ELFa(4L{`4 (  @VD<  B00 R㥲Р -LQ a`Vd`main() returneddHd   ),@@(LQ 0/L`Id -0L MR0 40 @, *0"Sp! "00# 0T!oR 0PS 0 $0S`F!0S 0 $*0Xb0 R2p'0S  0T!oR 0PSv 0 $0S`F!0S^ 0 $0SL "00# 0T!oR< 0PS1 0 $0S`F!0S 0 $ 0 R2h)p'0X0S]J082p'0S  0T!oR 0PS 0 $0S`F!0S 0 $0S "00# 0T!oR 0PS 0 $0S`F!0S 0 $082p'XZ0Sh  0T!oRZ 0PSO 0 $0S`F!0S7 0 $0(S"R$ 0 $0S "00# 0T!oR 0PS 0 $0S`F!0S 0 $XZ0  0b, 0Რ qR  0T!oR 0PS 0 $0S`F!0S 0 $0S "00# 0T!oRp 0PSe 0 $0S`F!0SM 0 $0S<  0T!oR. 0PS# 0 $0S`F!0S 0 $40Y:0 ,0 ,{h 0\0 ,0 ,bh2 0'\~0 ,k0 ,THha 0\:0 ,!0 , /h2 0'\0 ,0 ,0 ,h 0\0 ,|0 ,egr2 0'\J0 ,70 , g- 0\0 ,0 ,g2 0'\0 ,0 ,g 0\n0 ,R0 ,;gH2 0'\  00 -LMP 0* Qp  / 0p@ 0TGT`P0 T@ 0TPp0 T p-LMP@.. 4\8` #8$ 0 p Xp -LM0@!#P  0 (  -LMP@^ p0`  h F. p-LM@P U!! `  U 0 Rp 00p -LMP@\ p0  hp . -LM@`<6V #Xp V * 0 RP: 0Q@-@%Qʔ000SS !0Q  k\`!0Q <\00000 8 -LM`,0KPp0 0PA, $@00K=;0 0P&40K 0(0PT4 (pA Ƞ,Ƞ4 08 X4 ( T  , Z Y4(0 80 4X0 $40, T, $@(, 0T, 40T, $P ,0T `Z -L Mp`, 0 P1<@T  0R PU0 R X 0Z0R0S 400000 R Z$0X 0S eP0S,0S 0S0@ , SP -PLM,8  Z09c`<0 p10@ 0@@  0 @4@0@0xP 1U] |$0( 0$0R$ ( $0(0(0(P(00 T0 $@  0 tT0 $pJ0 W p 0 T0 $ 0T0 $08 R <0R~厶hb4 0-LM@0 0 0PP$G0 $Q0=;0 0P .0 00(P" R 0)(09 PX QT00P 00< $(,0  R<0Z480.Px   -LM -LM`@]pW0 P  @0h04p @d0T\XT 4K0 , (P ž5pPP  ahbhb -SLMp`@P P0  F0@(K 0( 0,`0 0hbhb`ibdibP0 R D0 R80 P $00sQ`ibhbhbdib p-LM P\@` d0T X0T L0T D0T pp 00_PEWFW@@W@DW@ -Lh\   -LMP$`Pp )  Do$0@S00 "$0S0` 0,@ 0 }o 0  @ 00(@ ho 0-$@P(0,P(0(0x T$ L B$  R $0S2p,0S0,00 +p(0 'phb p-LM00`QPP440Q@@S  j8@4Pp80S 0-L,, Q@ \S0lP8 d0`@ 0#0 -LM\`pVe ,PV[ U@ 0  @  0 H00S =08@U@ @ 0T P 0TD@0 TP@ 0T@@0 T 0@  0 x00,`0 `0S\d Md `  -QL M`pP R 0S,S0 0S,SS000 P@ ( 0S(0S  R0 S0S5 Q'X#<Z DnP`  $8@@ <  <`4`  <0 S X׵( -RL Mp`' 0 S ! P @ 0TD@0 TP @ 0T@@0 TP0 0 僀00 @, 0P, ,  b 100, @b   @'T0h@T,0@@  @-,@Q p000000000000 ,0, 00  0 00< D -LMpP 0 P`@,  I 0U40 0 \ 4  ( < ^ %@,P @ 0TD`@0 T,@P` 0TPP0 T8@(08 @0 o%-\ \  00R 0 0 -LM0P ^p@ 0K  `4\ $0K^$0 0;00` -LM@ \p P`, 0`i -LŸ00`000@Pp0 T 0TUt 0 T0 $P@ 0T@0 T@0 T $0<<P` 0T@0 T 0T@0 TlA0 0C\ 0  "!80 00 $1C&  0 "!0 0 Rm\0 T0 $P@ 0T@ @0 T @0 T $0 PpRdtRd'RdRd0 -L,  -LMPp@0 T0 TP` 0T0 TP 0T0 TP 0T0 TP0 T0 TP0 T0 TP0 T0 T p-LM@ 0TP 0T 0TP 0T 0TP 0T 0TP 0T 0TP 0T 0TP 0TP`U 0P PT0 Tp -LMp"4 d,0 0@T0偖00 P@0, \8 @T008p僂 0  @TT080, 0\0 80 \4 @ 00C\ 0  "!p0 00 \0C& T 0 "!00 0 Ro[pRdtRdRdRd0 p-X0LM@PH`0 PT0 Tp  -Pp @L` 0T@D@0 T 0P 0T@D@0 TP @ 0T@D@0 TP @ 0T@D@0 T$0P! 0 $ 0T@0 T0 $ 0T0 $ 0T@0 T0 $ -L M0 ||!\, 40 p@M ,*0ST1  , *W8E0E@(1 0S:P`劀0S0 0 0P6U@ PU*00 ,*00" 4 x0\ \0@D P gp00 i P     -1L M! 14 10 1 @00dS1 0 , X1q , 0 X1!R,00 )  tiP,00  P0S0 0P` V c0@ 0l@, 0 04 0@ 00C\ 0  "!0 00 p0C& h 0 "!0D 0 R YtRdpRd    RdRd0 - L 0$ 0 $ -LM  0@ 0 0T p-QLM0@`  `13pQP* 0 P(U:p p-QLM0@`  `D3pQP* 0PXU:p p-QLM0@`  `?3pQP* 0P\U:p p-QLM0@`  `2pQP* 0 P,U:p -QLM@/0 *`l -QLM@  -(L  -(L  0-" _  P0L @ 00h! p-LM@ ,\P` 0"\00PY YR` cUpp p-LMP@`V0 pd[p0H@ 0S' 000K  c 0H@ 0?' p-LM@` P[?XP 0s UP(0Sp(00PS 0U 0 0 [0P 0UPp -LM0S.||#0p#0lC0 0 0C\ 0  "!00 00 3C&  0 "!0"0 R0S 00 7 Q[0p`%`K% [)0S ) %0K , :[0@P&PK& [)0S ) &0K 0VS UR Z  p Z7-0pWp12gZ'1,@0pW 00P7 0000S 00  000 Z000 0`P`PDH$ ,0K$H ,K+K*@K12g1, VU000gWMpRdtRd RdRd0 0- @LP0 00\P0P0C& R 00#!t000 `0C& X 0 "!04 0 R0*WtRdpRdRdRd0 -h2LM PRT2 J D .0S4200h0S 22  BZA^c 4$` ,p@dP,` 000S2022/`VOھ2p1  p,@`0,K  `VOZ`@0S2`VZ00,0K,pK 0(@ *pK+K儔V Y0< kP 202" P2022$00$0d0 \`ߢ0006P |b` L j 8lib p-LM4@PU @$ `00  $ 0!2c1,0  0!2c16`,pXP $ - PLp0@ 0`0G'p0p0C& R@ 00#!t000 `0C& X 0 "!04 0 RVtRdpRdRdRd0 0- @P0L00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00hUtRdpRdRdRd0 p-LM$ P0S 0 $p4 `  0DPT0T $0 0$0 0$0 0P$00$0p -LM8@6@ 00S<"Z -0LS0@0p- 0PP00P=WP`U Lf    (\ YV j 0-L@LPB X0( X0( 0hzX' -0LM@p! jX00 ` YX00 PZpd3 <# RAX00Wڀ0?3S -1LMp@+p`0((0) %0K%[R%0K P )U d0 S pWX0++'0K 'K$0 0((0) &0K&[R &0KP ) -`0VLpP@ 0DPT dT0`0 W0V D0PT -!圁LMp0P00$`V" 4 $0Q Tq0LH1HL<I4F$0 3000$  $  0@p00C\ 0  "!0 00 0C&  0 "!0 0 RiT@0D PT$0 0$08tRdpRdD: RdRd0  -#LM08 ,0 p0 P 4 )3RR 0 A= 0 0   h3 ,0S \,80S 00g 0S@0 ŕ0őSS000@0000&2R& $ ` @0S6`V@DZX 0@00  00 `~0S6V`VZ6 `0S61`VZ0S0 00S000 @0 00   p pR00B"0P0 00    ,  R00 0B$`000 0 @0S   60S0 ` 00`(1 &hP0 0  0 S   50S0`00`0 hP0 VE00@p x0 gPk40Sh@@j0H 00OK hg, P000/Hb(  -08`P@L p0 T P0  0@e0 -08`P@L p0 T P0 0@e0 p-LM`P@2PUOp 0 @|P嚩00 `0 0T吩2 <剩20兩1$偩2}8 H \ p   p-LM@8P@`4  00 00S p  0S > S 00p000 dN`p 0 00  (000C0     -LM0P10#0@8PZ 0ha0 0000 H1 ,0<11p  $00$0 R 0$ 0 00  0@ ۝p00C& R 00#!000 l0C& d 0 "!0@ 0 RhO\pRdtRdlibRdRd0 -LM4@0S @440S -L M$X @R0  l0@ $@ɥ håP!\! - L - L]P@0 0Q0p0P0`0C& R@P 00#!x000 d0C& \ 0 "!08 0 RwNhibpRdtRdRdRd0 p-0LM 0@00 `R0P00 00C& R 00#!|000 h0C& ` 0 "!0< 0 Rph[^1NtRdpRdRdRd0 0-0 L@ 0T00 0P @TP 00C\ 0  "!x0 00 d0C& \ 0 "!08 0 R0MtRdhibpRdRdRd0 -L M`P@P 0T@{/0P T0T $020 T1 N0W $5 0T@8 0TPP!0` Tb 0T@c 0T0 $  pq/0 T$0W $00W T 0T@ 0T 0T0 $G -LM@(0SID 0S p0S`/ 000!PU ”(0S0 ?/ 0S@' 0 `0 @0(0X0C0 h0 0”(0S 0  00(0  0 <(% p-LM`@PPU@Zp -LM0PS`V 0  ;0 @@ p0 0$# p0  00@ 01`Qw  Ru 0A?00 $0 0<<00 1•(0ST000( RB1@7 X!0L T10 $ q/0 T 0 T0 $ 1 0 $0 T0 0 `0 @0( 0  0,0(• 38& -LM0p $P` `V00P00S0b XR$0@c $\0@1D 0@=(@ 0@#h `& -L4MDpK@ 0 T0qS u1S MS< 6S 0 $  à0 $  q/0 T0? $0@ XR$@ 0 [80| 蚠!S0d $X 0 [800 冠QSK ASaS1S$0 $@TT jK0 $`1PU ˜(0S,0S @Ul T0 1"   0 `0 @0(op0 $020 TX0 [80 !0= $0`> $0PQ $0@d $`P@ 0 L 0< $0` $0P> $0= @$@B0@e $`P 0 Hɟ0 $0p $0` $0P $0@ $p`P 0 @蛟0 $0@ $@  刟0 $~0` $t& }? " : 0T Sp S S0 $ 1 d 0 $U0 $0<<0 TE $0dlK@T0 $00 TTQK p0 $@T ˜(0S 0,00[ 7#4 0 `0 @0(0 $"0 $P@@? 0T0 TS4X0 [80Pƞ0 $@T ˜(0S0  p0C!A 1SAB0 ?0  0 `0 @0(0 $0@? $@AP`U ˜(0Ss@ 1V @T0 b1 b0 b0< $@$" 40 O40S @TO: 0 0   ,0,1 1r 0 $@PP0 T 0T@0 TT0 $000 T0 $000 T,!00,, 40@T: 0 `0 @0(hS >S 0 $0@Q $0@ 0 T%H&& '\'''($(4(d(H (((()()`)l)))$*****+ @KLCdF<+|+SXP喝0= $0`> $0PQ $0@d $`P@ 0 p0< $0P $0`> $0= @$@B0pe $0@d $P` 0 @60 $0` $0p $0P $0@ $`pP @0 x0 $0@ $@  7$2X0? $0@ XR$@ 0 [800֜lQ 0T0 $P1`V ˜ P(0S @ 0  ,0,P>0 X 0S SX墜"SD08 1X1  ,H ,P0$0 b!1317!10A0  0H0 R0 ? R2000 $(0Sk #>#[ 000 @  00 0000˜(0S%0 04 0@0Q T0y|0 5h 5 5,!S|lh I|0 $, b!1317! b00" 0(˜(0S (0  $0 (˜(0S 0 $0 (H0 !_4  cP @0()  -LM1`A p0 $P1U &0 $@1@T –(0ST 0< $1  j @/ 0 $ X 0 卛 0T0 $0 20T0 $@00 T 0T0? $0= $0@> $!p00 #RAp ApBp@|K  0p@^ZF X@ 0 0@ @^ 0@ @?0@pPp1Z PUZ |Kf0b $0@c $@D1  0TX 0J P  2(0 Q000 0 ^0`8\\(\ К 0 0# P  0 P   |K0p@7|K  0 P  |0p1X! ,0 00> 0 P |K 0@  0 PA  |K 0 @@0Tp0 $@00 T 0T@0 T0@ $ p 0T0 $@1PU –(0SU `PK h0@,@5 jX 0dR! 0 `0 @0(0? $0 p $0 P $@@ 0@ T0 $`U@ULt 1\  R! 0XP@ 0 @w :00 $T 4 1  PU 1S3   D@Ko 0T0 $  q/0 T0: T0c $0@b $ @0D  0h1  0  h2SxPpMhJ0 \00= $1Xp00C2 5tX  0 Y 0 $00#0 T  Y0 $1@!@ X  0TT@@   0 `0 @0(BXN0 $00#0 T0 $AZPAB0 $p0 $1B1+H +,!!!! "P"""""" ##H 8#h# -LM 0X!00<5 -1LSP `p0b $0@c $@ Q! *0S*0S* Q : Q` }WxVp% 1 q/0 T $0D 0T@ 0T0 $@0 T0 $1  00 T 0T 0@0` T`V0  T@0 T8 0` TX1,0, -LM@0 T0 $p0 T0 $ 0T0 $ p-L MP` 0嬗媗@@⥗ T l块40S @T:p,!00,, (勗40@T:H,|,,,) - BR0 01XAxA0X1LS S+ OPp T /,|0A_L P@`  `V@PZ0Xq/X @2, -LM`P@p!W 0   0S00\3Q 0Q%05  0i0 $0000 $0 0@-@ 0000 00#0P00S 0S(  P\ 0S 0R 0SR 0S 1 0S 0000P00000  l0 pR  \ 0S  Q 0S0p0Q R 1 0S  0R !Q 0S0 0S0  R  100Q0R  0S0 0@- PU#>@'  0R # 000#>T0 0R 0P 0QU # 00PRQ 100000 -LM  R  `Y,0 4 , 0 p0 1X  \,  00,   0  5 ,SR Q. 14 M Y@ 0 @@@@0P/@,  0̠0 @0@(+X `\ 0X Lȕ 0\4 rX 嶕0 T1 0 T 0Y00@ 0 0 000 p0@@00S 0 $@0 0 00 T,,4-2 -L M  X1p\P`  0 `R00S 0V00P0` 0̠@@*0X 6T< 0y0 T`- p-L M@PK` %X*0 ̠Pg*p -L MPpU`3 @K M@01X4 3[1   p   @0 #.[ @@   B( R PUW0 $q 0 $<2p W0 TZ0 $ q/0 T0 T0 $PpU' B@0( R'U  0P$ @0 00 T0 T@0 T0 Wđ  l ( 0 T0 $ 1y 0 $r  n(Y2M -L M0@p $1,00  $0= `$0P> $p00#"A AB01  0< $0 1$ HR10QP: -B\ 00  0020 -LMX@ 0 @库- 0-LM0  p0 CBPP0,BA ? 1SAࠣB࠳ 0P0 -LM1@   0 T0$ p-0LM 220@P`3   }/ 00 0 WDb0 $00 T0 $00 T 0000!2p0: $P( 0  0 22  002 2}/ }/0 2 V0 1 ' A0 ” @? 0}? "0  0}?#   0}?  "`0 P0: $0 0Ր-!