, or the one speci- fied by the --ff flag. In the default template, partition number 3 will be configured as an OpenBSD partition spanning from cylinder 0, head 1, sec- tor 1, and extending to the end of the disk. This mode is designed to initialize an MBR the very first time, or when it has been corrupted be- yond repair. The --uu flag is used to update the MBR code on a given drive. The MBR code extends from offset 0x000 to the start of the partition table at offset 0x1BE. It is similar to the --ii flag, except the existing parti- tion table is preserved. This is useful for writing new MBR code onto an existing drive, and is equivalent to the DOS command ``FDISK /MBR''. Note that this option will overwrite the NT disk signature, if present. The --ee flag is used to modify a partition table using an interactive edit mode of the ffddiisskk program. This mode is designed to allow you to change any partition on the drive you choose, including extended partitions. It is a very powerful mode, but is safe as long as you do not execute the _w_r_i_t_e command, or answer in the negative (the default) when ffddiisskk asks you about writing out changes. CCOOMMMMAANNDD MMOODDEE When you first enter this mode, you are presented with a prompt, that looks like so: _f_d_i_s_k_: _0_>. This prompt has two important pieces of infor- mation for you. It will tell you if the in-memory copy of the boot block has been modified or not. If it has been modified, the prompt will change to look like: _f_d_i_s_k_:_*_0_>. The second piece of information pertains to the number given in the prompt. This number specifies the disk offset of the currently selected boot block you are editing. This number could be something other than zero when you are editing extended partitions. The list of commands and their explanations are given below. _h_e_l_p Display a list of commands that ffddiisskk understands in the interac- tive edit mode. _m_a_n_u_a_l Display this manual page. _r_e_i_n_i_t Initialize the currently selected, in-memory copy of the boot block. _d_i_s_k Display the current drive geometry that ffddiisskk has probed. You are given a chance to edit it if you wish. _e_d_i_t Edit a given table entry in the memory copy of the current boot block. You may edit either in BIOS geometry mode, or in sector offsets and sizes. _s_e_t_p_i_d Change the partition identifier of the given partition table en- try. This command is particularly useful for reassigning an ex- isting partition to OpenBSD. _f_l_a_g Make the given partition table entry bootable. Only one entry can be marked bootable. If you wish to boot from an extended partition, you will need to mark the partition table entry for the extended partition as bootable. _u_p_d_a_t_e Update the machine code and 0xAA55 signature in the memory copy of the currently selected boot block. Note that this option will overwrite the NT disk signature, if present. _s_e_l_e_c_t Select and load into memory the boot block pointed to by the ex- tended partition table entry in the current boot block. _p_r_i_n_t Print the currently selected in-memory copy of the boot block and its MBR table to the terminal. _w_r_i_t_e Write the in-memory copy of the boot block to disk. You will be asked to confirm this operation. _e_x_i_t Exit the current level of ffddiisskk, either returning to the previ- ously selected in-memory copy of a boot block, or exiting the program if there is none. _q_u_i_t Exit the current level of ffddiisskk, either returning to the previ- ously selected in-memory copy of a boot block, or exiting the program if there is none. Unlike _e_x_i_t it does write the modified block out. _a_b_o_r_t Quit program without saving current changes. NNOOTTEESS The automatic calculation of starting cylinder etc. uses a set of figures that represent what the BIOS thinks is the geometry of the drive. These figures are by default taken from the in-core disklabel, or values that _/_b_o_o_t has passed to the kernel, but ffddiisskk gives you an opportunity to change them if there is a need to. This allows the user to create a bootblock that can work with drives that use geometry translation under a potentially different BIOS. If you hand craft your disk layout, please make sure that the OpenBSD partition starts on a cylinder boundary. (This restriction may be changed in the future.) Editing an existing partition is risky, and may cause you to lose all the data in that partition. You should run this program interactively once or twice to see how it works. This is completely safe as long as you answer the ``write'' ques- tions in the negative. FFIILLEESS /usr/mdec/mbr default MBR template SSEEEE AALLSSOO boot_i386(8), disklabel(8) BBUUGGSS There are subtleties ffddiisskk detects that are not explained in this manual page. As well, chances are that some of the subtleties it should detect are being steamrolled. Caveat Emptor. OpenBSD 3.6 January 3, 2002 3 <0<A!<B<C<D<E<F<Gߑ<Uב<Vґ<aƑ<b<c<e<f<h<i<Lu<li<nc<q\<qR<rF<s9<v-<w!<x<u@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.16 2003/07/29 18:38:36 deraadt Exp $$OpenBSD: mount_msdos.c,v 1.18 2003/07/03 22:41:40 tedu Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $<К<Ú<<<@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.13 2003/06/02 20:06:15 millert Exp $ D<2<1<2< <-1<2< <1<3< < 1<1< .+?@ABCDEFGHIJKLNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~;Zx0N$OpenBSD: buf.c,v 1.16 2003/10/18 19:15:43 jmc Exp $ <$OpenBSD: cbc.c,v 1.13 2004/05/08 07:05:19 deraadt Exp $@ $OpenBSD: glbl.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: io.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $<<$OpenBSD: main.c,v 1.28 2003/06/11 23:42:12 deraadt Exp $,=<@=<H$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.8 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.28 2003/10/30 16:01:43 millert Exp $<:<$OpenBSD: fwrite.c,v 1.3 2003/06/02 20:18:37 millert Exp $$OpenBSD: sethostname.c,v 1.7 2003/07/15 17:32:41 deraadt Exp $$OpenBSD: crypt.c,v 1.18 2003/08/12 01:22:17 deraadt Exp $./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:$OpenBSD: md5crypt.c,v 1.13 2003/08/07 00:30:21 deraadt Exp $./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzS<$OpenBSD: tcsetattr.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$OpenBSD: fputc.c,v 1.5 2003/06/02 20:18:37 millert Exp $$OpenBSD: errno.c,v 1.4 2004/07/17 20:38:43 marc Exp $$OpenBSD: basename.c,v 1.11 2003/06/17 21:56:23 millert Exp $$OpenBSD: alarm.c,v 1.5 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: inet_makeaddr.c,v 1.4 2003/06/02 20:18:35 millert Exp $$OpenBSD: getmntinfo.c,v 1.6 2004/05/18 02:05:52 jfb Exp $$OpenBSD: asprintf.c,v 1.10 2003/06/17 21:56:24 millert Exp $U*i+,,<0 %<$7 +$8<@H4$8<$H ;08<0HB88<@HK@H<@H P44@HdELF 44 (   `(fXf= tfZffgf6 ff"fM؎ЎR31H逥 |3U,WVS]51E&h5phj(h`/h`h0hSUUhVhnE=tu$hhhhh!/ =tt}hr/tEthhC/Ej?]Shh% GuE15t&ƃhVhkV5h,. }3@(=thF.5S#e[^_ÐU5hhPu `nU|WVSj5 P;ǃ}2t_tZP*,Phh-1vEPWC}uEtKhh -W%<5+PhhAq- jVWJ<Ã~F< t-=vօ|ut5V<N> thhI,~ ÅqW];؍x[^_US1ɻ`]=A< t< t<#]EQEPEu]+&xu t Exu tE@}t9QEPEuE0h\+1g&EEE QtBvӡǀ@Ћ]ÍvU WVSu} WE1ۃ?tvC<;u & 8tS0W Yu8uEe[^_ÍvU WVSu}~|1VEE&sXu.Mb)ʍ)GuU;E| t0Kt t'9t&9ṽjOK9wCA9vjOK뛉)E H9s C늃jhOj^O n)؍e[^_ÉUE@t$ t u8t@ t t8u1ÐUS];t3hnZ) ;uj N]Uhr-)h` ÉUh|)h@|1US;} 4h(C;|j JN1]ÍvUS=u jjPPjNPH5)OÃu5hP([=u% jSOP5h)(4&1ҋ TBA< vRS{O1]U SE=uEPP'1ÍvU|WVS}WuPAP}%5%Phhg'E%=@tWhha ƃ}(5Z%PhhÈ 't&=tC;u/CFWh}#5$Phh& WS*SV5 }V 1x[^_US] C% ԈPK-C trPK-CtwPKC@tttPK-C trPgK-CtwPNKCtttPK-CtrPK-CtwPJCtttPJus8ssh$]ÉU=xu 1t&xÍvU=~.8-t$uPMjgt617jUuhhhhh#ÉUMʊt<:tBt<:u::uhQhQhhhh#ÉUh#&1ÐU=t5ht#jj51ÐUSh`hxw#=t%3h|Q#CЃ ;u1]ÉU=thhx#t&j5h{1ÍvU=thhx"h5h81U=t5h"jj51ÐUS=tjHPhxO"w5HÃu5h""J5h "SN t5h!h`hx!1]ÍvU=u}=tej-BGt ja,Gt jcGt jsG@t jdFj F vj1ÉUVS] 59:-u\B:tnuuhW<hƃ=uP5h h)‰PV1e[^ÐU WVSu ^ S;NjE_VEPG P]XlG=le[^_ÍvU WVSU lt {[u9slj:lut-S9s&RSVWs[t S2+E9re[^_ÐUWVS} u]t#Ntt&BCtIuutBu)B[^_ÐUi91ÐUVS=thh G;=QjN1e[^_ÐUWVS}MEA߃]w}-uEUE}+uEAtu}0uF>/t> B %f=@w1 @=F>t/uPE PRÉM QlÃB %f=\zVJ=:= ~ 3BPVPrH;(}W4quv0+PjE PÃFM QPPv0NdPjM qBЉÃ ugWPRG/t DžE PÃu >1ۃtr0QB+t*h p%+hR+؍[^_U WVSEX@tm13tCp03*Oy؃tCp0*h s*hS}*1e[^_ÍvUWVS}EpE EE)E9vÃSuEP0FV])߃t1VF9w u%9FvEPEPEPEt}tE8Ee[^_ÍvUÉUWVSEu }U@t t.t!0x&0xPH)H P[^_ÉUEM PB AB|AABRA8Q<1ÉUWVS} EpuFt&VF9wu9Fw yvEPEPEPu[]U C9s;t))V9sF(CC@PCPW:CV1e[^_ÐUSEM t&@At t8t)‰[ÐUS5uCS Уp[ÐUWVS}EtСX@ExUBRjj,_AEPh b_ShO h u5@5DwjVu U WVS1;=}Lt76h 1ۃ;^}FC;^|h  G;=|e[^_ÐU{5P=tPS(VURJE1M fy,E];Ct EuEsT}tSPhVjC1RPEP uGuBh\5P=tP}(VURtsEC%PMQQ;CtBhg@5rP=tP(VEPECtEuCu/Et&SU9UvUMЋELME9EsESC9snEt7)PhqCS)‰PjCCE%P4 MЋELM̋UЋD9sEt)EM9MsM E GU B,9VMQh"EeEEԃE tE4EjM A 1RPEPuu hv8U B04Vg!EVQEP 9t?h5P=tPhpUUuN7M1EE P09U}E8uE(G9|E1U fz0E]C}EsT}tPhj1RPMQ uDu?h5P=tPf(VEP`sEE%PUR=;CtLh,5^P=tP(VMQ; C$EU‰UE(GM A09Et8VUREE%P;}t}uhŌVMQE t4U BB 4fB*fB,j4REE%Pt;EE%ME܋U B%AAEE%A EE%A1e[^_ÐUÉUÍvUÐUUBXwv$0w pg(`>WHP^Gv@70' Rhj@hUjÉUU=pt d2GP _3CVEЃ3Cuvw}j-Eރj VEPvwjVEPwj VEPsj0EЃjxEC wjVEP;Uj%EЃ7jlEЃ%&e[^_UWVSE u]ߍt&1CȅuKPEЃ9we[^_ÍvU=\u( P "j"ÐU=ubE Pu/h Uhf4frdPd71É7888 8&8,82888>8B8H8L8P8T8X88\8b8f88888888888888o8s8w8{88888888888888888888888888888888999 99999 9$9(9,909@5  '7jj\jjVjjPjj JjjDjj >jj 8jj2jj ,j (jj"jjjjjjjjj j|jxjtjpjljhjdj`j\j Xj Tj Pj Lj HjDj@jt S.C~e[^ÐUE EPUju ÍvUS]{DtX{uHhsLsH CuCD=tC@붍CLK]UVSuVxÃVmÃV_ÃVQuF@É؍e[^ÍvU WVSu1ۍV;`t.tFt FFT~ƒV@CvVÃVǃ utF@&1ۃVCvt2V{ÃVpà rVZutVAtutV$tut1ۃVCv1~DtF@e[^_UVS] SuƃtfubjXÉtjjXjS!j@h(jS+ u5huCLtsHS),S ;tjXSVe[^ÉUVSuv Hv) t+S:hsLcjXSXV;e[^U WVSE EE<G@tut&u1t&G@t&EGEGT_G9vÅtS7w)_)_)_Gt.PwEPGD=t)GG)EE1GW GW}7GD+t&uGDuAhwLEPGuGD=GLjW+G@G+EPEPwPkCGPGEW ;GPt G@RW{W @uM_wW(_G wGjjjBGP @uDu \G+EPEPwPBGP)}Ee[^_ÉUWVS}Uv ) uRE URPW`4~Tt.RE URPW?u uFit&t t!@'2VU VUF;E udE 9Fv\jjjWu  VH7^LjXjV j@h(jV'^L~HV% F9EU ;VE U+FVÉe uvDžDžRPW1;u);u!+uwE U'vZt&[^_ÐU WVSE) 11w u [t&u,tS@ЉƃuCt S@ Љt5u1v=e[^_ÐU WVSE] uU) w u  :tLt%u!48)v48ZGW,RVSW@Ѝe[^_ÐUWVSE >tE}~E @FF EEPuVÃu ~Et8uEEF EtE;ܤ}?EVuЉÃtttEEE;ܤ|ͅuFV@ e[^_ÐU WVSE} u) w u tP{$EPWV48 Pj(AУu>E481u,URVWQ@Уu+u &e[^_ÐUVSMt']u FC8tSF)‰ Iu1[^ÐU WVS11QVh@ CKǃüF?hnÃhjSSVwjSe[^_U WVSE1H{~FPPhIDC PS' thQ#F1҃:C$uEEK | 1҉FK K1҉pC SǃüGu9}?h5ÃhjSSWjSe[^_ÍvUWVS1ۃSCt~1ۡEtt&CUUuCSE1ۋ Mt)1ҋu<E CEEuىUChjj#MQSje[^_ÐUVSpƁOhÃhjS;hS3CK CCCHCPCLdCTCXd jhXC(P fC$ jheC8PC\dfCh,fCjCxǃǃC WEVǃWEVC PIfǃǃdƃǃǃdƃfǃǃüe[^UUtt&9t u1ÉUShthƒCtEc1Ef}Ehsss ssCtQPREPh@0u]ÉUu7u1ÍvU WVS1hƋt&;}nCuhVjEPSjC t KIhVs1C9t":}Bu B9Cu9uދue[^_ÐU WVS]h1=ht9r tW9srzuu? lwSDl= vSQhAAe[^_UUhBhÐUU131҄tUWVSu EPU3ـ?UM߉VN~ u.EUBVE%HNtE@t tw {t&}}gEv ];uQAUȉU3Eu'f=UuɁee MN FFuF1e[^_ÉU;:tP C;:uj T&< vhO;VpC<vh`WE;t  t&U }w"U$t &}PÉC ֋M ΁% ʁCt"C PSItXC$ CEX1e[^_UM=t#9tt&Bu:t9uBUMu1-p=ptp9t:t9uBÍvUVSMUu] tuSRQu t Pee[^ÉUE@1ÍvU1ÐZX)ĉqqqP␐U WVS}E M1;})EPWFЉƒuw1C;|uwЍe[^_ÐUEU tcBdB0} h &fBdB$0BaBUE tm t( t>t tZujjj  jttOHtGj jtPtШu$PHtP3tÍvUSà u  ut S,؋]ÐU XQ% RAܗPhjhÉU WVSEPEp;u@ vN| DBBЉ;urmWEVu WEVt u81fwV=t̘e19vЍe[^_ÐU1ɋU9s vf3 9rÐUSM] ȋUJt@s[ÐUVSU] Mփr CBu[^ÐU,WVS1] E1ɋ9tFAvEuD11Ґt&}:Av11Ґ;tF:Av[^_ÉUWVShE1EE PAMS}5‹5u"=PAMSuEExu@EuE}u12Ĵ% ȴ̴дԴ5u5Դش% GG Gur1wuwSCtG _w GGuh~@@DG wG=/=vGPh< PhAGwHu? w- @1ۋWGW 9w u9wȉ @Gw u?vGW  D@:uЈ8t F t&HPhLPe[^_U WVSE1uÃ{tS1&CS  P3sPh` {uCS  ǃ{u5D5@hWhe[^_ÍvU,WVSWEUGW EUUщȉ+EUHu=w?E EEEU+EU#u=w@)PGPWP0E;]Lu;MwEU UUU9U9Eu*U9Uv"EUWEU+EUUщ9]u?9Mv:E EEE9E&9UuE9Ew+M]O_ UUUU9U9Eu]U9UvUE É9uuD9]v?,)PWGPR_wEU)GW EU+EUGW O1e[^_ÐUWVSEEx]vUz3 ZЉΉpx UUU;]'u;Mw U UU9}9uUUU;]u=;Mv8U UU;]'u;Mw EUMQ)׋Epx UUU9}9u9uw2U UU9}u9uvEU)ڋuFV ft&E Ɖ9u@9vuURUMIMEEURUN0M~4UEEEv $~u)} MUEBUvڋMEB))9EmE;F jjjFUB8Mt  t&E1} MUEBUvڋEUЋUeEFUB8E1t&~ u-EMAUQEUQMN0~4! jjjFUB8}  ~t5m)8} MMEEvۋEFmOEtr t(t/=5t&V t&UB mt&m)σw&}6 MMEEvۋUҋE59V8E1^8o;]v];]v]SURMQ)]])]])^8t&}MUEBU vڋEFXmUJN\mUVTm=F`I}MUEBUvڋF`UfTFhF`mFT9F`rEfDFhF`F`v捆(FdFDFLPFLPFdPjFhPj E܃ tIMA t&E@ TUB ?F` ^LH#EVDUЋ6v}MMEEH#EMЋ9wfwVUm }MEEEE9rm)ϋF`f\0hF``fujUm!}FMMEEE9rm)ϋF`LFfEXmvfuZUm!}MMEEE9rm)1ɋEXmdt&Um'&}vMMEEE9rm)1ɋEX mV`F\FX9rF`fL0hF`sF\FX9F`>>(FdFDFL EPFLP^dSvXFhPj E܃ DFdFHFPMQFPPSv\FXDhPj E܃  ^LH#EVDUЋ3}DMMEEH#EMЋ9wtlugU"}MUEBUUEE H#E‹FD9wm)߉m)ωF8u  t @tUB V@ V@tC9s)}/MMEE9rܐt&N@H#EF8m) ^PH#EVHUЋ9}MMEEH#EMЋ9wufU!}MUEBUUEE H#E‹FH9wm)߉m)@N<V@ V@tH9s(t&}MMEE9r܋N@H#EFw9EM;At.&URMQltE@)EUR)UEMAQ UQQV~ttRA)PvQFMA8F4~t@>u耋UB4}u}t} u }uEE܍e[^_US]tC$tS,u+@,t Ps0҃s$s0C,C$1]ÐU WVSu}t ^$t;t&jjjrWU RPd ;Ct kt&vVt FC 9vPE +C Ps,C C$WE PC C,)P{$C 1e[^_ÉUWVS}u ]151v =t uB<1t 1)ЉA9sv‰[^_U WVS}t Ex$u Exu4w&?tRG4g0)ȉG41҃vG0D*Bo0G4G4wG`REPG`P Ep0G`P‹E)PPP `u0XpPEX@ p@1e[^_ÉUEtP$u t&1:u z4ÐUWVSu }ttF$Et F(t~,ut&hjv0ЉÃu EUz,t>jJPv0F(ЉEuSv0F,и}ߋuUBD)$(CDBH)$(CHBd)$(Cd}tJPr,MQEC,UZ$1e[^_ÐU WVSEu }ɉw)׃FFFFFFFFF F F F F FF˃rt FJuU +UU)ѡU +UU)Ӆ ˉ[^_ÐUWVS1UfzGvEE9EsMu NfBAM}9rEEEf}uMt EUf> OpenBSD/i386 %s %s%s /etc/boot.conf%s:%sboot> booting %s: failed(%d). will try %s Turning timeout off.  $  x4 ڇ և`чH ̇ timesttysetrebootmachinelshelpenvechoboot#open(%s): %s non-secure %s, will not proceed %s: %s %s: line too long %s: syntax error %scommands:machine:%s %s speed is %d %s not a console device /.stat(%s): %s opendir(%s): %s -fc-d-b---l-s-w-sSx-tT %u,%u %lu %s %s:%sRebooting... o<i$b^|XP timeoutimagettydevicehowtoaddr%d %s %s %p %s not a console device switching console to %s %s console not present howto: bad option: %c boot: illegal argument %s empty %s=%s 2.06diskprobingBIOStkd,memorydiskinfobootmachine boot {fd,hd}<0123>[abcd] Where [0123] is the disk number, and [abcd] is the partition. Booting from %s [%x,%d] [%x] Invalid device! bad language bad OP pciSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%s %s %d %d:%d:%d %d entry point at 0x%x %s: open %s: %s read headerELF%s=0x%lx lseek phdrread program headers+%s%lulseek textread text+%lulseek section headersread section headers [%s%ldlseek symbolsread symbols]bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %d00000w000000000000000000000000000000000000000000000000000000000000000000000000000000H0P0W0`0g0p023P33333333w2333333"3333330123456789abcdef|/-\ exit}yrolifc`gsfsesdssscseflagseipediesiebpespebxedxecxeaxijȳ̳гԳسܳyh]RB-ڑ͑k_H4reserved fault basemachine check ([P]Pro)stack faultsegment not present faultinvalid tss faultfp coprocessor operand fetch fault (![P]Pro)double faultdevice not available faultbounds check faultoverflow trapnon-maskable interruptinteger divide faultalignment faultpage faulttrace trapprotection faultasynchronous system traparithmetic trapbreakpoint trapinvalid opcode fault trap: %u(%x): %s cn_tab=%p %s %x%cCode dumpMemory dumpStack trace %s [%p]:%s%x%c1.2.1 fd%u+ hd%u%s* cd0ATAPI CD-ROMfictitiousDisk BIOS# Type Cyls Heads Secs Flags Checksum *none*label%cd%d 0x%x %s %d %d %d 0x%x 0x%x heap full (0x%lx+%u)failed to read disklabelbad MBR signature no BSD partition Unknown device: Bad unit number Bad partition id U0U7U0UU0U U0U0U0U0U0U0U0U0U0U0UUinvalid function/parameteraddress mark not foundwrite-protectedsector not foundreset faileddisk changeddrive parameter activity failedDMA overrun data boundary error bad sector detected bad track detected invalid mediacontrol data address mark detectedDMA arbitration level out of rangeuncorrectable CRC or ECC error on read controller failure1no media in drive2incorrect drive type in CMOS@seek failedoperation timed outdrive not readyvolume not locked in drivevolume locked in drivevolume not removablevolume in uselock count exceededvalid eject request failedundefined errorwrite faultstatus register errorsense operation failed  \ \  ^ _12wdfdwtsdstcdmcdscdhdcncompc %s%d pc%d com%dcom%d: changing speed to %d baud in 5 seconds, change your terminal to match!  com%d: %d baud ;Zx0Nmno disk labeldisk label corruptedUUUU mem[ No Extended memory detected.%uM %uK nff!a20=o%s] Region %ld: type %u at 0x%x for %uKB Low ram: %dKB High ram: %dKB Total free memory: %uKB apm: connect error apm`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N a  cn}of!NI s n ' " _afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3dLGhc" 8 3 r _ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmspfa#A< k f #  O J _ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"NI  i d   nobody*Unprivileged user/nonexistent/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/csh2_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/csh3proxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T _Z ? : k 5 k _dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin vm,%KB k f  u p / * Q Q _mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/csh1root\Vpk-( Z U    z + & _tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplg&!72 G B _rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd . install.md set_term() { [[ -n $TERM ]] && return ask "Terminal type?" ${MDTERM:-vt220} TERM=$resp export TERM md_set_term } welcome() { local _q cat << __EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD in a simple and rational way. At any prompt except password prompts you can run a shell command by typing '!foo', or escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C and then RETURN, but quitting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat << __EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat << __EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat << __EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat << __EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat << __EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it..." } get_dkdevs() { bsort `sed -ne "${MDDISKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}" /var/run/dmesg.boot` } get_cddevs() { bsort `sed -ne "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}" /var/run/dmesg.boot` } get_ifdevs() { ifconfig -a \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_serialdev() { local _devs _d _bd _td [[ -n $MDSERIAL ]] || exit set -- $MDSERIAL _d=$1 _bd=$2 _td=$3 _devs=$(sed -ne "/^${_d}\([0-9]\) .*/s//\1/p" /var/run/dmesg.boot) _devs=$(bsort $_devs) set -- $_devs echo "${_bd}${1} ${_td}${1}" } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while : ; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while : ; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _devs=$3 _defdev=$4 _err=$5 set -- $_devs if [[ $# -lt 1 ]]; then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_defdev:=$1} _devs="$*" while : ; do ask "Available ${_name}s are: ${_devs}.\nWhich one ${_query}? (or 'done')" "$_defdev" [[ $resp == done ]] && break if isin "$resp" $_devs; then makedev $resp && break else echo "'$resp' is not a valid choice." fi done } isin() { local _a=$1 _b shift for _b; do [ "$_a" = "$_b" ] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [ "$_a" != "$_b" ] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file > /tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >> /tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" << __EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 _node=/dev/r${1}c if isin $_dev $IFDEVS || [[ -c $_node || -z ${_dev##+([0-9])} ]] ; then return 0 fi if [[ ! -r /dev/MAKEDEV ]] ; then echo "No /dev/MAKEDEV. Can't create device nodes for ${_dev}." return 1 fi (cd /dev; sh MAKEDEV $_dev) [[ -c $_node ]] || return 1 DEVSMADE=`addel $_dev $DEVSMADE` } addhostent() { sed "/ $2\$/d" /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$1 $2" >> /tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action while : ; do _action= cat << __EOT The following sets are available. Enter a filename, 'all' to select all the sets, or 'done'. You may de-select a set by prepending a '-' to its name. __EOT _next= for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "\nFile name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while : ; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat << __EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat << __EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.