--.8. -LM0 1`X \ 0$0 \, 0$ K(0 0(0 (0Kt 0, SQ< (0 @S@  0^S  1pW@T  0T,0  ,0KpT ($ ,0M$ ,0  & $0RA-@ p`@SPE }}ό}}O}op  MPrP 0 Ѝp@-P b@}00}ό}}OP`0M0 bR ЍpG-M@P`p S}ό@PE `p}}O}_}o} 080}0< } 0 2Ѝ -LM01 22@ $ @00: T0W $00W TT -L M@K@0 $PU ”(0S0< $0p $0? $`PhV`  0@,0F 0 4U冑00UPPU A X0A u0 $00 T: 0TV 0 U0<0 oP }? b 0 $0 T0 T2ted*_P#` 0 `0 @0(jp.... /@/h/ -L M8pKP0 $@10CSlܵ "RHe T T  @0T5 !Q 0T40S.Q% 0BQ @ 0T•@ }/0… TQ 0T @0T2 " @0T@ 0T 0T后`T`V 0T23 R 2S 2S01v0 B$@LP2@02 2bST|  0T0 $ $00#20# `$00 T0 B$@LP@p 2P02 V;0 $000 } 2pSr 0 T0 $000 T01r5 2S8^ 0 $ 2S " 2R 0 $@000 0 $00 T !0T@02 $0@ $000 ///E- bPU@p*}?0^ 0CSW^ UP:2SPH0H 0SWZ 2SP2SP -L\M 0!XQp00,`@L@ #PsHXX@PXXXXXXXXXXXXXXXXXXXXXXXXXX@Y00T00S0 2P50S`0 US }? @" 4 RP/ 4P @0 P, K00K, @4 P@  40KPS40` ,0 ` 06P@ 40P R`0L0 @L0S , 40 ]B`` R3 RP3x#P00#h#h0 P00S 0H H0 0DP D0 H0\D @ < \ X0 0< K@ KD0KR@< H0K@` 0P( <\  RH0X R 0L <0 D0 @0 H0 @0@HD @0 @*D0U0@SX  0X  0B<DP@ H0B BP<Bp1T ZPX!0@8 K8@  ` 0P1 8T 0P8 0PLT \00 @6@B B1B 0XT0 L 80 T8 † †T "T @ L 0@0h0 -LM0P $0Z,0  •(0S0 1@X S |$ 0 P@ 0@00 @B B0,0 B, 0P` X 0`| 0` 0S B B,`  0P@| 0 `q Vb LŸHB"VX 0 @4@Q &@0 $000 T0: T101 R 00000<00 0: !p0C!A  1SA B 0@?0 @[ kX 0 #@X 0 W 0 ``X 0H 0 `0 @0(0000T111 -LM0` $pW –(0S0< $   0; S 0 $ 0 $0 $@ $00 @D$00 H$0P $@ $00 @D$00 H$0 $ $0 $ $0,0l0 Q$ 4R*A 0`$00 T@(40 TP(80 T(< T@0 T*40 T@*80 T*< T0 $ 00#0 T/ 0 `0 @0( -LM0` $PU –(0S0 $@ $00 LH$00 D$00 000b,P00 P$@ $0@0 HD$E0 4 phP'< T@'80 TP'40 T0 T@( 0TP(4p 0TP0 T1  0 T@0 T0 T0 $@@0 TP00 T0 T 0 `0 @0(8 -LM` P 0PP p@ 0@Z0 @pp@U0  p 0 S00Z00S  X0媊2 0-1   q?L@  q?Pl0U E 0BPE. ӻ0$q? p-LM1P< S a@T PA1v1!APH20H2pA0v1 P1  `@T LL 0S AT 0R0S171!'001! 01 (0 P PP \ 0-@XPPLXR0@P@ P`jP<ˇ  <"XbB>CNC 0@]@ P`PP" 0-0 0 =o0 R 0S 00^0SX@Շ X0Ї 7M2N2L23 p-L MP`U5 0SpHHDT 0H4 0p@HDTC,$ 4@ĕL`A$4$ĕVPpph@N -L$M⨠0SĚ1c  q?P <"XbP@P 0@ P`PBH4 01,  H b,R ^0 P@`0,P$00(<2,˜0 0 0,  P\L00 ,0P  0  0p 8p000 o:@L 3 -LM`0p1 !A!P0 0> 0@e 0 P@"¼1P e0 m| 0ep H 0X  `AD  ,,343@3H3P3X3Mx333 -LMp< 0T@W 0T!1#5P '0 T0Z $&.0800 T1b 0T@ 0TP2@T1 `@@K?TPUP 1 PU—\(0S+P 1 PU1 0d0D T@&40E TP&80F T&<G T$b@0H T&40I TP&80J T@&O_@ PpPhOH2!0H2 $2?*0!@2 12`V 1:11H"< 14H" RP(4A P 1 |4B P < 0T@W 0T44 R1155Ã110Z $@  @01 0 X1<1340 00 , , `p3V 1P3 1XQ!  L 01 1 003 , 4`?V"00?"T0 $86#(pD 0S8 0p $00Z00Sp   Z000S1   0S0 1000 0! 0000 p0#2p p0@S00 S   R0000000 p0 03 $0@2 $@D@@4@ B 01 $0@0 $@D@0@ .0[ $@ 1 01X, 3M3 2j4 0-L0P@ $`q 00T 0 00 00T0 0-1L6@_1!0 T0 $ 1V0 $00 T0 $5 PU! P-  0 $  }.q/0 T0 $PU 0 $h刂16101 0 $0 $T4 0-@L}P U00$   0q0T -LM@2' p-LM`!40 P 0$?0@ T0%$  $@P0 PTp0 $P -`p!L 0  0$P?0 T@'$  0TP0 T -LM1`p! 0   0$@?0 TP'$  0T@0 Tp@-Q@P`/ 0p0C#A  1SA B \00 R P?  t00^P u00UP  V00Vpp -LM!0p0C#0?A  1SA B  0@@  -LMp@P 0  B 01PU b@0( R 1 @PL 00L TĞ  l ( -QLMpP9 @  @0 B( R,` 0B( R    @0 B( R  n(  ,(  n(0T 0-1L@ @ 0$ P 0T,0e00M $P -LMP 40 6, 0 @ 0 $  0T0S p8 1000 6 09 TZ/ !01`V •(0S^@VU 40, 00PC 0S? *0,0S ,0 0 \ 0pW1@ %0 T0SYU 4 RQ ! 01@T •(0ST  0p!00`@ V0 0$# 9 0000`01@p0 00T3  B01@T b(0S0  0 $0@ $pW2  0T0 $3` Rs1@T^ •(0S`TX 00400, 00PC \? ,:\$ W 0 T400 , 0S100CS0  p 0,0S 0,00  w V0 $ |IxK} 0 `0 @0(D9{8 0 `0@0(O 0 $ 0 `0 @0( 0L 8 8@ 1 |x 0 `0 @0(0M $jL|4444* 5<5X5t55 -LM 0\, 00 p!!000 4 40z0 00 BS0YiPU `@ P UY \100CS0 40 0  00P , R 0R4 0S4 :S <R00000 0  0,0S0,0 -LM@PA , 00 $ Rp4 cW6 0 T0 $1 QW*W[ 1@T b(0S90000@,  0P$ R  Gp0SW^ 4 0 T0 $p0 $p 0 `0@0(0 $4 $}({ {L5*5 -`L0 P0 T0 $ 0@TUp0 T@ 0TA 0T -LM@0 T1B 0$00 T0 $00B T -LM0p`@ $@P0 T0 $ 0@TVP0@  0 T@ 0T0 TT0 $00 T -L,Mp 00 , 0000 $@ @P,  004@  PW zD 8P <  ,08 BS8 8  < 00s0 @  0S= 8< \-@` V$8 2@T R@0( RT ,0 0P` V8 <0 R8 @ , 00 @@5 08 \"0S<PU" 00 @ P0  ,0P D0 0D0 0,0S ,0   U4 0 T100CS0 Du^|8 0 T0 $180@Q080  b@0( R0X0T00ST ,0 0P  08 RĞ  l ( ^đ  l (D1@ @"M$6 0-0@L $00 T0 $P00 T0 $ (P0 T0 $0 00 T0 -0LTM0d0 d0DKp P#0 T0 $ 1N0 $1PA@ A@B@0T $d0`T 0% T0 $ 0 TWf}@20 T0 Tl @0 d @0h 1 0[0@ 1X!R Zl0S h0 $ q/0 T``pK@Pd  0@; 0P` 0@0 P V0 $ 0 TW 20 T0l0 0 $< -L0 0$ 0 00b,0 0R$0S4 ( xD6 -2L$M@< A00 c c c` P@ D   Dܫ10`KS 000KL"?00[R 0@B/0KA1*K+K40 , K-K.K8` ` 0Tb 0T@c 0xTp@4K 80KWP@7T:Va a 2P@ @ ᐰ` 0T<T2W) Z 0 !S!R Z0 KSpD1@SpD!`X0 R1S@ 1p !X z<  xdHd66 -頠@L TpP`*0;#;R @U3#P0@#5;#;00 ""A T*0;#;U H -2LM1(pK0')[1`8 V񟗐2[0[%[1X00 4 @* 0K 40K4Q@Q0d0d@T: Ph&;#;(( 08   20#0V00S  0SE023000 ,0  R0<<00a 00dY  0Ǡ0 +0$0,0 \ 0X Ǡ0 +0$ 00X6w4w866 -ML Mx0Sl1, (K`p@ 0RI*BKHH0!JyV PU *A00 R0  PU:ZxԮY000,0 S ,T[+㙮S Zhh+㏮@+㊮0U*Z(xHb777(7,7 -LM0p $  0 $0 ? 0 $Xb0Pb $0@c $@D 0xY0d $0`e $0Pf $0@R $P@` 0  \x0 $0@ $@  Ix1P ,P ,K40 $2@ 0d-@0 $ 0(-@0 $ 0,@0? $ ?0,@0 $ 0t,@0 $ 08,@0 $ 0+@0` $ `0+@0< $ <0+@0 $ 0H+@x0 $ 0 +@h0 $ 0*@X0 $ 0*@H0 $ 0X*@80 $ 0*@(0 $ 0)@0 $ 0)@0 $ 0h)@,0S L wP0o $0@o $@D wPUZ 8w 0v09 $vv1@ 0 $ @ 0Th8PT 1Xv0@T@v<v0@ $@T P0 T0 $  v0 $@T0P Sڌvv0A $@T P0 T0 $  v0 $@T0P Swv—(0SPqv6@0S Pgv @0 SP Rh[vxYv0B $@T P0 T Ev0 $@T0P S6v4v0%PUP<@0 T#v0 $ 0|%@0 $ 0@%@0 $ 0%@0 $ $0@4P Uhuu@PT,  Uh<P'0u0@$00$00#01 e\ @Tuu0P@T  UhP0u@THu `0S' X`ڸ!1<u4}u00 TY 0 $ q/0 T_u@PT  UXP0Tu@T8Ou0T\Eu0 $ 0" 0 $ !0#uv0  0 <(0M $@18u0 $@@,K2P!0@tw8!0 T0 $ 19 0 $2077777888$8,888@8L8T8\8d8l8t8|8888$dL88880D89989L9h9M99999999:L:`:d:p: -LM 0p`00* pP,P@0 d90 00 04P@0` &0  0 P@0` 0 0pP@0` 0 ,TtQtV V 0  0V 8:::;L; -@LPp`$ 80 0-!LM0@: 1 _”(0Sc1 QPT BU<  1}Sڰ1!;0100 $@1P01 1 00 $01 0T0 $e0 $P$0 0 ( -LBM804r4"(0 0@002 032#"L00D P@30` 0`X1 %X!@[1 PP@ 16t!0&Z`A00C\ 0  "!,0 00 1C&  0 "!0 0 R(0 S (U(X 0Y| 0Y1XX 0  BK! AE!HbpRdtRd  (RdRd0p; 0-LMBP(0S 0h0 $0( -LM(0PSpU R000    1 0p0C2#21P0000 0<0hS$0S ˜0(  R  $0  @T d 0h @T,0S  0,00 :6XXr,0S00030303830303X3`30h30303030303030303h303030303030303@3X00C&S)000000830000000000000000000000000000000@30 0,0,Q0yBŸ 0000 10  0P `000! 0  91tRh`R`00C\ 0  "!80 00 $2C&  0 "!0!0 R-! 00C\ 0  "!0 00 1C&  0 "!0`!0 R00034@ 0, `1317 A$0,0n0e0c0 0, 0^0[0Y0W 0 BaQ  $0 (˜0  $0 ( |;pRdtRdRdRd0Mb<0 S:<0- -LM 0R `Y 岐Ql2l2@0 ,0 \2p P 00XR $@00C\ 0  "!0 00 1C&  0 "!0!0 R*@h p8Q Y 2,0R  030 00   0 00   E H`@00C\ 0  "!0 00 0C&  0 "!0d 0 R0,0FPsvpRdtRdRdRd0dF -L$M0p X0,0W` P 0Q,@*00 Q @:00 00•0(  R@D010•(0S, 0 0, 00J4p0  0 0Sp0"C!X100  0@00   9  0 00•(0S0S 0  00 ` 0 011p0C!00 0`0<0 Ri 0@*X0 0C\ 0  "!0 00 l8C& d 0 "!0@(0 R P-0 7G0 0C\ 0  "!0 00 7C&  0 "!0t'0 R0  <o0; 0  01` '0 T0 $ 1n1b 0S T0 $ I 0p 0  f/0S* $&0F0 0C\ 0  "!0 00 5C&  0 "!0%0 R=D@K z H0@@ 00f?@q/0 T 0 T0 $0@ @pQ0 0$# p0  00@ 01`Qe  Rc 0`D?00 $0 0<<00 1•(0SB000( R01@' #0L T1OF#0 T0 $ 1 0 $0 ~0 0 `0 @0( 0  0,0(• l2 2hBaNQ0  $0 (;Wq0 1   0Ÿ  0`2 @000! 0  91QhN@00C\ 0  "!0 00 1C&  0 "!0\!0 R)(! 00C\ 0  "!0 00 0C&  0 "!0 0 R2 $(0  $0 (c  $0 (S00 p0p[pRdtRd26RdRd0;8& Mb 0-@QLP  0 $@TX m0T 0; -LM0X(,0P @ R`0 R* 000$^ –0  00 P 0 0, 0G/ ( ,  ᷣ q0,0 0000 10  0P 000! 0  91dQhM00C\ 0  "!(0 00 1C&  0 "!0 0 R. 00C\ 0  "!0 00 |0C& t 0 "!0P 0 R000.pRdtRdRdRd0 -LM0   00@T h+M @T -LM Ч 0' `p0P000  p0C!A 1SAB0 ? 0 Y00Hl0? $40S,  @T:0A/-–(0S0 $0  4 $0< @ $|6 T*1@T –(0STT 0 008464`l0 00&0 S 06h!qL0 $ ( Ep00C\ 0  "!0 00 5C&  0 "!0\%0 R q/0 T0  !p0C!A  1SA B 0 @?0@ : 0T, @0 T0 /Pk000 4hK0 $ ' Cp00C\ 0  "!0 00 3C&  0 "!0|#0 R q/0 T 0 `0 @0(&–(0S0 ,0S 0 ${0@  00 @P0 /0 thk 0,0 X0 H\ko 000 0  00 @ @1$ 1p0C0! ?0@ @0 .)k4 0 T? 0 T0 $000 TXk0  $0 (g0 $0 ([, 0 4xj40@T:FX\jThpRdtRd;L;; MbRdRd0< <.H<\<x<<<08XR 00 R Ѽ0006 -L⸢DM 2X  @DK  `D01XQ 8 ?O[q1   0#[000  0H H K0H @R H0 0@0T@ L0 L@ T H0SP P0 ? [ 1 P0P LKP K0[@HPT0K @T^P PL \ 0S0ȅ0ȅPT L0@  @X0@0X 00C\ 0  "!0 00 0C& | 0 "!0X 0 R<0[  000xpRdtRd6RdRd0j 0-!LM0@: 1 _”(0Sc1 QPT BU<  1}Sڰ1!;0100 $@1P01 1 00 $m01 0T0 $<0 $P$0 0 ( -L,M1`  0H0 P 00L < D @ q80 03K03K03K02KPK02K02KPP > ".B 0PU80S080 U 0T0 $APA  0T@ 0TU' p1  R U 0 200f" 00 $  1301 "pQ0 $DP0 $PP0 $TPTp 0Pp $0qP@ $@T0D@YT0  P1P31PPc g -LM2&P`, Y p 0 p@191 Wp W1@ 87#,00,0 1  @0 8#0S 1| 000p T0   0 0 pT W$0!000!@<#41" @@@@<1"1711 1 203 S%S( 0Z T, @002 T, P"403 T0 0 T@)401 Tl2@ l"20@ 0"  0 8 #q2g -L,M0L0 00PSp` @0  0T!!  J, 0 4 8 s i @KD K<0KH@ !0H0 1@ @@W@\T HPO DQA Q P 00S @0L0 00S,0S L 0 000L0 040 S0000T80SL 00L0 LU0S 0 T1 \X0Xg!@@ H@ D@ DH `BR` 0-1L0SP 1 00 T0 $ $@ 0T@0> 0BR 0 0 Q\ # 8#8SR0SS00000 R0 0  0S Q0000S0 -L M8`,0K(pKP00*p` ` ,@T D=.8  ,  4@T <08@0 0`  @TP = 8<D P@ Teh===> -3bLM@1`pܖWHPfPy  p!0W@O d8> -1aLp P @ @H0H S1H0yyH@1S!( @p00C& R 00#!x000 d0C& \ 0 "!08 0 Rh @tRdpRdRdRd001 p-L M8`@1~0 0 02  P@ U {dppd> -010LM ` PHpH@0T .@>P0 0C\ 0  "!0 00 0C&  0 "!0l 0 R3 Q1101!101tRdpRd>RdRd0 0-1@h0PL 0.D01P 0yτ1@0hv -PPLU` p1Ah0f=P h@\111T01 0 PPUC X0 BaC1h@01 $ChCD vMb> ? 1!ApRdtRdARdRd0 0-0@LP  0 101HP0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h% tRdpRdRdRd0 -LM`8@Qhpd@$0S (0S    $0 ($16 0S $S 0,0000i! 0S0(0,00 R 0S $00bS ߆S 0S0Sq4 0_iAP 0S P0S -PLM0`pp ?2SQ 2SH 2S 2S8i_ P i_1"2_•!0?0c~0~@lT0`@~0/ 0~0 @?t @?0H405dp0\hPd (F`0aiu?   8C(C XCgfff( p-LMbp0P  B  p0  p0 }d 2 SK}}}}}t}t}}}~}  p0| p0 2z 02p0 2y 02p0 x p0~ p0 p0 p0 2S p| p0 ^x p0~  p02~ 020@z {0p0   p0 y@x p0~ p0 p0 ,( ^m ^] tCC 0-Pp0LL^H0@  < 80p@ 00o^C bC -"LM0`, lB^ /@Ts 0@0\/@  0,0  3ఠZ p\ pp0 , @P\  p0,PU@ZpZYx122 2St  t R10 R9!   .> Y @,0S / 00   0 0p0 o/] ? o00@@㶏 0Y @0ZP0 HLS00l? ]c  CC`C -LM0` Pp#0唀0  4 ? 0 6\6,6/@#b  =2 S  p00z 0@ pX&?@Bcd2P@@] 2W[2SSQ Hp0  p 00t 2[ @/0, , […2p0+ [py0@42 S1 D0 (D%00p %0 5>  p0 ,0K0/p0p0$]$ ]p0* [2 Sp0 2 S@ / ğ0 A 4 p0A$\IpP@ 2p@0p@W 0 ,=#=,0@ J002#10T00S` , , [p0…+ [py0@>2 S; ß0 ` 1B00p W "0 @00  p90 0e"\0 =0p0 L`"u\8,"p\p0* [2 Sp0  DT !0 C cC!N\K\0W !0 @00T1  F JLFl!5\$0 B ? BD!*\4@0 00 =<.#=<0S p0 0D@20  0  p0 ph [L @ ?Ac\IJ@/0\0 @[@ @BMb CqnvCWC 0- @P0 00L |SP0P0C& R 00#!t000 `0C& X 0 "!04 0 R00htRdpRd`RdRd0 p-,1LM Ra 1@ 0 00R@0@0C& RP 00#!000 0C&  0 "!0t 0 RUL  . Dm; 0 0 0pJ@bpRd`tRdRdRd0 -LMs `0@ P0U3p gP`u P@m 0 0] 0 0 0D @ S 3H `00000 @@ 0/0 00S= r`00C\ 0  "!0 00 t2C& l 0 "!0H"0 R P P   /0@0 < $0D0 P` |}x1T 0L1  000 R  0 00U` 0'A00C\ 0  "!0 00 0C&  0 "!0 0 RD gBT1 `T21 P2-0 @0QZ 4NZ0 pRdtRdRdRd0b$D4D -pL0@`P#Up0P0? R gPU08 Z Z LDlD -L M, t0, ?Q,0刀Xn , 0p3`0 0  @ 00  ! 0 3 00W01 P/PP 30 Q   R R8 0S0  0S0 - 4<#0 0C\ 0 !3 0"C600" 00#!2  QX0QI \u P!0 S P P] 0  0J "0 0C\ 0 !1 0!C600! 00#!1  Q+ R 0S0000P0R00S(0 4,YQ,0000 , 00 0, 吀o\ 0S Pږ 0S EPP |׊0O R  0 00WP 01 P8X0V pRdtRdbRdRd0DDD -LMP1 `@ #pᔀ/PⴠF㡊 / 0 20 4 < 0/@0D  0Z00 1 P /0PS0000@0T 0 S00@@@ 0 0 0/0S ozoX D -LM@P `p0ᴠ3Z㔀 1 P /!0i8H0(S\ ,0S H0X0 0@0E 0,0000\1  (Q6,Q488AXN0U ,0S  ]000o0SPZ 1  R 0 0 0 F0 S 00pXH0>0SD0(0D0(0o%00C0 $W,W DDD E -0p L@0P3U`"  0S000I0S J0 R0 0C 0 0 0R 00000 0 T1 0S 0-@P0Lp d d`0@@ p2SS 00hWW0   p0"2 oU.~UQ20) "=  p0@00 0 0 00 =  p0h h-SUT X-NUP D-IU0? R••A Q& Q Q0S00Q0  ?0S aSM  #U0A :|<  p0X0 @0 0 ? R 0  <  p00 ;  p0 0"00 +T +T +T +T02 R | T? 0S• 03"Qv`ܧحLܰܰܰ0 2S 0 " 0D (  ? u0 -4 a}T02 xT0 k0Su S# 0  jT0 9  p0t0 @0 Ed i.RT` i.MT0 d GT2 R00 000.0@00z 0@" `)?@Bcd"P@@! 2V2SS   p0 p0 p0 0D@20 Q,  0 0 0 2S 0S  |R0 s0G S0 00f0 000Y R87  p00 @0 0 z000 0 @5 `'?@Bcdd"P@@! 2V2SS   p0 p0{ p0 0D@2",&vS&qS000&04 "2080 %@4?Abc f 8 AD0P` f80 e 4 `AS0002 R.> շ0 ȵS00ȅ0$000 4  ,p00 @0 0Zt$Sp$S8ğ0  S•|S•0 2<0"D PR0 <02D "(R0  000"?R 0< 0R0\C 30@Sz S0 03  p0 0 @0 \#R H#R0SB  S0 R0 3 ,2@@ p0@00 0Q1 P/I0S J0 R0 0C 0 0I J 0fH"qR@nR00 $fR000   0z 0@0 RR0 0 1IRp0 6 CR30  9R0 %  d0R  R?Q<S0X? R00 S R00R00S 2RmRP DFhFFCEFF,GDGTGGMbGRaGoGGGHH$HLH`HHHHHHI IPIdIxI -LMf0@V0@l 2S 0 a`6  p0D6 "2S$0a0Ɵ00  PS R0 S Sy 0 @00 222 SV "$0KR ##0p/0p0( [' [py0@)2 S& 0  U00 p4   o00p0 p0$LQ$GQp0& [2 Sp0 ~"0 4  p0$ Q0 00  03   000wS Sl"00o"0" 0@Sy  S]<0 0\S  SS? R   #P"I00J2 "H”0 0P0"P2"202/000 z0 P pX"?@RcefPPP! 2W2SS   p0 p0 p0 0EP2”0 0P0"002 ? R $,!fP 0<<0 YP2S o.QP0 0  p0t0 0@ 0 0vTt 5P80h\ /P0?"H(P] Cih_IMbIEI -L(MH0`p0P p0p0 Q p0p0$0S ^ <020pF㐀@' p0 0 D?@p@ /0SS  0,05 -O.p000 P \0 _ ? Mp0 D=  =D>  p00 ->D  p0/00CS5ļ`ܺ0,0 P03@P 0S R0S  R 0 0 0 {P00S1  ? 1/00CS񟗭P +Om吀  ? <R+;/ 2 S? wPPfP2Sa20  0VDUG *0<<00 9;  p0? AR#4@K2㜃00*0S00 =)C40 -B040 0 p0 R<K< 40R  80S 0 NP$ *N2 2S*0<<0 NB0 P@N N0.0 0S0 0 0 000f0 }N0SaX  0傠 P 3@Z  0  9 p082< ?"D  ?X  Q RBT pT[0@U0. 2 S' 7  8  p08    8  p0026'N'N8S `H  2 Q sD 0,M 0  MM T J0@ B M6TT  {T0@q jD7  p0–,0K P, , 0/p0B 0< 0p0, [+ [py0@12 S. 0 &F00 pT5   ,|Q%M,0SgoSp0  p00%rMp0* [2 Sp0 $]MYM00@p0 84  x85  p02X @$0K#/†0p/0p0( [' [py0@+2 S( 0  D00 pL3  o00p p002B<`#L(P#Lp0& [2 Sp0 @ /0 3  p0"L"L/@ Lq0@$2S 2  3 @p–,0K P, , 00/p02"LL0@`!0000  T2  p0BX!LLJ0|!xL I0SX 2SH .> Q00 000I Rt 0k d1  p00 @0-0 02H >L J@B@J lJxJJJJ KDKxKKKA 7 ! K    K* KG LL/ 0LDLF H K > TL l k LL ,M@MpM xMMMMMN,NHHNB;`NN3E1NN4OPOOCOOO@ K00  p0  p00 @0 | !K4!K00 0  p00 @0,0 j!K<!K00 l1  p0t0 @0@ 0  &$"K@8"K00  .zK2G 2S p00 P@  PP@aK0R )xr@p0@ 0   p0 0@ 00 8X#:K l#5K0#/Kp0 2 BT 0@ K0K0  3@p@ HD8$J2S_LJ2S p0@ JT@D)p0JT@Dl0 00 ? @"R420 SH 2"0@@S$T 0 " 0D (  ? 02  85  p00%J JH JJ"0J? JE0 X 0 $0vJ 0 0 0#@0 00(6 tdJ 0 _J\J*{00tD&OJ&JJ 0EJAJ2S 0 7  p00 @0 0 X'$J\l'J00 7  p00 @0 'J'J0p0p+ p0 P5PJ? RF ^ 2S@0X@Dd 0I32S1 B0P@I\@@ 0 S00Ʒx–B/0 @Ip0 0 @p0@ X l)Ip0 0 9@p@ ? R  yI0S/  z.nI 0 fI vp0f?X VIHd VG - 0P@0} 00LU@ ? R h1? `R 0V 00B#hN)  ?Accp0 x0  p0\ 0@ 00 <8 I0 $ I0@BMb  C E -L,M` p P03 p0p0@ D0H 0 ? @ @ 2P0 0" t p!ld $(HT!@000 @- 4HH$Q@00C\ 0  "!0 00 0C&  0 "!0 0 RoH0,0/0V0 2# PuH0t 0#t pRd P BtRdBRdRd0B -1q!L000_L@`P 0SM0SJ RG0S< R 0 0 0 cP`V@@Z@00C\ 0  "!0 00 0C&  0 "!0t 0 Rd00am((00S1 bpRdtRdRdRd0 -LMp0@p "00 R0 p0p0$0S< 002H0H  0Gp0 O -L MX@)W   0#P@ $#R 3R:03 0P 0Z0ŸlPt0x | p0 0U 0 # P^ p0SyE|0U0  P\ t0S  t0\| St  p0^࠱x Sp `,0K(pK0p0` ` ,PP0 0 ,  :4PP  -G00`0   PPd :A PP40X, : \0\hPPPQHQ p-LM` @0T7 0T@ 0T 0T@h0 T 0T@9 0T@ 0T@A 0TN 0T@O 0TH 0T@60@0 T#P020J TX0 0!0; TX0; 0O $@0M TX0P l R $0  @ 0O TM 0T@0O TX0 7 %0R $X0 p\@?#όL 0 0T0G $00G TX00" $0 00" TX0dJM T -L M `, 0p 0 P崠0 #̠#3B(0+)*@ -w0PS X0 0 < <0 0P0SQR0 RD R9 0@ #@!@"@,0  0S  hw p(0TP  00h #Ġ##Lh0@0 0, l0"""Ƞl  p(0 PW0 0S0000,  0!00X0000000X0 000 0P 0S  0 d0p S00 00 00 v0 d0t l = #=Y -`0 RLᲠp P8 0S ,  ) 0 0 030 0@###Ƞ+)*(0 0T00  @@ "" ?0 0 030SL S  @ 0 0 @ @0 D 00S@P Q@R@  0 0 030 0# ##Ƞ+)*(0 0T0 00d0p S000 X0 00 03xQ -LMP0 R @p  {D0  S0PQ0R00Sd0Pt0^|0^(`0 ZD ( 0 0 l 0`R Z V0 `H P 0 =D00 A 030?0`200>0 0?<0040 000`000 0 T P 0 T 0 T 0C 0( `0 `s0S0 0 0 4C 0( 0 ]QQ8RRR -L M0 p@ d 0R , 00 QP X x0Up00ClXUP 0\ C Q,0 P 020@ 00 ?@0S @ 0# ##Ƞ+)*(0 0T 0 T0^,%0S, P@0U20 0>0X0 010 0 !  0?@?<0 0@0 0X0p0Ux0U 0?0 \Al 0\ Q,000 0PQRS 020010 0?<00 00o0S, P0U20 @0>0X0 010 0 !  0?<0000 000Ah0@- PP @ @ P  0 0,,,,S QRP0-  00   00 ! @0T1X0  @1 @0Th@1 @0T X@1 @0T\ ?#/Z?B!P10! 1N N R0000 0 P@#0SP11@TPUX0)(0S0>, \p0 0:(8 0P80 p # ?Z? 00|P@0!Y>!0@\TX0  @h @T0|P".@40|!.@0|ugP  S -LDM0P $@P T T/0000S 0 ,@T 0,0P*:P:@TpW , ( L 0H0 1D 000 X  X R0B ( 0H$Ƞ 4 $4`8 4 ;0 0$ W 0 $@0 \04 $0P< ` P 8  >4o4 "50 0> W0P0 6 0 0, 0 X X0ST ! L 001{P^ ,0S T R0p0, \DH M 0p0, \t >4 W 0 # !"8 |>4  P Z XQ < 0, ,00C, \X0S <4;8˟W@ <0h  C>00 ,@@ W $ y 0SS;@^ ;^ " ^ @ ">Y0,0ZY :  Q00 0M  > 70p0t:@QK h:Q @TA T. T 00 0@S0P@Q0R0>0?, \OP@ P  0?p ;  P P  0?T  R00C##̠#,IJH0K 0=?=0 $P Y 80=00 @0|~=0 S@ѵ@`ѵ`ѥTT V00TP ,000D ,00d0p 0?zV00T  R"TV 0DSY Tpl8=aT4=pY,@0 (00 @e, 00 DY ==6@ Rm W6RR 6R4 000$0@@5 D@ $0 6 H $D@10L S,0  (& ,H10S00  L 00P 0pF?, \MLD H0<CD H0<=<;75@\ x5\0, ,0PcH<@ <5 000$P P `hh!rx @ }<J0 ,0@, ,0c4 t80f<WZ W @@8W<0$000 04 T0?R#000 0=>@&<PW hL<D Y0 $`< h?s <5 0@+& ;0, ,0@ @c, ;W 0x! "$# (,;L;8;0;(;0, ,0@ @c, ;w640; $000; T$ H ,p D L 0p tT!c#4 1q TXV T0T;z; 0T. T@ThTTT0UdU xUUUU V,$V\VV VV W8W\WpWW WWXXXhX  lXXXXXXXYY(Y@Y𫪪dY -L M p01 h!