* /etc/dhclient.conf if [[ -n $_hostname ]]; then echo "send host-name \"$_hostname\";" >> /etc/dhclient.conf echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >> /etc/dhclient.conf << __EOT request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT cat >> /etc/resolv.conf.tail << __EOT lookup file bind __EOT dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && $2 == "0.0.0.0" ]]; then ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 fi mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt set -- $(v4_info $_ifs) if [[ -n $2 ]]; then ifconfig $_ifs inet $2 delete [[ $2 != "0.0.0.0" ]] && { _addr=$2; _mask=$3; } fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" > $_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" > $_hn fi ;; esac } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while : ; do ask_until "$_prompt" "$_dr" case $resp in none|dhcp) break ;; esac route delete -inet default > /dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } isalphanumeric() { local _n=$1 while [[ ${#_n} -ne 0 ]]; do case $_n in [A-Za-z0-9]*) ;; *) return 1;; esac _n=${_n#?} done return 0 } enable_network() { local _netfile for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} if ! isalphanumeric "$if"; then continue fi ifconfig $if > /dev/null 2>&1 if [ $? -ne 0 ]; then continue fi while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|""|"rtsol") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= ifconfig $if $name $mask $bcaddr $ext1 $ext2 down cmd="dhclient $if" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) continue ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $(< /mnt/etc/mygate) fi route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat << __EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" "${_get_server_list:-yes}" _get_server_list=$resp if [[ $_get_server_list == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while : ; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp _passwd=root@`hostname` if [[ $_ftp_server_login != anonymous ]]; then resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _mp=$1 _dir=$2 while : ; do ask_until "Pathname to the sets? (or 'done')" "$_dir" case $resp in done) return ;; *) [[ -d $_mp/$resp ]] && { _dir=$_mp/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." ;; esac done install_files "file://$_dir" "`ls -l $_dir`" } install_cdrom() { local _drive _part _fstype _directory _n ask_which "CD-ROM" "contains the ${MODE} media" "$CDDEVS" [[ $resp == done ]] && return _drive=$resp _n=0 until disklabel $_drive >/tmp/label.$_drive 2>&1; do if egrep -q '(Input/output error)|(sector size 0)' /tmp/label.$_drive; then _n=$(( $_n + 1 )) if [ _n -le 5 ]; then echo "I/O error accessing $_drive; retrying" sleep 10 else echo "Cannot access $_drive." return fi else break fi done echo if grep -q '^ *c: .*ISO9660' /tmp/label.$_drive; then _fstype=cd9660 _part=c else resp= while [ -z "$resp" ] ; do ask "CD-ROM partition to mount? (normally 'c')" c case $resp in [a-p]) _part=$resp ;; *) echo "Invalid response: $resp" resp= ;; esac done cat << __EOT Two CD-ROM filesystem types are currently supported by this program: cd9660 ISO-9660 ffs Berkeley Fast Filesystem __EOT resp= while [ -z "$resp" ] ; do ask "Which filesystem type?" cd9660 case $resp in cd9660|ffs) _fstype=$resp ;; *) echo "Invalid response: '$resp'" resp= ;; esac done fi rm -f /tmp/label.$_drive if ! mount -t ${_fstype} -o ro /dev/${_drive}${_part} /mnt2 ; then echo "Cannot mount CD-ROM drive." return fi install_mounted_fs /mnt2 "$SETDIR" umount -f /mnt2 > /dev/null 2>&1 } mount_a_disk() { local _drive _def_partition _partition_range _partition local _fstype _fsopts ask_which "disk" "contains the ${MODE} sets" "$DKDEVS" [[ $resp == done ]] && return 1 _drive=$resp cat << __EOT The following partitions have been found on $_drive: __EOT disklabel $_drive 2>/dev/null | grep '^ .:' echo _likely_partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/swap/s/.*//' -e '/unused/s/.*//' \ -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _def_partition=`echo $_likely_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then _def_partition=`echo $_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then echo "There are no usable partitions on that disk" return 1 fi fi resp= while [ -z "$resp" ]; do ask "Partition?" "$_def_partition" case $resp in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp= ;; esac done cat << __EOT The following filesystem types are supported: default (deduced from the disklabel) ffs $MDFSTYPE __EOT resp= while [ -z "$resp" ]; do ask "Which filesystem type?" default case $resp in default) ;; ffs) _fstype="-t ffs" _fsopts=async ;; $MDFSTYPE) _fstype="-t $resp" _fsopts=$MDFSOPTS ;; *) echo "Invalid response: $resp" resp= ;; esac done if ! mount $_fstype -o ro,$_fsopts /dev/${_drive}${_partition} /mnt2; then echo "Cannot mount disk." return 1 fi return 0 } install_disk() { if mount_a_disk; then install_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 fi } install_nfs() { if [ ! -f /sbin/mount_nfs ]; then echo "/sbin/mount_nfs not found. Cannot mount NFS filesystems." return fi ask_until "Server IP address or hostname?" "$_nfs_server_ip" _nfs_server_ip=$resp ask_until "Filesystem on server to mount?" "$_nfs_server_path" _nfs_server_path=$resp _nfs_tcp= ask_yn "Use TCP transport? (only works with capable NFS server)" [[ $resp == y ]] && _nfs_tcp=-T if ! mount_nfs $_nfs_tcp -o ro ${_nfs_server_ip}:${_nfs_server_path} /mnt2 ; then echo "Cannot mount NFS server." return fi install_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _xcmd cat << __EOT The installation program needs to know which tape device to use. Make sure you use a "no rewind on close" device. __EOT ask_until "Name of tape device?" "${TAPE##*/}" TAPE=/dev/${resp##*/} if [ ! -c $TAPE ]; then echo "$TAPE does not exist or is not a character special file." return fi export TAPE echo -n "Rewinding ${TAPE} (mt rewind)..." if ! mt rewind ; then echo "FAILED." return fi echo "done." resp= while [ -z "$resp" ]; do ask "File number?" case $resp in [1-9]*) _nskip=$(( $resp - 1 )) ;; *) echo "Invalid file number ${resp}." resp= ;; esac done if [ $_nskip -ne 0 ]; then echo -n "Skipping to source file (mt fsf ${_nskip})..." if ! mt fsf $_nskip ; then echo "FAILED. Could not skip $_nskip files." return fi echo "done." fi cat << __EOT There are 2 different ways the file can be stored on tape: 1) an image of a gzipped tar file 2) a standard tar image __EOT resp= while [ -z "$resp" ]; do ask "Which way is it?" 1 case $resp in 1) _xcmd="tar zxvphf -" ;; 2) _xcmd="tar xvphf -" ;; *) echo "Invalid response: $resp." resp= ;; esac ( cd /mnt; dd if=$TAPE | $_xcmd ) done echo "Extraction complete." } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while : ; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _insane if [[ ! -s /mnt/bsd ]]; then _insane=y DEFAULTSETS=$(addel bsd $DEFAULTSETS) cat << __EOT +*** 'bsd' must be (re)installed: no kernel found. __EOT fi if [[ ! -d /mnt/sbin || ! -d /mnt/dev ]]; then _insane=y DEFAULTSETS=$(addel base${VERSION}.tgz $DEFAULTSETS) cat << __EOT +*** 'base${VERSION}.tgz' must be (re)installed: /sbin or /dev is missing. __EOT fi if [[ ! -s /mnt/etc/rc ]]; then _insane=y DEFAULTSETS=$(addel etc${VERSION}.tgz $DEFAULTSETS) cat << __EOT +*** 'etc${VERSION}.tgz' must be (re)installed: /etc/rc is missing. __EOT fi [[ -n $_insane ]] && return 1 return 0 } install_sets() { local _d cat << __EOT You will now specify the location and names of the ${MODE} sets you want to load. You will be able to repeat this step until all of your sets have been successfully loaded. If you are not sure what sets to ${MODE}, refer to the installation notes for details on the contents of each. __EOT while : ; do _d= cat << __EOT Sets can be located on a (m)ounted filesystem; a (c)drom, (d)isk or (t)ape device; or a (f)tp, (n)fs or (h)ttp server. __EOT [[ -z $DEFAULTSETS ]] && _d=done ask "Where are the $MODE sets? (or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) install_cdrom ;; d*|D*) install_disk ;; f*|F*) install_url ftp ;; h*|H*) install_url http ;; m*|M*) install_mounted_fs /mnt ;; n*|N*) install_nfs ;; t*|T*) install_tape ;; *) ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done < /tmp/fstab > /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat << __EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the ${MODE}. __EOT exit fi done < /etc/fstab } check_fs() { local _dev _mp _fstype _rest _fail echo "Checking non-root filesystems..." while read _dev _mp _fstype _rest; do [ "$_dev" != /dev/"$ROOTDEV" ] || continue [ -f "/sbin/fsck_$_fstype" ] || continue _rest=${_dev#/dev/} makedev ${_rest%[a-p]} || continue echo -n "fsck -p ${_dev}..." if ! fsck -fp ${_dev} > /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done < /etc/fstab echo "...done." [ "$_fail" ] && exit } get_fqdn() { local _dn _dn=$(hostname) _dn=${_dn#$(hostname -s)} _dn=${_dn#.} echo "${_dn:=my.domain}" } donetconfig() { local _dn _ns configure_ifs if [ -f /tmp/resolv.conf.shadow ]; then mv /tmp/resolv.conf.shadow /tmp/resolv.conf _ns=$(sed -ne '/^nameserver /s///p' /tmp/resolv.conf) _dn=$(sed -n \ -e '/^domain[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '/^search[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '${g;p;}' /tmp/resolv.conf) fi ask "DNS domain name? (e.g. 'bar.com')" "${_dn:=$(get_fqdn)}" hostname "$(hostname -s).$resp" ask "DNS nameserver? (IP address or 'none')" "${_ns:=none}" if [[ $resp != none ]]; then echo "lookup file bind" > /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >> /tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _bd _td ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ > /mnt/etc/rc.conf.local fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" yes if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf > /tmp/sysctl.conf fi fi [[ -z $SERIALDEV ]] && return set -- $SERIALDEV _bd=$1 _td=$2 ask_yn "Change the default console to $_bd?" [[ $resp == n ]] && return ask_which "speed" "should $_bd use" "9600 19200 38400 57600 115200" [[ $resp == done ]] && return echo "set tty $_bd\nstty $_bd $resp" >>/mnt/etc/boot.conf sed -e "/^${_td}/s/std.9600/std.${resp}/" \ -e "/^${_td}/s/unknown/vt220 /" \ -e "/${_td}/s/off/on secure/" /mnt/etc/ttys >/tmp/ttys } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /var/run/dmesg.boot DKDEVS=$(get_dkdevs) CDDEVS=$(get_cddevs) IFDEVS=$(get_ifdevs) SERIALDEV=$(get_serialdev) DEVSMADE= THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done if [ -z "$EDITOR" ] ; then EDITOR=ed [ -x /usr/b0123456789abcdefS) d le И S|L S,0XxРا<S(l!q! p!(w!x!S:k q! p!(w!x!f ܓ S<X S+!S,Z S)@q!(w!x!S@q!(w!x!Sg\ q!(w!x!S(l!q!(w!x!l!0@SаS@XC C @2X Xd$`@SDS S$S(S,S0STSPS!;!8!5!2!/!,!)!&!#! !!!!!!! !!!!!!!!!\!d!o!u!in_cksum: out of data by %u i386i386ʏ`Y*X!PZ**1*1и*1*1+1+1*1+1ZWNY1>Y1.Y1Y1Y1X1X1X1X1вX1ФX1БX1yX1lX1TX1BX1(X1X1X1X1""#"!" " ]10'"t'"!" "]1*"D*"!" "]1 -"d-"!" "^1 0"x0"!" "_12"h3"!" "P_1`;";"!" "_1>"L>"!" "`1?"@"!" "&a1 C"TC"!" "xa1D"$E"!" "a1 H"dH"!" "`b1@K"xK"!" "c1M"M"!" "`c1O"$P"!" "c1Z"DZ"!" " d1]"L^"!" "d1@f"tf"!" "f10k"k"!" "g1o"Do"!" "g1q"r"!" " h1j1j1иj1Ьj1Нj1Ѝj1~j1nj1bj1Tj1Gj17j1+j1j1 j1j1<"""Џ""`n10h "H"""Ԛ"@x1X"""Ќ"""""`y1"Ш"","T""1x"H"@11@%#T%#*#D,#\6#7#7#d5#@5#`1K#L#O#N#O#1P#@11Т1В1{1n1`1G1411ߛ1В1{1n1`1G1˛10(t#4t#10u#6,660l*0l*Рz*z*0l*0l*0l*0l*t{*0l*0l*0l*0l*0l*0l*0l*{*0l*0l*0l*0l*0l*0l*0l*\s*{*0l*0l* u* ~*|w*L~*Фs*}*0l*0l*tu*}*x*}*Є*{*0l*0l*Є*Д~*М*0*М*0*0l*0l*М*0**0*s*t*0l*\{*u*T*Єx*{*4t*P*Ф*0l*Dv*l*y*0l*|t*Ќ*0l*0l*Ьv*0l*Ќy*0l*t*Ф*0l*0l*w*0l*z*0l***0l*0l*L**0l*0l*(**p*l*,*D*D*\*,*X*t*P* *Ь*p*8*yrV{=Pk5eGmUv9aWvH f0/h+ʷV)>Hⷾ'"=o;v(D c xUN8Θ˷"㦍0y#|ٔ/EC k^&UVr dmVeM- S Kf.w/RvTqp'{CIxT4:]b )UJ!az4ju v\}jBDugf=P? zڪ-1]Y+2Bc`<VbZy jBDo i%8?N,a72*0|:E)+WLfCŌKx\);5h!5h!5h! yr@@***** *8*0l*`*Ѐ*`*Ѐ*6%K6`+А+0 +< +9+t9+9+`6[+b+^+h_+Ј_+(`+|a+H`+P`+Ј`+а`+8a+Т6М6Ж6А6Њ6Є6~6x6r6l6f6`6Z6T6N6H6B6<66606д6а6Ь6Ш6ܙ6ؙ6ԙ6Й6̙6ș6ę66м6и66z+{+4~+,~+d2d+а+Ш+Є+ȉ+d+++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>??  ` ~ ^ "' AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy\++Ќ+D+а+ȩ+@+\+6++6$lP@ 6TP` 6 #P(߶6 *P(ֶ6 *PPж6 #PPȶ6 *P(6$HTP65tM6 +D+6+p+Ш+0+T+6d+@++И+6ph++@+l+@68606(6 666666666+l++T++Ь+h!!!\!!!\!|!д!!М!!ФH,,'6@HPX`bdhjlnprtuv8%,%,8&,&,`',l',(,(,6``),l),pC,|C,0pE,иE,@6`6dU,V,_,Ѐ_, k_`,м`,66H`a, b,P`,Ѐ,6l,ܝ,@6,(,и, ,Ф,D,6|6h6T6F686,6 66 !"#$%()*+,-012345 @  0,,,Д, ,,0,\,И,L,,,,H,4,,,Д, ,,0,\,И,L,,,,H,   @00  6p,,,c0' c'c055$s ?/ 5*T +T5+T,T=*T +T=+T,T(`,T,T(@-T-TВP .TР.TВU .TР.TВ .TР.T666/TЀ/TЬ- -Ѐ#-#-b5= V@t@(@%-$&-l+-+-Xp0-0-//W 7Р 7p2-3-Ќ5-D3-h<- =-A-A- 7-777777Р7ARC@C-PC-8E-ФE-((Wl 7pH-ФH-M-PN-$s-t-pv- w-7Dw-x-}-}- `-И-ع-|-\3T777777- -`$7<- -Ь..  % 3u Du u <u 8u 2u 0&'u 1&u 0&u  @(7`)747*?7A7E7# # @I72^7b70w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-{{@e7 h7...Ф.p. ..D..(..|.:k7.symtab.strtab.shstrtab.text.rodata.data.bss   ! / d )`r7`r' /@:T@:D03 @:D4;D TLFa  /`r7@:Tj_$7$z1I(=AXZL6Wy),dWqLe|Wr.-j&b8:" !В |*F9(;( 0p.ЂD,%Y8n"$гu+7<VT,к'x# "HЇRXP+~)ЅS% *,^7X)DDFWd"d:Jp,o~IГ\+ЫHkЧ`1T77y98#QjЇ!T,6hJ.ПID-XAcTn|r7|x8H!W|.T4SD\|PЬT7R$pU!P(7/4е:oYN.'].ДqD.Ю|p$г0Z@- ` mK2<&,_! LY V%ܵ.W; TGSPaYG"Bf[*]pL>"}|ЬUW#ПYX}:)q4T-( $(%% X6 c0d@/VPAM[mBIl-TSlPP&T /p`g(^'*86-7$<д 0Р*!У77N-\3l/s-P C,NеqaLa.U*w@dK,0OЋl7XT^3 H7оC >.75$CEh%4U/7l\}+5{d7 ta({4u*g|#(*;,%T' 4;+В T0 t.Y? }'R X Й^ ^-f @So Wa \K, +й p'+ 7 Ѐ 8A- 4"C @7\ 7 ?н (&Л ,Q 0Ю. %V7 Q#xA V$N 2VZ hH`l 2V} 2V P 7  `+T  "9 p*| L| ,o D-s @F  ?> $7$ X 6 ЁM (!Z 7d +бo `Gy X! LT  |/ C!* S 8U {}  !X sn  7$ U- ,ЀA L5+ЪR "Пa ('j , { (8 ԡ1H 8( 7 0 W LV k_ h2&B , W Э\2 8= (t# K 8b 7To dMz -] ,h M,7 A" 8 ") а I,# +d7 #%4?!/Y6(y%I8x\*Vfp'(?tdS0{6VЀ|*F#!4`UN7 $`%q7j7Z\)l$h(3 &)G<4!^U`Aa̤@k`Us'<`dxhH)#й/(5VPC З |}l',u/wE 2 VBf`.woЌ`0UЀ3(Dy7lؽ$TvmD),p*3 ")LJ"6JTG *kSI,'^ Tu|> Ж@7$ "Ttu*gt(X4NУpH-4LXG ,VL7p,,X>$ xz"T)v8lбDpw N$)Ytc \o0*w6VSTUI=(->(Аj,a+*0 @V+йA"Pb7$Zhf87]!ubt{(>%C@(WD{@Ѝ^4О T$UW&!-h T89t&Mh~:[йkq"+n`?f|WD&P#w-`-$Ў`U`9T '8&u27XHДZ-|g 6Wа}\Я E,> BXht.p !{̷X$f.-p7.6m77?@-U#a4v \ L/77Р d.-DM.FL(.L--S@17;yHЌS`.la(.Њr-R,nd$)36X`C)Ј`~,@U ,IЏ,^$)2K;ԟ!O7Ш\x;]kq$,<).J!ВXb S`-tt&$$% W0$%dU0%)4>%d J%P.=T%87^%%cm% u% ,%4#?%GT%H3%̦#%H,к%+4% c%%V&d0&X.-"&7</&-9&'+H&x'!R&<#B_&>k&s&'-&9.w&#&xA#&,S&Xgq&l3T&$~,:&6 ')3'HS''C/'lУ:'8IC'Q'(9_'^k'P7'"`'xF'$Л'7'Y' {'lra'0(T''З($S(}!(pm,('ЭD( H"DO( _(4Tq(qz(,(B(а(hH(X(($T(Ĉ"(fC(TQ )T) V($)}!.),.Ѝ>)& M)D\$оY)p)7)VФ))).Ў),A)t-@)@\,) W)I0)Y@*6*Ћ *x4+*wB*x}Q*D&2n*]v*!*t+Њ*4-S*ȉ+К*VЬ*S*"a*+$Ш*|'+lЬ%+H+2+)З9+'*E+X#ЁT+`вf+/Вo+LU}+%+8x+1+|+7P +,*+,З+7+%+aB,]$,7',[,В0,7$A,-?U,V+i,#'u,3,0М,6p,Pif,,k,0-,Cw,%-%U-Й#-EE2-+WA-P&+S-!._-X.Ѐp-z-,Љ-x6-<&Г---|o-ĬT-"-h_-@Џ .!:.f.8%.|`5.@.ЀJ.F*X.'0i.2Vr.7.'.3X.S."i.U$.u7..0-G.0h$6/0 /6)!/xe-/-?D/`6Q/0V`/i/,*Sp/0j0/)/' /+/T/@S/lD/ a/40l 0<"(0+.+'0U40L"B0SQ0d"W_0P.ji05Vw0\!В0f0|$T0|(0.V0@$ 0UW070 71DЊ1D%&01/(*1Q*AB12J1\-d1T4 #t1l18F+Е1`1Ћ01<,1`+ 1T1a,R1HS1u71+V 2tdW2&T#2&T02 ((9C2DW!-S2uc2pDl2>#Г2!27g220.&2(p2(4 2(k2872 2:,Д3.Њ 3@H(>3D .3'63(.IC3`,LN3Wa30("k3+[x3S3 VЙ3@"Q37333f30)h3jT3@3XK4Ж4'484(1#oH4W^4x%Џi4d/n4,G4D%н44S4I.&4L'i4474i4+x 5!e5htГ,5X|858I3D5gR5\g]57j5uIx50-5$V5dS557$5Y*5P!"5GL5\'Н6TQ60/H6ȷ"6M(Б36\Bj@6гO6ia61+Vu6H]6-46,&6xT6T'K64"L6x36 6h8647إ 77(7X ,z<7L7h&]7fu77L(И7\%<7%707`7d77|_7#:8О8Di_8$<%8"48"ЄG8WV8Ya8=dr8H&H8d7808SP80V8:88$K8'8m* 9`xr9D3-З+9+;9UW0C9L-F[92Vc9tx9$u79`0,С9L&\959(,А9|c 929ܑ.E9,S9з985& ::n(:YЕ4:d7J:,X:H,'q:7x:D.6:,(:н:!T:#Т::d+S:8:@T:':, ;L7;<;*;,Q>B;\SL;_;*Ti;t;P{;*Ѓ;D;Х;|7;%V;3; %@;$A;<<7)<Ќ)"2<J%&B<7Q<p(Y<dP`<\Cl<PTt<<Gz<#<d<.&.<D*<rq<; <TW}=7=`*4)=9=XE=*O=)K_= n=r7w=,S=d-Ѕ==M$І=x"Њ=`=$=bW=dP)=y=о>8:>@,C$>'*3>6%F>3TW>~*М^>7l>4Qz>д><2>L >:>.Њ>5>>\Ы>4-B?@ ,?H !?L4??@4 T?!]\? 7b?`q?S{?#|?\?pQе?/(?S?#k?$E"? +?$*?@y@!@x'/@!@@?7H@-5W@D[b@; Ўp@%Wy@0"[@(7@.\@p@S@`@@.Љ@|#@A.s@/ABA$e"A@)7 /AЫ7AP,>GA,i(ШQA?$gA(+oxA9AA.}A\)AX8A ЫA7A)РAr7A .ВAG.Ё B\3TBp"І-BYW>BH8NBZBTБbBbWoB 'TzB0,B@"WB9(1B&gB BTКBTB0&{B@1<BDC-NC[е C#Љ.C /#7C(J@CyKCЪVChI_C0+аlChЀtC.ZC>CBC p!CG$Cb7C!JCtЧC+д Do*QDg+Ж 2D<2.WAD|ЛHD'TTDQЀeD,O-|D 'E9ЙEfЕE'EEiFtмFT!FЃ +Fj>FGFy7QFP-VXF*mFq!yFt4FЕFSF&{F!ЂF8wГF0-ХF8+'FЍ)F'еG GPG|?!Gd#O4GdW JGG([ZG;hG J.FwGx7G*V GHlG$&IG|!5G"gG@G<G@3TG -$G - HVЏH7H,-HdT*CH܂cMHPU5\H&zbH$7jHwsHmRHПHHQ&,Hpr7HXHL (H Hq7ЄHII T%It!6I0IBI0e`In.ЩqI%dI0s#YID+cIıI bIHI$ I8ЦI,GI/VI@ V( J`)AJ9#2JȀCJ+LKJ̥0VJIhJ"]zJtМJ7J{JȢ1TJbWJ*>J1Nl'>NB$1TNй`N"gN+qrNЀ~NpАN7$N,NN#лNT4ANUqNUWNENܤ)Ody1xO{":O23)O6=O.HO.7,XO7dO-6sOS}O<aO UO ,~OL:(?OhOL)!Os(RO2OX0PtSP  PxS7"PT71P+о[QЂdQ/7дtQ:ЀQo,Q Q Q@T+-Qx*QY#EQЖQ&GQyLR0 %RD,#%R0-R.7RR&PRtLcRoRTuRD,MRБRLR`6R#A R},R0.Rc!4RL8#WR7#NS. SLq7S<K%S@-У/S0 );S<.БMSL&еhS@!sS.ЅSМShSS%оSWSSАS\ S2TS&SJ!SSL.DT0TЮT0 G&T!T3TpЙ>T$VGT?OT 5T XT.cT.hT/sxTWTܱTT TTzmT0]TЀTؙ.zTܒ&T\6%pT+WT7UpU$h#Uaj7U&V>U.ЌJU,о`U@+$kUT"SxUm-UX,НU7UI{UU@UUTU8!U-cU5'+UKUH)$V%дVm.V5W@V7LV$uЏQV mЉ\VDVdVv)ZmV!.|V_,hV-gVDE+V(&\Vt!)VVVPЏV4($V$,W|b WXлW+W^E4WоBW`ШUW {W\WX>jW\JzWIdW8/БW.ЍWl7W)Wh/(WШWd7X )OX7&X,-\7X4 'АLXS*eX%nXTZxX +X!ЭX`T X74X$ЅXXXh%8X8UX,#>Y̓АYm.))YЮ=Ydr7AYX.иLYЇ"aSYd-bY2mY'+"}Y\7Y8QeYxEY?XY-SY\Y7Y#&Y7ZЁZ4Z0!?ZyQZdi<cZxlZ]$xZ@"Z@UZ jZq7%Zȩ+Z=<Z4N.лZL}Zd.ZȔ%WZ`% [ Е[([`-9['5E[ L[?$b[P&7q[U}[8[eк [I[%Ф[\D[`8[X У[ [<7 \X\Lc\b\"i-\?0>\Ȼ)oH\"AP\hCa\1{\S`\8$T\ؽ"f\*4\t!Ш\8Ѐ\\S`\й](S],<]72]<]\%E]R]бf]7u] .Д]!]q0]aD]U]*е]X1l]#Р]<^Y%h^;'^L(a4^8#;^8G^w*gN^7U^(7b^!q^Sw^(&!^T+^^D7^D&^!^p7^/p^DF)d_#Н_O"_(_ X=1_"eG_!BU_,Ц`_d]"Ѕm_$7_\a-_`_XЯ_<&_ЪИ_||.Ѐ_ YW _  _Gв`# `$T` O(`.7?`,лN`W$``Prm`DQ&9`4S`\^`d7$`@S`(:.t`P= Є` н`?`0'Ю aX)Ѝa|&$a0-aZ`d)пLdxOWd\!7cdod,бd!ГdTdR-&dt'd ЦdРdhdl,e,eP9"eXs1e(|qBeX*=Jeԍ%ВTeX _e$zje(3TqelT|eo*AeVeH.te4e`$}e?4e@'e.f=|!f̔I-fT--Bfq*[Rfxu"`fx0"ЉlfL,@vf$+Y~fNХfTfxr7fHOf\!fX=,wf8!ft7fTf /f7 gg"к"gл0gHm_Fg4b*Q[g (VbgDv*gig\"Л|gܰ-gBxg\{*g@K"7g7g9g ^g0"ЄgX`ЅgHpPgX$hW$h,+':h@%FIh@&TVhp)Bght'wh@YWhh 3uh3h7hCehs%h)!hMxh^(Іi$20"iL1<:i BiЯKi[(Vi$ZXfiȯ.zxiH*Ci'i+Лi\&diP.<i,i@Y'жiL%fiWida- jP! jL.j-(>jػ%ЍNj,%Ј^jЪljȸ%_zjkГjYj,j.Ej,Zj7 j?j.jЄ0j, k`;"Їk+&kC.D0k0;kЀFkȡ!<Rk^kTJLmkTSqki-!kL;Еk >'[k<kC"k7kx:k(k`,Tdk=l([>l4T"lPAo)l#о4l8All8Uly)cl9 plUwlJl&ЩllP*l6l}+Zll)_li#Ll4B,8m.'mpJ5 m70mj4Dm@SVm8nmxmqm#mh!mm$=m~m,i_m!Lm;0mC*mH)oml.Onx+E#nx 'H0n/;n*HnnISnZbnIпqnл{n-+Znv"unVnx0оn"n7$nn@- n&дnU+otzИo%\4o\!Do@C Yo56goL "sqo(,o,4o5Woo'ro<o8o@7$o@ pEНp[*8$p78pxj_FpV)^Xp!hp7upL Їp@2pl),мp,UpSp9p .plp p qCqCcq,К4qP)&>qоHqPq +"fqԈHwq(q &OqЅq)Tq,Gq)q9q<,Нq+rp*`r4:Trp0-N*rh-bBr0.&[Yr,ehr(asr &rLVr OrJ!rOre+еr9+r("sLQ(бsTWs2V%sHi_1s&{CsgVs5W_s*бhsHm.иssI!?s#нs ast %)s=#}sXsl+vsE&HsL,&8t*VtX]tgР/ttB7tf_@@t'ЅUt8S`t5vt@!tOth7t| t$"ЂtW1tSt`.Ћt\+tԣ9tc#Fu"!|u7u{Ж!u@U.u,t=u$c)CMu-К[uPm_nu08u|[u0e)tu-uЌuxquiUu@(4u$C)ЋuVud7v^.v\EVvP1vM;v!Kv%8Zv+1ivXg,}vT("v,Gv`Дv`vv(hv$0v8!кṿ@v7vwWw(#wX(w .=5wEHwTwЛcwp#qwЉwSwSw$!.w8&JwP=%w!wPVw`d$}w,Wx!Px`7!x0x;{UJ{ 1ЛT{`V`{.Дn{(Г{-'<{'І{l%Ё{$S0{О{d* {0S{h0{U`|t|( TP|7@'|^6|E D|7K| z^|@m|%Xy|pq#|v.|P-Ѓ|MБ|Li_|"|\S|lW-|\г|Ё }'T}0i_}г/}P79}8?B}pP}#&x\}<&j}Av}$"6}q}&}!}K7}8.}x|%Й}|1}&R~8~$T'~|9~="-E~ЕQ~P<,[~88Ѐq~<:|~}#)~x(~ ~-Л~.7~)~#Ц~ $,_*o'Ѓ8ĞV?jN=+Yh3"Wed-"q v~!Vr7\%?xjИ‚`X)ИԂܓ Ѝ,M |ZaN+lU6@)ЕB|Ze.7$ud!к5V>* V`nT+гŃ)΃Ћރ rT&%V (X| &3#Z37W=!JtdЙZxip.[u %,!u0UPx+?„Г΄Ћ4U.o#и47M"#7$1h'IA" HЏTsa4p,T\}(!&7|гȅ(fYՅ.Ц(+b t7 H!r|xI !Ю-X+WHUWQ*V\Ue<6{@%U!n0+,.ж+RD͆WPԆЁr7д(v@u '}-+z)8R Kl TQN"_,"*kЖx4{+@7v) Sp-Cч7377,ЅX " T.V:W+nO!^YЃhT9T p`M}d84Аx #E$*Ў*%~Ĉ7Ԉp'ۈ,[|Pp&̢@@WИL+о1j_= !J5WU7a@V-hP(r )&'#"Sɉ<7 ԉ$l)$\Ь\6Ѐ$E(}77N /S"$bТp`(+E477P"exCŠU͊7ՊD+DފV%th}"Q ^0 u7#$7>7H$-Л]r7k$Tsl,+ -V Ds\Ƌ7΋hbX+ <7xT+%H4&AE'РQ!TZB^b)ЛkPT,w;+Лj(" SL)(VpW$ƌ.ӌhW7$@J|7|*nx*Ё%Я2hc)OA !>NK,Z`Y*dflЋt|.к|1ОS$FjG*T-?ލ8.<C-6Р Mc'hOЊ<4t#UKЍYvХpxЧ@5,aj8[ФŎhИώt.е؎ep0 T+t 5T,<<У[l7(Ԑ? LSRV* dЫ0JtV'W%\!4MЏ=s.ЁGXUP]d,kT*'Н/*E)E,\xU*ЫّS6 <Й0A$!-075=DT0t+Иi'67'Б"  DqcЗƒ4,Ќ֒x.h@7$#^ I` #-8,ЩEDAW"+cso SvDGЧ<ri},:ɓP(^ӓ7ޓ#-b"E<P8Du95cН@9THX-EW*ЅgTq*}К0&Е|*y,t*G;?ٔ/4(N]$s Фr%@+2$'+D'гYTN$fWs@ /gi_ `3PЉ7#$J*{˕4:VՕ !Ѕ`1(V,0R7$ @T]3h.-P'КkKy<" @U-L(,z5%ШÖ$7ۖ>IX"?&V6FAGz'лZ3`jUz<Lxz,h TΗ>М֗-Riܥ10"d("6 \/I:7$K6 W@b/"lXv-sh 6SL-ЀDTDYWf_@ǘ2Vј0s)nߘȾ&c@W2 ,7 Y$00!Oa.p-ТCHжKTU$*\t[$$u# М,К@P`-Н`'9 %̙(7ޙxTț7":P>з)D,o<+Jz+/V{1eUmo.|wTЀ<7A*7@9''%d9Ú@=͚P)ܚTU$wdВ 'Ўz%а1#=N!dX-ff,^yܻ-K1\7@7ћXgb(w!,]0'T4$H0%L7,Y.5-%EH>!Sg )TsФ2.Еp+x"4&ЋϜhr7֜x-v|Л:КS#0,,6DZ"бCAQ4Ua-/lYvIT4S`Ђ<\<;<j͝TQ,]GlchbTE Pi_#d+02d'T=l7Db*NPk,kbTr`ЮgCk.24t*G Ϟ7֞6W4j*@%ЩL95HE!z,.[<\7H&8Y wb_,o7vH" ~D(bj_|! н*ТЇȟlܟ~-Б~5"EА !