{X@T T T 0,0 `V    (0S    $0 ( $ `V' V 000     0pp(o(0S $ $0 (P,@l 0X0[YZ,`  0 " 0$ @ $ 4  P(0S1,S01ppq  $0 @( :0,0 0S0 0q:,@m 00S0hTg (Tbt000 0 0{0000 ppT0HH0FlYY -LM`0p @P h@T0A`(@0S F/ 9:Y -LM4 .:440#0KS80 00 , < <0Su8<00Q8 <0 4QU @T00 4 01 0 00 PP0 P9TP40QU @T0040 10  00 PP0 9TP0PU+ $0  0$0@, 0X0 q x9 0p0CS00 00 , 9 R0000 0P pTp0 1`V0@00 0 / TʄQU 00 PP0 5 9@Y<0 0S40#[ 00<48000<0 *4#JTZZDZpZZZ -5L앟M 0 p0`0 0, PU hR0000, 0 4 @ p V묀X- 0 A0S pP k40   ,$ `j ,\o 0"""Ƞ[YZX 0  ğ @  $0P@(0S    $0 (:00B00 PP00S000)C0 0C\ 0  "!0 00 3C&  0 "!0\#0 R@T C0Z 0 R6 T) B0 0C\ 0  "!0 00 2C&  0 "!0x"0 Rpy00 ,0S 00`S 0QX0 4 0   00S, |@DTʣ :80pA,00 0C\ 0  "!80 00 $1C&  0 "!0 0 R, 00 8 <GP,  <i묀000,h 8<0cP8, ` 0@@T 0Z,tRdpRd  RdRd0ZZ,[S -L M 8p (H P, 0 0Qp0pU  0 !01 R PY0 R0Q00  , R  0T0 0S $00` `1S `VV 0(`S 'W ʇ0(@ P@ p'W(W V000S 00  0 "00 `0 SP QR 0 S, 0 S0Z 000SJ R0 1C 000 1QQ@4 !010 ###Ƞ0`J/) 0S ( W{ ppm@000/ Ij Qh.F/ R01 (~Pp P 4  T[ -@Lhp<0P  06 `000{$00$0@`0`0C^  00#!t000 \0C& T  00#!04 0 RpRdl[tRdRdRd0 -L|M<  PD  oh DP eh<@80K4PK 0P@ @ 0,P<  X<0D 00 8 :4P<0D00@  0 P<0D : P<  s@ @D0<@0 0  0@  P4@V@ Q< @ D0< 0H  0  , @ @ @00gDH 0,  0,0 t0 0 !P0 T?00@0EPT F X0G0\ M `0 N00Q0R0S0P L 0T 9 : ; A B C 80<DLd0O0helfp g x0 ]0|0^` _a0b0c0dX0Y0Z0[0t \@11 RL8 $ #4"( 3#8(0 < d3 \<0L>1D3 /8ß!0S!(\  0D00  00D0  0" 0Ÿ000 @C\ 0  "!|0 00 h2C& ` 0 "!0<"0 RD@ 4 ^@  1 0<00 D0 0000C\ 0  "!t0 00 `1C& X 0 "!04!0 R<  4<D0$<D0 <08 0DD<  4<  l4<`4< P4[[p t pRdx | tRdRdRd0[$\T\\\ p-LM1! 0SPO*aV R0000 0 p P`! EfX0910  P0 0/!1 0 101p! 0!0@0|80!@0 !?\p, -0L`pP@4@P@' PUU1 1P0 1@1 R 0S @0  R0Z 6PU0m`< 4 80 4! w1 \ 0- 80,#@L(Pf 80,#(]0h4 -LMP0p @Rh8` 0Sa: !30b0C02#1 11$0CRR*D!10!,!A'& A!10C0  101 0  !X0$ B9!10 #P1 ! 100P0 m$0!00|  -LM0PpUAg00 `0V Sd 480`08 @08  800G 1`0C 1 -p0Lh3d0d 3\0\3T0T3L0L3D0D2<0<h2 ] ] <] X] p] ] ] -2L0@2P 0 T2  $`Xp”  $0D2=7 hh2:]] 0-2@ L $2PU02PE78;70h|2 $00 0 R (2R@0(2000UPE(2@0(2000 0-@200 L 2P ”0  T7;700”00 $”0 0 T -LMoP`pB0  T• 0 T}|2  $•0  $0pW`00"V @00"0202002 Vh 0 `  0-2@L  $0 ”?00,2,20  T,2PU0”0  T,2PU -4< BLMRp< (2 7  —0  080K4ddd@ 0X004(H@0@0C\P 0  "!0 00 3C&  0 "!0#0 RU 01 00000!C \! 0  "!D0 00 03C& ( 0 "!0#0 R0S$00 >2@ 000'$@0@0C\ 0  "!X0 00 D2C& < 0 "!0"0 Rj$ R 1 0+10 ,(#[R8  ly B0<J$0 H <2 $ B@$ @Di000U 0$< 080KHpRdtRdbRdRd0bb -LM20P2  $ppGwD 2  $0(0`0 0 J9 • TB  0T•  0TB0  0 0K4 "4::C00 0 • 0 pGTw(2 @0(2b• 0 T2$ , -L M\`p@㼑P $0P@P@_ U0SX Z 0K$ $0G P$ $APU0\EPEPU\E PE$ $PU\E´0PE” PU0\EPES0S0S  $@ $@DUT 0-PL@ 0 T#0000000 0- ]@Lfa ("7 <7("0,A 0-(2'L@0+P(2'  $B0 0 T• 0T} P  X0hV/2  $40S ? • 0  T2 $ ?R(20(2 0BS0B S((2 0(20(2•0(2 02 T(2•0(22 0^ -LM(2P  7  2  $•00 0 TB{/0  T•<#0  TB #0  T•#0  TB.0  T•"0  T2  $0•<<0  T7l* •  `0T2  $•00# 0 T2  $•00 0 T78@07hp2  $•00  T(2 }8 7:# • 0 TB 0 T•  0TB@0  00d•  0•  TB@0$,00t }@ d(2 0T2  $•00  T7@07  -L M4@`2  $–0 0 T耙X 2 $3#0P2%0"2%*2  $3 ,2^耙X 0 S00 00C0(2 7ZR B0  , T–  0TB  0TR#.0  T– 0 TB 0 T–  0TX@ –0   d@T– ,0 TlPg}#–0  , TB#.0$ T–$0 TB$0 T–$ 0TX@ PpU00  Q00S 0Q 0U 0U0 –$Pt@T–$x0Pp–$Pnpt202$+$2  $–00 0 T9 : -42LM(2@P8`0 pVP1A'00C\ 0  "!0 00 1C&  0 "!0l!0 R L1T0D1T*<1T 41T A 4 040 R=8 4P4@ x0T 0Tt0. @RL0SLX0T/0tRdpRdRdRd02i 1i i i 5i i 6i( -LM@20SHHHxHHH 42S 4"7,  0-@P2  L$00("@004 @0000 000  p-L M` @KP 0\ 0 pP -@L` pP$0` S000 $57?P0 @;R8@080 Q090 p-LM2@  $”0 0 T2  $P`83-'2  $”?  $”00# 0 T2  $”00 0 Tp -LMX`P a{Op "0p34\+q( ,200 N+18@0 0 4("8P /  `Oi0 .05S 3S 0# .04S 0 %&003S 4S hF0  0,h+,L^HAE"H8H^ p-0PLM` P @09(@`00C& R 00#!000 t0C& l 0 "!0H 0 Rpph0 tRdpRdRdRd0 0-L@Pp2l (  P}U}U 00h*^ 0-Lp@l1 Xp2l (0p”08l#8 XPp2l (0p”08l#8 Xp2l (0p”08l#8 Xp2l (0p”08l#8 Xp2l (0p”08l#8 Xp2l (0p”08l#8 Xp2l (0p”08l#8 XPUZ0 p-LMpl2P@ `P1Xp2l (0p•08#8l X@D0D3  1 p2l(p•008l#8 Xp2l (0p•08l#8 Xp2l (0p•08l#8 X@pp2l (p•00 -4LMट `P 0 0PP`pp l4XpB0l Xp2l (0p—08#8l X d ` \ Xp2l (0p—08l#8 Xp2l (0p—08l#8 Xp2l (0p—08l#8 Xp2l (0p—08l#8 Xp2l (p2l P (0p—08l#8 XUIzp2l (0p—08 l#8XU ] p2l (0p—08l#8 X@p2l (0p—08l#8 Xp2l (0p—08#8l tAX0 0C\ 0  "!80 00 $1C&  0 "!0 0 RUp2l(000@p2l (0p—08l#8 Xp2l (0p—08l#8 X@TZtRdpRdRdRd0 -d2LM\r ` 0 00`p@P(2l Xp2l (0p”08#8l X ' #    p2l (0p”08l#8 Xp2l (0p”08l#8 Xp2l (0p”08#8l X00C\ 0  "!x0 00 d0C& \ 0 "!08 0 RtRdpRdRdRd0 -LM7$pK00#0Q00SP`0@ Y"`K!@K1[ -L MpǗ@, T (K\P` |Y&@K%PKbK -LM@ p”ld0 X\ Qp” 0l p2l$p”0l0 T 0-L@Pp”l (0  PcUdU 0\'0_ -LMlpBP p ;XP` Ǖ@0pV+?p•p•0?0 < 0llXP` p2l( 0 $Y$0@ TǕV 0-Lp@l|0 Xp2l $LP 9 0p”l1Sp”l9 X0 -LpPl 81Xp2l $L4 p @p8p•2;8l#8 @XTڼaV@ `pp•l9 X X0S6p•0l3; XV@`Zp4<4p•9l0 0-LpPl|0 Xp2l ,?0Ap•l0 \pBl .;X0 -Ll2pP 2Xp2l (pB Ƞl 2,hXp2l ,? pL   X ?  X~ ?  Xo Xd ?  XT 6 SB X@ p•l1 Xp2l $p•0l0 TXp•p•l :l .;Xp•l0 \pBl H1Xp•l0 X2)p•l 1Xp•l 0XpBl 0T`0vh T0v"&h0vl T0v"`|0vl T0v"```T0vh T0v"&hu``h 0 v&hT0"e 0-LpPl ;X7pB00l X7 H@ p2l (  @}T}T4 p•l ;Xp•;l X7`0hp•l t0Xp2l (7 @p•0 89l X8%z꠆(_ 0-?L@ 2PSh 0 %X%0h@0P R0 %$%  D_l___(` p-L M 0P`K`@![x2RS Dh2R+`2RX2R E RH2 Q 8$? p@ ?U  " $p ?U  "1R11R 1R11R R ?U "1R 7ʀ1R, t1R l1R8 ? U " H@1R 41R,?U  " 1R ?U  "U? b R ʼ0R 0R2 ?U  "& R 0uڀ0RtV`U`WPUPx```WQWRde`ebeFv`UaP (aQ@a\aVXxa-2π< PP2 << 5 p-LMbO\̆'^,0/4<2N>"Tz/^0 " 2^̌ U 22%%p -锢L`BP027P 7V,0q00 2`Vu -H4HdL M@ 0P0$0E@0@0C\P 0  "!0 00 3C&  0 "!0#0 RU h3 0000\0!C \! 0  "!0 00 3C&  0 "!0"0 R$0p02ppp p@ 000$@0@0C\ 0  "!40 00 2C&  0 "!0!0 Rl$ R 1 0+10 (p,p0 R00 27 0cS4;Ӵ4Q 0 S00000A I0C 0 iP  01$R Z 010w00 0 $,0S 404, P 0/- pb净 -'匧LM 0`00  = LpR  p–l ;Xk$kp–l 7X@\p– l0@TTP@p– l0X@TPZ7Pk 6 Rd p–l/ 0Th6pB<  T6lX<6 RE p–l (6Xp2l $4@ @@Hp–p–@$H9l X4 p–9l0 X5 R p–l :X'pB,0l8 \p–<5 lX 5 R p– l5X2Sp–p– : .;llX4 R p2l $p–00l@0 Tp–l :XO00"pR00l ,4Xp–l @0XpBl *;Xp–l 3XpBl 3Xp–3l X7S\p–l 3XpB 0lXp–l ;Xep–l :X\Y p– 3lX4B@04$+$00C\ 0  "!0 00 2C&  0 "!0l"0 R\24op–l $2X[p–l- @0TpBl1 X'pB,0l<$ \p–l1 X@p–H$Hl9p–l X1Xw< Ad00C\ 0  "!0 00 0C&  0 "!0 0 Rojp–l ;X-tRdpRd'<0h~vRdRd0 00`a -L = !R / 00C S DDDD? C   -P =L p•R`l1 pXp2l (p•@l T1Xp2 l,H$H 0 0 0  0P0<܎̎Ԏ܎#00p•l $ 060060 R %0?  R-00p•l $$0'0 4W r000,  0b -l3LM `3@H`LP0 P 3pC'0 0C\ 0  "!0 00 2C&  0 "!0"0 Rd2Tw|2T[*t2TH l2T p88Bp˜l @2Xp2l $4) = S =@S 48C8p22  pB l9 Xp˜l 1X2 pB9l0@ 404 0S %4Pp4@ 0 R p0T 0T0. @RL0SL0T} = R / 0 pr!.tRdpRdRdRd02i 1i i i 5i i 6i( -d0`0d0Lp–l0 pXp2l (@PH$Hd XbC0SLbdb -LM`pR(0S G (0S7$2S,pW`Z8K`pT(0S G (0S$4SpW`Z iKR04$0(GR02$0(G p-0LML`4pPl ;XpBl :Xp•l :XpBl 9XIp•l :XpBl .;X2;p•l x0XpBl ;Xp•:l X7S4-[4=4ph -L9LH$M 0@000`*@00C )L\8 <  0  "!0 00 8C&  0 "!0(0 R0@Kp 0p7PP d  NMǖ}>0 @00 p0 *,P ǖ} '7 4P fǖ=00p  0 Pǖ'7 P@tX J_ǖ00Pp  0 P@PTǖ~>0p 0 PJ^@ Pǖp00Pp  0 P@PTǖ~>00p  0 P\ L7`^O@ 004?S6    85%4005 ` R8 5500808  5 080%OT 8 00 Np–l5 Xp2l (p4K 0pW3[#202y0CP O%5% =`"4$d2h"80H2  0p4P"R "0"2PS ? ? (4 Rq %0lO0aV"RLTdTh\hdh# < = R! 788u#0907p–l ;XpBl <X!<W2 R %< ?  R-0<0 $ '0 #< 28 T0'0 0$0 Q 0- 0tp2  ` | 0# 08(2 c 0]`@ 0004@0@0C\ 0  "!0 00 1C&  0 "!0  Q( &!N1  =Pp–l 1Xp2l ('  8p–0@9l X|tRdpRdRd&Rd0b0@ @ *0,PG<,6 4P0@  0 PP~<,86 Pbp@< ? 0   0P11U)GR<R02p@ڴ NuFp]@<@  0 P@!2p0W2p PpPW*K{  02[ 8#(# ??Pp"tx2$7=  44@K0 } @J` Jd4d$@p4 X4X$0 2@`S0<@ 0S  (8L2 T  02[$0SL2_0L23@823<"@2#3 r 0("R) ! P!  P #,00&@#0802(@%> !0<0  =2[ [0  Ki[|@00CUSK@#[0pŸC b  0K6K0 M"[3[0u  0|3[[  B0X3K@QDRU $0< @$=0C!L=LPP <0$< <0)8<, 0@0 b@ 0<0< p 8<0,0<0< 8<, 0<0,0L0 4 pc, <ccd,dLdldd p-LM@_%f(2S @`_ mgp?, -LM48p 0X``FX64P@@8 0X480 X480 XV`48 0X4@80 X40 8( 0 48X`V48 0X|b -L M00 00 S40 `, 48 0X@pDY74@ PP8 0X480 X㷾480 X㮾W@|BT#4 ,0pDX74@PP8 0X480 X㐾480 XㇾW@4 P @480 Xv40 8(0 pD7048 0pDX`W@4 80X40040 Q40 \x -L M4,=@S\p, ,0}S4;ô4,`PV( <  0PU`V 0 S00 00C0W bK`p`4P<<(0S/0(  5    (0Q0,  000   (0Q<(0S,00,0 \0 0<( $0 (3@@4@ 0400$$@0@0C\p 0!!3 0#C6000 "!#0#0 RW 01l3 00\#00`0!C \! 0!!3 0#C6000 "!"0"0 R00$0 000001R0 0Bp2@ 000T"$@0@0C\ 0!!2 0"C6000 "!!0!0 Rd$ R 1 01+00 ,0(0i<0Y$0 P04tRdpRdbRdRd0bb p-LM4:`883 dP\408 ,@ PEu OU p 'd p-8LMʠȌ#84@`Ì8 0 \P\48 ,0 PEu !Up ph 'e -X2LM L2@4P@`0 p(P 2B'0 0C\ 0  "!0 00 1C&  0 "!0!0 R 鑳p1T9h1T#*`1T X1T $$A@ 404 0S `4P4@z0T 0Tt0. @RL0SLX0T/0tRdpRdRdRd02i 1i i i 5i i 6i( -LM`1 y!Dp0 @04 A TP @ OZ J<0S  AE@TP@Y) 000408 $<(0S,4,098D0 \t<@p (0S{?0   (0 0 {?(4<4D -LM<28H ,<”089H \.<28H ,<”080H \<28H ,<”080H \0h<28H ,<”080H \<28H ,<”080K 0-L<@8;H \<28H ,<”089H \<28H ,<”080H \<28H ,<”080H \P<28H ,<”080H \<28H ,<”080H \PUZ<28H ,<”080H \~<28H ,<”080H \n<”8H 0\0 -L@`pPW5H x <28,<”080H \L<28H ,<”080H \<<28H ,<”080H \PE+uTRPEu5 V5H 2 <28,<”080H \<28H ,<”080H \<28H ,<”080H \PEu<28H ,<”080<28H ,<”080 p-LM<P08<` \@2<28H ,P@Tpp -PL@p<•8;H \<28H ,<•089H \<28H ,<•080H \<28H ,<•080H \w `I<28H ,<•080H \b<28H ,0 8#hU<28H ,<•080H \E@R` -LM\p @P`K*K%> \ 0  lY2[2[#$0$@ 0T? -LMQ<<@88H H "::\<28H ,<”088H \<28H ,<”088H \ -LM<@89H \<28H ,<”8H ,<”088H \<28H ,<”088H \<28H , 0-L<8PH :\@@TZ0 p- B0LMB`Ppz@ -1qL ` 0@ P0@    PI9yP000@B@>00C\ 0  "!0 00 0C& x 0 "!0T 0 RZS@>@TZtRdpRdRdRd0 -\1LMTq 0 `P@ 00`X f b ^ Z V R@00C^  00#!t000 \0C& T  00#!04 0 RtRdpRdRdRd0 -LM%@0LQ`SPP0T0 QppW0 2 R T U U  U Q!1 Q QQ Q' ,pK~60*@KS)PK 0S [<–8 00 \<280 ,<–870 \U(08@HP𴠠<28 ,0 P e긠꼠ĠȠ̠9<–;288 \@㐰<28 ,P@TQe -L M0KP@ %`6 T0BS00S0 SppW SK S# S.@K-`K庂K  0S <•8400 \<280 ,4 4 <•780 \VDPX`hp 4 <•84 0\ 040 0 0 5;<•0288 \@<28 ,P@Te 0-%> L0BS@~_R 0@00d2000S70d20 -LM@h2   ? %> R 0p 0  0 ^  -LM|\ ?xB#<0 c {`|,=5<兒,  @ +(x2Q ;444  <280 ,<–08@00 \4 j<280 ,<–0800 \ATP @  <50SI 1 11PT@40z? `1 {? ̖(0S10̖(0S <–08 \?040+0 0(0 0 +<(E 1 114<4<280 ,<–0800 \<280 ,<–08@0s@',A -LM<`81 \ R  P 0@pU@P<–8 0\0L  RR@ 0CS R R R R %^ R 0BS R 00h J  -pLMW`P) <280 ,;0SW FW{ %> RT T3 <280 ,<•08<0 \%>$+Q X<280 ,<•:800 \<28 ,<•08< \<280 ,<•08<0 \%>T*Q<28 ,<•08<W <280 ,<•0870 \<280 ,<•070 8\9  <280 ,<•0850 \<280 ,<•070 8\$9 R %n0 S <280 ,<•0870 \<280 ,<•0850 \<280 ,<•0480 \0 SS1<28h ,<•080h \<28p ,<• 888p \T1 <28p ,<•<8?0p \<28h ,<•080h \<28p ,<•080p \T(S v<28p ,<•<8=0<28` ,<•080` \<28` ,<•080` \<28` ,<•08"0` \<28 ,<•08; \<%.0 SSV<28x ,<•0830x \<280 ,<•0a780 %n\0S% S <280 ,<•0870 \<28p ,<• 888p \0 SSTP<280 ,<•0580 \0<28x ,<•08<280 ,<•0850 \<280 ,<•070 8\3 Rc %N0 S4 <280 ,<•0870 \<280 ,<•0850 \<280 ,<•0480 \0 SSFTL<28` ,<•080` \<28` ,<•08"0` \<28 ,<•08; \%.0 SSV<28x ,<•0830x \<280 ,<•0a780 %N\0S% S <280 ,<•0870 \<28p ,<• 888p \0 SSfb<280 ,<•0580 \0<28x ,<•08<280 ,<•:800 \@<2( 8,   (00R0S@⻩TT o RQ Nf p-LM<2P8 ,<•080 \@ 㕩<28 , @T%>0 C SRK SSH SF T@ {<•88 0\0p  0 P̖,)< P@ )xS-PO̖00@p  0 PP@?Uڬ̖3=00p 0 PGNP @̖p00@p 0 PP@Uڬ̖3= 00p 0 PP@pzF`,\34 0 4L3L#0H3 D#T00 4`0 T0^1%.0 SS 3 #,23~O0"42"2 0P%.0 SS–\h29h2"0S00h2;h2p 0 –\I %> R# %> R4 %N0 S 0CS O!0D<28 ,<–080 \<–8x 1\ <–18x \ 0 R !040/", A`b|<V<Vl4;4 P  %.0 0CSW1 R1N   d0 0d0h00h0 h00h0< h `x0!ↁh `0|T( R ̔(0S! $PP̔(0S,?#< B0,`c 0 0 0(004 $0  (̔m0S 40 R,0 0 0 0(fQ{s -`2`r  L h2@ 4~oc  u <28` ,0 P0Sa 0SV 1 RO  R ,0 000S 00 R<h2  1 R- 1|A00C\ 0  "!D0 00 01C& ( 0 "!0!0 Rm麟00Ba _ 0  ? l0  70 <28( ,8SP<S>,0  0 tRdpRdR RdRd0gfff 0-%^0LS@j SSB l29 Sl2"<280 ,<”0860 \%.0 SS 0<280 ,<”08:0 \<280 ,<”0890 \<280 ,<”l"080<280 ,<”08:0 \P<”8( ,0 PXUU 0f -LM<28P( ,<20S 4p4<28( ,20S<•88 0\<28( ,1`0SW pU <•8( 0\@=8    Q-X@VX0T,0S L(<S <280 ,@ 0x00$@0@0C\ 0  "!0 00 1C&  0 "!0 0 R%$ R 1 0+10 ,p(p %NR00R  R<•<• 0 688\04` SS~" R R00R@@T  <28 ,<•08 \h2`(0 S04040404040404043040404040404044040404040404040404040404040404D-<28 ,<•089 \h2 l2 Ss<280 ,<•0860 \<280 ,<•0840 \<280 ,<•080 8%N\ 0B RS%> R <280 ,<•0890 \<280 ,<•080 \7P ̕(0S<•,,08 \, R ,0  000SR p-LM@`~_%> R 000,  p 0S00 p -2LM 2@p`4P0 >PH2pDB'0 0C\ 0  "! 0 00 1C&  0 "!0!0 R駙1TU1T?*1T, 1T p``A$ = S =@S @0 8C8p`2l2 $`2  `2 @ V404 0S  Z4Pp4@p tX0T P0T~/0ptRdpRdRdRd02i 1i i i 5i 6i( 0-d0@0Pd0L4' 0S00h&Lb -LM@4D`<280 , 40 20" @ 40W1I H  !1"2!1"2 0L" R03S SV㜂唂% { %  0T2ST12KVP?   ,0 S , S @0P 0@ @@@@@@0 @@9@S@@ @ LD,  ,0 @$@@0W 0W000W0 0Q0 0 000000 P/ ]t@yt xt zt {t ktjt@\tltmt -L M#l00Q(@0 P4, $0S S 0, R@pp  Rp  Rp   p0p00 pSp 0S $0R 0 0R0 p0 H`|2|"|0P0C@|0p00, T0 0, T0 B40, T,0 T0,000 T0 0SH $0KS,0Ӂ0 T0004 0) 00$0(  0 9S0 &6R h0(!"P C0 ,000 T00, T 00, T$0KS!0ӡ0, T,0 , 00,000 TB hP/ -h2LDM\2l , TPL2 `0A04p删0p  |0S<ڗ00A`00C\ 0  "!0 00 1C&  0 "!0!0 RT1 ,0S d,:ȍ000  T0 0 >HQ0Q (p 0p00 0 lK H  @TP0  @TTH00  000  T0Hp0HHb pRdtRdRdRd0h 0-0L 000p0P@  0p000C& R 00#!t000 `0C& X 0 "!04 0 R08tRdpRdRdRd0 -!L M0000x0ppt`p0t000C& R@P 00#!000 0C&  0 "!0l 0 R\\V @@W 0<`@5tRdpRdRdRd0(%g -PLM@E 0RA 2P 8p `堠 V VJ +<W0  p0 (BP00C\ 0  "!0 00 1C&  0 "!0!0 Ro錌0 0L \P00C\ 0  "!(0 00 1C&  0 "!0 0 R$ V*АЀP0 x p0 0RTp0x 00 h P`" V:d0a]:0400 TpRdtRdRdRd0 P/  -LM`84@P㈀ $8 ,   $pR <<30 l P 0S #0 0C\ 0  "!0 00 2C&  0 "!"0"0 R $ 0@~0Uh:x t0 0Rt0x Y  $pP $0PS %P+0  , 0  , p0 0p0| R,0H⸾, h0x!2 $t fh08(0S100B;0P` *0-@@0*0+) ?<0 90- 020  F< 0h ?A3cj  0 (<0 <80  0 B?(8Mb 4k -LMP`p /P@ )0"S S 00)0q l1 ,  (p=P0S $(P -LM0Pp $hP`> $020 lAT0 L0 T0 !4 0j0 <0@T0 0s  '0s @DTT -0S 0S2Sia i +0S 01 00 (00 $ $000H ! { 0 v i ib ii-00CS񟗻꼫 p-LM0@SP`0 00CS'|0Hh$P p P P P \P"Pup -LMPp@`l0 T0S/ 0T*0 T+0S0 !  8p "p T,0 T 0T 0 -@LP`pl!0 T @0 T0  -LMp@P`00CS%Ȯ,HHX9 -0  d 0p 0S  Wpl! 0 $p p00 p -@L0P; S`p> $0S; 0Sd|00  ( p :hX ;w 0p0 (0$ 0 p 00 Sp -LM0@` P,0 t$ d 00(0 $CW> $ $p8@g(0S.0) <ŸR0 S@ * @T J000 R:0@0 d 08(0S0  0 B?(0  0 B?($p $0<<0 T $0 l1 3  $p $W 0 0TꂠZ 0sp p 0T $  $pJ p-LM@`P0SꈴhԴ pp  o 00   [ -0LSp! 0 T@ .l`@P0S PUN000 0p 30S S  -P@ P`L -$0\0'0 A,  X$!p 0 \0 \ 0 T XC00 T00,0R/ 0,  X0aqJ -`L0p 0@P(0l \ 00\ 0p P$ 0T -`L0p 0@P(0l \ 00\0 T 0Jp P  0T 0T -LM0pP/p@*  `$T)? T $0 P)00S 0  T 0i? 0@S)00S 0p P 0 T 00 0  0 p-LM0@P` 0T 0T 0T\ 0S    php -4!4qLM0`0004@P0S8 S 3 PUNZ@PPU @Z@00C\ 0  "!0 00 l0C& d 0 "!0@ 0 Risx`tRdpRdRdRd0 -Lp\P` 0S 00 $0 $@A@0  T0 T0@S  0S  00 S0S  0p  m 0p P0 \ 0p  $ @P 0p P0 \ 0p $0 `" @ z p-LM`@P $  0T0 \ 0 $#P_ȿPP(P000 0sp p 0  T 0_pP p M 00l!!  0F 0   p-LM0@P`,\ 0 p"p 0 T $ $ 0  -LM`@pP 0P0 k\ 0p _ $ PR XڈQ00RP6RQ.0l!P 0S%00  0P  i !  0i 0p i}P 0 \ 0P 0 T @- l1 d0 Q@   \000 S@505 3:S0 0 p-LM@`P0 T 0phG -L@P`0 p  05p \ 0 i0s h^ p-LM@P`0  0\ 0php p-LM0@`P 0T  0  d 0P 0T 0p@-@l0<000@0@-@l,00P00P0@ p-LM0lAP0 S 000<0`0 T0 Tp p-LM0PlA`! R 0t000S*Q0 2 0 <00 T0 Tp p-LM0P`@ 0T $0 0}Nx@T $p -LM`VPp@2 V *0 T9 -0  d0000@0 T1V *0 T+0 T,00 -0LMP@`e $8S $ $0 00G@@p 0   0T 0T0 T0吀00  0T 0T0 T 0 0 i: T p-LM<@PT` h)0X0   8(0S     0 (8 $  8(0S|  $(0Sa)00S@dddd$0 (0, 000֌ph0,00S4 I00 奎<000  0 B?(8xdk -LM<@T 劎0  0  hk -LM P0 ` 0@ v-0Ss 0S̡(@00C\ 0  "!0 00 1C& x 0 "!H1T  Qos0p4@0 T00P00C\P 0  "!0 00 0C&  0 "!0 0 R 2 00 0 0 @TMs;pRdtRdRdRd0 -`L@ Pp$0@000 T p- LM 0@S00P`p AB1!10d@2@d`0@$T @a2a3c13D@ /&b00(phk|Pʚ;Ck`P p-L$M8 (0K$`KP0  0.*` ,@Td .< 8  (  4@ T$ p.pkl -`LT $0 0T Tp @P &0P Up T $0 0T T $0xR'x3S %,l -,LM, P`)p] 0Tu0] Tu] $@@GuHpW$Z] 0Tu -LM P@0] ` pTyu] 0TquP P] 0Teu0] T]u0X`Z] 0TiPu0 < 0   Q0--0L@P  Q 00x8S0@o | 0-x8PS@L 1DDH(Kピ0ʰPP, p-L Mh@V PK 0בP ,0"  000(^ `08 00pp80 -L MH`Tr; @ 000X 080$00 @0@0C\ 0  "!0 00 1C&  0 "!P1\  QYq0pK 0gP? 000@0,0 0P00(@T 0XZp0 0C\ 0  "!t0 00 `0C& X 0 "!04 0 R~ q|pRdtRdRdRd0 - @Lp0` 0P0j 80Xp0p0C& R 00#!p000 \0C& T 0 "!00 0 RhptRdpRdRdRd0 -LM4 < @@ S!78 ,4p  B8 6P, 0 90>0P`*@D S : R#: ,Jc0 3@`p`B0 Xp0C$ 0P8 ,04 0 P@ 0P0PP`  0 0B@$B -L MX`Ur; @ 000X 08040 0 @0@0C\ 0  "!0 00 1C&  0 "!P1\  Qp0@K 0 P?q 0000 ,0#  0P0(0(?