н75,!>ЃI)T_d7fL1:z70 D-жpv-Кp+#ɠȽ+ Р-нO#@6,Sa%4г1AhO^[5-WmXwt*~P&}Ќ"AJЫ,w30֣1.TZ+ЏW#":.}ʪTi_UЀm|-,'=8"dM RS[gmM*v)2V4i_.]"Zū@"ҫ$a߫ `Hп+C) ?$ !?-ZNDx_"S$6 _%r#3Hx)d&G`&ZDj!jɬ4 -V Vȕi $7&GЂ1 m_ DВYd+:hȀ!jq\"j!gq2h7WTҭLp'Щ߭@5#,7d!Џ &+/!+_+o&й6.FCXnЃ`#нtl & x *TQ&+Ů(J#Wٮ4.CQ&1 p #L.0(j Bty7TJ$'X#f7$uDk77-8LYW P7ů)ԯ@Q$9XSOPؖB-HX+-4U=L#ЕZl!dWtІz}$h*Ch,p|L'ЯlYБ=Q˰i߰x-*ПPB ST>;f07К"@+1M)Г:cHHЄR\"Y[l)ndt%nD+kTv,-nw 0$ 6± /(ʱ-\+%"}7ul(K|}#$'tW!Л8DБCDzQLJ$W$fUpX{<z7PHеi ""(ʲ@Њ۲9.GPShH..*4)h777N0x[]Ch,)|7$8иش+@5TWHO'pb@$2ȳq)x׳߳py0u.=}(%ZS4S&p!Фɾ0>dҾ'Ѓݾ44LкЙy hO)"l" 79$VC'L\'me7$vy2l4#\!Y-rXиƿlHԿبО߿hy=_дܞ  <&Ю0$Ы+R+`7'о@&T0Vc0ux=SH+I7hlЁ"Зb#з}}+Иe,б@'C+V.p 0Њ@-0!K*)"f/vЕ9lC7RH\}ШfPQ,m"Vy$7ua$&-FP.ЦvІH8.W>Ќ'X$'T !Ё4,7D;'O@vk_xW*.h,#5w3'\Ј0 FUO,hBa|7 /,Э`.l'-@Ckj_"7;JH/!,7@k0-F'|-:heWEwT7c,-дs<#l G.w-D&Y"+V|&І)Ћ Э HV>'hLЇ(@S,Љ9T@P-Tj__0Vj,7~дbЧ@Yx|Z82"x -"DBМ8,r|+\ "9vAp-$'"77TD.[ l*e7v@U#Д"ЩVl1+.Э<.(w%OnФ(7%`U0.8AЅ:NХG+^P"9W-Оh\K*5y++7-F|!ЄД!Уd +Pȳе 1TT4w2*,<POS`\(dPWm)t W@bpDCU<sа'4!fW/dj"оPNн @7!0] *U1\7HlPй`7j.0yhY!6>|+y8xFoPSPd3Tr*о7 A. T'z/{8=h^7 h%+gwB Ќ T,g 2HMа\- &xK"Ќh H*!H?+ ]@HLr7W*7`Th\Шrh'ЉzܺEPg<7؎)u`('4.X8,Иj_7R* e{ g_'x 4&?K8RlZ@Fh({UA9F0g UثG`#'t$7d{Ќpm_ T*Td+)@4SA<.ЮKT+[7$m,#!{_ tS7нDкػ2Ќ w- %l'С8x-L&T\(n@&y!/@T*"[$^7`0,%07&  e%-(<2Q8f.E %ЧM$V]f'o4w|p*^`mhTW4/-0?$\!Ў Sh+В)? |8w)7 РCMIL^)VH' _Ȍnk8SE~T7(*3]p#Щ`7,fH?6'dJ 9,Б'( U'С38'?T WM@7$b!n%X}!!7$"$X87x-О UW@ZЀ@V\1T*f)S:؞1`T8^ YpY.~SX)Й!А|-q"77>"аUST*.Y!Կ" 8vE-:VІbrX2 "б0zБd7).6&c: \xt!Ѕ717ж#2/C;G,ЧQ\t5.i6Ux `p.ЧE0.T*0GжX W)VH"}x7 0 W.P~8h FЃTp,Ў]ЀnHi~ 2EОYh` .-eW|`0y1h2S*pЇ7PFSPT7Z k97\x[*pa#ЧLYf,Цz'S` /p8V$Ѝ"J7,:+O*оS@ T į,Wp-ВQ1T_\!!iؽБ}!"Rг+)L,6((D7P /6).n@#37G-,tED!гZ.>d!EsUN.=(-ts*HB*Љ$#اмLP)H&p j`P<Г<-Н,)V3[B ="(D܈ЫO^g_@g4T{,9#l<7+:-А8 'TXk)U<S_i_&qМ0T`C7L.6W*a8"y.+Z$.*x#q)L!  #.Њ@!7@W6 @H 7|c-T1L#P+;Ĥ?J+V,yiL"ВtT*А|8Њ7}-p+`#1P K(1_ "8P8dkЗ1&Їg$ 1T7`oкG9&Г]TВggTn '&Ю#Щ.ЌP+,5V!;`S<(Pg74lZС'41":fВM'W"ej_s W, Vб@/Ѐr72,Т<})AH؛-Х ,g(003\-i>7J*ERS]D2Аu@~з.7ST*$7$,4TW$+К(!&0 7.l74!вDx"ЖR8]7 o7 ~*++Ё|>)Ў|3Ъ4[.P- *HiЗLYC!P)Л0 &V=#$ЧLLJT$>%gSrܠ1М7_q>bx-'{*6Ќ f!$!46L+OsFY@d7yU"U-Q)l%8x'Б cW7+VK*I,w%ЩE$-̛p>*O&cH7qX-,У@+#Z2T8%T$-Є*ЄT7%Ѕ`.9V*L-h7@M+1]L(5j"'qHS0/Е|.Аs#Л39X.DK|p`@(Ћ#,ld)T%LV20@-`Vi_aL'To IvU$H!2P.Vh?UЄ@ /8V3-H$ Ь, ;|ux,z9U-G2OE7 Y$T*n!w`.$|c-eh&$k'а67ЀD $+S 7]$ g1"t(Z9? QА.Ї'l=,_-T' \"T--}к9EĻS\GК`-iT8z&FjL-U=:,9.$Жx7+ ;$T( x4С+5Ѓ9pH)Q*иZ?n .<|,7TT(W(,,8%@L**J3VxT$%`U<е T-I.x5 rA0"2UC`P7f`,+pT%I}$:47 $ "1,@:+#$3s U  Kn<r/,H?(O+ДWWcsr0rcz7p2-,qCTP! ГBa7dH h{аԪW.HK9}"КF@,дT(г^ 3$Жml$yTUE,8V,u7`E,xpj,6hBО2T V*Q@E)й$R}1T9(u7B"\L5[TeWf $Ms Ty,m{1ܺ*2  V,л@d+п>`|o$.ж0*@, 'P$T/li_HD1T\0Jh%3sؾI"'3И),*E>  Џ~5 `?.#RI7@Y\Аf7zT#'2VPi9TО,,XpVS,ОW-d `&`7+76\+FQ%XX+8e7`{h @/$ЁK,8+F"Gd&00,}/(%}$t з3ЮAx&ЭLdsTgaX.pM|7S, /*.gPj*OS.и(Ы"Z+ .g % &J2 ? ̲)U $M^ *Јf :p -Q c)g %О 2, &, %T   {  . 0=,( |.в -j  B*T" 8,+ (&#5 l%$HH TV p Уf Tnp lz + 0Ѕ   d+j g.# R! X & l70 u#V -S 7) f'88 2ЍE 7Z .c 8+w  #< . \'k 8+Ѕ ,З %  о D Hi +А !д 7$.  7; ; G u7O  T` o )Ьx @K, 7  i) O eW  p>& lO r7 lv)V \& О ! JG t-5 V#= H | ДZ p{$h -s 8+;  +V xl +Д )V n{ + !] `" H  @ OвЉ)|,s>%VFp(NHU#ЊUlK<``lp7dv$T~KЙ8^7zЍ`TA"$SlC#0 -p, W*SP#@+2V9X=K`dTL@]7$m: :  2V0#KFТ'Tc#нX,#xZh-`.G)V(3^twuh_@ЂeW %>!t-#Ѕж7G':)pHл'T!G.*lf:Odw^"rh4X Њy@/(#"й/X.-,й )Хu77X~"Q\!+V94Ё#)'9'F\huЪk+u0*ж|)3k0)T*(("'z!,Ty*Ёp+4S7 tP '/;-HSR'\8$dx7r!L(Д,c2xT s->+Zx7Ѐ,Wdo*;2T;l'@DBL '\3Gjh'XvK#H~S$'LЁ ,\)T.(6q'Ѕ'ЅL&Н77':)\5 >-jQ)_, еn?+{1($& d%KuЩd)Ф0:T@<(z.Ыx]$S,!@*H"O(Z(ЀeЍy7,EwC(zF4v%?$\$+V @(Н@&#T-@7jEh [(ДlWyh,%@]Ј`*B &p,[5 &TpT+,xdС:(hJ ^Z5Wb5-etX"1&u|X%y0%А@'qU@TWYM8оb(Ж/V*#Ѐ87@h"HG+2PQ+#e< +}Q ,"*f,Z*ZxVUT,ZS.8XlYu5VH'.!/L7h7P@SpX74`@7@oPSz(@`a,Ь(_)l7M,*И2VlԺХtF#, (7P8-KL+nT|)Y]8b"Yk8@000k"Е\ Wh ,=e)Q+tШM-Њ(й8x'7P,W:,}UL[^ЫhD To2V|дQXX+ЋP!m'}@PЖ0O.С"з TP З T Ay0 TB T"oP f 3[ Z=i 0} + ,.A ? xY Q) &Ю x#Ё @U X %T8!%Г!3S !`T)!@q70!W#xS#,#%Ї#5#@m$,\$\e-$d2C$GS$.Z$2$+h$ <Cw$'Й$_$*$cW$Є$Љ$p6н$ +T\$8$'$cW$W 1%.Й%l+y'%L#0%6;%,Q0J%-Н`%j_k% "%<Н%> %D+п%*%_% 7$%Hv%{%H.И&b2&%&P- /&E$:& C"4F&ЂP&K[&tЫn&,v&В&XeW&O(?&Y$&!&`%O&*L'.В'(Z'0#+'@m9'1M'*D_'l'w}'4"T'\d)0'?$'/'7'.'!T'%T' (.Ћ("#(7-(п@(;ZF(0@.R( %pi(-v(Щ(XW (@#А(X$7(([(MЬ(\J%d(д(*~(`Y$/)!m)!Ъ+)LФ8)|"TE)UO)&/_)}o),Л)l0b) )(h,_)%A)Т)T)h1)7)xS-)E1 *Z*^Ъ)*П1*S>D*y)qL*8#B[*(rFg*7o*pЌ{**h"W*\&J*l&T*!*;e*$V*y*'s*S*j%л*Dh[+pi_+x')+4+%ЂF+^$5S+8PfZ+ze+`p+Ԫ+%+ 7+!Z+ #+yq+$.Ў+!+0+:+ /f+7,pzG,I$!,ؖ~3,.l>,$M,+X,d,},2 ,Xc!,,p+'Ш,T}i,h!x,X.,`,Ѓ,"&--s--UH-.|(-#Ї6-܆A A-E7H-H WV-*$#j-'Ws--}-Ё-?!-*- )л-d2Ш-T&-y;-+n--*.:(w.r.#K42o4L)'Џ44l4ps4|FЏ4V4Lc,502h 5)5. $5]7|-5'TD5ЎKM5T('Y5P&Џd5%Эm5hB)йz55 5po,Ї 5k!V5(3Э5 й5TO(:5rо5п5PЍ6D"D67$"6ܲ#,46m>6,AR6Ȭj`6)}i6zv6dJ60)T6а6`_676L!Y646+6_H6$Ј6@nh6)7 "7!3%7tЂ47PA<7!,оP7+^72 s7 ~70A]74T73T70t)7W7.v7t 7$477,Я8A(]8w 8h7C8-ЩU8@f"4a8c"нu878j8$D8p)8'e878.8p.8&"^8iS8$]9 09"9W$(9@p>49 99l,XP9h,6d9m9W6(9.{9TQ&9-$9lw92V9|k|9(\9 %9Hk&:@ :TRЋ:7':`74:I?:L:H&:g:T" n:i{:t3:\+:\K:@`2:`UЀ:D:":G-:|)R:X;>&_;$$$;ıE5;(S*N;HЀ];5Td;wi;,Ьt;4;Ь};`}L;p4T; !Є;4T;+M ;&Ћ;Љ;pT;,[;)<!</((<)k5<'ЁE<U<u(i<.Ќw<7+5<\&<<<@2<3<)l<8Щ=p9 =7= !Ў=`61=ԫ@=B(2J=+:U=\6#{h=H{ w=8te=-=!7=7=DD=-=+V=>U!>7+>,a5>+ N>Ж+uZ>ȡІh>Тy>xFК>@ ->,>$-}>t(>#> :+>+Ђ>y>Yu ??a?h!?YWЈ%?Й2?<'[D?Z$вW? _?\[ck?x. Ew?l7}?.?=.t? Ls?r+Н?A :?&5?|q3?k.o?+C@Y$,&@#h9@8SB@N@$OH\@(37pl@O(y@z#G@T>@$@3T@$)@TВ@Tk@@-S A`*NA"AD+%A752A,3CA&hQAWr[AоgAнrA ~AhQЮAX/A*JA+6A%АAalA.9A7A`-0РA7ADB 2BsЌB(,l/Bs'>SD [Dc%ЖiD M2zDp!пDМD`fD>"LD/DtqDcDSD,МD DBD2VE(TE.E+.#EV.Ei_5E'lJEMp^E2mE)zE8E-Ei_EmEoZE|-SEY*:E(MaExTEQ&&F)v F/VF2V(FЗ8F('дKFb;YF bFv$mF(_@zF)vFEFTF,гFV,3F u*gFd: .FSFL /Fll&BF"ЖF\aFTG"AG`),  GT0-GX]:S*ES7QS_S:VnSl"Ц{Sx`.S-YS\1SЍS4.КS\,ZST S(+9S`ЃT7$T2.]#T,59T]7FT!kSTZ cT<7rTx"5{T,/T8)СTST*ТTR&(T%4T"TT<](U?U# U!5*Ur@U WU,=nU7uUs-#U@h_@U"#U!fU 6U$-NU\B!OUt1'.UL{U|U%*V`V%VA6V<о>V\_LVUSVT:;cVЦlV})E|V0 Vp7КVԖ!VT:VB (V,V |(BV,иVpW\TW܆.Wl&/WR.:W|=YHW%ЛXW.dW %IsW4W-SWWg.>W8q_W)TWSW7(XX)7Xl X".Xfw[L?\[u[j_[k"[ȵ3[pQ[к[U[P. [V[$,Ѐ\T ,g\%м\ z%л0\|Ь>\%, P\ M_\]P>0Q]`]%,,q]lЪ]&R]$7]z*Ё]#]l]-]#-м]л^,n^H+{'^@'Ы0^U:^!"!G^dQ^ZZ^@7$j^@Kv^\B(<^H,$^;&?^U^t!(^{^W^,j _@.#9#_[!@3_D,ЙD_,гO_F)e_#Ђm_Uv_x_Е,}_@9+4_I_x.Ѓ_'И_9#T_!{_{`Z Ш`qЙ&`$?m8` 7H`!V`r'c`An`l]w`0`L!A`` W`@U`` W`,''-`tf`"Ї`@'+a*aL#al)q,a10@a^aDUbaSTqalB,вa@+Ta"#a|.#+a$)al@ar7aDUWa/Va-ЦbTg)b;V%b|pgI,gx'hll#eh(7@3h7:hFChh)7Khh8\h+mhs|hL8hIKh( 2hla-h ,hj'Oh8(h  i.КiPMбi`\Ё(im,Ь>i1JiXi!ЪfiPZ*Мwi0 Ki ~(\i.i@%-i +Яi%imiМMm2TZmh!imb<|mЩmE.mi mDI7m,m7m'Tm+pmTo)Ёmd7nmRnP* (n 5n7Ln0I]ndVgn@Qon܇%nG\nN8nZnTnn&nnPмn7oH Ф oxBhoЂ(oЏ5oT#9?o$ЇNo(g-X]o]Qho@TH|oTSo7oHЎo8'To -o0:(o еo@-VoM/o8%^p! pD.)pl+:4p"/=p/VNphUp dpUlpx"|vp7p.Kpc.Fp,'Іp U$Рp cpD2+p7q<qԸH$qs(8q1TШFqo*7Wq.Яdq"pnq+V|qUq4xq +"q`* q 8&q(l!q|+;q%/qh%qt7r7r4b-Gr1<0r9rzEr\ w\r}.Iir@"#yr_rpjar "r,)Ѓr 7 r8"Хr|WrХr TrTrxrYs,y sh"/s\X=s$6MsB|T| |-|hb|TW|T8|h|0)}~ }(?}q(}~"W3}O"4?}L!H}/VS}0Vc}'Vl} V(w}l>}bWFdO8@rZ.ЇnP,{.Ё|E;-9Ă`', Ԃ#UTw-EdN'йD-V8~G%s1,V8gCH*cT Д^$gq1}T837 p "; 6TlTʃs*Hу+ ڃp+}I-и$9C&87;|aFU O '_3Tk,Wx0S3Є8"Я/"е/(Ȅ?$%݄a+*VZX!HU'Z$К:4!MP)U oh7SX7S%+I.tЈh ʅDr.؅Р!i|=JlS<%Йx #"D4t8 @\ N$c8So&/}(R&~(T0ņ ;Vц`TنDLUG8/  TO-',V1\*8`(F Kh[Н\3Vi,} -:b-3'J2lw"LJЇ·J27аއ+WUƐt Њڐ,.ЋXh `&w)0"B;X4Fb$CRdS]H jПv|g$Ѕ К@#D: $$ő>+%ӑ '@\D%dЍ@M $T 677PUDhR4j cpjs|%-)x^oІ7͒j ݒ\!*O,K'y*(^4/C)SQ'Цa(r R|7(0' %OV$ϓoNߓ =bHH{X1"7$8#!4BВB`mЬM$Xh,uL"N4VԚ"UЛǔcהL-U!е0@7$-(H[*^/yЉ@7$RЇm;zS,`< D_0.lb͕]'NՕ(7А yx-A+Я ,4"SF0*ЫOS YX&Пdtf"q0VU|j_lhŖE,Җ<*4U '@2к L W2V&BГ76-,J<wXL~c.nX'ЩSDX+и`UW`4 W× SБҗ6tлt+sG)4,а$T&0=; A&W"`_@ix7.Х[P28!ЪXјtTܘ,'Ў8<ГgZ *),5{)|A"зOHe(Xj_f sHА'& x!N0Ľyr7<+пǙ*ϙЃؙ,в ,Ф,%T)78BGE@,=T%f s-,gHHB(('<К@$Ѐ$UT7p;l)ܰ+6("L?4^`m}gP'Їv4^~ ).\HLlo'[$U#$ěd7כ-г0TP&$ %k##4`#ЏA'ЬSt#>_~l"+sS}T'3"ДJм7(A?̜0֜.ߜV7 T .b5#/!Х/q-@l#йZZ"Df |l5Vd7`.VdSܯ+('A֝B">0 gJ,S "j!@$W1r> N.^(%ЃgIoЎ~ n&4B*n<˞xМ՞H- "T "P807 RU|Z,W&|v(0M.9Ex) LTY Sc@i#e v.="[T^){*<%v$7Ɵ0%aΟ(g$SЙ|RD H Ђ0"T-ԑE< Q D7SЭd,-"p8'x66x5 l8-zɠ++\ݠU|pгq !Д SS.xG(*x3\)=`4VgЈajsWT-V0Gо,$~ǡHN'С79kT* *+7%`Ъ5 /C0.PH"ib0uprprЇ{!"/p/|+d7 `8AЧâH(7͢.&ڢ7T_# p!0:t3GSP$X ,oC+~T(0! P)+&o1 ǣ7֣@UИݣ+Te"Х7<;hm_+y87$CA-WOm^Uh|t*Ho)9wU;<\cWb2 X7äP'TΤk{ڤ+dB$rrTܐ "Th&dH!Ŷ:+MҶ .f߶г%h +(0u7/"A`qZ,MhHЖx@@&c%9؅%D&Лѷ` ݷ'A(|7К\ S(3H.\C7S7f )мqT%#7 Y!hXɸWڸh.`'@p i_?"w#8!"\,ЧQ8%V@F,R̮&Щ\ (&kpx$0S$*$K0!ι,Vٹ+<T+L0-Ѓ @(кK 3(`eW0HS=HVQS[+gx.+ vi,)iO&W˺ UӺ- u-ЗP9.T6,t7=$VF7LQh-"` ,Vn0{m)<J,",Va DMϻ@;g߻&dc  mc7+HgY5a-B>`7F,МR)>bлrt<+W7dS7 DS+0@.0 Ƽ)Ҽ,&еhF,H #&T*V-7 D^]$Sj&Tq@ TweJ`.7Ќ)$",Ⱦ!˽%!ֽlV T,/ -6>$7Vj,jHQ#Vr+E|xlܵ)$LJ'-H-VTLT^(ʾ@<ھHPH`-7О -m &І'#,9L[ȱ%hE-п{ty#В^X0&q8P&3ɿOҿ<gۿ7Vl7)+'lА 7$,!J4PwDx,Oal-n$(Kv(Л`j*W|(x,F*zМ8W S35bX#iy4D,ФHj_R WQc7 n${KH0 +7$+ІbWlSG! 4"78<+E\!X @g\ Еrvs8Rtr7 </db$ЇLTj_7$)PV6 (U9)xX3 DP/L }Zܪ,"q0"+lHT0x4S_Ј.EeW&fhSXLИ !,f.Yl,&l#8-?Uаb"АmwT1$`SW$)y*kP'ЛRVL,Щ8| _7"'T01o9<TDG)Yit'"бx-!I 8KB["ПԠ TH?'i&pA,T74БB8>&N@i_Z fW`e#qU}S(+3L6g8MPYS.&<Кp.кT P"b85<.-7E\'XWe$V(urн|Mм8, %"м *X}###`,>87c@-QS"p./&mDqTh!Зc ell-#}|2r dWL`6( )L&Ф #pdk.R T.""4#DВ19F:j_KZ(мj u- L^"*x7O#K*дX?:U d00ИK.Щ'+DH'T#*8-d$; F"J5а[t.@jЁ0r8(Ľ+|78+/i_h'9T@ЉUл'p6('3'*Ї;D;BdnN@'.]"$eT|0M,2y47$({F IWgX2  S]#P4$iC$аQ4ЈcPwsL,Q-xU(fq0yГHНDNи,7*6w4".0н"&Ь2@i,+E'XdWZ aj'2kl!}|Sp$eXxYz*І"Y7?U8.oi_9LCN*V g'Џ_$-#Hq(pU~yp30 `V<aT+@STh%T4T1@ L6,T#x+",X%=%МNTSW4u7apm_standbysspec_vnodeop_opv_descwi_set_nwkeynge_mii_readregpfslowtimonanouptimeaha_free_ccbuvm_map_callrandomreadehci_device_ctrl_closeuha_scsi_cmdaxe_tickem_set_mac_typeuvm_page_lookup_freelisteephy_mii_phy_autopmap_alloc_pvpageahd_handle_devresetie_readframepcscp_write_reglongjmpwi_usb_rx_list_inittxp_download_fw_waitffs_vnodeop_opv_descAdwISRep_eisa_matchvfs_opv_descsvfs_allocate_syncvnodepcmcia_printuhci_pci_attachvga_pci_mmapscsi_do_safeioctlarpresolvedp8390_readchange_displayparamseaattachchrtoblktblXnmisys_minheritsea_reselectbufq_default_allocchild_returnvga_setfontrtlabel_unreftrm_initACBne2000_write_mbuffdcresultuvm_map_initne_pcmcia_caipsec_soft_first_usenkmempagesuhci_device_isoc_donewdc_atapi_drive_selectedncr53c9x_scsi_cmdgscpcib_cacopyinstraue_miibus_readregray_intr_startsys_getgidgscpcib_cdcpu_cache_ebxext2fs_vnodeopv_descsdofilewritevwi_inquire_usbdumpmagttyflushsys_setsockoptfxp_stats_updatecomdefaultratevop_lookup_vp_offsetsahd_set_hnscb_qoffdefrouter_lookupinetswohci_powerpowerhook_establishwi_get_fid_usbpcdisplay_erasecolscdce_rxeofip_reassin6addr_anyrt_maskedcopyVOP_ACCESSusbd_get_quirksip6_get_prevhdrscheduler_startpciide_triones_productsaic_isapnp_attach_insqueahd_unbusy_tcldisk_finddc_ioctluvm_maxkaddrehci_pci_cansphy_cdan_ioctlicsphy_resetcmoscheckrlphyattachohci_waitintriomem_exiop_print_identsys_closeahc_run_qoutfifosea_donede_cdusbd_do_request_flagsrtflushclone1stge_attachtxp_reset_adaptertl_mii_writeregin6_purgemkludgeffs_inode_allocmountlist_slocksys_setsidax88190_init_cardahc_platform_intrusbd_intr_transferinitclock_funcami_completeem_init_rx_addrsiha_pci_ca__ashldi3nge_intrwb_encapvn_statcom_pcmcia_disable1vop_getattr_descunp_detachsiop_scriptnd6_nud_hintether_ip6multicast_minusbd_submatcham7990_watchdog__mainray_cmd_scheduleef_tickepreadwdc_ioctl_getaue_stopfstenvufs_quota_deletehardclockbioscninitwi_read_data_iomyip_ifpstge_cawdc_reset_channelvga_extended_attachin6_domifdetachdevopnahd_scb_devinfosiop_pci_attachukbd_keydesc_no_nodeadwskbd_cndetachvop_whiteout_vp_offsetsXtssnge_jalloccd9660_vgetfsubriiop_intr_eventreg_store_bcdtprintf_openahd_probe_scbswdc_isapnp_caisp_reinitwsdisplay_burnerohci_device_intr_closeurl_csr_read_2sis_miibus_statchgdest6_inputgsignalacphy_caahd_check_cmdcmpltqueuesbioscnprobeahc_eisa_attachehci_pci_matchipport_firstautoehci_strwi_txeofmii_mediachgaue_devsipsendredirectsbpf_setifem_encapVOP_SETEXTATTRunp_internalizetk_rawcc__wdstartevcount_intrfc_lfcemptyvfs_export_lookupif_cloners_countifnetyieldohci_endpdm_freemwsmuxattachfilt_seltruesc_print_addrcomspeeddc_setfilt_asixlogusbkqfiltervn_writechkin_ifscrubdp8390_media_initpdevnames_sizevfs_stdextattrctlahd_build_transfer_msgbge_shutdownroute_dstpckbdprobeinit_execi8254_microtimewskbd_cdsys_getdirentriesbcmpnd6_dad_startioprbs_cdexec_maxhdrszuhci_device_ctrl_doneam7990_stopmmmmapuvm_map_spacefitssetjmpcacminphyswdc_disable_intropti82c700_set_intrwsdisplay_switchiha_alloc_scbsbge_stopxl_cardbus_matchre_ifmedia_stspci_subclass_communicationsuvm_deviceopslogread_filtopsXrecurse_legacy8vndxfer_poolfilt_fifowritecpu_info_primaryem_set_multiffs_specop_ptcp6_mtudisc_callbackcopyoutstrmainbus_matchext2fs_fifoop_opv_desccac_scsi_cmduvm_swapinusb_transfer_completetrm_RecoverSRBapm_suspendlxtphy_servicefxp_mediastatussd_scsibus_get_parmstcp_attachbios32_servicewskbd_cngetcvop_print_vp_offsetsbuf_dirtysoo_writem_zeropdc20262_dma_startffs_specop_entriesunp_gcingwi_pci_lookupbdevswbaddynamicportsohci_root_ctrl_closereg_load_singleahd_aic790X_setupuvm_mk_pclusterdomainnameehci_endpdlockinittl_hardresetttywrite_filtopswi_usb_devswds_pollre_ifmedia_updepic_read_eepromregnd6_ns_outputbpfkqfilterVOP_LEASEwi_headsk_xmac_miibus_writeregttyunblockahd_get_transfer_dirioprbs_unconfigremovedevga_accessopsigmp_timers_are_runninguvm_deallocatefilt_procattachpckbc_xt_translationle_isapnp_attachufs_quota_free_inode2trm_MsgOutPhase0filt_procdetach__divdi3ahd_add_col_listsys_clock_settimesiop_led_offwdc_floating_busiha_pci_probelocnamesdisk_busynpxdna_functcp_pulloutofbandevcount_sysctlopti82c558_set_triggerelwatchdogsddetachsqphy_statuspool_set_drain_hookahd_list_unlockukbd_keydesc_jpmouse_copy_extend_linesis_stoparprequestsiginitpci_mapreg_mapuhci_device_isoc_aborttrm_StartWaitingSRBepconfigvga_console_screenvn_default_erroriha_pop_done_scbusb_task_thread_procbioscnputcip_sysctlmpt_free_replyuhidev_closemsdosfs_vptofhffs_fifoop_opv_descusbd_clear_endpoint_stallbus_space_allocsetdisklabelknote_removedc_ifmedia_stsroutedomainhid_locateicmp6_errorVOP_MKDIRdc_txeofnpxsave_procrtl80x9_media_initepgetip_protoxsys_settimeofdaypcmcia_read_cissdstrategyaddlogehci_sync_hcep_pcmcia_attachstge_set_filterep_cdwe_isa_cauvm_page_physgetmsdosfs_syncfldenvstackgap_randomep_pci_caeisasubmatchffs_clrblockusbd_set_hub_featurestge_stats_updatepdc202xx_chip_mapbpf_filterchgproccntaic_free_acbahd_get_hnscb_qoffaac_sa_interfaceip_drainumass_init_shuttlesoqremque__adddi3comattachvr_stoppci_classuvm_map_inheritfifo_printinfompt_ioc_statusapmopencd9660_syncahc_isa_irqbge_init_rx_ring_jumbopmap_free_pvpccom_cdget_addressbios_printem_display_debug_statsin6_ifawithscopevop_inactive_descfdc_cdfmul_ibge_tickuvm_schedulerxe_pcmcia_matchsync_printnchashvnopspcic_ident_okgdt_pci_enable_intrpool_cache_initsys_lchownskc_cdmsdosfs_removecd9660_readaic_sensestge_startwi_get_idgdt_timeoutwm_sqrtzeroin_addrbmtphy_cdehci_device_bulk_closewdc_set_driveuvm_map_protectusbd_get_xfer_statusre_encapprintfpcic_chip_do_mem_mapahb_donein6addr_nodelocal_allnodessched_lockehci_alloc_sqtd_chainahc_find_softccdce_devsrandomwriteuhci_device_intr_methodsprelist_updateahd_pollbge_readmem_indtl_intvec_netstsip6_protoxsys_recvfrommpt_intrXhold_legacy3ttrstrtsys_sbrktrm_print_infoiha_se2_instri386_fpu_presentrandomyc_chipsetsepic_openbsd_attachsysctl_doprocsiop_modechangekcopywsdisplayopenext2fs_initpdq_ifattachahc_platform_set_tagsrtfreetxp_watchdogahd_fetch_devinforay_matchcd9660_linkdc_list_rx_inithostnamelenupl_cdsk_ifmedia_stsepic_miibus_mediainitcd9660_specop_entriestwe_thread_createray_cmd_donemulticast_register_ifm_tag_freeahc_shutdownlgdtisapnp_map_readportttyopenraw_ctlinputwi_usb_ctl_unlockccdlookupnd6_ioctldc_watchdogaxe_miibus_statchgusbd_get_stringipsec_exp_allocationsbpfclosedevwaitusbd_probe_and_attachiop_lct_getsoftdep_setup_removesys_writevsys_setpriorityami_cdm_tag_prependE_abs_script_sched_slot0_Usedaxe_cmdray_shutdownahd_handle_scsiinturl_unlock_miiumass_detachusbd_free_iface_dataahd_pci_ident_tableip_defttlsys_undeletefxp_detachwi_usb_attachurl_rx_list_initusb_schedsoftintrapm_powmgt_engagearpintrcac_pci_attachbge_deviceskqueue_registerpci_conf_readpciaddr_resource_managecred0isapnp_bestconfigin_delmultipiix_get_triggerwdc_isa_probeuvm_forknatsem6x86_cpuresetvfs_op_descspdq_ifwatchdoguhci_device_intr_abortpcic_chip_mem_freeumass_activatend6_rtrequestncr53c9x_selectuvm_km_suballocusb_delay_mstweminphysep_pci_matchgdt_mpr_set_sema0bpfdetachsys_closefromfifo_ioctlehci_devdttydefcharssigexithidirtypagesepsetfilterisa_dmacascadestge_mii_bitbang_writein6mask128dc_eeprom_getword_pnicdead_lookupatapiscsi_cafadd__uvm_amap_poolin_pcballocXprotVOP_LOOKUPdc_stopbrgphy_looppccbb_conf_writepcred_poolenqueue_randomnessusbd_set_idleexphyattachpcibios_presentserverworks_pci_intremul_nativeaxe_txeofwskbd_inputre_miibus_statchgmachine_archahd_write_seepromepic_common_attachacphy_cdaac_raw_switchvop_rename_vp_offsetssys_ovadviselockmgr_printinfowb_intreisa_bus_dma_tagwsmux_attach_scusbd_pipe2device_handleaue_rx_list_initwb_bfreebufq_default_freewsdisplay_kbdholdscreenufs_quota_alloc_inode2VOP_WHITEOUTmicrouptimetwe_pci_caamd756_getclinkpmap_is_activesocket_poolahd_scb_active_in_fifopgrphashsys_setpgiduha_switchfd_set_motorfxp_int_delayprofhzwb_fixmediatwe_attach_bus_space_unmapcache_enterahd_run_qoutfifoexec_elf32_makecmdsbha_get_ccbext2fs_bufatoffsys_setloginaac_startuptxp_cdcpuresetfntcp_do_rfc3390sys_setresuidwb_caadv_cdaha_cdvr_miibus_statchgrn_deletedp8390_debugnge_stopiskmemdevstat_rush_requestsgdt_put_slottrm_Interruptwi_watchdogwe_recv_intpcmcia_poweripsec_def_compfc_lmdistancewdc_atapi_ctrladw_build_reqnch_poolsomaxconnpiix_initip6_mrouter_verpmap_pg_gipsec_exp_timeoutip_directedbcastahc_softc_compisp_cdaac_cdfdivripci_mode_bus_dmamap_loaduihashtblcac_eisa_l0_completedaac_watchdogscsi_get_xsamap_initffs_flushfilesffs_blkprefetherip_allowahd_outlicmp_sysctlsys_lseekexec_aout_prep_zmagicfucompppool_cache_getahd_inqcyrix3_cpu_namenprocssmc91cxx_mediachangempt_minphysllinfo_arpmsdosfs_pollwds_get_scbpci_lookup_quirkdatamsdosfs_accessaddupc_intrdvd_read_bcaam7990_copytobuf_contigamphy_servicerl_shutdownwsevent_finiip6stattxp_inituvm_pageboot_allocmii_phy_updateswwriteti_read_eepromxl_read_eepromether_crc32_leaue_csr_write_1sm_pcmcia_funce_enaddrpiix3_4_setup_channelosb4_set_intrrn_searchXosyscallec_read_hdrmpt_pci_lookupipipstatsecurelevelwe_media_initresume_ireturl_matcharpt_keeptl_dio_write16savectxisapnp_printioprbs_watchdogsys_seteuidtrm_EnableMsgOutahd_pci_test_register_accessbios_getoptwskbdpolluvm_map_checkprotmax_protohdrahd_platform_alloccdce_activateep_isa_mediaray_powerohci_pci_matchsis_rxeociop_msg_freeextent_findepstarttrm_scsi_cmdumass_scsi_attachahd_check_extportwdc_atapi_intr_databufpagesrandomkqfilterusbrev_strpciaddr_resource_allocatepckbd_consopsegwatchdogrlphy_cdpccbb_pcmcia_do_mem_mapsys_keventcopyargsadw_reset_bussk_intr_yukonarc4_reinituhci_device_bulk_methodsiop_reconfiguremi_switchcd9660_statfsrndwrite_filtopssysctl_sensorsmpt_free_requestkern_sysctlwi_pci_common_attachsis_ioctlnd6_delaypckbc_send_cmdin_pcbinitpccbb_intr_disestablishsqphymatchnmbclust_updateie_hardware_namesfdremovepcic_event_processnge_eeprom_idleuvm_tree_RB_NEXTigmp_fasttimophtree_SPLAY_INSERTaha_isapnp_cascsi_user_donekillprocehci_device_ctrl_startwds_cduserconf_cmdbufwi_get_pmumass_bbb_statetxp_set_filteraac_get_ccbohci_device_ctrl_abortvop_pathconf_vp_offsetsahd_queue_scbstge_shutdowncdce_startpcic_deactivate_cardray_set_pendingapmioctluvm_map_entry_poolcrgetuhci_activateopti82c558_pci_icuunp_bindtcp_delackuhci_device_isoc_closeiha_msgin_sdtrem_clean_transmit_interruptscsignalreaddisklabelmpt_print_reply_hdrusbd_clear_endpoint_stall_asyncwskbd_set_displaytcpstatwddkdriveratapi_mode_sensebha_pci_attachpccbb_pcmcia_attach_setupncr53c9x_pollfillmapentryelinitpcicbbmatchiop_util_claimtcp_timer_persistrelookupgdt_from_waitsys_umasktrm_StatusPhase0pci_subclass_i2ofilt_fileattachsysentisapnp_free_regiontcp_setpersistwsscreen_lookup_syncufs_ihashlookupaac_start_ccbsicmp_rediracceptapmclosevop_reclaim_descusbd_get_hub_statuswsemul_vt100_detachAscResetBussoftdep_setup_inomapdepisp_getrqentryip_outputahd_platform_scb_freecardbus_function_enableray_free_ccs_chainbpf_mtapahd_download_instrtl_eeprom_getbytepckbc_cleanupahd_save_modespckbd_set_ledsti_eeprom_putbytefindblknamekue_rx_list_initpool_initpcmcia_card_attachbpfreadxl_pci_attachpool_putm_copym2sysctl_structam7990_startohci_hash_rem_tduhci_poll_hubmpt_set_initial_config_spipmap_pinitaxe_ifmedia_stssysctl_rdstringuvn_attachxl_newbufahd_is_pausedti_64bitslot_warlasttimefiforead_filtopsehci_freexxl_pci_devicespagezerocnkqfiltersysctl_disklockdesiredvnodesufs_pollusbd_remove_devicecac_pci_l0_intr_enablemsdosfs_readlinkcac_ccb_allocahc_restartusbd_get_device_statusosb4_pci_icuspec_vnodeop_pahc_initlookupahd_platform_dump_card_stateec_fake_test_mempccbb_pcmcia_mem_freecomcngetcnchinitexec_mapsnprintfext2fs_readlinksoftdep_setup_blkmapdepether_ioctlsyscallumass_bbb_transferrnd_attachedtqphy_serviceip6_forwardinganon_swap_offkue_resetarp_allocated_bus_dmamap_load_mbufwdc_print_capsahb_debugbge_blockinitwi_watchdog_usbgdt_mpr_get_statusi386_has_sse2ifindex2ifnetcd9660_ioctlgdt_eval_mappingem_initvga_50lscreen_bf_isa_bus_dmamap_destroycac_cmdusbd_get_config_desc_fullin6_savemkludgein_pcbnotifyallmouse_copy_worduvm_pglistallocsyn_cache_addohci_device_ctrl_transferwsdisplay_addscreencomeventscpu_initincorehzwskbddoioctlrgephy_mii_modelbios_cdne_isapnp_cawi_pci_acex_attachdefrouter_resetcd9660_ihashinsahd_namewdc_atapi_send_packetcpuidcheckaliasdl10019_mediachangecue_activatere_tx_list_initsk_initttyretypestartuphook_listahd_search_qinfifoefgetkue_detachnge_mii_sendrt_timer_queue_changelf_initwi_ioctl_usbcpu_attachuvm_km_pages_lowatmpt_rd_dbdpt_eisa_irqsd_switchwdc_preata_drivesdclosevop_poll_vp_offsetsvop_generic_kqfilterpffasttimosea_pollinitsiginfosys_getuidiha_del_pend_scbaic_print_active_acbuvm_unlock_fpageqexec_setup_stackioprbs_free_ccbpager_map_wanted_lockuao_createloccpcic_isa_chip_intr_disestablishvr_list_rx_initioprbs_switchaue_lock_miipccbb_pcmcia_io_unmapffs_realloccgiha_devahd_pci_write_configwskbd_load_keymappmap_remove_ptecd9660_bufatoffiha_state_5groupmemberuvmspace_inituhci_power_vga_scrlistether_sprintfmsdosfs_unlockselwaiticmp6_mtudisc_callbackssys_forkvop_setextattr_descsysbeeppmap_free_pvpageip_setmoptionspccbb_winlist_insertuha_get_mscp__qdivremspec_opennge_mii_writeregfilt_bpfreadehci_alloc_sqhdc_eeprom_getwordwsdisplay_emulinputuvm_fault_wireusbd_abort_pipepcmcia_ccr_readrtc_update_centurysis_newbufsi_freeahc_lookup_phase_entryXrecurse_legacy2vm_nphyssegadw_ccb_phys_kvip6_randomidproc_filtopsisapnp_id_to_vendoruvm_lock_fpageqelf32_os_pt_notewdc_print_current_modesXrecurse_legacy5bge_miibus_writeregtl_watchdogfiledescopensys_vforkehci_freemvop_reclaim_vp_offsetsmpt_check_doorbelliop_adjqparamuvm_pager_initCopybufferwinChkNamest_decide_modedvd_read_copyrightvmi_list_slockpool_draincac_l0_completedem_setup_receive_structuresmyip_initializedahd_resumetrap_typesync_vnodeop_psys_mkdirdl10019_media_finiahd_inluao_reference_lockedFPU_round_sqrtufs_fhtovpcom_pcmcia_activatewskbd_translatedumppcbray_start_join_net_donerttrashohci_root_ctrl_abortmblowatefioctltxp_stopgetnewvnodexl_cardbus_attachufs_inactivepciide_natsemi_productskue_load_fwnd6_mmaxtriessiop_intrem_print_link_statussys_socketuhci_abort_xferuhci_detachdead_vnodeop_opv_descohci_shutdownpcic_chip_socket_disablebha_cdwi_init_usbpcic_detach_cardahc_match_scbpckbd_caiop_release_mfavop_generic_bwriteep_mii_clrbitnanotimere_cdpccbb_make_tagufsspec_writedead_vnodeop_entriesxl_freetxrxmpt_check_xfer_settingslxtphy_caiso_disklabelspoofpcmcia_cafifo_badopfdfreeepmbufemptyahd_find_scb_by_tagahc_update_neg_requestadv_devtty_countadv_intrpciide_chipenahd_handle_nonpkt_busfreeraw_disconnectaic_abortipsec_ipcomp_default_levelseaprintsis_south_matchgdt_raw_switchre_intrbrelvpgdt_dequeuewdc_logmsdosfs_mountfsahd_setup_data_scbahc_pci_intrXhold_legacy12em_82547_update_fifo_headehci_root_intr_startwi_stopip6_sprintfsync_fsyncvop_setattr_vp_offsetssetstatclockratecd9660_strategyohci_allocmreg_u_mulwds_scb_phys_kvuserconf_parsebootargcip6_keepfaithray_recvext2fs_allocaac_eval_mappingst_loadfdcopybha_scsi_cmdhole_startgscpcib_attachb_to_qmpt_read_config_info_spivga_is_consoleef_miibus_writereguhci_pci_matchcmd0643_9_chip_mapusb_blk_freelistfst_i_udp_sendspaceahc_set_widthdc_newbufvfs_rootmountallocehci_device_isoc_transferahd_dump_scbscue_tx_list_initrw_initcd9660_opendpt_create_ccbsray_start_associsapnp_submatchip6_mforwardsoftdep_setup_allocindir_metaohci_root_ctrl_startinit386cmaskpckbc_cnattachbrgphy_cdiop_util_abortext2fs_blkprefwi_alloc_nicmem_iovga_stdscreenahc_pci_ident_tableiop_msg_waiticsphyattachfdcintrVOP_ISLOCKEDsys_kqueueccdgetdisklabelXsyscalluao_referenceisp_copy_out_hdrurio_causbd_kill_pipeuhci_freemin6_addrscopevr_rxeoccninitmaxlockdepthwi_usb_tx_unlockraw_usrreqnblkdevuhci_find_prev_qhahd_iocell_first_selectionuhidev_detachiop_posturioclosescancttyinputahd_resolve_seqaddrukbd_consopsbiodoneopti82c700_initnge_encapgdt_pci_release_eventahc_isa_idstringehci_free_sqtdXhold_legacy8wi_usb_txfrmelstartmaxslpext2fs_makeinodeehci_device_intr_methodswds_start_scbsatdevbasecue_startaue_csr_read_2usb_eventsst_read_block_limitsi386_fpu_fdivbugufsread_filtopsufs_symlinkrl_initpvalloc_lockapm_doidleeisa_attach_hookcd_scsibus_set_modepcscp_read_regtxp_dma_freeufs_mkdiran_stopex_cdtxp_ioctlpci_subclass_satcomahd_build_mode_stateusbd_get_no_altsami_intrin_iawithaddr__anddi3re_txeofrt_missmsgdofilereadVOP_BMAPip_dooptionsvn_lockcue_tick_taskahd_fini_scbdataahc_handle_seqintrip6_ctlinputaac_describe_controllercdce_capmap_free_pvsahd_reset_channelcac_eisa_l0_intr_enabledivide_by_zerowsemul_vt100_handle_csiumass_cbi_adscsbdropcardslot_campt_alloc_fw_memxe_pcmcia_lan_nid_ciscallbacktcp_debugusbd_transferinpcb_poolneed_reschedohci_hubdohci_pollnextralocpcib_callbackstge_mediastatusfxp_ioctlsys_setegidwdc_wait_for_statussm_pcmcia_prodrn_matchfifo_readam7990_setladrfreg_u_subcd9660_symlinkautoconf_verbosewds_free_bufin6_setpeeraddrunp_externalizesys_munlockallpcic_powerwb_mii_syncuvm_faultuhci_waitintrsk_xmac_miibus_readregrandomioctliha_append_free_scbcomsopensoreceivedc_decode_leaf_miipool_getuextralocrootfsohci_root_intr_startrip6_outputsoftdep_freefileahd_softc_insertscsibus_cdti_cmdpmap_alloc_ptpndflushaic_pcmcia_attachcompose_tab_cmpsea_initsis_list_tx_initrn_insertspec_pollgdt_watchdogAscInquiryHandlingahd_get_sense_bufaddrnge_read_eepromfilt_kqdetachaue_unlock_miiipsec_exp_bytesbufqueuesconfig_deferem_check_for_link_bus_dmamem_allocwscnprobetrm_Reselectm_tag_initan_pcmcia_cafilt_usbreadusb_add_eventif_attachuha_devpciaddr_ioaddr_isa_bus_dmamem_unmapm_reclaimahd_inw_scbramnameigdt_cntdpt_waitaic_scsi_resetahd_update_coalescing_valuesXstray_legacy4em_read_pci_cfgcpu_ecxfeatureext2fs_readdirip6_ctloutputdead_pollversiondc_rxeofwihap_initem_rx_int_delay_dflt_bus_dmamap_synckqueue_initahd_adapter_req_set_xfer_modeaxe_rx_list_inittl_dio_write8ata_dmaerrcom_common_getcuvm_pagezeroin6_setsockaddrigmp_leavegroupAdwInitDrivervga_cnattachamd756_initmountlistuserconf_histbufwds_queue_scbwdc_atapi_the_poll_machinewihap_mgmt_inputcomsoftVOP_REVOKEconfig_deactivatescsi_probe_bussesclallocipsec_esp_trans_default_levelbiowaitpci_subclass_inputpentium_base_tscreg_adddepca_isa_probefilt_ufsreadpciintr_pir_lookupunixswdc_apply_fixupadv_pci_casccssis_read96x_mactqphy_caintel686_common_cpu_setupehci_check_intrwsdisplaymmapccpuncr53c9x_readregsuvm_map_replaceem_setup_linkti_intracard_chip_mapi386_use_fxsavexl_intrtx_caaac_devfdinitarc4randomboothowtotcp_delack_tickspdq_os_addr_fillupl_stoppcibios_pir_initttopenata_get_paramsether_ipmulticast_minconfig_rootsearchstge_intrrip6_sendspacempt_free_fw_memscsidebug_lunsuao_dropswapenxiobha_findisascanusb_cdem_rx_abs_int_delay_dfltrnd_event_headahc_check_extportwsdisplay_switchtoconsolepmap_tlb_shootdown_job_putin6_maxmtupmap_enterepic_ifwatchdogxl_list_tx_init_90xBmpt_ioc_diagtl_stopsys_setreuidusbd_ratecheckvga_console_attachedwi_usb_open_pipesbiosprobeu14_start_mboxsk_intruvm_map_findspacebha_intrwsevent_initsis_shutdowngdt_mpr_release_eventahd_get_scbsdsizefdstrategysys_pwritevkqueue_scanvop_print_descvia82c586_getclinktcp_closeepioctltrm_DataOutPhase0ami_scsi_cmdgdt_simplelockohci_free_stdu14_intrsd_patternsscsi_initmsdosfs_advlockdl10019_mediastatuskue_attachukbd_keydesc_svif_indexlimusbd_free_xferst_switchfallocbuffersisapnp_print_regionpcscp_dma_resetahc_set_syncratestge_mii_writeregnge_ifmedia_mii_updep_pci_devicespckbc_submatchlxtphy_cdiha_reseltrm_initdeadproc_mutexcomcnprobepfctlinputphys_mapuvm_anon_removeumass_bbb_methodscomintrufs_lockisa_attach_hookbge_setmultisys_accessem_read_mac_addrnsphy_statususerconf_initiha_read_eeprombce_caintrnamesvga_isa_matchpccbb_pcmcia_writekillpg1ti_ifmedia_stsxl_ifmedia_stsurl_tx_list_initpchb_printuhci_strukbd_keydesc_frvputonfreelistuhci_device_ctrl_transferXillgdt_raw_scsi_cmdmouse_removeierintwdioctlext2fs_mountroottxp_cmd_desc_numfreeaic_dequeuepciide_mapregs_compatioprbsminphysregyearurl_ioctlem_update_stats_countersahc_validate_widthsetrunnablesk_caeisa_intr_mappool_do_putmpt_ctlopali1543_icuahc_pci_attachwi_set_ssidcue_ioctlnd6_prefix_onlinkatapi_to_scsi_sensewdc_atapi_ioctlcue_attachosversionelf32_read_fromray_resetstge_rxintrhid_is_collectionem_free_receive_structuresami_attachwi_usb_tx_list_inittvtohzip6_mroutervr_startvmi_listudp6_usrreqratecheckmpt_send_cmdsm_pcmcia_cain_rtchangevfs_syncwaitgdt_chainaue_crccansignalmsdosfs_check_exportwsmux_muxopslf_setlocknbigpipetrm_Nopcue_devsin_controllmaxmpt_print_replyahc_send_asyncuvm_pagecopytl_casysctl_quadsys_readexec_process_vmcmdskue_tx_list_initem_phy_igp_get_infocmd_chip_mapahbintrrddkdriverohci_freemahd_done_unlockuhci_remove_ls_ctrlmbstatuhidev_intrvia82c586_set_triggerahbminphysdcphy_statusttyinfoisapnp_newconfttyinami_schwartz_initramdisk_devsohci_root_ctrl_donewe_cdgetnulldevusb_get_next_eventti_ioctlxl_ioctlstge_mediachangepciide_dma_initextent_destroyip6_forward_srcrtloop_clonergetcttsetwaterwhichqsahaprobe_bus_space_mapfilt_apmrdetachray_cmd_ranmouse_copy_startem_clear_hw_cntrspmap_enter_pvmsgbufenabledunp_disconnecttrm_pci_probeufsfifo_writesys_listensys_mountehci_root_ctrl_donepgsignalehci_waitintrsmc91cxx_set_mediafirstcaic_print_acbtcp_rndiss_initahd_sync_sglistpcdisplay_eraserowsuhub_detachahd_chip_namesstge_resetwi_pci_native_attachuvm_page_rehashvop_getattr_vp_offsetsstge_watchdogvop_islocked_vp_offsetsne_pcmcia_enableti_free_rx_ring_mini_isa_bus_dmamap_load_uiotxp_intrffs_fsyncmpt_pop_reply_queuepmap_remove_pteswsdisplay_consinetdomainehci_abort_xferahd_clear_msg_statememcpyppbprintwdc_enable_intrkthread_exitdc_parse_21143_sromaxe_activateiha_msgout_extendedcpucue_newbufsi_getdisk_constructvfs_unbusywsdisplay_paramip_nhopsrip_usrrequhci_setup_isocahd_write_flexportfilt_usbrdetachspec_writesiop_wdtr_msgiop_handle_replyipsec_esp_network_default_levelin_broadcastpool_page_free_oldnointrfd_getfiledc_setfilt_admtekncr53c9x_free_ecbmpt_initahd_minphyssdioctlutsnameexit2__hex2asciiwsmux_isset_displaypdq_os_transmit_doneaue_resetrl_resetkue_open_pipesvr_miibus_readregacer_setup_channelip6_mloopbackext2fs_cgupdateuhci_add_hs_ctrlpccbb_powerrddumpgdt_pcinew_get_statusem_enable_intrcpu_setperfmpt_run_pprufs_lookupahd_update_residualsiop_pci_resetufs_bmapdoasyncfreeip6_mrouter_detachip6_randomflowlabelsync_vnodeop_opv_descttpolldegetlogpollkthread_createahd_verify_cksumwds_ipollsi_findpckbc_cleanqueueam7990_copyfrombuf_contigwdc_default_read_raw_multi_2ahc_isa_cacd_scsibus_get_modepoly_l2pmap_add_pvpageffs_fifoop_entrieslogcloseconstabaic_dump_drivernbufpcmcia_submatchvop_setextattr_vp_offsetsohci_rhsctl_ioctlufs_strategyohci_device_requestami_raw_switchkue_watchdogbounds_check_with_labelether_input_mbufif_qflusharc4_timeoutreg_store_singlepci_subclass_networkiop_shutdownext2fs_checkpathns_scx200_chip_mapsocantrcvmoreepreadeepromAscISRadw_dequeuefdiv_idevclsfile_filtopsiha_print_infost_cddc_pci_attachmsdosfs_renamesysctl_proc_argssiop_adapterahd_known_modesext2fsfifo_reclaimpipe_wfiltops__lshldi3pci_intr_establishAscInitDriverpckbc_init_slotdataPTmapahd_intrsd_scsibus_mode_sensepmap_activatepcic_printbmtphy_resetvop_create_vp_offsetsxe_statchgconfig_make_softcncr53c9x_msgoutunp_discardexec_aout_makecmdscue_csr_write_1dumpmemip6_outputwi_read_record_iovga_pci_ioctlfd_caip6_mrouter_getukbd_keydesc_sv_nodeadpcic_isa_probeswap_syscall_lockufs_kqfilterem_is_valid_ether_addrscsi_autoconfcheckdirsexecswnsphyter_cdumass_atapi_attachin6_are_prefix_equalin6_controlahd_handle_scb_statusahc_print_registerwe_readmemem_setup_ledleapyearsys_sigsuspendcd9660_unmountpciide_dma_startwdc_atapi_the_machineehci_device_bulk_abortpccbbintrtrapsignalreg_store_doublerushjobrn_inithead0ahd_find_pci_devicewd_flushcachend_defrouterfdcloseexecpckbc_slot_namesapm_bebattevcount_attachlimcopyaac_host_commandwi_do_hostencryptCONST_INFtcp_timer_rexmturl_ifmedia_changepcmcia_io_mapsiop_pci_cart_timer_initcpu_featurend6_useloopbackaxe_tx_list_initehci_pcd_ablegdt_pci_get_statusrip6statepic_read_phy_regcnpolltcp_debxcd_casys_truncateesigcodescsi_xfer_poolacphy_serviceohci_add_doneem_read_phy_regtl_newbufsrv_ipohci_add_edwdc_xfer_poolcdce_newbufsoacceptkqueue_pollcdgetdisklabelvop_bmap_vp_offsetsadw_asc3550_mcodeasc_mcodepool_page_alloc_kmemehci_device_isoc_donein6_ifaddloopne_isa_attachufs_creatend6_optionscd9660_seekfxp_cardbus_attachnd6_llinfo_settimeraha_switchxe_intrsis_list_rx_initmsdosfs_unmountelf32_load_psectionXsoftclockuhci_device_bulk_transferan_write_recordsmc91cxx_resetahd_clear_fifouhci_remove_intrrtcintrppbattachm_tag_nextohci_intr1ray_casea_switchset_precision_flag_downmsdosfs_writecue_resetXrecurse_legacy15AdwGetEEPROMConfigami_freemempccbb_pcmcia_intr_disestablishexec_script_makecmdsfilt_pipedetachcd9660_rootne_pcmcia_get_enaddrstack_underflowrgephy_statusiophyattachselrecordcomstoprip_outputbge_cdcpu_cache_eaxext2fs_accessmld6_fasttimeoef_miibus_readregbus_space_freekthread_qichpcib_cdimaxvop_unlock_vp_offsetsohci_free_sedstioctluserconf_pdevpciintr_link_map_listclock_secs_to_ymdhmsmbpoolfsub_ist_write_filemarkstcp_canceltimersahd_wait_flexportfinit_tqphymatchrip_recvspaceroute_initccdreadsd_scsibus_flushlink_rtrequestwdc_get_xferaac_rx_get_fwstatusuvm_vmspace_poolcac_eisa_l0_fifo_fullvr_mii_readregep_isapnp_castge_mii_statchgsis_mii_readregioport_exspec_lookuppipe_createahd_default_configfifowrite_filtopssysctl_vnodepdc202xx_setup_channelnd6_sysctltrm_read_allnge_alloc_jumbo_mempciide_amd_productspci_subclass_multimediavn_openan_txeofuhci_freexif_clone_createcdce_tx_list_initle_isa_attachuao_detachpckbd_set_xtscancodetxp_ifmedia_stsmallocopti82c700_set_triggerwb_txeoftl_dio_write32ahc_platform_freexe_mediachangeamd_family5_setupamap_pp_adjrefep_pcmcia_matchtl_dio_setbit16apollo_chip_mapin_pcbrtentrytl_dio_read16aicattachknote_dequeueuhci_root_ctrl_startwi_cmd_usbvia8231_get_intrtcp_outflagskqueue_statcdce_ioctlcd9660_rrip_analyzeohci_hash_find_tdexphymatchahc_isa_matchuriowriteip6_v6onlysys_preadvidentifycpusys_recvmsgvga_setfontsetgdtxe_set_addresspipe_statwb_read_eepromvn_writemtdphy_servicevop_mkdir_vp_offsetsVOP_LINKxl_txeofpcmcia_megahertz_xjem1144_func0icmp_inputuvm_km_free_poolpage1umass_cdvcountmtd_attachrd_root_sizevm_page_zero_enableaha_reset_ccbin6_delmultistathzrl_setmultitxp_ifmedia_updahc_qinfifo_requeue_tailround_regvia8231_pci_icuwskbd_cnattachwe_test_memwdc_ata_bio_intref_ifmedia_stsuhidev_get_reportsys_getloginbuckstring_inituhci_free_std_chainicmp6_rediracceptext2fs_vnodeop_opv_descpckbcintrdetruncahd_pci_attachpmap_unmap_ptescopyoutmpt_pci_attachahd_handle_hwerrintcomconsaddrcpu_dumppfindip_ctloutputpdq_hwresetuhidev_set_report_asyncwsevent_readti_add_mcastarp_ifinitreg_load_bcdufs_dirbadcd9660_readdirvfs_unmountallccdattachwsdisplaypollrgephy_loopohci_allocxcopyrightsdattachvop_whiteout_desctcp_timer_keepusbd_devinfo_vpepic_miibus_statchgwsemul_vt100_cnattachtcp_mss_updatepciide_lookup_productffsfifo_reclaimehci_root_ctrl_startrw_enter_readvunmapbufehci_device_ctrl_transferpcic_attach_cardip6_sourcecheck_intervalahd_alloc_tstatesis_watchdogroute_outputrti_deletevop_kqfilter_descsys_geteuidrl_mii_readregdectohexdechostzeroisbroadcastpckbd_bell_fnisa_intr_typenamepmap_exec_fixupicmpmaskreplin6_pcblookup_listenmsdosfs_mknodef_isapnp_attachcd9660_specop_pip6_defmcasthlimsys_munmaptrm_StartSRBdc_mii_readbitXoflfilt_solistenvsnprintfrl_read_eepromcardbus_get_capabilityisaattacharplookupdc_initwsemuldisplaydevprintuvm_map_pageableproftimer_trampolineem_write_reg_iochainallocstge_rxdrainvia8231_initec_test_memifmedia_baudratecardbus_detach_cardpckbd_hookup_bellarith_overflowedataaic_pcmcia_matchusbd_setup_default_xferem_82547_tx_fifo_resetuvm_pagelookupsoshutdownuserconf_hist_cmdtcp_rndiss_reseeduserconf_listproc_cansugidcd9660_rrip_getsymnamewsemul_vt100_scrolldownwsdisplay_getc_dummybge_ifmedia_updnge_setmultinswapbpf_iflistPaste_availem_reset_adaptivewdc_downgrade_modeip6intrqel_probeaxe_newbufnd6_rs_inputAscInitASC_SOFTCmpt_init_requestpciide_mapreg_dmawdc_atapi_real_start_2soabortdpt_eisa_attachem_get_bufem_82547_move_tail_lockedunp_inologkqfilteruvm_tree_RB_INSERTuprintfintrtypepccbb_winlist_deletemainbus_casoftdep_flushworklistsys_issetugidinitclocksadv_switchcd9660_mmapsd_reassign_blocksif_detachxmphy_caaue_watchdogwsmuxopenisp_controlwdc_ata_bio_startnd6_cache_lladdrifqmaxlencatqsession_poolpcic_intr_findisa_dmamem_freeray_rccs_intrpciintr_icu_handleext2fs_specop_opv_descunp_connectisa_freeuvm_pagermapinxl_setmodebha_collect_mboif_detached_startbge_intrpci_decompose_tagpool_serialaic_debugaue_ioctlvfs_mountedonpckbc_slot_enablefc_lookuppmap_deactivatevr_ifmedia_stsep_mii_readbitpcibios_return_codenge_proberbus_pccbb_parent_ioif_downndqbfilt_rndreadle_pci_matchallocsysVOP_GETATTRuhci_root_ctrl_methodssiop_add_reselswuvm_km_pages_headahd_pci_intrahc_freewi_usb_matchelf32_check_headertcp6_usrreqpckbc_poll_cmdadw_pci_matchdc_decode_leaf_siaeephy_cdinphy_cdukbd_parse_descepic_eeprom_clockcac_l0_fifo_fullcyrix3_cpu_setuptcp_rndiss_cntcac_pci_findtypeopti82c558_get_intrpmap_unwireipaddrxl_mii_readregahd_timeoutem_tx_int_delay_dfltip6_auto_linklocalpccbb_cb_intr_disestablishuvm_pageunwiresmc91cxx_intram7990_intrwsmuxdoioctlehci_device_intr_abortapmcallti_mem_readahd_rem_wscbdc_setcfgapm_thread_createtl_miibus_readregip6_mrtprotoiha_selectdc_eeprom_widthsis_miibus_writeregcdattachuserconf_devicepcic_chip_io_unmapurioreadin_localaddrtxp_dma_mallocsys_sigaltstackray_update_error_countersbrgphy_resetsoisdisconnectingwi_media_changegdt_copy_internal_dataAdwRamSelfTestsyn_hash2rttimer_queue_headbha_initCONST_1dp8390_enableiha_bad_seqexphy_caiestoprtredirectsis_eeprom_putbyteaac_enqueue_fibaac_unmap_commandwdc_atapi_pio_intrtl_stats_updatecd_scsibus_setchanttymodemfpa_cawsdisplay_defaultscreensreal_2op_NaNmtx_enteraxe_devskqueue_poolvntblinitallcftablesuhub_activatebge_free_tx_ringti_startti_newbuf_stdtxp_shutdownax88190_mii_bitbang_opsxl_startnpxprobescsiforcelun_targetsVOP_REALLOCBLKSuhci_globalresetdc_shutdowndc_devsE_abs_tag0_Usedahd_alloc_scbssys_setresgidsdebugmsdosfs_sync_vnodesplassert_failvr_watchdogtty_initaxe_ioctlxe_pcmcia_interpret_manfidahc_setup_datawsdisplay_clearonclosesdzerorefudp6_recvspaceuvm_km_freesys_killadw_build_sglistapm_clicomconsiohuserconf_numberperfleveladw_intrcopystr_faultem_watchdogrt_setmetricssys_getegidst_spaceahd_restartem_phy_m88_get_infopckbc_flushkue_code_segumass_init_insystemserverworks_setup_channelst_quirk_patternsem_validate_eeprom_checksumdirchkahc_eisa_caXrecurse_legacy13exphy_resetipip_outputpipecloseext2fs_fifoop_entriesVOP_REMOVEpci_mapreg_typeahd_free_scbXsoftttyray_stopwi_usb_activateec_attachiop_strvisconsinitiha_msgoutpcibios_entryti_cabootdevext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachsis_ifmedia_updmtdphyattachifaof_ifpforaddrtwe_donepcic_chip_io_freert_timer_queue_destroyisa_dma_stats_bouncesan_stats_updatewi_cdsd_cdicmp_mtudiscipport_hifirstautosys_fstatem_read_eepromrgephyattachaac_internal_cache_cmduserconf_enablewb_txeocumass_bbb_resetvia82c586_set_intrgscpcib_matchahc_set_recoveryscbem_driver_versionsa6_anysys_getprioritygdt_internal_cache_cmdray_fill_in_tx_ccsdpt_pollpci_subclass_cryptosysctl_diskinitE_ldsa_abs_reselect_Useduvm_km_valloccue_getmacgdt_initnatsemi_chip_mapgdt_mpr_test_busyvga_pci_attachsys_unmountahd_get_residualtwe_pci_attachapmkqfilterxl_cardbus_productself32_probesahd_inq_scbramin6ifa_ifpwithaddrvgoneliha_se2_rdpcic_chip_mem_unmapsis_read_cmossofreeahd_print_pathctrl_eventeephyattachinphyattachsiop_timeoutXdoretipmap_removebootargvtl_miibus_writeregahc_acquire_seepromisa_dmamap_createicmp6_fasttimoext2fs_removemtx_initamd756_get_intrif_clone_destroyehci_close_pipewdccommandwe_read_hdrahd_pause_and_flushworkcopy_faultukbd_keydesc_nopmap_steal_ptpmyipbpf_setfuserconf_historydc_mii_readregcac_eisa_l0_submitaha_finduvm_page_unbusybha_polliop_pci_caepic_ifmedia_updtk_noutsk_init_yukonext2fs_mountioprbs_startmif6tablepmap_collectuhci_check_intrsmc91cxx_ioctlukbd_enablepciide_compat_intrcpu_sysctlcd9660_vnodeop_pcd9660_deftstampwskbddocloseip_randomidfxp_attach_commonaue_tx_list_initiop_initiator_registernosuidcoredumpukphyattachvop_poll_descsk_init_rx_ringcddumpiha_state_2pckbc_attachXstray_legacy6wsdisplay_noemul_catcp_disconnectintel586_cpu_setupvop_open_vp_offsetsuvmspace_execuhci_timeoutwi_usb_detachwsmux_createsys_mmapehci_bus_methodsbootaic_donend6_is_addr_neighborwsemul_vt100_output_normalgdt_sizeunp_rightshostnamebha_disable_isacompatcmd680_setup_channelsetsegmentwsdisplay_emulbellupl_outputfdstartext2fs_bmapuvmexpehci_detachPTDpaddrdc_intrbge_chipinitufs_diremptyreinsertfinishdupray_activateaha_init_ccbahd_get_hescb_qofftl_cdukphy_serviceqsphy_resetpool_destroylogwakeupdl10019_mii_readregshutdownhook_listaha_isapnp_probeiop_cdep_pcmcia_lookupip_dosourcerouteukbd_keydesc_sfsoread_filtopspcic_attach_socketcpu_swapoutbdevsw_lookupdisk_changewsemul_vt100_resetopi386_ioplan_read_recordsc_devsamap_lookupsdoreallocblksadv_initiopioctlahc_minphysfsaveamd756_setup_channelbpfread_filtopssoinitisapnp_alloc_drqdc_read_sromem_get_speed_and_duplexVOP_MKNODuvmtrm_ResetDevParamapm_evindexnd6_ifdetachin6_ifaddrroute_protoxe_getre_newbufext2fs_truncateti_txeof_tigon1cd_play_tracksvirttimer_trampolineip6_maxfragpacketsehci_confdax88190_media_finiaha_inquire_setup_informationuvm_km_threadpckbd_keydesctabnge_eeprom_getworduhci_root_intr_methodslminscsi_probe_bussys_fpathconfahd_handle_seqintwsmuxpollarpt_pruneohci_device_bulk_methodscnopensoconnect2knote_poolami_devfdattachnatsemi_setup_channelscsi_test_unit_readyarc4random_bytesnmbclustvop_reallocblks_vp_offsetssominconnep_pcmcia_get_enaddrcpu_cache_ecxredebuguhci_device_clear_togglepcmcia_matchnchashtbluvm_vnp_syncgdt_free_ccbadw_initcac_devahd_handle_proto_violationXstray_legacy12wsmux_set_displayarpt_downwsmoused_wakeuprdgetdisklabeltwe_scsi_cmdwb_mii_writeregpckbd_cdbpf_tapwds_initapm_set_verwsmousednge_startmii_phy_autotrap_typeswe_set_mediamax_datalenuhaminphysmsdosfs_initohci_device_ctrl_startvop_readdir_descwi_write_record_ioesp_cdtag_wordfmulp_ext2fs_writeisa_dmamem_maplf_clearlockbioscnpollci8254_delaysiop_resetbusurl_memip_srcrouteip6_accept_rtadvsys_setregidtrm_RequestSensepcmcia_cdusbd_device2interface_handleurl_csr_read_1ccdlockusbd_dopollne_pci_prodvinvalbufpckbc_poll_datamii_bitbang_writeregmainbus_attachsys_ftruncateuhci_device_isoc_startm_splitisp_doneefstopuhci_remove_hs_ctrlncr53c9x_attachahd_add_scb_to_free_listfifo_pollurl_stoptcp_timer_initpdq_runeisaattachaicintrnd6_maxnudhinttcp6_inputwdc_atapi_donesosetoptehci_set_qh_qtdtcp_mssahd_sg_virt_to_buscache_purgeskcprintti_attachbpf_mcopyax88190_mediachangexl_attachpcmcia_3cxem556_func0siop_printstatspcmcia_intr_disestablishaha_ccb_phys_kvfork1am7990_ioctlcurpcbec_readmemvfs_hang_addrlistst_cacue_tickmrt6statdead_writeufs_dirrewriteinsmntquettreadtk_cancccac_l0_intr_pendingvga_initext2fs_blkfreeudp_outputfind_last_setcd9660_vnodeop_entriesahd_acquire_seepromdelay_functcp_rndiss_msbsys_chmodccdsizeahd_inwwb_rxeofprelist_removeffs_vgetaxe_encapinitprocahc_set_unitisapnp_config_isa_dma_check_bufferti_init_rx_ring_jumbo__umoddi3pci_intr_stringvia82c586_init_isa_dma_alloc_bouncebufip6_log_intervaltrm_DataIO_transferuvm_page_physdumpiha_append_pend_scbrootconfccdbuffercac_ccb_donesyn_cache_timervt100_initchartablespccbb_pcmcia_do_io_mapsolisten_filtopspci113x_insertin6_update_ifa__wdcerroriha_busfreeep_mii_sendbitscdce_detachvop_bmap_descXhold_legacy4dpt_pci_attachsuser_ucredfxp_startray_cmd_is_scheduledisapnp_mergeahd_read_flexportsd_shutdownwi_shutdownmem_noext2fs_buf_allocdp8390_startxl_start_90xBuhci_free_stdpciaddr_resource_reservebge_startiha_switchep_pcmcia_detachstwriteXhold_legacy1revarprequestkernel_mapuhci_device_isoc_enterwi_init_iodumpdevray_simple_cmdcompare_st_dataCONST_PI2cd9660_lockdc_list_tx_initem_check_polarityietintvia8231_set_triggerfdivr_vfs_mount_foreach_vnodekqueue_kqfilterbge_newbuf_jumboaac_free_ccbip6_mrouter_donewi_mgmt_xmitpckbd_enablepccbb_pcmcia_readpccbb_pcmcia_mem_mapaac_scsi_cmdzeroin6_addrstrncasecmpFPU_st0_ptrrl_tickohci_device_bulk_startwdc_atapi_minphysisa_defaultirqin_ifaddrnd6_optionwin2unixfnmax_hdrrbus_deleteffs_readm_freevop_default_descahd_get_sdscb_qoffne_pcmcia_dl10019_get_enaddrpccbb_pcmcia_socket_enabletrm_write_allscsi_inqmatchfdesc_poolusbd_add_drv_eventpcic_queue_eventcmd_pci_intrvop_strategy_vp_offsetspool_page_allocin_pcblookupfilt_pipewritecd9660_pollm_tag_delete_chainpool_head_slockahc_actionbzerosis_miibus_readregfxp_pci_devicestickfixintervaladw_reset_ccbmii_bitbang_syncufs_closeahd_list_lockinitem_tx_abs_int_delay_dfltfixjobcpcdisplay_getcharehci_shutdownpci_subclass_daspscsi_execute_xsbge_txeofin6_addmultirn_newpairvop_setattr_descsis_devicessys_obreak__udivdi3fxp_powerusbd_set_config_noiha_xfer_datargephy_cdusbpollpciide_cdcpu_classintrlevellastddateaic_isa_probeem_check_downshiftadv_pci_devicesahd_cdaac_sa_qnotifyin6mask0bpf_validateusbd_get_string_descvaccessmpt_resetieinitaac_rx_get_mailboxstatusuao_set_swslotmbinitisapnp_attachmpt_pollusbd_get_reportsk_ticktxp_rxbuf_reclaimvga_common_attachwskbd_default_bell_datavga_cdamap_allocVOP_LOCKMD5Finalaic_datain_piofxp_cardbus_detachpckbd_cnpollcwskbd_matchsd_scsibus_opscp_timeaxe_rxeofcd9660_vget_internalwi_intrukbd_keydesc_usne_pci_matchrl_pci_matchvgetrd_attachuha_isa_attachCONST_QNaNaac_completeahd_sglist_allocsizewinChksumcb_resetserverworks_chip_mapiop_hrt_getfreeclusterchainmld6_initray_recv_authprocfs_checkiopermdisk_initi386_cpuid_featurescd9660_fifoop_opv_descohci_hash_rem_itdohci_bus_methodsahd_scb_timer_resetAPTmaprip6_ctloutputwdcrestartcardbus_cagdt_pci_probenetiompt_cdaue_sendusbd_getnewaddrnd6_na_outputmpt_read_cfg_headerpcic_isa_caext2fs_fhtovpumass_cbi_transferext2fs_createdpt_hba_inquireem_local_timerXhold_legacy9cpu_idusbd_bulk_transfer_cbwi_sync_mediavfs_opv_init_explicitpipe_pollnsphy_capcic_chip_io_allocbmtphyattachsysctl_dopoolcd9660_fifoop_puhub_matchep_detachahd_targetcmd_offsetaha_devpmtu_expiretcp_respondsys_readvamap_cow_nowroundrobinapm_periodic_checkuvm_map_createvfs_opv_initissignalwdprintCopybuffer_sizeiop_tfn_printnetclspcibios_cacdevvpuhci_intrpci_intr_route_linkbha_create_ccbsigmp_joingrouprandompolluiomoveohci_device_isoc_donewi_usb_wridrespfsubr_msdosfs_startdeviocwi_intr_ackXstray_legacy13FPU_roundpciide_dma_table_setupbpf_reset_dnd6_dad_stophid_start_parseuseloopbackepic_set_rx_modeuvm_waitfilt_apmreadnexecsststartnge_eeprom_putbytexl_powerapm_op_inprogpmap_referencereg_subsys_bindax88190_mii_statchgray_disableloioctlrw_exit_writetrm_ReleaseSRBpmap_bootstrapipsec_auth_default_levelldt_freesys_mquerypcic_isa_alloc_iobasebigadjkmeminit_nkmempagesspec_vnodeop_entriesiha_xpad_inusbd_new_devicewi_pcmcia_detacheisa_devinfofdsizeray_find_free_tx_ccswdzerorefamd756_pci_icuscsiforcelun_busesfillinusemaprecvitfill_kproc2ep_media_changeahd_done_lockfxp_scb_cmdcom_pcmcia_enableXspllowerfp_etcti_alloc_jumbo_memfilt_sowritecnpollcuvm_kernaccsys_linkahd_platform_set_tagslog_openevcount_initdpt_eisa_cafragtbl124userconf_totdevtxp_download_fwvop_inactive_vp_offsetsahd_outwrt_ifmsgrt_tableswdc_atapi_real_startrealitexpireipstatunix2dostimetrm_get_dataahd_force_renegotiationscsibus_caiha_reset_tcsurl_newbufusbd_delay_mscnputcpool_page_free_kmemcrfreeec_capcic_attach_socketsfsubrpgdt_pci_attachami_raw_devip6_lasthdrdl10022_mii_bitbang_opsstack_underflow_iahc_clear_intstatohci_device_isoc_abortuhub_uhub_caepic_input_eepromwmpt_print_scsi_io_requestpool_sethiwatwi_read_record_usbwsemul_vt100_output_c0c1wdgetdefaultlabelahd_devlimited_syncrateahd_update_modesgdt_enqueueahc_print_scbxl_resetuvm_swap_getepmbuffillpciide_serverworks_productsext2fs_reloadif_detach_rtdeleteXstray_legacy15elf32_copyargsisochariha_pop_free_scbiophymatchuvm_km_alloc1siop_cdcdopentcp_usrclosednsphyter_caaue_ifmedia_stsphysmemiop_ictxhashurl_cdwskbd_holdscreensm_pcmcia_ascii_enaddrinferiorukbd_attachclusterallocahc_abort_scbsXrecurse_legacy7bioscngetcext2fs_fifoop_pinitrtclockltsleepwskbd_attachin_pcbbindmpt_wait_stateXrecurse_legacy4umass_cbi_statesis_attachmtdphy_caxl_mediacheckuhci_timeout_taskuhci_root_ctrl_closertalloc2endtsleepwihap_check_txpckbc_isa_intr_establishuvm_pageratopsigactssharepcdisplay_attachpcic_poll_intrbpfattachpccbb_chipinitif_detach_queuesitimerdecrusb_create_event_threadether_outputpci_cdem_phy_setup_autonegbpfilter_lookupm_copym0trm_DataInPhase1ahd_sync_sensevga_init_screenaxe_miibus_readregvm_physmemiso_shipdirrdwriteintel686_cpu_setuprnd_timeoutahc_softc_insertbios_memmapicmpmaskpipe_ioctlwskbd_enablecd9660_mountrootnetlckbpf_allocbufspcic_isa_attachmsgbufmappedohci_device_setintrcomprobe1getphysbufkue_fix_segaha_donecdsizeuhci_device_ctrl_startumass_lookupupl_activateufsfifo_closewakeupsoftdep_slowdowngetnanotimebiosclosewdc_pcmcia_disk_device_interface_callbacki386_get_iopermpciide_matchresume_pop_gstcprexmtthreshkprintf_mutexahd_assert_modesclassnamesrt_getifawi_get_fid_ioahd_search_scb_listepic_start_activityviac3_rnd_tmoenosyslockmgrpccom_isa_cartlabel_name2idisp_uninituvm_vnodeopsisa_dmadonevfsconfami_copyhdscompwroffpccom_xr16850_fifo_initVOP_OPENef_cdurio_attachwsdisplay_console_inittedbuckstringuhci_device_bulk_startsiop_scsicmd_endusbd_fill_deviceinfosk_shutdownscsi_interpret_senseXstksqphy_cdext2fs_flushfilesfakeintrwe_mediastatusmsdosfs_vnodeop_pcomconsattachedwi_usb_txeof_frmbrgphy_probelxtphyattachufs_readlinkrdopendoscheckpathcac_eisa_matchpcbmapgdt_pcinew_copy_cmdnd6_option_inituvm_km_alloc_poolpage1brgphy_serviceskc_devicespiix_setup_channelahd_pci_probeiha_state_4egprobeem_print_debug_infoti_loadfwin6_init_prefix_ltimessoftdep_change_directoryentry_offsetnchstatsmsgbufpcd9660_fhtovpE_ldsa_abs_selected_Usedsys_setgidpcibios_entry_infouserconf_common_attrfd_dev_to_typeswapconffilt_ufswritert6_flushrd_ioctl_serverehci_timeout_taskaic_cduvm_mlk_call_pcdisplay_scrlistsis_read_macatapiscsi_attachE_ldsa_abs_slot_Usedmmrwepic_intrffs_bufatofffdcattachem_init_hwwi_usb_rridrespuvm_errno2vmerrordohooksahc_find_pci_deviceiha_state_8ahd_print_registerresume_pop_estrig_apcscp_adapterem_pci_set_mwiwdc_atapi_tape_doneehci_free_sqtd_chainukbd_activateem_disable_intrsiop_sdpresume_pop_dsaue_setmultiif_detached_ioctllocnampmpt_pci_matchadv_pci_matchvop_close_descwi_usb_cacom_pcmcia_attach2i386_has_xcryptuserconf_showip_mtudisc_timeout_qwe_mediachangeaac_copy_internal_dataupdate_cpuspeedffs_fhtovpgetvnodefilt_ufsvnodepool_setlowatray_initkmembaseXstray_legacy1iop_msg_allocrip6_inituvm_aiobuf_poolisofncmpnpxintrpcmcia_card_detachwb_resetsysctl_emulsys_sigprocmaskvga_load_fontahd_pci_read_configray_attachreg_load_doublein6_if_upfilt_pipereadukbd_keydesc_ukskip_spc_rightpchb_rndbha_queue_ccbsoreservepidtakenu14_polltl_attachwsmux_displayioctlCONST_PIuvm_mmapusb_activateufs_quotactlaroundin6_pcbnotifystrrchrusbd_clear_endpoint_toggleaha2840_load_seepromst_check_eodgetdevvpbge_resetpci_mem_finddefrouter_selectamap_unrefext2fs_statfscrdupamap_wiperangetickdeltaisodirinocfrootslease_checkchrtoblksiop_get_lunswahd_get_pci_slotscsiprintbge_inituserconf_pdevnamminphysukbd_matchmicrotime_funcahd_sg_bus_to_virturl_tickrtalloc_noclonetimeout_mutexcd9660_specop_opv_descether_addmultivga_burneropti82c700_getclinkvop_mknod_descvga_ioctlfdcstartcdce_cdip6qffs_vptofhifunitvfs_isbusybha_isa_attachbawritetputcharan_reset_isa_bus_dmamap_unloadwskbd_detachcyrix6x86_cpu_setupre_diagi386_nocpuid_cpusffs_fragacctahd_sync_tqinfifosys_fchowndcphy_attachvwaitforioskc_attachmii_phy_tickcd_read_subchannelextendfilexe_cycle_powerlortrequesticmp6_inputwsemul_vt100_outputuserconf_addgdt_waitwb_deviceswdc_atapi_resetohci_device_intr_methodswi_func_iocreatededivide_kernelbge_writereg_indsbreleasemsdosfs_islockedtrm_DataOutPhase1bios32_entrymax_linkhdrumass_attachem_dma_freewsdisplayioctltm86_cpu_nameviac3_rnd_presentsysctl_rtablemsdosfs_reclaimvop_mknod_vp_offsetssqphy_servicesetregionuserconf_hist_eocfxp_stopext2fs_getattrrtlabel_id2nameapm_standbysbdroprecordXhold_legacy15arith_invaliduvm_coredumpahc_find_periodisapnp_unconfigem_write_phy_regpmap_tlb_shootdown_qwdsizeapm_cpu_idleray_if_startrl_pci_devicesacphy_statusip6_sysctlsuseran_pcmcia_matchpcibiosattachdiskconftl_intvec_rxeofvn_syncer_add_to_worklistusbd_get_interface_descriptoriestartwi_pci_plx_attachgdt_freetk_ninsysfilt_opspciide_mapchanclusterfreempt_pci_link_peerrootdevisapnp_alloc_regionehci_device_isoc_startufs_ihash_slockm_tag_firstee16_eeprom_inbitstrm_Disconnectem_82547_move_tailcdmatchi386_cpuid_ecxfeaturesvga_setscreentypeusbd_get_config_descriptorclock_expandyeartxp_download_fw_sectionpciide_machdep_compat_intr_establishdumpsysicmptstampreplif_detached_watchdogusbd_ar_pipecy693_setup_channelext2fs_fsyncdoforceuhci_root_intr_startiha_intrsys_fsyncwi_usb_stopuserconf_add_readusbd_reset_portep_isapnp_matchifconfsiop_led_onpciide_pci_intrcpu_apmwarnamap_wipeoutuser_configtcp_rndiss_nexttcp_outputnsphyattach_bus_dmamem_mmaptrm_ResetAllDevParamwsdisplay_emul_attachbha_doneupdate_ledsext2fs_updatetcp_timer_2mslne2000_writememaue_openpipesvr_shutdownffs_reload_vnodeif_addgroupmsdosfs_setattrVOP_RMDIRmpt_send_port_enablecac_flushpool_allocator_freefilt_proceopnotsuppsk_stopfifo_lookupahc_validate_offsetffs_reallocblksrootvprandomcloseaxe_miibus_writeregmpt_print_requestem_print_hw_statstrm_pci_attachpcmcia_intr_establishuserconf_maxlocnamespool_reclaimusb_quirksahb_findpci_subclass_serialbusbpf_sysctlvflushehci_openef_ifmedia_updiop_submatchcddetachtcpctl_varsarptimeradw_asc38C0800_mcode_dataset_pci_isa_bridge_callbacktcp_reass_limitm_copymruaddrdstrategyam7990_initmouse_copy_extend_charpcic_chip_io_mapif_upehci_intr1ne2000_ring_copyde_caupl_intrsis_setmulti_sisrgephy_resetsis_setmulti_nsclock_broken_latchVOP_BWRITErt_timer_queue_createahd_fetch_transinfowddonemsdosfs_ioctlpchb_caupl_matchspllowerwdc_isa_attachsk_rxcsumsys_openurio_matchtl_dio_read32inet6domainvga_pci_cafxp_pci_attach_bus_dmamem_alloc_rangepgdeletepccbb_ctrluvm_pageidlezerophtree_SPLAY_MINMAXraw_attachpcib_printuhci_noopether_ip6multicast_maxpipe_poolpccbb_rbus_cb_space_freeuao_initvop_abortop_descadw_asc38C0800_mcodeioprbs_timeoutbus_space_unmapxe_mdi_readifa_ifwithroutespec_kqfiltertcp_notifycd9660_tstamp_conv7randomattachsys_sstkem_smartspeedrtflushclonegetblkmouse_pasteti_jfreeem_tbi_adjust_statsdead_vnodeop_pdl10019_stop_cardcac_l0_submitmouse_copy_endmaxsmapaic_resettrapwritewdc_ata_biosoconnectwskbd_repeatpcibios_get_statuspccbb_detect_cardnobuffers__lshrdi3rtrequest1usbd_errstrisa_nmicnsetdc_crc_letcp_identtcp_rst_ppslimrtrequestuhci_openifinitcd_load_tocunpst_recvspacedc_miibus_statchgne_pcmcia_attachkue_initraw_inputcd9660_reclaimiha_next_statekue_ioctlfilt_logrdetachtrm_MsgInPhase1pccbb_intr_establishaacminphysnd6_ifattachunpdg_recvspacepipe_closecd9660_inactivertcdrainahd_compose_idsoftdep_mountmsdosfs_rmdiruvm_km_getpageiha_timeoutahd_inb_scbrampcic_intr_probemsdosfs_fsyncsmc91cxx_initcfdataffscardbus_save_barahc_index_busy_tclwi_usb_tx_lockusbd_do_request_async_cbufs_checkpathem_init_eeprom_paramspfxlist_onlink_checkm_tag_findinittodrxl_miibus_writeregadw_alloc_carriersahd_parse_msgvga_mapcharapmadler32vputmpt_disable_intsdk_establishtcbhashsizecd9660_setattrusbd_get_configan_pcmcia_activatecyhc_slockufs_quota_initkqread_filtopsusbd_setup_pipeiop_initiator_unregisteraue_csr_read_1pcmcia_check_cis_quirksem_read_part_numiop_reconf_threadbioopsti_eeprom_getbytewe_ring_copymsdosfs_statfslboltpipe_inittrm_set_dataapm_set_powstatebce_cdusbd_open_pipe_intrapm_majversyncerprocpcmcia_card_gettypesmc91cxx_attachufs_ihashinsin_setpeeraddradw_pollwdcactivateeephymatchinphymatchmpt_doneefbusyeepromwsdisplay_delscreenkvtopether_ifdetachtwe_pci_matchvop_fsync_vp_offsetspcdisplay_cauhidev_get_report_descdiv_smalluserconf_histcurrndstatscy82c693_writest_touch_tapemsdosfs_inactivepanicstrwsdisplay_kbdinputupl_newbufumass_scsi_cbpdc20265_pci_intrext2fs_sync_vnodeahc_softc_initunpdg_sendspacesession0mpt_timeoutami_stimeoutu24_initviscpyray_update_mcastisa_nodefaultirqeisamatchE_abs_lunsw_return_Usedray_media_changeahc_calc_residualgdt_growcopyincomparamsiop_common_resetxl_mii_syncep_pcmcia_prodcd9660_defattrohci_device_bulk_closeahc_print_devinfopckbc_set_inputhandlernge_list_tx_initrtalloc1elstopuao_swhash_elt_poolufs_ihashgetne2000_read_hdrsigacts0ncr53c9x_dequeuepccbb_cb_intr_establishfindblkmajorpager_mapntohlsorflushxmphy_mii_phy_autottioctlarpintrqttycharsslpqueohci_root_ctrl_methodsvprintfan_media_changesyncdelaywi_usb_infofrmahd_assert_atnffs_mountahb_pollext2fs_specop_entriestrm_ResetSCSIBusicmp6errppslimXresumeusb_neventsstack_underflow_poppool_inactive_timedp8390_mediachangewb_list_tx_inituhci_add_intrconfig_process_deferred_childrenohci_ifcdwsdisplaywritepool_cache_reclaimin6_setmaxmtuem_carbus_pccbb_parent_memmsdosfs_rootmii_bitbang_sendbitsusbd_finishti_mem_settqphyattachfxp_eeprom_putwordahd_setup_noxfer_scbm_tag_getahd_update_neg_tablepckbc_startcpu_vendorsl_probesb_lockdc_attachwb_stopohci_root_intr_abortuhci_pollrt_labelssea_scsi_cmdstge_matchan_shutdownupl_watchdogamd756_set_intrapm_epsuid_clear_isa_bus_dmamap_loadttwriteisa_dma_stats_loadsiha_exec_scbtwe_copy_internal_dataahd_set_scbptrehci_activatere_miibus_writeregswapdev_vpdp8390_resetdead_readufs_pathconffile_poolohci_timeoutAscExeScsiQueuesk_setmultivop_symlink_vp_offsetsunputcendppb_cdpcmcia_verbosewskbd_isset_displayVOP_CREATEprobe_switchcdce_stopcac_eisa_attachvop_readlink_descAscReInitLramuvm_map_referencespec_ebadfphtree_SPLAYnd6_recalc_reachtm_intervalbha_devin_ifinitfifo_closeohci_device_ctrl_closedc_startwi_pcmcia_activatepciide_mapregs_nativein_pcbhashlookupray_download_paramsapmread_filtopsre_eeprom_putbyteem_setup_transmit_structuresgdt_init_cpu_isa_bus_dmamem_mapaac_sa_set_interruptscd9660_vnodeop_opv_descVOP_ABORTOPehci_pcdvr_encapem_identify_hardwareuhci_idoneami_copy_internal_datadefault_chip_mapsys_acceptuha_eisa_matchnsphyter_statusuvm_map_entry_kmem_poolaha_finish_ccbssis_ifmedia_stsem_process_receive_interruptsccdcloseasc_mcode_chksumwi_inquirepccbb_cardenablepccbb_pcmcia_io_alloctcp_rst_ppslim_countukbd_detachcom_pcmcia_enable1if_clone_listsys_futimesccdinitsdgetdisklabelwb_startwi_do_hostdecryptXrecurse_legacy1internal_commandpci_subclass_wirelessin_losingfddumpmpt_scsi_statusbha_start_ccbssis_chip_mapVOP_SYMLINKgeteblkusbd_set_interfacewsscreen_detachfp_nopem_force_mac_fcscsibusmatchvn_ioctluhci_remove_bulkwi_usb_ctl_locknge_attachioprbs_enqueue_ccbufsspec_readaxe_cdpipespaceohci_alloc_stdcmd646_9_irqackip6_sendredirectsdc_eeprom_idlevga_mmapukphy_caitimerfixvr_attachip_stripoptionsaxe_setmultitl_intrsyn_cache_countdc_eeprom_putbytexl_list_tx_initarith_underflowep_vortex_probemediand6_timer_chne_pcmcia_ax88190_set_iobasegdt_pcinew_intrcpu_resetgdt_intrahc_eisa_matchelink_idseqtcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1isa_dmaabortcbbprintohci_detachahd_get_snscb_qoffbdevvpiewatchdogifa_ifwithdstaddrAscInitFromASC_SOFTCehci_cdrbus_new_root_delegatestge_mii_bitbang_opssis_rxeofin6_nigroupxl_cardbus_detachwi_pci_matchuihashdpt_readcfgti_shutdowntcp_keepintvlvop_reallocblks_descxl_shutdowntl_read_eeprompmap_is_curpmapvop_remove_desccdwriteufswrite_filtopsttybgconfig_searchusbd_printgdt_nextuvm_km_valloc_prefer_waitsyn_cache_pooliha_msgin_extendedcom_pcmcia_prodpckbc_isa_matchpci_subclass_mass_storageffs_allocahd_qinfifo_countaue_tick_taskatapiscsi_cdeginiti386_proc0_tss_ldt_initray_user_report_paramsrgephymatchipsec_exp_first_userlphy_serviceplimit_poolip6_defhlimumass_setup_ctrl_transfercd_scsibus_load_unloadunp_connect2usbd_set_pollingrn_walktreepool_prime_pagepciide_ite_productsstclosesys_chownuvm_pagewirevop_lease_vp_offsetsu14_initem_stopin6_joingroupsys_munlockiha_setup_sg_listuvm_anfreeuhci_bus_methodsukbd_keydesc_bedofilereadvipip_sysctlvn_statfileiha_msgintwe_threadrw_exit_readwi_intr_enableip6_mrouter_settablefulluhub_exploreahd_clear_critical_sectionupl_txeofreg_store_int64trm_ScsiRstDetecttcp_maxidlemclpoolststrategycttyioctltrm_clock_periodffs_vnodeop_psys_lstatfilt_rndwriteiha_reset_dmarbus_newpckbc_poll_data1ahc_freeze_devqohci_timeout_taskohci_hash_add_tdiso_uiodirahd_index_busy_tclahd_calc_residualurl_activatenbtportscttyopencd_atapibus_opsahd_setup_initiator_msgoutinet6ctlerrmapaic_scsi_cmdfifo_vnoperateioprbs_cadisknamesXrecurse_legacy9umass_quirkshexdectodecdumplopmap_zero_page_uncachedmsdosfs_mounttl_intvec_txeocnullcnpollcuvm_km_initahd_parse_cfgdatapciide_acard_productsffs_sbupdateahd_dump_card_stateudp_sysctlax88190_mii_bitbang_readvmmapbsyusb_add_taskurl_int_miibus_readregpmap_tlb_shootdown_job_mutexuserconf_histlenusbd_set_protocolpcibios_get_intr_routingisa_intr_allocahd_release_simqvop_mkdir_descrl_txeofukbd_accessopstl_setmodeusbclosepchbattachncr53c9x_resetahd_get_scsi_statusAdwWaitEEPCmdcdce_get_descpciintr_icu_tagsis96x_setup_channelepic_set_mc_tablevmspace0epic_ifstartstmatchscsi_decode_sensettywaitbios_getdiskinfouvm_map_setuptcp_syn_cache_sizebha_attachwdc_default_vtbldpt_pci_matchrl_detachifa_ifwithnetmemchrrd_attach_hookohci_device_ctrl_doneetextqsphy_statusnpxdna_xmmsk_watchdogsqphyattachncr53c9x_scsi_resetadw_enqueueahd_platform_freedc_pci_acpivt100_selectattributepdq_ifinitumass_scsi_setupproc_poolaue_intrali1543_getclinkudp6_inputsys_writemap_forwmergenge_txeofsb_maxvga_50lscreen_monousbd_fill_iface_datawsdisplay_maxscreenidxcnstopcbb_cdihashtblsys_dup2em_phy_resetwdc_ioctl_findwsdisplay_switch1pcic_pci_machdep_chip_intr_establishsiop_productswd_get_paramssys_readlinkahd_set_unitvia8231_get_triggersis_intr__ashrdi3aac_bio_completescsibuszerorefohci_intrcardbus_read_exromwsdisplay_burnep_isa_attachip6_auto_flowlabelgdt_attachskc_cacardbus_mapreg_mapuha_free_mscplf_splitopti82c700_get_intrsk_marv_miibus_statchgifafreeVOP_STRATEGYtzrip_sendspacean_cmdisp_pci_caaac_pci_caamap_addtcp_freequhci_device_requestdvd_authahd_print_devinfogdt_mpr_intrexphy_serviceumass_scsi_cmdcdreadspec_inactivedp8390_stopehci_device_intr_startahd_sglist_sizebge_encapahd_stat_timerwi_func_usbpckbd_cngetci386_has_ssesys_sendtoicmperrppslimgeneric_filtopsknote_dropcue_watchdogin6_selectsrcukbd_keydesc_sg_nodeadpmap_tlb_shootdown_q_drainwi_usb_threadem_82547_fifo_workaroundtwe_startin6_pcbsetportpckbd_initalldevscom_pcmcia_attachfaddp_dp8390_rintsk_marv_miibus_readregwddumpicmp_do_errorvmcmd_map_readvnusbd_get_interface_altindexamap_extendsigpropvmapbufXalignaxe_rxstartisapnp_isa_attach_hooksis_cadehashtblsocketopsXstray_legacy3siop_pci_matchiop_hrt_get0deviond6_maxndoptip6_iduvm_map_clip_startrawcbtablespec_readpcscp_dma_gounp_markPTDacphyattachpcdisplay_scricmp_mtudisc_timeoutnwsmuxskip_char_rightttyread_filtopsuvm_mapbge_release_resourcescac_initpci_conf_writeusbd_bulk_transfervop_lookup_desccac_ccb_startahd_freeze_simqgetinoquotafifo_ebadfaac_rx_set_interruptsscsi_do_ioctlan_setdefehci_free_sqhcd_resettimedeltaxl_txeocuhci_pci_cabicc_isa_probeudpstatmpt_downloadbootsea_devsetrootcd_read_toccdioctlcue_stopsetup_buffersahd_chip_initifmedia_addahc_release_seepromahd_get_sense_bufsizefxp_eeprom_shiftinwe_probei386_set_iopermpcdisplay_mapcharusbd_set_config_indexlogopenpcic_pci_machdep_intr_estiha_wide_doneopti82c700_pci_icup4_model_isa_bus_dmamem_allocbreadndpt_shutdowntrm_cdpmap_tlb_shootdown_job_gettcbtableimaxlevel__xordi3nge_jfreefrag6_draindosdiremptyigmp_slowtimoifpromiscrtl80x9_mediachangeidlesys_getsocknamecd9660_lookupvop_fsync_descep_mii_writeregwi_usb_intrusbd_alloc_buffermask_rnheadvga_40lscreen_monopcdisplay_putcharround_to_intsi_headfxp_cardbus_setupufs_rootray_media_statuspciaddr_searchtcp_sysctlVOP_SETATTRahd_set_sescb_qoffahd_flush_device_writesahc_alloc_scbsusbreadpmap_kremovesigactsinitcbb_pci_caohci_pci_causbd_set_reportahc_eisa_irqaac_describe_codeexec_elf32_fixupsk_init_xmacrt_newaddrmsgvop_generic_lockcomconsiotwb_ifmedia_updan_write_datauvmfault_anongetconsttyvga_alloc_screenpcdisplay_copycolswdc_pcmcia_caunsetgateuvm_pagealloc_stratpmap_tmpunmap_pvepterl_startfdcloseapm_err_translatepcscp_attachusermountext2fs_dirrewrite__ucmpdi2vn_closefileumass_discopci_findvendorip_mtudiscvfs_free_netcredpool_cache_do_invalidatemld6_start_listeningkue_matchpmap_kenter_paufs_whiteoutpidhashtblaue_matchusbd_get_protocolfmul__le_isa_probeiop_status_gettcp_drain_bpamierrsea_get_scbtrm_RewaitSRBiha_status_msgm_pullupenterpgrpwdc_pcmcia_lookupMPFailisp_resetcnbellm_copydataXhold_legacy11intrhandumass_atapiscsi_devpcic_chip_mem_allocwdc_atapi_timer_handlerwsscreen_attach_syncray_ioctluvm_cnt_headcpu_camtx_leavefilt_signalsigactsfreewdc_default_write_raw_multi_4FPU_st0_tagttymallocahd_set_sdscb_qoffpckbc_cdupl_attachpoly_div4sd_scsibus_get_optparmswsdisplaykqfilterkue_setmultipcisubmatchegioctlmmioctlumass_matchsendsigohci_device_ctrl_methodspcdisplay_emulopsbpf_ifnameehci_allocmohci_cdxe_initvfs_busymouse_copy_extend_afterfilt_ufsdetachiha_state_3sis85c503_set_intrlf_getlockieresetsolistenami_switchray_detachwskbd_compose_valueAscInitFromEEPip_ecn_ingressmsdosfs_bmapfifo_bmaprip_ctloutputffs_vtblif_getgroupem_set_promiscuserconf_morekqueue_ioctlec_cddc_mii_writeregem_free_pci_resourcessys_wait4rip6_recvspaceamap_share_protectusb_all_tasksfs_sysctltl_mii_syncukbd_cnattachxe_pcmcia_activatewe_paramsfilt_sordetachwsdisplay_console_confsys_osigaltstackusb_task_threadahc_execute_scbaic_pcmcia_caisa_intr_checkxmphy_servicesmc91cxx_startti_newbuf_jumboamap_pp_establishwb_rxeocvr_list_tx_inituvm_anon_initffs_reclaimbmtphy_causb_free_deviceAdwReadEEPWordpmap_zero_physpmap_virtual_spaceahd_attachamd756_set_triggerusb_disconnect_portsis_txeoftcp_quenchbpfpollnumemptybufsCONST_Zupdatepriohci_activatempt_do_uploadahc_timeoutAdwInitCarriersbmtphy_serviceuhci_device_bulk_closewskbd_cnbellipendingaic_dataout_pioapm_errorvt100_decmodexmphy_statusuhci_intr1pciide_print_channelsahd_donewi_seekfilt_soreadmpt_get_iocfactszeropageipsec_def_encpool_logsizegdt_pollingle_isa_intredgeip4_input6pdevinit__iordi3le_isa_wrcsrnsphytermatchinetctlerrmapffs_specop_opv_descresetprioritympt_read_cfg_pageenoioctlahd_construct_sdtrwi_usb_start_threadioprbs_devsigacts_poolXosyscall_endexecsigsconfig_initrl_ifmedia_updbios_pciinfoicmp6_redirect_inputiha_push_pend_scbpckbc_set_pollaue_read_macpciaddr_print_devidnpxinitdc_ifmedia_updst_interpret_senseepresettl_startpmap_tmpmap_pascsistrategynd6_ra_inputin6addr_loopbackttypendvprintnormalize_nuoin6addr_linklocal_allroutersqsphymatchin_revarpinputstrlcpyxe_mediastatusdc_setfiltdpt_cdbge_miibus_statchgehci_device_isoc_methodsgdtminphysusbd_reload_device_descext2fs_advlockknote_fdcloseefcompletecmdvop_lease_descehci_device_intr_donexl_setmulti_hashif_clone_detachpipe_rfiltopsahd_get_scbptrahd_currently_packetizedcomcninitimaskin6_cksumahd_dump_sglistpciide_print_modesstrncmpvfs_opv_numopsXstray_legacy8vfs_shutdowngetsocknge_capccbb_pcmcia_card_detectepic_ifioctliop_intrupl_startmouse_hidein_interfacessyn_cache_respondnatsem6x86_cpu_setupllinfo_nd6sbcheckreserveuvm_iopreemptunixdomainuha_timeoutahd_resetwscngetcuvm_tree_RB_REMOVEsis_startscsibusattachbios_diskinfoetheripstatsyn_hash1xl_list_rx_initulminwihap_data_inputahd_set_widthproc0paddrrn_addmaskali1543_set_intraha_queue_ccbtrm_linkSRBray_ccs_donepciaddr_do_resource_reserveahc_resumeusb_attachbpf_bufsizeselscanahc_pci_capciide_promise_productssoo_pollsmc91cxx_stopukbd_keydesc_dk_nodead_randseedeg_cdpoly_div16sig_filtopsohci_device_bulk_transferukbd_cdaac_sync_fibwskbdopenem_startttclosurl_rxeofipsec_soft_allocations_bus_dmamem_mapst_mount_tapenet_sysctl_vga_scrlist_monovop_getextattr_vp_offsetsffree_wskbd_do_ioctldead_ioctlec_mediachangefill_eprocpdq_interruptaue_initusb_matchFPU_Arith_exit__wdccommand_startsysctl_iflistrl_watchdogep_read_eepromtxp_command2AdwSendIdleCmdvwakeupcmd680_channel_mapbha_pci_caXhold_legacy7pci_subclass_bridgeif_clonersahd_validate_offsetwdcbit_bucketvgonewdc_probe_capstcp6_ctlinputusb_allocmemfld_i_ufsspec_closene2000devsnd6_prefix_offlinkuvm_anon_dropswapdl10019_mii_bitbang_readwi_detachigmp_inputvop_ioctl_vp_offsetskmemusagelf_getblockusbd_add_dev_eventec_probepciide_irqacksis_mii_writeregpmap_pmap_pooltcp_rttdfltcleanerprocisa_strayintrpdc202xx_pci_intrfifo_reclaimsbappendstreamm_tag_copy_chainload_store_instrepic_miibus_readregunion_check_pusbd_intr_transfer_cbpiix_set_triggerfdformatahd_platform_intrxe_cduha_eisa_causb_event_threadee16_eeprom_outbitsisa_mem_headsowrite_filtopstl_ifmedia_stsstrncpymc146818_writerevarp_in_progressgdt_exec_ccbi386_cpuid_cpusbge_watchdogsdreadicmp6errratelimsys_opipeep_statchgupdatefatscue_memata_perrorvfs_getvfsaue_txeofffs_sync_vnodencr53c9x_sensebge_free_rx_ring_stdahd_aic7901A_setupproc_stoppcic_pci_carrticks_initXhold_legacy0usbd_set_port_featuredelaycountpcibios_flagsbpfilter_createsysctl_lockax88190_mii_writeregtl_prodslockfpoolahd_done_lockinitahc_set_tagsvga_console_vchtonluvm_km_kmemallocusb_find_descin6_mask2lenmrt6_ioctltcp_dooptionsdos2unixtimesys_sigactiondeupdatehci_ifcd_isa_bus_dmamem_freesoftintr__negdi2npxsave_cpuin6_purgeaddrcpu_modeluhci_softintr_bpamiccbffreepiop_msg_polluvm_tree_RB_FINDcttyreadcd9660_unlockisp_put_gxn_id_requestahd_set_sense_residualsis_eeprom_idleuserconf_cmdswsdisplaycloseahc_tailqidle_exitiophy_statusschedclockbpfioctlconfig_attachohci_alloc_sitdcue_rx_list_initdl10019_init_cardfxp_write_eepromahd_execute_scbep_pcmcia_enablesis_initbmtphy_statusnpx_cdray_reset_resetloopsysctl_filedisk_unbusysoisconnectedmpt_run_xferray_intramap_clean_worksti_handle_eventsuhci_alloc_std_chainusb_block_freememetherip_sysctlVOP_PATHCONFumass_fixup_sonydk_mountrootwsscreen_detach_syncgdt_sync_eventahb_care_rxeofvattr_nullrw_enter_waitsys_getsockoptwds_findpdq_stopahd_release_seepromuhidev_attachtwe_cdstge_copy_smallfrag6_nfragpacketsefstartvr_mii_writeregmul64reg_store_extendedwildcardpcscp_cdtl_list_rx_initpckbc_consdatafxp_add_rfabufxl_encapray_send_authin6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlan_cdcpu_matchite_chip_mapVOP_READLINKumass_cbi_methodsufs_seekahc_chip_initmii_submatchohci_root_intr_transferwsdisplay_unset_cons_kbdmsdosfs_pathconftimeout_wheelbpf_m_xhalfpdq_os_receive_pdupcic_wait_readybge_ifmedia_stsfdioctlaverunnablecd9660_getattrttyfreemtd_cdcom_pcmcia_matchttysleepwi_pci_capmap_do_tlb_shootdownehci_root_intr_doneahd_handle_scsi_statusdp8390_initaic_devunp_disposerd_open_hookufs_getattrVOP_GETEXTATTRvfs_exportscsi_inquirepcic_submatchbge_ioctliop_pci_attachiha_minphysuvm_km_pgremoveramdisk_ndevsbiosattachex_region_plfscaleisapnp_unmap_readportahc_reset_channelpciintr_icu_lookupip_optcopyxe_pcmcia_camc146818_readpci_intr_mapvfs_registersys_dupmcllowatmii_printbpfilterattachiop_systabAdwResetChipwb_cdisapnp_newdevsd_atapibus_opspolynomialadw_asc38C1600_mcode_datatimeout_todopcic_event_threadwsemul_vt100_scrollupahd_wait_seeprompaniccue_rxeofmsdosfs_lockseltrueeisa_cawsdisplay_console_devicepci_subclass_systembpf_m_xwordepwatchdogahd_compile_devinfoti_rxeofsoftdep_initializexl_rxeofunp_shutdownreg_store_int16wi_resetami_allocmemahd_qinfifo_requeue_tailahc_run_untagged_queueext2fs_sysctlcluster_callbackkthread_run_deferred_queuesmc91cxx_idstrsbha_free_ccbvop_lock_vp_offsetswdreadlastdaycheck_execwi_usb_cdtcp_initpcmcia_attachdeferred_config_queuedp8390_getmcafisapnp_flattenahc_platform_allocray_cmd_cancelem_wait_autonegipport_lastautouhci_endpdwsmux_detach_scsis_setup_channelcom_raisedtrcd9660_fifoop_entriesahc_unbusy_tclami_pci_matchbios_sysctlahb_initicsphy_statuswinSlotCntvn_kqfilterem_validate_mdi_settingext2fs_syncep_mii_readregvga_40lscreenpciide_intr_flagcache_purgevfsfxp_mdi_writeem_led_offpostsigsys_pathconfcue_open_pipesin_addmultigetmicrotimexmphy_cdmaxumass_clear_endpoint_stallnpxdna_s87ohci_setup_isocaue_newbufbge_rxeofscsi_probedeviha_data_over_runmpt_print_event_noticetcp_templateepic_rx_donemsdosfs_readam7990_zerobuf_contigahc_pollcomopenohci_initusbd_setup_xferisa_dmamem_mmapsata_setup_channelispdevahd_dump_all_cards_statepiix_chip_mapbcopyfxp_read_eepromurl_tick_taskef_mii_synccue_detachusbioctlle_isa_rdcsreftxstatepic_tickAdwInquiryHandlingkqueue_wakeupip6_unknown_opttcp_reasssys_getfhcomcnputcext2fs_vgetrt_timer_timerehci_alloc_sqtdahb_scsi_cmdaxe_resetdefrouter_addreqin6_clearscopefifo_vnodeop_entriesmainbus_printusbd_set_addressne2000_readmemwb_ifmedia_stsffs_setblockipsec_expire_acquirekue_stopwsscreen_switchwaitiop_systab_setmemcmpti_free_rx_ring_jumbowskbd_init_keymaposb4_inittl_shutdownmsdosfs_createcd9660_startahd_platform_abort_scbscomstartpmap_try_steal_pvpool_allocator_kmemcfroots_sizepdq_ifstarttickadjehci_pci_alldevssiop_clearfifoelattachbiosioctlvop_rmdir_vp_offsetsvga_isa_cnattachsbreservebtportsvrecycletrm_write_cmdcpu_brandstrahaattachem_phy_hw_resetan_read_datareserve_dumppagescrcopyray_update_params_donewdclosesys_revokeip6_setpktoptionssysctl_stringsys_rebootmpt_print_dbbufpooldl10019_mii_bitbang_writefdopenMCFailwdccommandextpcdisplay_cursor_init_bus_dmamap_load_buffercpu_forkan_startdpt_scsi_cmdwi_write_data_ioahd_busy_tclcardslot_event_throwttylistre_initwdopenuvm_vslockxl_mii_send__bin2bcdahb_devttyoutputkue_cacd9660_tstamp_conv17wskbd_calxtphy_statustqphy_cdwdc_atapi_intr_completeep_pcmcia_enable1pcmcia_scan_cisclockintruhci_root_intr_abortahc_pci_probern_mkfreelistahd_parse_vpddataahd_initVOP_READvop_bwrite_descin6ifa_ifpforlinklocalufs_ioctlffs_freefilelastdtimeAscFindSignaturesys_setuidcardslot_cd_wdc_ata_bio_startxl_setcfgioprbs_intrstart_updatesiop_common_attachusbd_clear_port_featurepcic_pci_machdep_chip_intr_disestablishre_stopufs_quota_free_blocks2intrstraysenditisadma_dmamtl_ifmedia_updintel686_p4_cpu_setupioprbs_enqueuecluster_writernd_event_tailwb_miibus_readregmpt_scsi_statempt_send_ioc_initapm_dobusyuriopolluvm_setpagesizeehci_root_intr_closetcp_xmit_timerst_rewindin6_recoverscopevga_50lscreennsphy_servicecac_l0aue_tickvia82c586_get_triggerelprobetickmclpool_warnmsgscsi_preventmmclosenumfreepagescd9660_accessahc_search_untagged_queuesstge_mii_bitbang_readsk_xmac_hashffs_statfsuhci_shutdownfucompiegetiha_msgout_sdtrwdcprobeiophy_cdudp_recvspacewdc_ioctl_strategyvr_probeefinitsyn_cache_unreachuserconf_histszsys_getrlimitaac_sa_get_fwstatusbpf_attachdicmp6_ctloutputahd_set_tagsreg_load_int16ufs_dirremovetrm_timeoutpci_bus_maxdevsrgephy_servicecinitif_attachsetuppipe_writevop_symlink_descin_pcblookup_listensbappendepic_init_ringsm_copybacknextgennumberfxp_mc_setupapm_powmgt_enableiopcloseuvm_swap_puticmpbmcastechofifo_advlockevcnt_attachehci_timeoutahd_set_transaction_statusurio_activatebge_init_tx_ringsm_pcmcia_detachegattachconfig_scanwi_get_nwkeyisapnp_matchpccbb_pcmcia_socket_disablefdfinishsis_tickripsrciso_nchstatskue_txeofem_update_eeprom_checksumscsidebug_targetsnlineswohci_rem_edether_ifattachfdcstatusfstp_iwdsattach__wdccommand_donestge_mii_readregsignal_initnsphyter_servicesk_init_tx_ringffs_updatetrm_pci_cafsubp_wsmuxclosedp8390_getunix2dosfnahc_search_qinfifovga_screenlist_monospec_advlockmtdphy_cdsis_resetfragtblraw_sendspaceisp_copy_in_hdrnullopam7990_meminitre_attachadw_scsi_cmdsis85c503_get_intrtc990imageintrcntip6_ecn_ingressusb_discovercomdiagextralocpcic_isa_bus_width_probeset_precision_flag_upbcedebugsk_encapunsleepti_init_tx_ringmpt_req_statewb_watchdogwdprobeargdevsk_yukon_hashohci_alloc_std_chainpcic_chip_mem_mapegintrwi_pci_tmd_attachgetnanouptimeipintrohci_pci_detachuhci_pci_detachepic_tx_donemaxdmapti_watchdogxl_watchdogalltrapsusb_block_allocmemwe_write_mbufext2fs_symlinkinverse_charwi_pci_plx_print_cistxp_capabilitiesip6_savecontrolpciide_chan_candisableXintrq_to_bisa_mallocmountrootsyn_cache_resetuhci_device_intr_doneuhidev_openaac_enqueue_ccbprocess_read_fpregsip_initreaddeohci_freexbge_jalloccd9660_rrip_getnamegdt_switcheisa_intr_stringufs_check_exportsysctl_rdintpdc20268_setup_channelAPTDgdt_pcinew_release_eventAdwASC38C1600Cablinglodirtypagesre_rx_list_initem_probefindwin95VOP_WRITEsys_nanosleepahd_perform_autosenseahd_rem_col_listip6_flow_seqXrecurse_legacy11cardbus_attach_cardifa_ifwithaddrclock_ymdhms_to_secsepic_miibus_writeregsiop_add_devuhci_root_intr_transferif_clone_attachaic_isapnp_cawsmoused_releasesys_getfsstatohci_abort_xfermpt_get_requestbpfopencom_pcmcia_detachcdstrategyem_config_collision_distnatsemi_irqackapollo_sata_chip_mapahc_suspendsis_encapkmemstatsnd6_slowtimo_chuvm_km_valloc_alignahd_set_syncratenge_rxeofmntvnode_slockiop_msg_unmapadw_devstreadcomwritemouse_copy_selectionwsdisplay_noemul_attachVOP_RENAMEXrsvdcdclosesys_fchdirrtcgetalleventsrandompidmpt_print_ioc_factswd_cdurl_initahd_reset_current_busfilt_ttyrdetacharp_inusewb_setmulti_bus_dmamap_destroyvn_polluhci_device_isoc_methodsinet6swrouteswdosdirtemplatemainbus_cdre_ioctlXhold_legacy13pcibiosprobeisa_dmacountsys_mincorene2000_test_memgdt_cdapm_power_printpoly_atanlastsecondsahd_find_syncratexl_mii_writeregvga_getcharXdnausbd_error_strsusbd_sync_transferu24_pollaha_pollbrgphy_statusffs_vnodeop_entrieslun_switchamphymatchtcp_maxpersistidledc_pnic_rx_bug_warali1543_initisa_mappagefdcprobespec_ioctlxe_pcmcia_detachbge_init_rx_ring_stdufs_initsync_vnodeop_entriesproc_reparentrbus_space_alloc_subregionuvm_exitan_attachsis_cdfc_bmapcallspr_rmpageffs_initcluster_wbuildfd_nvtotypeprocess_xmm_to_s87sis_eeprom_getworduvm_initaue_attachsys_ioctlsys_xfspioctlif_free_sadliha_state_6aac_switchfilt_bpfrdetachwsdisplay_emul_cast_loadquirksicmp6_initfilt_ttywritepool_update_curpagepcdisplay_cursorhid_end_parsein_setsockaddrsmc91cxx_enableisaprintepic_free_ringscy82c693_readrandom_stateeintrcntdpt_eisa_boardstl_softresetbpf_moveinpcscp_caostypevndbuf_poollastpidXrecurse_legacy0uvm_page_physloadfrstorisa_dmamem_allocwdc_exec_xferwdcresetXhold_legacy6ray_start_join_timoipintrqohci_noopepintrwb_miibus_statchgccd_softcxl_detachahd_reinitialize_dataptrsppb_camaxprocusb_frag_freelistpmap_apte_fluship_slowtimordsizepcscp_dma_setupfcom_stip6_nexthdrrtdeletemsg__bss_startapm_disconnectdcphy_cdahbattachdc_setfilt_xircomkue_rxeofisa_intr_disestablishpciide_via_productssiop_attachXstray_legacy14bge_stats_update_regsskc_probeVOP_KQFILTERstge_add_rxbufsys_msyncvop_rmdir_descahd_lockahd_print_scban_cache_storewskbdreadsbappendrecordevcount_detachsd_capcmcia_function_disabletl_dio_setbitsoftdep_fsync_mountdevinitmsgbufehci_device_bulk_startan_alloc_nicmempciide_intel_productsconfig_activatememsetiop_pci_matchpipe_free_kmemti_chipinitufs_getlbnsshrxspmaps_lockohci_strahd_find_busy_tclphysiopcmcia_3cxem556_func0_cfe0mpt_pci_read_config_regshole_endin6_selecthlimupl_senduha_eisa_attachwdattachti_devicessmc91cxx_mediausbd_set_report_asyncapm_minvermii_phy_delete_mediaicmp_mtudisc_cloneread_seepromclass_cmpmath_emulatesodisconnectpool_allocator_oldnointrsys_setgroupsmainaue_csr_write_2asc_mcode_sizeohci_device_bulk_doneusbd_initaac_attachmtdphymatchdc_detachisp_attachiha_reset_scsi_buscardbus_mapreg_unmapahd_setup_iocell_workaroundiop_systab_sizenge_miibus_writeregaac_rx_get_istatuspmap_tlb_shootdownsiop_lookup_productip_flushkue_startre_watchdogioprbs_get_ccbdp8390_configahd_stitch_tid_listreg_load_extendedsiop_scsicmduvm_unmap_removefd_typesisa_drq_isfreegdt_pcinew_test_busyicmp_errorinpcb_pool_initalizedukbd_delayed_decodewsmuxdevsisapnp_caresume_pop_fsupl_rx_list_inituvm_swap_markbadkqueueopsmpt_write_cfg_pagevholdurio_detachpciide_map_compat_intrahd_set_nameahd_sent_msgahd_get_sense_bufwdc_atapi_in_data_phaseusbd_no_quirkre_read_eepromami_startsis_hostbr_matchm_adjfcomppaac_sa_get_istatusmld6_stop_listeningpmap_free_pv_doitppsratecheckscsi_free_xskmemlimitxl_pci_intr_ackahd_intr_enablepcic_intr_socketmpt_print_request_hdrXintrspuriouspcibios_print_exclirqtl_setfiltamap_copyeg_cauvm_rb_spacedevinami_scsi_raw_cmdahd_restore_modesuhci_allocmrl_miibus_readregan_initahd_get_sescb_qoffahaintrlf_findoverlapaic_minphysgdt_devaic_get_acbovbcopywscninitlf_wakelockef_isapnp_cadumpconfwi_rxeof_isa_dma_free_bouncebufehci_pci_detachbrgphy_cahpt_pci_intrfilt_rndwdetachwsdisplay_cons_kbd_pollcsk_attachdead_badoppciide_dma_finishaac_exec_ccbcalcrusys_unlinkrt_setgateahc_find_syncratevr_setmultitcp_ack_on_pushpmap_growkernelext2fs_rmdirsysctl_intupl_tx_list_initkqueue_closewsdisplaystopstrlcatifnet_addrssysctl_int_arrtrm_minphysaic_show_scsi_cmdcdce_matchXstray_legacy0comhwiflowdisk_unlockep_roadrunner_mii_enablepciide_cypress_productsufs_ihashremiha_mainti_encap_tigon2cttywrite_bus_dmamap_createurl_stop_taskpciaddr_device_is_agpsdmatchusb_freememccdopenproc0cdce_initvga_pci_matchufs_renameaxe_caext2gennumberAdwSleepMilliSecondsk_resetusbd_get_hid_descriptorrt_ifannouncemsgsoo_readreg_load_int64ne_isa_matchpciide_vendorsbreadaufs_openwsmuxdocloseehci_pcd_enableshrxpcscp_dma_intrm_catsplxahd_pauseaha_timeoutohci_pci_attachrtinitncr53c9x_variant_namestqphy_statuscluster_collectbufsepbusyeepromsiop_handle_qtag_rejectwi_write_data_usbumass_scsi_minphyssis_probeuvm_swap_initosb4_get_intrpccbb_winsettcp_nowttystatsaue_miibus_statchgbus_space_subregionunp_gcsys_clock_gettimeiha_mark_busy_scbip6_hdrnestlimitpool_catchuppckbd_inputfrag6_initsiop_sdtr_negahc_attachbuf_replacevnodemsdosfs_vnodeop_opv_descadw_async_callbacklba2msfre_miibus_readregbge_miibus_readregtimeout_setgdt_pci_caisapnp_initrdread__subdi3wb_shutdownwsdisplay_resetisa_has_been_seenntohsxl_cardbus_intr_ackmpt_soft_resetxe_mdi_write_bus_dmamem_freeiha_set_ssiginet_ntoange_shutdownext2fs_mkdirohci_openext2fs_direntermii_pollstatrlphy_cawdgetdisklabelpciide_machdep_compat_intr_disestablishst_erasedupfdopenfxp_scb_waitfdivrpifmedia_list_addpidhashvfs_mountrootef_mii_writebuvm_totaliop_msg_postencdebugahc_pause_and_flushworktimedl10019_mii_bitbang_opsbha_pci_devicesvia82c586_get_intrpcic_isa_chip_intr_establishstart_initelf32_olf_check_headeruhub_attachami_pci_attachtcp_mssdfltFPU_data_addressuvm_swap_freetcp_rndiss_sboxti_init2wdc_atapi_update_statuspccbb_pcmcia_io_mapioprbs_exec_ccbtwe_disposeXdbgaxe_initem_init_lockedrnd_wseluhidev_set_reportstge_stopvr_setcfgin_pcbdetachmsdosfs_vfsopsaue_ifmedia_updcomparecd_sizettycheckoutqiha_scsi_cmdicmp6_mtudisc_callback_registerne_pcmcia_detachrcc_bus_visitedaue_carnd_event_spaceiop_config_interruptsahd_inl_scbramrt_getmetricsbge_free_rx_ring_jumbowdc_ata_bio_kill_xfercn_tabin6_ifdetachbge_jfreewdc_atapi_intr_commandip_forwardti_stats_updateextent_createrdclosexl_stats_updatebpf_freeddisklistsys_fstatfscac_intrec_mediastatusurl_txeofkue_devspccbb_pcmcia_mem_unmapm_injectmpt_rd_intrem_mta_setvr_rxeofpci_make_tagahd_reset_pollXdivpci_intr_fixupnd6_setdefaultifaceffs_isfreeblockccdioctlnge_miibus_readreguvm_map_lookup_entryhztoadw_init_ccbicsphymatchvop_pathconf_descahd_aic7902_setupm_pullup2eisa_intr_establishdead_strategywds_doneprocfs_domemahd_detachstge_tickspec_fsync__wdcwait_resetdc_cdip6_optlenpckbc_cmdresponseahbmatchuvm_map_deallocateicmp_reflectaic_initelgetmii_phy_activatepmap_write_protectext2fs_reclaimtwe_cmdisapnp_get_resourceahb_send_mboxpciide_acer_productsffs_ballocsys_getgroupsurio_cduhub_cdaha_cmduvm_km_pages_freewi_start_usbip6_raw_ctloutputsoftdep_setup_allocdirectkernel_textpcic_attachpcscp_dma_stopufs_startahd_attach_to_HostRAID_controllersray_update_subcmdxmphy_probebrgphy_mii_phy_autoohci_devdmpt_wait_db_ackAdwInitFromEEPROMbha_isa_probepccbb_shutdownkinfo_vdebugurl_sendcdce_encapnsphy_resetuvm_rb_insertufs_bmaparrayfragtbl8wscnpollcuvn_sync_locksysctl_initXbptpcmcia_function_enablerbus_new_root_shareXrecursepcdisplay_accessopsurl_resetwdc_get_logusb_needs_exploreufs_quota_alloc_blocks2fc_fileextendsdc_read_eepromre_startvr_txeoffilt_sigattachVOP_FSYNCffs_sysctlipport_hilastautoarpinit_donespec_closecd9660_closeem_initialize_receive_unitcngetcsys_shutdownam7990_resetpckbdattachehci_rem_qhdc_delayrnd_statesahd_extract_mode_stateahd_find_softcsm_pcmcia_lannid_ciscallbackseaintrm_gethdrem_dma_mallocpdq_pci_matchconfig_rootfound_isa_bus_dmamap_load_rawmpt_hard_resetcue_cdputcsiop_resetmtd_intrsysctl_rdstructuhidev_cdtrapumass_scsi_devfdintrem_config_fc_after_link_upschedcpupckbc_isa_caopti82c558_get_triggerec_init_cardtprintf_closevga_stdscreen_monowds_scsi_cmdpccbb_close_winsbappendcontrolnge_ifmedia_tbi_stsukbd_set_ledswsdisplay_screenstateem_get_cable_lengthfddi_inputsiop_update_scntl3pciide_nvidia_productssoftdep_flushfilessea_free_scbipv4_inputm_getclrpool_headfix_f00fax88190_mediastatusncr53c9x_watchnge_delaywsmuxioctlwdc_atapi_send_cmdncr53c9x_msginahd_flush_qoutfifousbd_interface2device_handlewinchip_cpu_setupipforwardingohci_device_isoc_transferusbd_open_pipe_ivalbufhashtblsyn_cache_lookuparc4random_stateprtactivepcic_intrcac_eisa_l0_intr_pendingksym_upcaseufs_makeinodeadw_isr_callbackahd_unpauseip6_process_hopoptsufsfifo_readusbd_find_edescbge_probetwe_completewsdisplay_set_cons_kbdcom_common_putcfifo_writefilt_ttyreadsys_getpgiduhci_runldtcache_lookupwb_eeprom_getwordaac_sa_set_mailboxrdioctluhci_allocxin6_purgeifle_cdurl_detachumass_scsi_sense_cbdp8390_intrwsemul_vt100_handle_dcsin6_ifawithifptrm_GetFreeSRBncr53c9x_doneaxe_detachwskbd_set_console_displayaac_sa_clear_istatusahd_pci_split_intrdumpsizeccdstrategytrm_wait_30usukbd_keydesctabnge_miibus_statchgpci_matchbyidextent_freeuvm_aiodone_daemonusb_cookie_nopdq_pci_attachaddupc_tasksched_syncahc_handle_brkadrintusbd_clear_hub_featureieprobesc_err1comclosecac_ccb_freepcmcia_print_cisem_clear_vftasetsigvecsys_sendmsgan_promiscvn_marktextami_donestrcmpmpt_whowskbd_rem_muxvr_ticksys_quotactluhidev_matchvop_close_vp_offsetsep_vortex_mediarndread_filtopsrl_mii_sendisp_asyncaic_reselectep_isapnp_attachsis_mii_sendtcp_mtudisc_increaseulmaxin6_pcbconnectdehashan_watchdogkue_cdXrecurse_legacy3out_fdchook_disestablishbpf_catchpacketapmerrorsffs_isblockiha_reset_chipusbd_find_quirkuvm_aobj_poolpci_camouse_copy_extendcpu_apmhalticmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrpcibattachrtable_initdp8390_detachata_set_modevop_access_descwsmux_setmaxmii_phy_auto_timeoutsyn_cache_getnetisrttyrubnpxattachrevarpwhoamivop_generic_islockedwsscreen_attachbufcachepercentm_pulldownioprbs_scsi_cmdan_seekacer_pci_intrahd_num_pci_devspmap_initufs_rmdirpsignal1rlphymatchminuhci_device_ctrl_abortfxp_initidtisapnp_configureip6_initconfig_detach_childrenrawcbre_caukbd_cngetcahb_ecb_phys_kvtcpcb_poolFPU_rmti_init_rx_ring_minimii_bitbang_readregvga_selectfontaha_scsi_cmdipip_allowsys_pollFPU_loaded_datauvm_map_clip_endufs_makedirentryusbd_set_configfindcpuspeedrl_list_tx_initfpa_cdem_write_pci_cfgegrecvvnode_hold_listlastdosdateahc_intr_enablesk_alloc_jumbo_memuhci_add_bulkufs_linksys_mkfifoifa_ifwithafaha_initiha_msgout_wdtrisa_cdpcmcia_parse_cis_tupleapmattachfadd_iin6_leavegroupsqphy_caiminem_reset_hwsddumpsys_chflagsCONST_LN2sdstartef_isapnp_matchvt100_outputuvm_km_putpageray_cdsk_jallocext2fs_vnodeop_pusbd_get_port_statusuvm_pageoutncr53c9x_timeoutray_enablepffindtypepdevnamespci_subclass_dockiop_ictxhashtblqsyncwi_setmultire_gmii_writeregfifo_opencd9660_vptofhwi_attachusb_camii_phy_downuvmspace_forkraw_initknote_enqueueudpcksumtcp_sendspaceiha_msgout_rejecturl_csr_write_4aac_startdl10019_mii_writeregisp_startpci_mode_detectffs_oldfscompatwdcdetachin6_matchlensys_madvisepcic_chip_socket_enablempt_get_portfactspcdisplay_copyrowsupl_openpipesstack_overflowelink_resetbge_attachehci_device_ctrl_methodsmtd_pci_cadpt_pci_casmc91cxx_disableahd_sg_setupscsibusdetachdisk_attachwskbd_displayioctlgdt_lock_storencpuspccbb_pcmcia_io_freearptfreeipq_lockedcom_detachwds_get_buffxch_ififo_vnodeop_pvop_write_descep_isa_probemediaaxe_stopvop_read_vp_offsetsahd_set_residualdead_printsk_vpd_readmpt_prteephy_serviceinphy_servicemii_media_tabledpt_init_ccbpcic_init_socketst_pcic_readwdstrategytcp_rndiss_encryptti_cdxl_cdpmap_tmpmap_pveptettyprintfccdinterleaveaha_start_ccbscb_chipsetsigcodehpt_chip_mapipip_inputem_adapter_listwds_devcomttybge_capcibmatchne2000_detectbuf_undirtysysctl_tstringti_setmultiintel686_cpu_namexl_setmultiusbd_start_nextepic_output_eepromwfilt_ttywdetachgdt_clear_eventsepic_stopbootargpuvm_tree_RB_INSERT_COLORpool_allocator_nointrvop_unlock_descsys_sysarchsk_xmac_miibus_statchggdt_pci_test_busyigmp_initxe_full_resetahb_get_ecbfdtimeoutmii_phy_add_mediafxp_bundle_maxvga_free_screenbha_ccb_phys_kvputphysbufpdq_pci_ifintrvop_remove_vp_offsetsMD5Initvga_isa_attachtrm_resetqsXrecurse_legacy12ffs_vfsopssysctl_mallocwihap_ioctlusb_dev_openfrag6_slowtimouvm_map_hintahd_handle_msg_rejectexceptionahc_num_pci_devsphtree_SPLAY_REMOVExl_miibus_statchgmsdosfs_mkdiruhci_free_sqhkthread_create_deferredahc_run_untagged_queuesuhidevsubmatchefwatchdogne_isa_cascsidebug_busesscsibusactivatecomcnpollcnd6_timertcp_do_ecncpu_waitray_free_ccsvop_open_descami_quartz_donetwe_switchahd_softc_compec_set_mediaqsphy_servicepckbd_accessopsahd_pci_ca__cmpdi2cd_patternsraw_detachaac_pci_attachXhold_legacy10nsensorsdomainnamelenehci_pollacard_pci_intrpciattachiop_configure_devicespmap_alloc_pvusbd_get_report_descriptorpcibios_print_pir_tableip_rtaddrfiledesc_initload_dsaie_find_mem_sizerd_server_looptag_switchvgaconsoleurl_ifmedia_statuscue_csr_read_1vrelewi_set_pmohci_alloc_sedem_set_media_typeem_update_link_statusaac_sa_get_mailboxstatusprtrealloccheck_consoleapm_record_eventamap_freein6_domifattachwsdisplay_cnputcwdc_atapi_reset_2ray_issue_cmdaac_rx_clear_istatusswreadidle_loopusb_blk_nfreend6_prefix_lookupuhci_device_ctrl_methodsrl_stopan_pcmcia_detachcddonesync_inactivewb_newbufspec_printtxp_devicestl_setmultilocleanpagesext2fs_lookupmsdosfs_openehci_hubdwscnputcext2fs_linkvop_generic_revokeohci_hash_add_itdcpu_switchiop_ofifo_initviac3_rndfifo_printusbd_get_buffervia8231_getclinkfilt_sigdetachtrig_btcp_do_sackext2fs_renameipsec_def_authmii_activateuhci_add_loopusbd_setup_isoc_xferttywflushcd9660_rrip_offseturl_startali1543_get_intrwskbd_default_keyrepeat_datacomioctlclosefvop_rename_descumass_cbi_resetsoftdep_sync_metadatakue_trig_segpmap_releaseif_clone_lookupgetmicrouptimemii_tickpcic_vendorwds_timeoutip6_dad_countreg_load_int32em_pci_clear_mwippbmatchuvm_pager_dropclusterfilt_generic_detachnge_list_rx_initahd_suspendadv_pci_attachtss_allocexec_aout_prep_omagicmpt_send_handshake_cmdpcmcia_card_deactivateiha_cdwi_pcmcia_matchintrmaskcd_get_parmspmap_extractpckbc_is_consoleray_alloc_ccsnd6_ifptomacti_ifmedia_updamap_unaddxl_ifmedia_updvr_txeocrl_miibus_statchgcd9660_printohci_rhsc_enabledc_tickif_congestionnfilestrm_MsgInPhase0epstatusaha_collect_mbocd9660_islocked__bcd2bintss_freeatapi_printin6if_do_daduhci_root_ctrl_transferbge_writemem_indrevarpwhoareweahd_initialize_hscbsisadma_cdcue_txeofepic_openbsd_shutdownaue_detachpipe_kqfilternforce_pci_intrext2fs_opentxp_tx_reclaimsoftdep_setup_directory_addusb_insert_transferPTDpdeaxe_matchahd_set_active_fifopcic_isa_intr_listcpu_f00f_bugmsdosfs_vnodeop_entriesukbd_keymapdatafxp_mediachangest_mode_sensestopprofclocknullioctlukbd_is_consoleisohashncr53c9x_schedre_eeprom_getwordsk_marv_miibus_writeregaic_dump6360wi_set_debugpcic_isa_addrsea_abortukbd_keydesc_itiexmitbreadosb4_getclinkem_intrdc_miibus_writeregamap_lookupsea_send_scbne_pci_lookupipctl_varsxe_startapollo_setup_channelpmap_page_removert_timer_remove_allwskbddevprinttxp_rsp_fixuppckbc_console_attachedahb_cdwdc_output_bytesvga_isa_caisadma_caisapnp_mapegstartdc_coalaic_timeoutapmprobesoftdep_setup_allocindir_pagewsdisplay_closescreeniophy_caem_read_reg_iotcp_usrreqgdt_get_ccbnge_cdsd_interpret_senseudp_usrreqifmedia_initstge_ioctlext2fs_vfsopsti_init_rx_ring_stdext2fs_inactivedead_bmapsoo_kqfilterne_pcmcia_disablefifo_pathconfcpu_startupamap_refehci_device_bulk_transferuhci_device_isoc_transferfilt_fifordetachahd_verify_vpd_cksumwdc_ioctlapm_suspendsamphyattachfilt_fiforeadtrm_initAdapterfdexpandtickssrandomwdc_ata_presentpiix_set_intrisapnp_print_pintl_probepdc20262_dma_finishmsdosfs_closewdc_isapnp_attachext2fs_setattrapm_resumesysctl_clockratevn_rdwrohci_close_pipend6_need_cacherl_mii_syncsea_cdip6intrurl_setmultiusbd_get_device_descre_setmultirw_exit_waiterswdc_default_write_raw_multi_2isa_dmamem_unmapiha_append_done_scbcac_l0_intr_enableXstray_legacy2wdc_isapnp_matchuvm_pagedeactivatetxp_show_descriptorvop_write_vp_offsetsfdivp_cy82c693_initahd_update_pending_scbsufs_unlockep_pcmcia_activatetcp_ctloutputopti82c558_set_intrahb_free_ecbsk_jfreemono_timeukphy_statusMD5Updateblktochrvop_create_descifmedia_setpcscp_dma_isactivepcmcia_function_initem_setup_interfacetrm_eepromBufpmap_createuvm_map_extractahc_adapter_req_set_xfer_moderbus_space_freeioprbs_copy_internal_datand6_prelist_addvia8231_set_intrufs_removepci_intr_disestablishiopopenboottimecd9660_readlinkamd756_get_triggerwsdisplay_set_console_kbdVOP_ADVLOCKaxe_watchdogsk_rxeofwdc_atapi_intrpmap_exec_accountxl_rx_resyncfrag6_inputuhci_device_intr_closetrm_SetXferParamsunpst_sendspacebus_space_mapsis_mii_synctcp_rscalettwakeupuvmspace_freepmap_change_attrsext2fs_inode_poolswbufffs_ino_poolti_txeof_tigon2ahd_handle_lqiphase_errormii_phy_statusmsgwsdisplay_internal_ioctlVOP_PRINTfdsharewdsprobepci_subclass_memoryahd_handle_transmission_errorbuficmpv6ctl_varsef_miibus_statchginverse_regioncdstartioprbs_internal_cache_cmdfilt_generic_readwriteuserconf_disablecnvmemgdt_countspechash_slockusb_detachpckbc_isa_attachipforward_rtuhci_device_intr_startwds_cmdohci_device_isoc_closeurl_int_miibus_writereguhidev_activatevt100_ansimodepcdisplay_cddc_setfilt_21143ahc_probe_scbssys_nosysadw_print_infoat_pollcdevswallprocbha_dequeuepccbb_pcmcia_intr_establishne2000_attachem_enable_vlansrl_attachtxp_alloc_ringssys_mlockallwskbdcloseuvm_sysctladw_alloc_controlsnge_initsk_setfiltpmap_map_ptesgetsnepstop_bus_dmamem_unmapdisksortsys_fchflagsnamei_poolpckbd_ioctlaac_rx_qnotifyrt_timer_countuhci_device_intr_transferpowerhook_disestablishvga_loadcharspiix_get_intrukphymatchuvm_pager_putohci_device_bulk_abortmpt_ioc_eventtxp_chip_initip6_ecn_egressin_canforwardmpt_dump_sglremove_selectionwsdisplay_shutdownhookndumpmemrl_ifmedia_stsefsetmultiohci_device_intr_abortwi_pcmcia_attachpmap_destroypowerhook_listetherbroadcastaddram7990_configfdcpseudointrie_drop_packet_buffervfs_getnewfsidaue_rxeofem_cdsis85c503_pci_icuu14_findudp6_ctlinputitimerroundee16_eeprom_clockisadmamatchami_quartz_initscsi_print_sensewskbd_update_layoutreg_divtl_mii_sendmmopenffs_inode_freeohci_device_intr_transferwdc_cdukbd_intramphy_statusrtioctlan_media_statuskue_ctlpdq_flush_transmittersk_cdefresetwsdisplay_noemul_matchrl_rxeofeptxstatprofprocswdc_free_xferfxp_cardbus_matchtl_calchaship6_inputicsphy_cdwi_usb_cmdresppagemoveroute_srcvr_resetspeedup_syncerigmp_sendpktAscAbortCCBwb_inittxp_responseloop_clone_destroyahd_complete_scbpccbb_powerhookwdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcm_getptrukbd_caufsvnode_filtopsccdmakedisklabelahd_abort_scbsreadbuffersuvm_fault_unwireuserconf_common_attr_valuhci_add_ls_ctrlopti82c700_get_triggersis_reverseext2fs_vnodeop_entriessys_getitimerhid_get_datadonicewdcstartpci_intr_header_fixupfxp_statchgetherip_inputcpu_configurei8254_initclocksip6_freemoptionsbge_read_eepromcdce_txeofne_pcmcia_matchwsdisplay_common_attachpool_page_alloc_oldnointrdcphy_servicern_refineswdsprintsockargswsdisplay_getactivescreenhpt_setup_channelvop_generic_abortopisapnp_testconfigreg_u_divstattachpmap_copy_pagesetregstrm_FinishSRBsk_intr_bcomahd_handle_pkt_busfreeXrecurse_legacy6epsetmediael_caupl_rxeofusbread_filtopssobindvmcmd_map_zeroadw_create_ccbsvfsinitarcbroadcastaddrupl_caAdwLoadMCodecnclosefxp_pci_matchdev_rawpartpcic_isa_alloc_iosizesddonetcp_do_rfc1323ip_fragsfilt_fifowdetachwdc_dmawaitmii_phy_setmedialo0ifphostiduha_doneopti82c700_addregreadtl_dio_clrbit16wi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutipqmaxlenXhold_legacy2AdwASC38C0800Cablingext2fs_vptofhep_isa_probesk_starttxp_probeip_maxqueuesysctl_ttyuhub_cain_socktrimwsmux_rem_muxrl_miibus_writeregrtallocsys_mprotectaic_isapnp_matchmsdosfs_reallocblksvop_readlink_vp_offsetsuhci_alloc_sqhwi_pcmcia_capmap_zero_pagedequeue_randomnessdpt_initurioioctlahd_get_pci_functioncue_caisapnp_findsyncer_maxdelayxl_cardbus_cawsdisplay_getscreenpcdisplay_cnattachdeadprocdc_mii_sync_isa_bus_dmamap_createstart_reaperehci_root_ctrl_methodsuvmspace_unsharesys_fcntlisp_prtnforce_setup_channelvfs_free_addrlistsys_setrlimitsys_sigpendingwds_switchloop_clone_createem_hash_mc_addruvm_map_cleanicmp_redirtimeoutccdiodonettyclosepool_allocator_drainadw_free_ccbwdrestartdisk_resetstatxe_ether_ioctlahd_actionaac_sub_identifiersicmp6_nodeinfomaxvfsconftimeout_addcpu_cdep_pcmcia_disable1pcscp_dma_isintrip6_forwardnumcachempt_event_notify_replycmd0643_9_setup_channelcpu_initclockscue_sendwskbdioctlmii_downkinfo_vgetfailedbrelseext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miipccbb_pcmcia_mem_allocaac_host_responseahd_setup_datawsdisplay_switch3ttyoutehci_device_requestdevice_lookupnge_ifmedia_tbi_updwdc_pcmcia_prdenormal_operandwi_usb_txeofcdminphysnumcleanpagesschedhzcac_ccb_pollfdprobecomprobeem_allocate_pci_resourcesrip6_inputfd_motor_offtxp_rx_reclaimuvm_tree_RB_MINMAXtcp_totbackoffuserconf_basexe_stoppci_subclass_displaylooutputfddi_outputahd_reset_cmds_pendingcue_setmultiiop_passthroughsoisdisconnectedaic_findcpu_coredumpec_ring_copyrevbitsdvd_read_disckeyuvm_aio_aiodonebha_timeoutfxp_pci_cawds_caclrbitsahd_construct_wdtrpcmcia_card_intrmii_phy_statusfddi_ifattachAdwResetSCSIBuscommajorfdwritedl10019_mii_resetscsidebug_levelstge_productssoclosewakeup_nsys_connectUn_implbuf_daemontrm_CommandPhase1skpcrd_sleep_pripcic_cdadw_cdohci_root_ctrl_transferipv6ctl_varsroute6_inputaac_map_commandvop_read_desccnreadcluster_newbufsys_socketpairswitch_exitpci_addr_fixupti_encap_tigon1pcimatchudp6_sendspacedounmountuvm_swap_allocwskbd_pickfreekbd_resettcp_ackdrop_ppslim_countfxp_autosize_eepromiememinitidt_regionpool_cache_destroyahc_dump_card_statettspeedtabns_scx200_setup_channelkqueue_readapm_perrorcd_scsibus_setvolAdwASC3550Cablingcd9660_mountamiminphysahd_init_scbdatast_mode_selectuserconf_maxdevcue_initfork_tfmratesiop_del_devacard_setup_channellxtphymatchmpt_enable_intsvga_putcharpv_sizeiop_create_reconf_threadwskbd_activatewsdisplay_cons_pollmodewi_media_statusurl_miibus_statchgnd6_purgetcp_keepidleif_attachheadnextcichpcib_attachiszerodevuhci_devdti_initxl_initupl_inputvop_advlock_vp_offsetsahd_set_transaction_tagumass_caem_hardware_initcac_pci_l0_fifo_fullsys_fhstatst_unmountnullmodemohci_hash_find_itdahc_search_disc_listif_attachdomain1raw_recvspaceccdunlockXstray_legacy11diskerrwi_startcd_cdahb_send_immedwsdisplay_screentype_pickwsdisplay_addscreen_printbha_pci_matchsys_preadne_pcmcia_activateefintrem_media_statusehci_root_intr_abortwdc_pcmcia_detachmpt_pci_set_config_regskmem_mapcd9660_check_exportpccom_pcmcia_caaxe_startqsphyattachsoqinsquediskstatsdc_decode_leaf_symcdce_attachavail_endudp_inputpciintr_icu_tableieattachnchrtoblktblisa_dmastarttl_encapihashrn_search_mresettodrsmc91cxx_readahd_setup_scb_commonufs_readdirsys_flockarc4random_initializedbios_capvwi_usb_do_transmit_syncle_pci_attachspec_badopsm_pcmcia_disablemsdosfs_linkohci_root_intr_methodsisapnp_process_tagicmpctl_varsigmpstatvn_initialize_syncerdsm_cdu24_intrdpt_eisa_matchcd9660_quotactlaac_rx_interfaceicmp_senduhci_root_ctrl_donesiop_morecbdcdce_watchdogcy693_chip_mapvop_bwrite_vp_offsetssiop_ppr_negefreadwdc_ata_errtime_uptimele_pci_cati_mem_writesowakeupinsideti_newbuf_minidc_encapcac_pci_l0_intr_pending_edataep_eisa_attachmouse_