^ Xڨ00C\ 0  "!t0 00 `0C& X 0 "!04 0 R~ o|pRdtRdRdRd0 - @Lp0` 0P0H 8 0Xp0p0C& R 00#!p000 \0C& T 0 "!00 0 RhotRdpRdRdRd0 -L Mp yd— hl2  d2h ,) B9 @P0  _TU  X0\20\2 0PPU$0Z0PPU&0Z> 0'(0 0PP@ p2 x,{[03[P @ 090QP @ 090GP@ 0P90=0E?0P! |0U90|"#P0>U 0 P2x"PUd—hl2  d2h , `G d—hl2  d2h ,d—hl2@  dR@h0 \Pdd—hl2  d2h P,cUldBhl2  d—h0 \d<dBPhl2 P d— 0h\d)d—hl2 P d2h4 ,dB ɠhl2 P,  d—h 0\,!, P qd—hl2  d2h ,P UL@ @P1|P>U d—hl2  p2dB ,0 0h \d—hl2  dB$0h \d—hl2  dB$0h( \dRhl2  d—h 3\dBhl2  d—3h1 \dBhl2  d2h ,d—`hl2 o `dB`0h \d—hl2  d2h4 ,, dR00"N>C 0C@0l, A, Ȃhl2 A$ @ d—h04 \,0dR!h2hl2  d—A0h@ \dBhl2  d2hH ,d—`hl2  dBh:H \dRhl2  d—P 8h\dBhl2  d—h0H \Pݏd— hl2  d2hH ,P UP 0@T 004 PHLHa0 D80>H !loYPUJA|VPU@DZ@!l\lpl\ ll@%I$| , 0 ꥍ -LMHTe | H0S8T|  |@8.HS H0 0-LMdR@ hl2  d”h 0\0 -4LM P P `i P(C0 0C\ 0  "!0 00 3C&  0 "!0h#0 RollLd‘ 0P0 0hl2 P d2 h,L(pR dBhl2 P d–p0h \2 00C 0d–Lxhl2P d2h ,PT"d‘0p00hl2 p p2dB t–,0 0h \d–hl2 p dB$0h \d–hl2 p $dB0h( \P8SBL(Rp/ dBPhl2 P d–@p0 h\ㆎdBhl2 Pp d–0 h\2r 0L0C0P)d–hl2p d2h ,pd–hl2 p P(dB800h \tRdpRdRdRd0=P 40 R(0 R0 R|b`= -PLMP x"RpW 0``00VdB hl2  d•a0h \3` T2X"0 T2X"XOI3@T2V0CT2dB hl2  d•h 0\303 $$Nhl| 3t1@`3\ dB hl2  d•h 0\`T80T8/P`T(0T8d hl2  d2 h,x"`ad hl2   d2h ,`Q x"pLl m0mDm 0- LMQP dB@hl2 d•h @0\0#dB@ # hl2  d•h p- @LM`0P00$)`0`0C& R 00#!p000 \0C& T 0 "!00 0 RpphMjtRdpRdRdRd0 -QpL@P`,8S  0 R`(8S 0$ $Rp0S`@` TP$p@p`m -L MT20T25 00%0(8,H,,0 (00C\ 0  "!p0 00 \5C& T 0 "!$%0,%0 R?`T $PpU 0SSW`,P 4P$U  R00R\ Y T20CT23 `4 @0 p0b@0 L @0 倠0 `#> 00ZF 3Z5 0L0#3@ 000#@0@0C\ 0  "!x0 00 d3C& \ 0 "!,38  Q Ri0Sp R000R!B6S0 !0^p@P⃠"Q 00c0 C20000#:2U0(2@ 00 "0嘂2@0@0C\ 0!!  0!C6000 "!1  Q h$0S`I 04 0dB hl2  d˜0h \Z0 00 0@ 000I @0@0C\ 0!!  0 C6000 "!L0X  Q h@$0S hpRdtRdRdRd0 -LM`@(0 S4p8PP 0$01l00<@ ,0 00 00C 00$@202LP0080004 -LMhdBP l2`   d2hP ,V5 <0 @ȕ10C S1 !@s T 0 0 m馁Tpd• hl2  d2 h,?> 0D <@0 Tp -LM`0Vp0Pᛊ0 QdBhl2 d2 h,3 `VZ00hYO0S | -LMd@ hl2  d2 h,3 h. -L$M`%% 0 0 < p D8PP, @ P@ $4D@08 8 2 00 $0880, T4  ,K4 <0 ,0P @, 4040<0<@  D240<0,  0 0 4 0 22$p<!,\10LP0,0,0, ,0 ,0,Q,0$p000808dBhl2 dš0h \0S ,1 R) A00C\ 0  "!0 00 0C&  0 "!0 0 RfP@5| t0 l0 ,!  ,(0pRdtRd=RdRd0d Mb0 0  Q-L 0S S 0SQ 0 0 夻m-0#1?$ˀR 4   R 0 0 0 !1?0P 0SP-(0,#1?&̀R, 600, R000000 !1?0P (0S,P0@-@D 0 hPR 0@W0x p0t0@w| 0- @LP0 00AP0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h ftRdpRdRdRd0 -L M0"`@0TP, 20@  ,0R Ppl Y4 BP0 _ 80 0$,S03( 00 0*  Y < !<00  υP3A!P000P0P0C\ 0  "!0 00 l1C& d 0 "!0@!0 Re00S  vW 000o* 0@ 00P000, 0r00  o P 80(S"ˠ ʠw0SX0 SP000 |  pRdtRdRdRd0     -0@L P0p0`40oχP0P0C& R 00#!|000 h0C& ` 0 "!0< 0 R4hVdtRdpRdRdRd0 -LMp`04 4,  R80 TRU3 Rڹ̃3@ 0P00#@0@0C\ 0  "!x0 00 d3C& \ 0 "!,#04#0 R, 090 I2@ 0 00z"@0@0C\ 0  "!0 00 2C&  0 "!P"0X"0 RQ02 000, L0$ pR/ , 090}!0 0C\ 0  "!0 00 1C&  0 "!h1t  Qo2d0 #>WPS  @ $0S U0, 0ddr@ P0P00`}P0P0C\ 0  "!x0 00 d0C& \ 0 "!08 0 R c|@bmpRdtRdRdRd0 p-QLM@`PpT 00 @DRT0  0 @DRTʃ0p -LM@}P 0h -L00 S?0\< C00By 0( <25(  4p0< ^000P @<0 8@0*Q< `0!< 0PR < 0A,(0"A 0 P4p <0 @ 000` 0@00( 40 , 84 09000C\ 0  "!0 00 t0C& l 0 "!0H 0 Ro]0 $o|pRdtRdRdRd0n0 0P | -LM園P 0 @ 0SS* hB00C\ 0  "!40 00 2C&  0 "!0!0 Ro\004p090L`40S_ 00C\l 0  "!\0 00 H1C& @ 0 "!0!0 R67@ 000 v0( 90 @0@0C\ 0  "!0 00 x0C& p 0 "!0L 0 RoX\W\ `40S pRdtRdRdRd0,n p-LM 0@<0`0@`P 0004tP0P0C& R 00#!t000 `0C& X 0 "!04 0 Rp \pRdtRdRdRd0 0-0L@P80h5 -`V`V` pP0UL`p` #k@d 00S APP U ɲhk| jbjbTn\n -LM@Փ0 00\ h  0- 8x 8#T0%PLT0AT 0S 0Z 8R(0 4 jbjb - 8h LM8#0!P @0 A0T S  0S  jbjb -L M @ 6@Hm0 -L M@ 0@8m0 -LMD0`#((0"t1'ATw T0StȀ0 S0S0S Smwm^0S 0 0mdjbr @edAr k~gd0 -LM@Pe   `<(00`0p4S80,0d080 4`00 (0,40X0>40 <8dppᵚ 88#0 p |nnWEV0 0-@0P @L SP 0000P0V -LM0s@S* 00 0000 -LMⴁq`PU @!0@׊P^PU $00<0$0@T0 P8:00/ P@0T,1pP, a00/TU# 9T0pD UA DA Da0DSR `TWpD@T7pD0s" @00DR Sa0D_TS7ToPOPP tPTP P xPXPP@(0P鐅bbbrrs bs -LM||`P0Ulp@0T UPe R PUP0U00 G P   0-@PLP 9 0S& cP  P h 00C0\@P & 0SU00hc0 qPPDs Ps 0-L1L0@S8!0CQG!0D]S' T T T T 00h 00000P@k00 0 0 0hm p@x0 0 S 0CRL000 (00  x      0 0 0 lQ Z   -LMS@ \00S SL L0L L0P 0^0?l 0卣 0 ts|sssss p-LMP@PLU` ph38`00 ,$0'Pp`ss,s -L MP@0T(*$K(pK,`K!$0  $c , @Q h0( \$0T\ (0DS<ޢ0T:,0H֢]`\`sH ssHd -PL`m Hp>P@ 00CS 0} @TR@0Sq Sf SZ 0S 0S 00 q4 S 1!0S 2!8S  ^1Q- 2!8S( 1 RT T U h1Q 2\!8S UP!000@1@j,1@@DT$@DbTC \ 00CS0 00CS0ڸ0 RF)B00  0 00Sv h00S 0So P00S 0Sh Hpfꘆbbbbsbt  -LMp0@SSHP S 0S iX 0  rPxi T`0 Q00 28 6S Q 000ꘆbb 0S00lꘆbP0pQr  8 80, ,0 0ᐆbbbubbbbD0<08 pQ(0 0ᘆbbbubbb-L0H D0pQ, ,0 0䘆bbbubbbb 80cR   (0 0 0ᘆbbubbb p-LMHP@ ' D T h0\ `` T` T0V D0\ P00p P 0  0-@@L08PS0S00000  - 0L`x@\ lpPbXd0 4P 0S<00h p hVd 8 btt(q 0-\L@P 2S P(٠0P2 00 TP@`2S@PT P Wp @  -0L Mt`, p0 @–R\ ,0K@T00 ,0 S1051P5꤆b -PLPM`\p 0K@  0SV 000餆b -L1L`MD0 PP(0 `pl KpKt KpP 1l R*t0S@hK 0@@ (0S (噁l RW xK| K0P x| P@hK0@@ D HbH nttt 0-LM(P@ 0@?0餆b-00 C꤆b -L\ 騆b - 0L0S 騆b -L\   騆b -L\ꨆb -LM$@T騆b -L\ 騆b -0L0Sꨆb -L@PMK!P 0Q0S\H 0 <0 RX:PTIPGHD@A<<0 4;HdbttubPbtLuubbu p-LM`P pP@0T:tPt@0T*dP 0 @T:@p0P 0 @T:u L ]`\`b -LM@KP -LM KPK -0 SL 0  -L \   00 -L MdPhIKP \ PV@KFP TP,930uxv -T LM@HT 00  (0R   bv 0 0 P-PL` @T pP 0S @TP@ 0P0`0 000 $mK0S,v  8vn -p`L@PTp eP 0S0W: ` @Th& 00h n 0-LMl@0S`0hXPU P@P@D ,, @ PU0 Pvdvv -LM@7h 0-LMPKP@@-' h0 0-pPL0S`00S @.0 . 00 @T03000  0  -0LM@`TPp P 0.S 0U:R0>0>0Up1 @TW 0@  -LM0PhS` /S+ bS` `$pK 0S 8@x $ h_$ IPX @ @0f0P,`lSvtvububv 0-LMQ@<00CS t|0 uo0-0P0K0,0 coPT Q 0QP0 R000(P$0    - db-  -40LM @R  b` 00Cs0 -@L`0 SpP 00L S0 @0V0 0S0 S@P 0 a0CSa0RS-P@媛a@0a S_R@ zTh鞛vv -L4M0 sS, `@HKTI   a0@S0a SR0S 0S0S\ + a AL00lL0 V L0SZ00V00S 0S + a0BS aB0SA o1 @V@xq 0PS`LK0 PBTU@P !0001 ,0S ,}&pX T KT@ T0cP T K0T0 0X PQU0:S000 S 0a0CS0000S _0a0B`F~00C ZUSHbbbv v -p|`LP P @\t  0S $Ġ 1 0 @ bbxr` -LMPp0P` 0@S$ K P $ P0 $Ġ  <@0 A0h00bbxr` -h0L`PX 0S 0S 0S  0 1 bxr` -t0LlPd 0S 0S l 4080 00P  bxr` p-LM^P`@ P  0S 0S l 40!t0 0pPp,@0S \P00pbt bxr`H0HP< 0S0x0S0S b -0LPt  l 0S 0S l 40!D01$  (P  bxr` -$0L0Sb 0-HPL0@S P0 T 0 b 0-`0L @R LP0@0C000PS T0000b  -@0LM\0 @T b -MML1 Ḿ1, ^Pp P,0 S ,{BNK@D@D0d!ᖙFK0@P4  0 @tD L$ p4 Ht P@0OK dA09=P@ 4 @ SP@d lQP` @ TK@KOKNT NT D AP@L0 Le A0dP xt T |$ '=P4@`0 +RhbHb@bvw -LMO, ,0 !0!hꔗȗ -LMr@W41R2p U8`40< ?㳀Ϡ@4/00 000E  =PPp  0 S0 0x0@0p0{4ἃ \塘!xƃ U? ? ꐯLT"w -L2 S   -0L"R"0 02S p- @LM`0P001``0`0C& R 00#!p000 \0C& T 0 "!00 0 Rpph2AtRdpRdRdRd0 -).0@r0<”PPL"0`@T<2@X"$$0 0<”L"@0Tp#00<”@d"$@ 06 -7).P@0Y @E*T:@5& 0 DpRdtRd bRdRd0bbb0bb w@b - 8LM8A#4@ S @0 R0bܤb p-LM1s< s@0 p800 <000`00 P 00C\ 0  "!0 00 x0C& p 0 "!0L 0 RpG5,@,0b 0bpRdtRdRdRd0Hb @-0@0 00Q000 0 S0  0S00@00C\ 0  "!t0 00 `0C& X 0 "!04 0 R@4pRdtRdbRdRd0< 0 0P@-0@0 00Q000 0 S0  0S00@00C\ 0  "!t0 00 `0C& X 0 "!04 0 R@4pRdtRdHbRdRd0 - hh&$00R0LMSp0S 2@ 00P00P0 "@00C\ 0  "!`0 00 L2C& D 0 "!"0"0 Rr0SR&4SZ1  1@ 1 1 bB&! 02 S6ʬ1b1 R0PP00P\!@00C\ 0  "!(0 00 1C&  0 "!0  Q 3$D S:#8#H MPtBt2P0  9TP0P0C\ 0  "!$0 00 2C&  0 "!0!0 MP1 ?R#p!00A000 0C1\px1V k:l10SggLP Q1 00 0 R@09 000C\e000  P 00C\ 0  "!d0 00 P0C& H 0 "!0RR@R R pRdtRdRd0bRd0R 0bؤbR -|"LM 0,0  0S PRPrK@0 0<00*K(Ÿ0 RQ"%1C00#050%1@00C\ 0  "!0 00 1C&  0 "!1  QTKKKXE0[p[0 0[p 0 0[[P[ [p[0 `[0.@[P "`#p0@$[P[[` 净[删[剐[`'pU! , KKKKKpK@K@K K @`K| d  o`  Q xK$0 ,0S 8,k2HbpRdtRd0 048 (3 bpRdtRdbbRdRd08x 0-LM0@99 90:RP9 HP0SP U P09P[?09P 09<9 0@9@0909 09090909090@909 040 0$ 0 PR0a/Kc -0LMR`(0 P1 HP0SP U (PP5 ||=P @ pP  @yP   @q0 PR(Ka/0( G-M1vΌ \0000 0c?0cll0 Lb1a/"ba0l A ?#όO$/LNpBNa|P0PP 12c!b  <`C<2c2c!dV!B0 Ѝ*Q989QA0!0Q0CZ 0-LMP@0l0C0K00K00K0 0K0 0K 0K0K Kz0@-0 @  0@- 049 0@ 48<0 0@ 4 8<0 0 $*000 0-PL@] 0hXx -L M, 0@000 0 $0T` p,?*Z2V/00Ǵ`0㸑 P Sa\````(```````8```````````````t2P`V  T0p0@00T:$0 p`,, 0S000  $0,0  00a 0 P22P2pf`0pf `㜐 ὸP2 Ԃ2P0PXpx`bb -0L@dap SL@P$0  ("Q *0$00 0 e0b 000  ʸ 0W0 00000`PCpP p2P0`PXx`bb p-L M$0P" ` a d!0S$0  S! 0@0  $0dp$0 pX0@-0 @P $0(,# 0000CP 0$ 0x00 p-LM0@S`P0- P$ P00 |00 0 0000p|PóP P0 0 |00  |P⟳ O@- @ 0p`P$4@(8,0   B D8ꈃ`@bئb`hbxyyc -LtM☠K` p @pPPP@0w  Qk @0(0$ ,puPP;@80SX|0! 0QN0 Q4@0* 0TP U@KY 0 SZa⛰0Y IZa⑰ p H Q 0'P !0 0"PP L $^Z  K|` -L4M@`|0` D p@ 40 ,` 8` <` L` P` b P@ Ph5 WS0P  0PPP@D R 0"P@0, K"P,P HP ,0K+0 P@$00HP <P0S S 0PcX0PL0S L0 DD QPD @0P<\ 3D R 0 !V 9 701! 9Z/6Z`ï@LP P04 8 0U`00C\ 0  "!0 00 4C&  0 "!0$0 R㘭 0@$/,0p,  PP ,yU  R0   @0 S@0t`0@0 0t`93@0P00K xP00PH00d0 /0  0P 48p?` `! P2 BPP  -LDM4 00 080 8ȟ8@P 00H 4(P`00D L0 P0 00 \HdȟP00C\ 0  "!00 00 8C&  0 "!'00 R7'70c40S@3H 0#2 PL0 P P'P80BD'D70^ l0 4 Po ^PU \d*!lD2!X0  @00@04   00U \F*!l1!e@X0P @00@04 000  , 0 0 0>.0 N^@PT \*l,1 @e00  0000  GC?\*!l0!X0  @00@04 00",00S0c,00,i0CTDK! \33 5 Ƞ OP!>Km kK1.0Q@ pb 00Cpp!@Dq1T#[@T; 20CS0T233333ȑY: 01 bpnKoK  m?KPH\5 :0\*  b 0 0b$10#[1 @To0 0|X *ܡ  P PpH0!>0kK1 ̑  c. . j?K!#[ ̑ -Hbz -BML M 0`3S 0D4 , KD\|4(KD$4$  _P 1D RBB)p  0@kP@3 (K! !PP"0PS U3 410  3@ 4 @<P( Ph3(K R 0S2 B.K BBK0N\N  B 0C @P00T00ST2(K 0 2PU92 0C8$ @ < S)P6666,8H8CKL C>KL N0C@4O 1s<$84!1 8!Q<4%000 0a00b 1551%2PU1(K0S@10$1)k ,0 S , S  (P (@BK@+@Ϧ44@QD1D$(K 2 0" 1 008A 1s<$84 !1 8!Q<4%000 0a00b 155 1%) D$  @V \*B>K0C  0CvP@ B.K B B kP Hb! z|! z -LLM@Q@D1U d0 ` 8d0K00ipW D)A)lPp@ `K 2)/)0`0 0<X0 \ 0P0 T 0H0 L :D0 @ 080 04p < 00 0$p (p ,0 p0S -L MBpBP ,0 (` 0@P@"@2V*0S @T:@W (( 0 PP: 'p  0P@0 S 0R , ᡡP -L$M (14 @ @D Pp 0S 㝥 P 0 @S@R*0 S  R:R*0< S S4  Q Q 0S8 0 # S S 00000 0S S SQ 00 Q Q Q Q Q < 04S4 0!D0;H0  D  u0 0@ H0Q0 T0S08 ğ (10$(1 `000 R00 D`00C\ 0  "!T0 00 @4C& 8 0 "!0$0 R0 ?@ ' `8 {<0S 4?@ &< `m? &(10+`300 0P@0@4!(10(1 @$Ff(1! 0(1,H0 001D  H0 10 0C(10(1e 00(1 04fZ `M P ?'0S,ŸL2, ` 0 b02B&! 02 S7 1b1 R000q`00C\ 0  "!0 00 t1C& l 0 "!0H!0 Rn ?L 9'L0 001 `CnY1?L =&L.,K2 P@w(1, 0(100,0, $,0, (00(0,,00C,0,(0 ,I0zpRd`btRdRdRd0bbbb4z3 p-LM@P0c0? %Ad`A  0P?&`p p-LMPU`% *@0 PR@ U: @0\0 ?&00@pV -LM0PUp*` @0 0000 P00X0#02SP` -LM PR@0:#:S'0:#:S"j&jV HPp  @ Ȍ qΌP00` qP@0  -L$M`@. .\0  , @ BPp@ 0P 0  00Pp ,0R   . . p -LMP. .\ 0@ p`P ȌqΌ  p-1"LM1! @00> 0>0Q`P 1.*!a!00`G/ 0B!0b0!P PPP0Q*!a!00` 10G?  B0 P P0PplF -`5`L$MjLQcHHYl Vț[ <(Dچ;ş00S 0 0$ 0 P8 R08 `<0 < D0夔0S0 4 @`D 0 l$l4, `$010 T VpH )L@ %LP@. 0P24 $03 0O0`V000#3@p@A QY@Q0@00 K30K@cFFPPp00 0TP@`0*`2880`",3 >0,!C )P]< yb0S P0SB"P 000IfXJP0P0C\ 0  "!p0 00 \2C& T 0 "!00"0 R  RM Ÿ|0  P@<0S P0 !@{E0Sn:10S}Pa @09@00 PPX 00 8A@04q0@00  P 0 @00@0 0 Pn E@bbTXbbPbb$b(blb! @zgvb bcbbܦbKd\Id pRdtRdRdRd0HbDblPHzbTz, ! \zcbpzbbbb,zzzRzzRzzRzz-zHb, bZ 0000ZN<0 3P0 +P0 #P0 P0 P hF@;0PK0K=0PK! ,1@0@9<1@F  -@ LHM0, X 00 TK0P0 T ( P0 S$ \jZjD&({8{`{ -L-P$ _P p -L M, p0 , 0! P!4  Y !Z PP0 b Vg0EEW  c03PP B@Dx8 X0  R@0SB4  c03P- B@ Dr0 R U  1 2 1 1s 0U 0PZ P00P1 2104 S@ Tp@ T @02020Tp@T -L Mp 1Qぐ2 A' g0a cf`  Z f RH02 0"2 SA' S?', :0 00202a ,2,0@f00202c0 #00PfᲓ00202S,00000''' -LM@`p PK 0S Szpp1 Q300TX0Pv0(0 0 R 0S00PP 0 0Q 0V  000PW 00,00,0 0S00PP@  0^ R1s 1 11 ^ P[_)1 11ꨫb ܪbb8 0-LPWI@U(   @00@0 R @00@002L0020< 00 ,0 0b!  202 -Lp<WP< I R@00@0 R@00@00\2f<0 `P0 20BT0Ҥ 0 ' #3' B `@B !C ,0s @` V 0S 0S ` V 0,04 0 8 ` V@ R 0s  ` V@`cVڌ Vڦ?`cVV'  0 b -pL2`0C(2P@U R ,00,0 PU@Z000S0202SP P0PH b2 @ 0 b2B&! 02 Sʂ1b R00 000000 0XR@00C\ 0  "!$0 00 2C&  0 "!0!0 RU8PhWa1 @ 0 bx1B&! 02 S7ʂ1bP R80 800080 8Q@00C\ 0  "!0 00 0C&  0 "!0 0 R 80}qUoP''F'0;pRdbtRdbbRdRd0b -PLMP`= Q ,0 0SW ( M 00CS 0,00C,0,0 S( p,@0L!p9,0Sʸ0  0S 0S@ R000 ?" 00C0V@p0K$8K @㲂Kp@ 0 㴂K,0,0C,0H;p0K$8K@@㲂Kp@ 0 㴂K4|bܪb p-LM0@P3 R.`P(0K$``0KaK`P`01K!K 090 0 p 0 0pp`aK0 90 0-p p (("\ -L`Pp@Pm P- P  00S# 0s 0 P 00 0101 1s 0V`1 21   p1 1  0q p 10 1 1s 0 V 0`U P 1s 1 2 1 U )1 211 21  p-LMP@` T0 @ Tp -PL(p`@0T 0@T  0-@MLDPD 0<PVS, (@0P@MS0- <|bD||b -4 L014 s$ 08000+ 40$ 0S00 Q0 0 0S0040$ Q  p-LMP.P` 0@ 0\ | P 14` 01! 0 00 10Q p,0  @b(04 1S01 Q0 0 0S00 p-LM,P"@000R R 0Spd,Kf 1:0$2K1,` 2K$P  P000(0!0 (0p0 0 -LM Kp$ K`uPU0  0 00 0S@P@ 0$@$  ,0S,P` (00(0 ,00C,0 (0,0.9갫b+ -L$M`8 P 0S ,00,0P^P$< B @ P !!@4 `PP?4p P" @0 :0GPUp  0<S< ' 90 P  0 0 B 0 4@ W 0l !S <Q8 P 0 4K 408P0,0( 0C,0,80@K PP@ -LM0pS, @`PsJ $5Z 0S!4P 8 !4!0QU 8C(0Q PU 0  U 0,0 0 0$0d$p00008  P (00(0 Hp00C\ 0  "!0 00 4C&  0 "!0#0 R| 3 (00#00c00(  ( 00C\ 0  "!<0 00 (3C&  0 "!0"0 RD 5 (02 B"`0000( 0S ( . R`00C\ 0  "!X0 00 D2C& < 0 "!0"0 RX  ,' W RPP( X`48 ,0( 0C,00,0 0  00P,    ,7 0,0 J 80  0V1RU 9P ,0 0 ,0 ,0R*00QU 0V PU!0S + pRdtRdRdRd0|b -LtMQ  $`儠 S ,8P,/A#bl p p@K\0 0  & U:P p 7R'002c2c30 xK` t0p'x0P p  =9@ =C 0p d7d@0 0P0p0P\ R#00 0 '00F04 @00C\ 0  "!0 00 6C&  0 "!|6  QN RBp0Sl0S x@Kxp0\1 pKK| 0cPl=9 A = | |0 5Rڴ%002c2c30  Q0 j0 !! U l t0Sr00  #P C ` 0Z\0  h0K0`0K0 @hK R 0 0 00  0T ( 9  ( 00C0Z` R\0\0 00` \0 X$P00C\ 0  "!40 00 4C&  0 "!3  Q 1 0p01  (0t0(0  B d#P00C\ 0 !  0$#C60030  "!2  QT80 2 00P00JPyt|"P00C\@ 0 !  04"C600$20  "!1  Q" o10 0 P00P  p; <[Y 0 (0 0(0 00C000 0 @80 PU(00(0  B  P00C\ 0 !  0 C60000  "!t0  QZ} ~   p l (MbQ ?BpRdtRdL|RdRd0 -0P`L$@Ap 0 Sp) @`00C& R 00#!000 t0C& l 0 "!0H 0 Rm000tRdpRdRdRd0 p-LMP$`pt08O*0 H0p -LM,, X$p0 1@`T 0WP`/ U@,X4Q q 8 1@`T 0WP` U@40X:lP,0$80HOP4,00,08  4 OP갫b|b -LM0@  t h l E40 0-@LTP 80 P (00(0 @T0 p-LM@`TP 80 K@Tp 0  -8 L0pS`( ,0Q@LT , P!0,`ࡉ0P ,@0P00Q000p(04\ 08 #4# 0Q40 @&48 0-80P@Q04#4#00 8 0!0LS0  Q0 0 0S00(080 R40h.O40,  , 4L|b -1L0 P 0 0  0p(0`0(0 @  00C& R 00#!x000 d0C& \ 0 "!08 0 Rh,tRdpRdRdRd0@-0@0P  pQ 0 0 00 `(00(0  B P00C& R  0 0#!p000 \0C& T 0 "!00 0 R@tRdpRdRdRd0P(0 0 (0!P -L$M`"0$0( PGP@8pW@ W @4LdNc0  0P@T0@0!0@;00 0~P@1 I 0  0OP@ 0  @p ,KIP@., 0@0b 0(1 Y#q0S  p( 0TYT$1 !S@#@3R 1$ R: 0S* @T  0 4`MP418 (1TP#2@0T00S Dbx! d! -LM,06_L ,0D @0H" ? p1 1 A A A 匑 C 0l1 h! n?K Po`1 \! >K/K KT1 l <` dA 0@ 8@ XA H@ PPp4/uH0P @` D P P R   R?0@SD儎> P 0 bl>B&! 02 SH1b1 R0D00D  nP00C\ 0  "!0 00 =C&  0 "!0-0 RH00H0 D2`Vp H0#K`PPd7 42 Pp?K` 0"R 4"P42p@ ?WpWKH00\F < @ 0 b0#60`  \0>0#60P . "& X00T  Pp\42OK2cX2 T2( 2 KX"P2<$PL  *PF & *|1S0# 42 \42 0> Pp p@00@0, p0)0,   R ,07,02 ,0<,00  0  ,0Y 'P's$KL"p 0 y  <`,0S KP2<`X"H2 K( <;P&,0 ?l 0S H R <`S <`@0S,06,0`K <`  l? m,06,0騅%@(00030 00000 0  0\@U@00C\ 0  "! 0 00 4C&  0 "!0$0 R` I^ PL ,0@7<,0L;2` 0" 2 0 " 082 0S/KK 82 3_VPpH:9D KPpD 0@ Pp#H@"D00D082帀8"82@"82$ 8(00(08",00C,08(0,`VŻ/<M 8X@#8.0\F ̂2 @ 0 b2B&! 02 Sʐ1b1 R00000  \R@00C\ 0  "!(0 00 2C&  0 "!0!0 R]8PUF 1 @ 0 b1B&! 02 SCh1b1 R0PP8P008  4Q@00C\ 0  "!0 00 0C&  0 "!0 0 R IL"p 0d'P8] 2 W u< 8F b! a`pRdbtRdbbRdRd0b+ >3 0R 0R0R,07  0H,0).00C w ? M -LMp$K4 ,@P  `@ PT4(  01 B10R,0 P@( ,K Q'00K@8,fP4( 0,0 B0RP,0 ( 4K  P@"`V@J,K Q'00K@,AP0 ,0`V0P,0 Z  @P  -LM40pGH,0z,BT6A$ ONb\bDb@b| 0-\P@LTC08 S8008< @RdRd0dSpSc| -LM@ P  P80Q 40S $1 R Q\b 0-0-LM@0lKP -@ @P@ 0 0,ό,LU00b P0-L@4P'P04 DL@b| -p0p`PVL  sP@  ~$ p0P`@@%Jpb , | 0-XX0@ TL  P0 RP 2@T0 , pb -LM$P`p@}0 00 00 00 p`pp 0- L  0000 1SP0PSP& @0 0C\ 0  "!t0 00 `0C& X 0 "!04 0 R0pRdtRdRdRd0 -L M `@P <<.00 000 0 04 0700700- R  P0ES$`|0 0S  0  0T]0`} 00 * \Hm 0 0CQ 00#!000 0NÃ0G@ă. B&, "00 0, ŸL PPG "0 0cC61 Tp,@ @ 0 d R0 d 0S P00B00C\ 0  "!0 00 1C&  0 "!0!0 R9* L1\A00C\ 0  "!(0 00 1C&  0 "!0 0 R  E@PppZ P P ppT P p pP P  P P p pH PppDPPpp>Ppp:~tRdbpRd, cbbRdRd0 -P1Pq L1 bB&!<1`LP 01Aa  S 00S0PP@00`0P0C\ 0  "!0 00 0C&  0 "!0h 0 Rh H0&  @`0bpRdbtRdbRdRd0, 40S(0 !/B! R, R, , \` p-LM`xPL 0K !`6 KH0@@<0 @00@ 0pV , `, b|bb -L0à PP PP @P@ P P   P   P  P P   P  PPP 0-0L@0000P 10 @b 0-0@ SL@P0000 0S @b 0 0 c-  1 00*00 -RLM@ R`$p0 P0000< PL00 0S` pC8@7! -L$M00 X5P00Qp6 Q< , 4 00 D%`0  00 4@005000$@00000004`00C\ 0  "!0 00 t4C& l 0 "!<$0D$0 R0Dp40,p0 80 S 08 a R 0007 0D @0 @000$;T0 < 0H00<0S0 D HR00 P4 004;00L /,0#p0  00  4@0"@00  000002p00C\ 0  "!|0 00 h2C& ` 0 "!02<  Qu H e00C00   4 R 4 <0 C 0l   40 l \S 0Sn 800S80 WPH!0@ < 01Q 007000400+ !@00C\ 0  "!0 00 0C&  0 "!0  Q400500',0/d, P@bpRdtRddRdRd0l -LM!:t@yu 00b!Ce -LM\0@ShA;b<0S8<0 p-L M`a\?XAP# PPD1)@J@0?# @ 1)@?@ ?# @0)@4`@@ 0R @`8 0H `8 0P `8 0 `8 00 `8p l0`P{8p Xb\bTbPbbbbb- 8b@bL,bT`b\bhb -p1L h1 !@PT 0SK @T0a010p  0 S @004 p00C\ 0  "!0 00 0C&  0 "!0 0 R t0S00@@P )@TbbpRdtRdbRdRd0 -LM@ 00S 0@p,00P 4 RHP@b<0 40 P 40 S8PTbPb<0 40 P 0 SPbb -LPp@P`$ $1P   $@ RD0D0D0 $0S $a0S@0 @0D00PD0^4P P 8T` $1 000p00! R00!