copy_linesigactsunsharetimeout_hardclock_update__wdcdo_resetrdattachimenupl_detachttkqfilterwaittimem_tag_deletecd9660_ihashremepinitip_fragmentsea_caXpageusbd_endpoint_countsys_statfsrawin6pcbtablepci_bus_dma_tagpool_cache_invalidatesea_transfer_piokprintfdevice_unrefrc4_keysetupscsi_startdcphy_matchin_cksumvnode_poolvnode_free_listsk_txeoftcp_savetiuvm_pagereallocncr53c9x_reselectapm_battlowepic_stop_activityiop_lct_get0an_init_tx_ringuvm_fault_unwire_lockedklist_invalidateaac_raw_scsi_cmduvm_km_createthread_endpmap_get_ptppciide_attachsogetoptAPTDpdehid_report_sizeuvm_unmaparc4maybeinitami_pci_casoftdep_load_inodeblockpciintr_bitmap_count_irqwsemul_vt100_attacharp_intimerpollscandomaininitepic_read_eepromsii3112_setup_channelvflushbuftime_secondacer_chip_mapip6_forward_rtusbd_get_interfacewskbd_get_mapentryle_isapnp_campt_ioc_functionahd_list_lockusbd_read_report_descdcphy_autosbcreatecontrolsys_mlockdvd_read_structvdevgonehtonsehci_pci_attachahc_controller_infobucketkqueue_writesys_syncaic_msginfddkdriverpcibios_pir_headercominitmb_mapaic_schedenodevan_rxeofffs_mountfsin_delayed_cksumwds_senseuha_isa_probein6_is_addr_deprecatediha_find_pend_scbahd_swap_with_next_hscbahd_sync_scbukbd_keydesc_eswsemul_vt100_edec_media_initicmperrppslim_lastrtstatttvtimeoutahd_run_data_fifouha_cd_sk_mclgetncr53c9x_intrspeclisthbdwriteray_user_update_paramsVOP_INACTIVEtcp_syn_cacheadw_minphyswsemul_vt100_translateami_cmdpciide_sis_productsaac_identifierseephy_cainphy_cawds_free_scbp3_stepkputcharsys_getsidwi_write_record_usbahd_clear_intstatcue_csr_read_2uhci_device_setintrwdc_pcmcia_disk_device_interfacele_isapnp_matchadw_pci_attachfileheadrc4_cryptusbd_alloc_xferwb_attachnextvnodeidcttypollsys_swapctlbd_reqahd_unlockcheck_ie_presentahc_resetAdwSetEEPROMConfigst_patternsisa_cain_selectsrcmsgscpu_exitisapnp_knowndevswskbd_muxopswe_isapnp_cafsub__ahbprintwsmux_add_muxbpfilter_destroyunp_attachohci_device_isoc_startmpt_attachtcp_syn_bucket_limitsys_renamernd_rselti_free_tx_ringusbd_nbusesfrag6_nfragsip6_log_timeem_deviceseephy_statusinphy_statusiha_abort_xsvga_40lscreen_bfgdt_pcinew_set_sema0ufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnvga_console_typeaac_rx_set_mailboxprocess_s87_to_xmmsbflushehci_device_intr_transferipsec_require_pfsswapdevsiop_devwd_cawsdisplayttykue_senddc_rx_resyncsysctl_intrcntaxe_tick_taskvn_readsetgdtbwriteleavepgrpqsphy_cdtl_dio_clrbitiop_param_opcd_scsibus_set_pa_immeduvmpageropsuvm_page_initohci_root_intr_closeiha_state_1em_write_vftaehci_root_ctrl_closeem_fill_descriptorsfxp_cardbus_catcp_timer_funcsipqent_poolpcib_cdbufq_default_addif_attachdomainicmp_ratelimittxp_caxe_pcmcia_funce_enaddrinvalhashieintruhci_rem_loopXfpuuvm_km_page_initrttimer_poolax88190_mii_readregusbd_get_config_descxe_watchdogti_jallocvr_devicesrgephy_load_dspcodesosendukbd_keydesc_sgdosetrlimitpcdisplay_screenlistnge_ifmedia_mii_stsrn_initcmd_channel_mapbufq_default_getloopattachusb_match_deviceepic_write_phy_regdp8390_watchdogahd_construct_pprwdc_input_bytesti_cmd_exttl_dio_read8usbd_do_request_flags_pipeprocess_read_regschainlengthdc_miibus_readregmpt_print_enable_replyisa_dmafinishedvr_intrpj_freern_lookupahd_outqahd_lookup_scbuvm_map_reservedc_resetallocate_copybufferuserconf_show_attrsys_execvedc_pci_cabootapiveraic_pcmcia_prodahc_isa_attachite_setup_channelamd756_chip_mapfdallocusb_pci_remwsdisplayread_remquedc_mii_sendscsi_donechkvnlockhw_sysctluhci_device_bulk_aborttl_intvec_adchktcp_syn_cache_limitconsintrnumvnodescomreadurioopenuvm_pagefreeehci_device_isoc_abortie_cdukbd_decodecd_scsibus_opsadw_asc3550_mcode_dataext2fs_inode_allocXstray_legacy7sm_pcmcia_attacheisaprintwsdisplay_switch2ahd_set_snscb_qoffiha_pci_attachin6_ifindex2scopeidin6_pcbbindXdblere_probecluster_rbuildreaperahd_loadseqcoredumpfilt_kqueuepckbd_cnattachmalloc_rounduprl_powerhookep_mii_sync_bpamifailichpcib_matchpipe_readuhci_root_intr_closeifioctlsys_utimesusbd_do_requestahc_set_namend6_storelladdrrip_initsocreatenge_resetusbd_find_idescwe_init_cardioprbs_matchvmmapureadcaue_startcalibrate_cyclecounterufs_setattrlogprinpx_cadoclusterreadsys_exituhaprintfdretrypci_attach_hookuha_attachm_applyahd_handle_ign_wide_residueahd_tailqaxe_lock_miifconstem_disable_promiscwdc_exec_command_isa_bus_dmamap_load_mbufvga_stdscreen_bfray_cmd_is_runninggdt_pci_set_sema0wdcintrusb_seleventcd_playsys_clock_getresaxe_attachsm_pcmcia_enablesyn_cache_insertioprbs_start_ccbsspec_bmapiminlevelttystats_initpciprintne_cdrl_cdapm_cpu_busyem_allocate_receive_structurespool_cache_destruct_objectuha_mscp_phys_kviunmaskfd_motor_onbhaminphysnd6_umaxtriesohci_device_intr_doneiop_util_eventregray_start_join_netfxp_mdi_readisadmaattachti_gibinitdcphy_resetnd6_debugpoly_div2re_devicesstdumpehci_root_ctrl_transfercpu_cpuspeedmpt_print_init_replypciide_cmd_productsget_random_bytesurl_csr_write_1ami_disposeesymosreleaseVOP_RECLAIMsiop_update_xfer_modempt_recv_handshake_replyan_pcmcia_attachahc_isa_probetcpqe_poolpgrp0ahd_qinfifo_requeueopti82c558_getclinkurl_watchdogahd_set_scsi_statususerconf_changetxp_startcd_scsibus_getvolmakefstypeaac_dequeuecddkdriveruvm_anon_addadw_get_ccbcac_pci_l0_completeduserconf_helpiop_resetufs_advlockicmp_initdpt_minphysmouse_moverelti_del_mcastsii3112_chip_mapuvm_growvfinddevfd_cdvp3_cfg_intr_shiftE_ldsa_abs_reselected_Usedgdt_wait_gdtXhold_legacy5if_detached_initevcount_timeoutpciide_unmap_compat_intrelreadahd_controller_infodopowerhooksehci_device_bulk_methodsahd_get_pci_buspmap_tmpunmap_paapm_handle_eventpccbb_conf_readether_delmultipoly_2xm1vfs_op_initvga_screenlistec_write_mbufsk_vpd_readbyteexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutre_allocmemti_probevr_miibus_writeregaac_sync_commandwdccommandshortvcleanahd_sg_sizeuhci_device_bulk_doneiophy_servicesplassert_ctlwdc_atapi_startsys_getresuidsys_fhopendos2unixfnpciaddr_do_resource_allocatescsibussubmatchrtentry_poolXrecurse_legacy10cdzerorefuvm_km_pgremove_intrsafeext2fs_sbupdateray_report_paramsdefrtrlist_delsys_fchmodvop_strategy_descray_update_promiscrtcputuvm_unmap_detachvop_islocked_desciha_msgin_ignore_wid_residgdt_scsi_cmdadw_pci_caisapnp_alloc_irqehci_add_qhahd_set_modesupl_inituserconf_common_devwb_tickpdq_initializestartbha_cmdusbd_devinfoskip_spc_leftsiop_wdtr_negcardbus_function_disablest_identify_drivepoly_tanvn_isdisksys_selectxmphy_attachvnode_free_list_slockzombprocpckbd_bell_fn_arglogreadahd_get_transaction_statusisapnp_unmapreg_store_int32dead_lockusb_pci_addadw_asc38C1600_mcodetcp_issfc_largedistanceahd_createdmamemcom_pcmcia_disablesys_setitimerisofntransurl_attachpccbb_rbus_cb_space_allocnd_prefixwsemul_vt100_resetbootstrap_gdtext2fs_specop_pvfs_unregistervia82c586_pci_icuiha_done_scbvt100_setnrcpchbmatchselwakeupwdc_isa_caem_update_adaptiveffs_reloadem_initialize_transmit_unitcnwriteahd_platform_freeze_devqumass_bbb_get_max_lunehci_device_bulk_doneuipc_usrreqnd6_na_inputrtl80x9_mediastatusichpcib_cati_free_rx_ring_stdvflush_vnodefilt_rndrdetachreg_u_addwds_inquire_setup_informationaha_get_ccbscsi_scsi_cmdnge_tickbios_cksumleniha_xpad_outdpt_free_ccbem_media_changerip6_usrreqin6mask96xl_eeprom_waitcoldbutton_eventelioctlunp_scanexec_aout_prep_nmagicisapnp_com_submatchtl_mii_readregsbappendaddrehci_powerbpf_maxbufsize_vga_mapcharsis85c503_inittl_eeprom_putbyteufs_islockedusb_detach_wakeupisapnp_wait_statusffs_unmountfifo_inactivene2000_detachsk_vpd_read_resgdt_mpr_copy_cmdsys_pwriteisohashtblwihap_shutdowntwe_devuvmspace_allocrevarpinputpckbd_cnbellcd_pausesoftdep_setup_directory_changehashinitpccbb_open_winttstartXmissingumass_setup_transferrd_ioctl_kallocsis_read_eepromwdwriteipsec_keep_invalidmpt_print_scsi_io_replypchb_cdepic_openbsd_probepciide_channel_dma_setupvga_pci_cnattachbad144internuao_detach_lockedpci_devinfodpt_done_ccbsdopentcp_tracewb_list_rx_initmii_phy_resetip_getmoptionsuhci_hubd_piixdp8390_mediastatusin6mask32__moddi3disk_countohci_confdel_cddead_openkue_setwordatapiscsi_matchuserconf_attrwdc_kill_pendingahd_configure_terminationbmtphymatchicmp6_redirect_outputroute_cbvop_revoke_vp_offsetsva_nullexphy_cdreadeppckbd_bellpccbb_pcmcia_wait_readylxtphy_resettcp_slowtimoahd_timer_resetamphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbsys_fhstatfself32_load_filesys_getpeernamevr_ioctlccdintriha_init_tulipmpt_wait_db_inttxp_tickdpt_timeoutee16_read_eepromehci_device_intr_closeehci_intrxe_pcmcia_attachfdc_cascsi_strvisbpfwritedoingcachesys_getrusageapm_threadnge_ioctlaue_reset_pegasus_IIelintrcomconscflagnd6_prunem_getffs_truncateuhidevprintmii_attachadw_timeoutttylclosefstsw_cmd680_chip_mapmd_diskconftl_initcac_pci_l0_submitpool_allocator_allocwdc_default_read_regin6_ifremloopchar_typeuha_isa_caohci_free_sitdrl_intrncr53c9x_debuggdt_internal_cmdusbctlprintti_stopvn_closexl_choose_xcvrxl_stopin6_createmkludgedoclusterwriteusbd_close_pipewsdisplay_cfg_ioctlffs_writebremfreefilt_sowdetachnd6_initip6_maxfragslimfreenge_mii_syncfxp_intrwe_attachsoftdep_setup_freeblocksuhci_reset__wdccommand_intretherip_outputuvm_km_free_wakeuprootvnodeehci_initifmedia_ioctlahd_check_patchwb_probecac_copy_internal_datadc_mii_writebitbha_isa_canormalizereg_mulicmperrpps_countuserconf_modify__one_cmpldi2wi_usb_rxeofatapi_mode_selectcd9660_ihashgetaic_pollmii_phy_detach__muldi3wskbd_add_muxmbtypesahd_shutdownvga_copyrowsuhidev_caurl_lock_miiip_mtudisc_timeoutvfs_opv_init_defaultrandomopenamd_family6_setupin6addr_linklocal_allnodesfxp_watchdogamphy_cabufiniteisa_intr_disestablishskip_char_leftpcscp_gluecpu_exec_aout_makecmdsisamatchepic_initscsi_quirk_patternsuserconf_lineslimit0ep_mii_setbitbrgphy_load_dspcodeE_abs_targ0_Useduniqdosnameusb_async_procext2fs_mknodvttoif_tabwdc_pcmcia_activatebgetvppgrp_poolfdiv__egresetucred_poolvga_doswitchXstray_legacy5pj_pageadw_pci_devicesarp_maxtriespcibios_cdcd9660_bmapax88190_mii_bitbang_writeaue_eeprom_getwordgdt_get_slotldt_allocstge_cdufs_dirbadentrydpt_intriop_printlogioctlbha_inquire_setup_information_bus_dmamap_load_uiostrlennge_watchdogwds_free_bufferstartrtclockvop_abortop_vp_offsetsahd_freeze_devquhci_cdfifo_kqfilterray_check_scheduledevcount_synceisa_cdkue_activateray_update_paramswsdisplayparampool_page_freetrm_StatusPhase1wdsintrwdactivatecopystrtl_intvec_txeofsys_pipeusb_detach_waitarp_rtrequestpcic_pci_attachegstopvr_initext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initle_isa_caproc_trampolinelapic_tpraic_isa_attachsys_rmdirdp8390_disableAdwExeScsiQueueem_attachcd9660_vfsopspckbc_attach_slotgetticknkpdeem_get_bus_inforl_mii_writeregfxp_cdcac_cdAscResetDeviceallocbufsocantsendmoreproc_zapvop_revoke_desccac_sdhusb_rem_taskep_pcmcia_disablewi_pci_attachsiop_sdtr_msgcdactivateether_inputuvm_vsunlocklockstatusquotaoffarpioctlffs_fifoop_pfs_posix_sysctlif_slowtimouhci_root_ctrl_abortep_pcmcia_cabge_handle_eventswd_shutdownudbtablewi_setdefbgedebugahc_chip_nameswdcattachpiix_getclinkcb_detect_voltageufs_printem_rar_setfatentrypcic_pci_matchwi_update_statsncr53c9x_abortmf6ctablesiop_startusbd_printBCDsys_statvga_alloc_attrXf00f_redirectin_baddynamiclineswtxp_commandmsdosfs_symlinksys_symlinkicmp6_sysctlahd_read_seepromclfreeconfig_found_smioprbs_dequeueusbd_interface2endpoint_descriptortxp_attachfdreleaseehci_disownuvm_swapout_threadssm_pcmcia_matchbge_alloc_jumbo_memmpt_dma_mem_allocknote_attachmax_keylenextmemisa_dmamap_destroyxl_pci_matchaac_enqueuedp8390_ioctlsplraisesk_newbuf__assertif_congestion_clearapm_resumeswsdisplay_emul_matchin6_prefixlen2maskpcmcia_megahertz_xjem1144_func0_cfe0ahd_sync_qoutfifocom_activatecn_devvpudp6_outputwi_get_debugmpt_actionisapnp_cdmaxfilesuvm_pageactivatein6_addr2scopeidip6_sourcecheckvop_access_vp_offsetsne_pci_attachrl_pci_attach_bus_dmamap_load_rawffs_mountrootrd_cdahc_donetprintfuvm_map_pageable_alldofilewriteehci_device_isoc_closewb_miibus_writeregipqiha_sync_done_isa_bus_dmamap_synciha_push_sense_requestdl10019_media_initmsdosfs_strategytimeout_delem_ioctluhci_alloc_stdXsoftnetcpu_cache_edxwsemul_vt100_el_isa_bus_dmamem_mmapif_delgroupspec_strategyuvm_pglistfreeusbopenax88190_media_initext2fs_readsoo_statwskbd_cnpollcdkcsumattachkue_newbuftl_wait_uprusage_pooldisk_detachstrchrhid_clear_localrlphy_resetahc_clear_critical_sectionscsi_sizergephy_caaac_dequeue_fibpci_mapreg_infoadw_queue_ccbaac_initisp_initgenericconfiftovt_tabtcp_backoffvga_scrollbackisa_bus_dma_tagsys_chrootehci_odevdwdc_ioctl_freeavail_startpcibios_pir_tabletl_intvec_rxeoctl_list_tx_initehci_device_clear_toggleuhci_portreseticmp6_redirtimeoutpci_bus_fixupsoisconnectingpdq_queue_transmit_datadpt_cmdwsdisplay_pollcpci_subclass_processorvop_link_descisapnp_findcardaobj_pagerne_pci_carl_pci_cacardbus_intr_disestablishahc_compile_devinfostopenuvm_tree_RB_REMOVE_COLORpcibios_pir_table_nentriesMD5Transformu24_findmld6_inputsk_intr_xmacvop_link_vp_offsetsrgephy_mii_phy_autobpf_d_listuhci_root_intr_donepcic_chip_do_io_mapsyn_cache_cleanupip_pcboptsfc_purgeiha_scsilance_isa_probeem_detect_gig_phyiop_msg_map_biovop_getextattr_descahc_cdifmedia_delete_instanceE_ldsa_abs_data_Usedurl_casoftdep_update_inodeblockgdt_pci_copy_cmdelresetccddumpep_media_status_sk_mgetcac_eisa_caacphymatchicmp6statwsdisplaydevprintgdt_pci_intrccdwritewsevent_pollmap_backmergesys_profilvmcmd_map_pagedvnahd_update_neg_requestin6_pcbhashlookupwb_eeprom_putbytetwe_intrwsdisplay_cdvr_cabpf_detachdVOP_UNLOCKehci_root_ctrl_abortsyn_cache_initvop_readdir_vp_offsetscd9660_wchar2chareggetip_ecn_egressether_ipmulticast_maxmouse_copy_extend_worduvm_init_limitsiha_waitukphy_cdfucom_in_pcbconnectdevoutahc_busy_tclem_free_transmit_structuresokaytocloneVOP_POLLVOP_IOCTLaic_msgoutXfpusegmahb_switchsafeprinumccdsys_rforkxe_ioctlwdc_default_read_raw_multi_4pdq_os_restart_transmittergdt_wait_indexdpt_alloc_ccbaac_timeoutuao_swap_offmachinewi_cmd_ioVOP_CLOSEgdt_start_ccbsuvm_anallocin_pcbdisconnectuvm_vnp_terminatepool_cache_putahd_probe_stack_sizewi_usb_rxfrmrl_eeprom_getwordsys_getpidnd6_defifindexunp_dropuvm_map_advicetcp_mtudisctimeout_startupsmc91cxx_mediastatusami_schwartz_donecue_matchaac_pci_probepckbc_enqueue_cmdrn_addroutesdactivateaic_isa_caem_cleanup_ledpmap_test_attrswsscrollbackukbd_cnpollcvr_ifmedia_updahd_get_transfer_lengthXhold_legacy14ahc_handle_scsiintshmsegdvd_read_manufactconfig_activate_childrenst_pcic_writeami_quartz_execem_allocate_transmit_structurestl_miibus_statchgnforce_chip_mapem_mc_addr_list_updateremrunqueuepccbb_free_tagsoo_closesiop_handle_resettcp_recvspaceuvm_meterahd_set_hescb_qoffuhidev_maxrepidsubnetsarelocaltcp_ackdrop_ppslimsea_selectioprbs_attachuhci_ifcdehci_device_ctrl_donend6_lookupfxp_shutdownXrecurse_legacy14pager_map_wantedfillwurl_openpipessk_probeadw_attachpentium_mhzsys_getppidiop_initmii_anarVOP_READDIRdomainstrm_GoingSRB_Doneem_led_onbge_newbuf_stdsys___sysctlin4_cksumextent_alloc_subregionaac_intrAdwDelayMicroSecondisp_intrtm86_cpu_setupneedbufferu24_start_mboxwsemul_pickusbd_do_request_asyncbge_stats_updatein6_ifattachiop_sdhsetperf_priotcp_rst_ppslim_lasticsphy_caahb_timeoutwsdisplaystartisp_get_ct_hdrsis85c503_getclinkuvm_rb_removeohci_root_intr_doneepic_ifmedia_ststickfixusbd_get_device_descriptorcd9660_initccdstartumass_fixup_yedatavp3_cfg_trigger_shiftipsec_soft_bytesnselcollemul_elf32usbd_open_pipenumdirtypagesm_tag_unlinkohci_softintrpcdisplay_matchbiosopenbufhashahd_enable_coalescingahd_freedmamemvga_show_screenmsdosfs_lookupspec_pathconfgdt_async_eventhook_establishtcptv_keep_initsys_chdirxe_resetsensors_sk_mgethdrwds_collect_mboext2fs_diremptymotion_eventuserconf_cntdcphy_caE_abs_msgin_Usedmouse_zaxisep_default_to_mediasea_timeoutem_config_dsp_after_link_changeext2fs_inode_freepcmcia_ccr_writexl_txeof_90xBapm_cdukbd_keydesc_swapctrlcapsahd_handle_message_phaseip6_rr_pruneapm_cavr_cdsbcompressami_schwartz_execukbd_keydesc_dkahaminphysmsf2lbabus_mem_add_mappingnd6_outputcdevsw_lookuplogsoftcsys_adjtimexl_pci_carbus_space_allocohci_device_clear_togglepckbd_keymapdatavop_kqfilter_vp_offsetspciintr_link_lookupwdstartwsmuxreadamap_splitrefwdsminphyswb_setcfgnclruheadmpt_pci_cacac_pci_cange_newbufuvm_aio_biodonern_initheadahd_validate_widthukbd_keydesc_deusbd_get_descem_start_lockedahd_aic7901_setupvop_generic_unlockuvmspace_sharert_timer_addsm_pcmcia_activatepci_get_capabilityroute_usrreqdeextendepic_set_tx_modeem_receive_checksumahd_freetcp_dropicmpstatudpctl_varsstge_initfdreadm_prependXstray_legacy10vop_advlock_descsetgatecd9660_pathconfpckbcprintax88190_stop_cardin_pcbrehashre_tickre_resetahd_platform_flushworkin_arpinputmpt_statebge_eeprom_getbyteehci_root_intr_transferne2100_isa_probeufs_accessin6_embedscopeif_alloc_sadlmpt_pprunix2winfnncr53c9x_get_ecbcardbus_restore_barapm_flagsXbndreassignbufuhci_confdsiop_minphysXstray_legacy9ip_freemoptionsnetconsohasoutofbandspec_vnoperatevop_ioctl_descwsmux_attachi386_fpu_exceptionmodifiersnd6_dad_duplicatedsoftdep_change_linkcntfifo_vnodeop_opv_descwsmux_detach_bus_dmamap_unloadmsdosfs_fhtovppim6_inputether_crc32_besiop_setuptablescpuid_levelpgfindxl_waitahc_scb_devinfoie_isa_capckbd_consdatavop_lock_descseaprobetcp_ackdrop_ppslim_lastrqinitcd9660_ihash_slockip4_inputtcp_inputsysctl_dumpentrydkcksumahd_match_scbcardbus_intr_establishwsdisplay_cnattachpcib_caiha_msgout_abortnd6_gctimerncr53c9x_initurl_csr_write_2isa_devdc_pci_matchcd_switchiptimerip_inputnd6_setmtuaxe_ifmedia_updpci_intr_post_fixupwdc_ata_ctrl_intrusbd_get_endpoint_descriptorudp_ctlinputmii_detachpool_sethardlimitep_isa_capci_subclass_prehistoricn6expireip_freefpoly_sinesk_ioctlwdc_default_write_regpcic_create_event_threadudbhashsizeicmp6_mtudisc_updatesun_nonamecpu_info_listkmeminitaha_isa_capcic_pci_machdep_pcic_intr_establishnsphyterattachnd6_ns_inputdevice_refehci_device_ctrl_abortrd_root_imageffs_syncuvm_map_submapcnioctlufs_vinitehci_nooppccom_isapnp_cawb_mii_sendem_set_d3_lplu_staterl_eeprom_putbyteeintrnamespool_primepdq_ifioctlcomconsinitwds_bufferiop_devinfopgrphashtblsddkdriversys_getpeereidsmc91cxx_watchdogifmedia_matchahd_lockinitstatclocksiop_ppr_msgaue_activategetnewbufwi_read_data_usbCONST_PI4dvd_read_physicalrw_enter_writeukbd_keydesc_de_nodeadpccbb_pci_callbackuvm_mlk_hintuserconf_argbufaic_selectm_tag_copyehci_idoneeisa_maxslotssiop_pci_attach_commonst_readee16_probepci_io_findiop_msg_mapopti82c558_initcac_get_dinforay_check_ccsgdt_enqueue_ccbhid_get_itemepic_write_eepromregmsdosfs_getattrwritedisklabelm_devgetioprbs_adjqparammsdosfs_printkernel_pmap_storewsemul_vt100_opsstge_txintrem_write_eepromiop_simple_cmdstartprofclockohci_device_isoc_enterrl_encaptx_cdupl_ioctlnsphymatchsys_getresgidprocinitapm_userstandbysahd_softc_initmsdosfs_readdirdead_ebadfusbd_interface_countbrgphy_attachcac_switchwddetachintr_calculatemaskssoo_ioctlforkstatwi_card_identaue_miibus_writeregsk_ifmedia_upddl10019_mii_statchgcardbus_cdpoly_l2p1cac_pci_matchicsphy_servicetrm_DataInPhase0wi_send_packetmpt_send_event_requestin6mask64ohci_rhsc_ablere_gmii_readregadv_attachsoftclockaic_switchupdate_modifierisa_dma_stats_nbouncebufspccbbattachswdevtdisk_lockbha_enqueueuhci_initpcscp_matchieioctlsbwaitufs_reclaimwb_mii_readregsdwriteohci_device_intr_startvga_common_probetrm_MsgOutPhase1trm_switchfilt_logreadsysctl_rdquaduvm_vnp_setsizerl_ioctlvmcmdset_extenddefault_product_descip6_use_deprecatedehci_softintrtrm_check_eepromahd_freeze_scbep_pci_attachuserconf_hist_intextent_alloc_regionsys_mknodxe_pcmcia_manfid_ciscallbackext2fs_mountfskill_vmcmdsuhci_device_ctrl_closeufs_mknodsbinsertoobknotexl_cardbus_lookupfcompstlf_advlockeephy_resetfreeem_phy_get_infopci_device_foreachpccbbintr_functionwi_ioctlsis_delaypmap_tlb_shootnowxl_miibus_readregAdwResetCCBswstrategyuserconf_pnumehci_allocxfinitscsibusprintrtl80x9_init_cardehci_root_intr_methodssys_getpgrpccddevsukbd_ioctlwsemul_vt100_console_emuldatasonewconnisa_intr_establishwb_ioctlioprbs_intr_eventufs_direnterpffindprotoan_intrahd_lookup_phase_entrycluster_readtcp_saveti6wdctimeoutwsemul_vt100_initnchrdevex_caep_eisa_caaue_cdcac_shutdownpiix_pci_icupciide_cafddprintnatsemi_pci_intrpciide_chansetupqsphy_cashmmaxpgs