`00a 0 10P8 0  ($1@ ;x,00,0 @`bbbb -LM@ @RD0D0D0 $0S 0$1 -LM 0@ `R x0S0x0 R000 00CS0 hm9 k9b`b -H0P$LQ@p ` 0S T@T $Q 0S L@T100CSW00000CS0 R00000CS0 -LM@T  10S @@T@R    @@T -LM1`NP,@Kp0 @9,4 0> 0, h @ `2Ld p@000P<SAt܂Q0 -LM0Sn0Hb0 R 0R  R RmPPw 2nP@g ^aPT T 10HPS 14 T *@0nS& aS @0(T00S1@T,1 h @wSl0S  P$$$1 1U4pP,0p0l R 0S΄ 0 {@ 0s@wP 0d 0_@|\@xZ@tX@piU@TXb@b\\bdt ,4DD8PX`hlĀ400H400$00 0-LQ@P 40Q P $$1 R 000$ 0-LQ@P 40Q P $$1  Q 0 0P 40000$000,0700 000 0-L0\0P   0@\!:ʹP@0 p-LM$14@ Q ` @PU  p4J400p p-LMP`U6P1 40P. P@ Pp$$1  Q p,0  0 R U4P 40U phP $1  Q p$@p -0P` QL@p [pT  S`X  LWV  -LMPup@`S 0UP u 0U 0 U 0U P>v 0V 0 V 0V P-w 0W 0 W 0W Pu U ROPv 0V `w 0Wp,0<,0v 0 Vw 0W -0P`QL  @p ɳpT  `X  WV  -LMPup@`D 0UA u 0U 0 U 0U fP/v 0V 0 V 0V UPw 0W 0 W 0W DP u Pv i`wp,0<,0v 0 Vw 0W -L M|   0\   Kq@ T00 0 T -L M|   0\   Kq@ T00 0 T p-LMP`@0S ( T 0T 0T P0T P T C@@@@,0<,0p R0Sp p-LMP@ `0S 0T 0T P @,0<,0p p-LMP`@0S ! T 0T 0T oP0T fP @@@,0<,0p R0Sp p-LMP@ `0S 0T 0T <P d@,0<,0p -Lp`@'PPUK!ʱP P,0<,00 R*0SR:0 0S 000 >P -LM3P@n00,b 00CS04,b 0-0LSP P @=s000 0-L@P P.s000 0R0 $1 ٱ 0-LP@P0 0$ R?P,0  0"R   0-L0QP)@1 Q 0P P0@ )T 0D000 Q^0 0P |0 Q P 0T@P$ P ( 0@T@PPXb -LM0SP`p5 S P@ T  <@S0S0 0@T 0 0 S @TW pP$ @T   @@TpPXb p-LM`0PQ \ 0 0Q \ p !UP0UP0PUP40@ PP0000!P0P0C\ 0  "!0 00 l0C& d 0 "!0@ 0 Rp ppRdtRdRdRd0 p-LM0(@KP `$P0  p0 -QLMp@G P0 S  0R`0S  0REP,` Rڐ0V 0GSHH H P P P \ p L10S0S0P 0R W   Q0 PQ0ba>0>0  00ab0PP0<@0 /000B04 P$, ,,  0S   -L8C8$M`,PPKS``@KC\, 0 40  0  "!0 00 2C&  0 "!0x"0 RPK@K 0 @0@0 ,@4 00pR000 00 2H@K\1 pǏLpPKM20S@#-Q QPn`3% mP KW/ m0@PpK- m"M2 0S @##mSPU`!q p0奎 @K3' m m,@  wm4pW 8<@K  P à ]C@TPa`~ pà&pm@K0 km4@@pK Om+l@BpRdtRdRdRd0ĩb 0-LP| 0\@ H 0h00H@0@- @P0P=9@ =C 0 0P=9@ =C0 0 S  0 \00Z0?B p-L Mp`@PT 0X LF0@ p0 0 pP /00\`b- 00CS0\1b0@-P@Q9 P7 SM ,0 4 ^- Q \ 0 Q \ 00 0Q Q \ \ 0 Q \ 0$!$ 0S -L M$$@ O 0@.錃- b 0-LP /$O/@ro0810b$0$0$ 81081 0-$0L8!PR @$@0$ 810CS810$00b -L M@PD^`$P T T,pKX* !, 0 $ (0 1 $ 1$00$0 1$00$0  1$0@0$0 T  0000 0ŭPP =P , $00$0 $0 0$0 A-P2Pr0@$01 0PAa0!000U8<0b 0110 010@ 1 10 0 10110 010110 01Q d1!4 Q20U 00101 1 0 1(A00C\ 0  "!0 00 0C&  0 "!0 0 RA11 01 R 100,0,000,040S 0 0S ,07,0,07tRdpRd4, RdRd0D- 1B#20R00S1 11R4, p-LM@ $PP `\o @ 1 0 1! P1 01000 ! 1S0 1,07,0P RPp4, 0-L((10 0P000S; 3S* P@00C\ 0  "!0 00 0C&  0 "!0| 0 R00!8< !S08<1 10pRdtRdRdRd000 0-LM$@!1!010P8<1 J0P}P 0锃 0-LM$@P1 10 1Q#P0 K 㽫P0 1101  !00 S 101 !01  ! 01 K 0 ! 1 0 P 0-LM$@P1 10 1Q"P0 PK |P0 1101  !0 S1%Fτ"0#1%( 3(F ޫP -@LQPp& R@P` @ 0PT r 0 R0 b0h -LMPS`p% ,1@T 40S@TX, Ġ T\0P  V R$@T 40S@@T,  0P V 10 0CSPXb P-Lp`P$ $` P @T U  0 V V 00V U U U @@TP@ U 0 V V 00V U U U hh -PLM@ P h p-PLM`P @T U  ,0 E@@Tp -LM,A P` $@p 1 0q(,$am&0 <  < !p !101!  1V 0 1 0!1 01014, -LM@,`Zu t  n,$ 0F s1d1 10  "0S00ć $1 RN P03800%700, 0Z0 Y dd"00, 0010Sb S3 82 T02  Y( ",0B0, 00C\ 0  "!0 00 1C&  0 "!0!0 Ro,   V! U X 000l0S  5,0H%Z000Z l0S010.02S200ć,   20Z00S.10Z00S H0,0O/`0  +U 10Sd4, pRdtRd@b]bRdRd0 -L`!,03P & l 0@ , , !> S` $0" 1 S S  40 0040SC  $1 RHO?, 1 B"P0000P0P0C\ 0  "!0 00 1C&  0 "!0!0 R ; 4A41O0 P000, > HpCP00C\ 0  "!0 00 0C&  0 "!0| 0 R, ] PZ 0@!>000U$14, pRdtRdRdRd0, H*010,  -1LMP@0  p$@  $1S0,0 ,1(00 0100 ,0 Y`a 10  1011  !1  1V0 1 01!1 0101q00C\ 0  "!0 00 0C&  0 "!0 0 R0 <  < $ Q001$1(1,1000,00 0 Vo@bpRdtRd4, RdRd0 0-P@L4 0(14 2  0h꼃ԃ 0-LT, 0*00@0, !@P0h$0$PP>4, -#LIM0,  ,0 ` @06:D R @0S hß,0 S X,a0^ P 00Q D@K #0130K- 0 @ ` Pp 괐JK  0Pp80S p )0 @W \, $164d JKhP@CK0 0 JK 0 !,000R/h,50 pK|p =j$tp $1|@K\0 (!Tp X 06P0 &L  Ơ0H Pp|0S'T@L0TJT@ P ,0  Ppp P`.Pp L0T@&@,H0P "b 0 pp`p  0# Ppx, P@7[0  pPPp,,  (0 R$Hbc>, - L tN -LM@P`pcT0EP@S02828282028202028282828282828282828282828282p $ 1 01410@b4 1S01 Q0 0 0S00 0S 00 0 P -QLp`0S @PU 0 0C W0SUP!P P 0 e00 0@epe0 SP 0 0S l  0-LM0PS- 0SC)@ 0R0 0S S 0 B0 0@0@ 00 K` 1P 00 P0-LP@T*@T:]P 0S* !0S:0D00/ -L@`p PBP0 Vp P  00 00S0@ R0000 0  p-LMP @T @Tpp@T ` R0000 0 V@T 0- L@PP( 0 S600, $0R0000 0 , -(1(qLM0 P P 3a@T @T@00C\ 0  "!0 00 0C&  0 "!0d 0 RiJ0`@T @TtRdpRd, RdRd0 -@ML0(( I@' 0I@!bhb$ -LDM0`SP\` p 0B Sz!XK␤P@DX00C Sh9(;0;8;P;@;H;P;X;`;T0娡 S PF\  0LP@`"X*\`0 \KA0TK 0 @Q X0 -T  Q  ¤@ \ 0P@  0\K -P@`\XTP-D@cP@x;bD! `$Dll -LMQP`p @ 0B6S6<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<0BES񟗤=>>0>8>X>`>h>|>?\???C?tC?@@@@??@@T@tCtCh@p@x@@@@@@@@@@A,ADA\AdAtAAAAAABtCtCtChBpBBBBBtCtCtCBBBC$CTCtC|C5 1x5t5 L`5\ş 0@ş<ş 7$$K,0 PPX 0S( Q40S (qğ0 L@P00X00SP\4 pPD0,K , ,0P0Q ᚵ*33 ß0 L@\P00X00SP 3 0t 0oX3bTßpPßnLßlH3 ̠4ßd 0Z 0UΝ0O2Q 2 R 0F A 0p@2 2 2"0*A 0p^\"X"T",2^ 2R  0~A 0N*A0K 00 !PP 0 0BSR A 0@x!t!p!l1 ϠIA 0tA 0pA 0p 0 0PPdA 0p - PG  dbb`bba b`bbX1 \1 3 0b, (ba0̩bbPbb - 0 , + - bbcb$ 2 -L M@ \QP@@ 0L SDDDDDE E4E\EEEEF1 -1!0 1!06!0 0b6 : PD10S<1P$1$!l0   A 0@@00S $KP $0-阀0S p0 pP0dSd00SV b`Id! \`c, ,b, bb, p-LMP@`  0STRPPP  ᭡0T0\00S p !p p -PLM0 @ 0 SR0 \K  0 @0@-RM@P 0-P\ \Ѝ0Ѝ0@ p-LMP@`  0STRPPP  K0T0\00S p ῠp p M-PL0@ 0 SR0 \  0 @ -LMP  -LMP -LPp` @aU  0S*T S 0Z030#WQ$U T 0S: ؠ0W0P00S N0 00@SC  00@C -L@`pPaT 0 S:U T   p-LMP@`P  0S:T\P P ᅠ 0T0R00Sp  p p 0-PL@P 0 S:R 0\  XP -LMP@p`& V00P @P P`FU@ /V0 0`F 1P0@PU0h00h  002y?ꬫbb -RMLMŸ8% <5 8, \80R L% H5 Qx Ru0SrD5 2@ PU 10S VcO$NOOOPPN40S! PU@\@ 2 8%R H 0b<%\0 1 ,0S ,7 H5<;0L%R D X\H5 0H5 OK%Y 1%.# ᮟPD%  BiD%  X*H5;RNK@D @DE R/㗟PR/㑟PH,0 $1 R$1 0S 40,0 $1 0Sl00 Q0 Q Q0SS`SppD ^0HbXb\b4 p-LMP$1`   @P 0`1 0BRSo0 @0S0c 0($0$!014,C/Rn` T"00C0H0S40X2$1 &>\"$, ?  R; l0d2x0S0 1h2|0l20@S$1  Q020Q'g[0 @@? -@@ xBY[0 @S[0+.@P P0p0d2,0s@R$A,A0A4AC[TB~w -LM% [  0 @( 00@ 8 $0@ @$H 0PP@@1X@ ` (0@d0, h 40l0H0S40p0$1 0S40t0$1 |@x 0 @ 000 00040_0 -$11=, / $1 R* l00x0S00|0|0@`00 @ 00d ̊ h0B0 ^  .0@0 1!$!1(1 !,!10#03O/ M? 3 ` N`$1 sZ1 0BRS01111$ 0 R`00`0$ 0 R`00`0 R P  =100CS> @0.00S0t 00K z_!08 K0 , 84001! 0nO 0rϊO 0vO 0~oO Ί 0O  $0冏O !(0O ,0O 00O 40O 80O <0O @0O D0O HP00 TL0L!0S,0 =9C =C0 ,0 , 00 2$"0 00C0,0   (41 !01 !0@ ,1@1  00 00 >!` `0X Ql0V/@. _003>6?B12 -QLTMPQ0DSzP U 100CS,0   f  000 - 80K`0 \ H D T P0K p`KX @` < XKUP`T  40 T T4,0p p0 8 0px x tP 1p  0APd l 0wSu*dKt 㯜P`rxP K0@@ h0K `0 `0KH \ X0 T D < XKP`[h0SS  PK: @ #: Zc`KX `p \P T HP D < XKP`@P@*0S @T:0l00S0*d gP`* d0 T h0d 0h0   `UP` pd0A0 d0 p x0t0Qx0 t lR:0l S: ` [0dKt d0 ,`,0  TT070- -LM, @ ,0iPz0S} b PU ,\PUPiPb2|"@`@  @"P2  P@U`@ p ,0"S0f " '\,0 @ `v^4 8  @ 0H $ P ,0X 4 ` <0h D p0L PTpUV00PC00,0   T 0PU ` ,0 @.^4 8 0@ 0H$0P ,0X40` <0hD0p0L PT`Uhb b$b, , ,bD -LM@-QM @P\0 PЍD0\ 0S \ 0L Ѝ@, , p-L M\@` Q 0 mppQ0 \"\ 0 1PU P P 80K00,0 !0080pp 0ppx! `! -LMHğ@4^P`@$4^Y 4D04`  T 00C\ 0  "!0 00 3C&  0 "!0#0 R(`00C\ 0  "!80 00 $3C&  0 "!0"0 Rki괂2p0 >  `lP0 S0@@0Y@0Z P ,0 0R,0  10| PUml0S`  1 @00@0 ap00C\ 0  "!0 00 1C&  0 "!0l!0 R1`1`!, 0 ,0# =U,0 Z U  R ,0 10 9PU $ E00P#Y p+x`p00C\l0SD`010\Pp nb`@bPbtRdpRdbRdRd0bb p- PLM`00@00l R 10S, 4,0;,0@`00C& R 00#!x000 d0C& \ 0 "!08 0 Rpphpc tRdpRdRdRd0l0-SL 2?\ 00S00 0Rl0b -1唡LM0 0P0t!0p`@T l0S+ @T4A0 0C\ 0  "!0 00 0C&  0 "!0 0 Ro l 0`FS10S0S,0吀010 cP P000V8tRdpRdbRdRd0]b_`b -LM 1r1/AbP( $ (@Kʨ1 RQژQ0P\ 0P1 xb#hh!`(000 b0 0<cQ=9 @ =0 , ,0 0 ,01 Q=9A@ =C`00 0 C\ 0  "!0 00 0C&  0 "!0h 0 R`0QMb~HdbbbtpRdtRdb?BRdRd0 0-LM0PKS@ S =00] 0-LM@P 0PK 㫗PQ Q0C0 0-LM0PSX@ S0 D0  W0QK 0 00Pʚ; p-L,M `K@ sP p 81(PK 0@a(0 $ :PA0S;OP0J0P Pp0#PS 8K4 ,08c00Pc0 A00 , 0 ,0  ,0 c00PcX0 A@ 0@ < <0 @0@KS@P T: ,`KP4@KP 0S#Pu<K◺,0S(0S ᏸ8( 80, <0P=9@ =C, ( , (0 sŒ0$K $0 -P?B -LMP J`^0S@$pK0  0=BR L0 0?0$ S ,K ( 0,cP=9l A( =, (0 , &@Q 0R?BL0Q R 40RQ R 00R0 ?B 0S0 0R0 0- R \b =9 = L 0 0 aS 00S 00S0S 0 000 aQ 0=)0C -0 p-LM@ KPᦹ  0 `0nRC(0 ( =$ (0 $ S` ^P 0K ` p $0S -LM@,KP{( ,0 `p0l=RC 40 0 4 0 \`P 40S00K p00Z`` V000000!0 Q00bb00  0-PL@l0  0|0  0 c0cR 0 0 PP$0h00 PP- bb -LM@<<00 0 00000h{- 0-L'  01 0P Q Q0!01 P01   N`1`"0 0R  0!01 P 0 0 0@420&0K 0R  0!01 P0 0 0@8 <1 0R  0!01 P01   @@T@0- bbbb -LMq0SA ܁a 0 00cSZSO S1"001 000 0bS9 Sl1"001 0000cS$ S<1"00! 0 00cS  S1"00! 0SoS0&0"< Ѓ!S0&!<0 Ѓ!S0&р 0!< 0Ѓ1S`0&\ 0!< 0Ѓ10 P00$0@}*b- bbb -LM@PT 0倐0c/a"|,K0K ~ ~0H0\0  b,G$0U@Tbb0 0-L0LDF@D<84PK@TP0h,bȄ؄- bb -$L  X 0h*b<,  p-LM(`0PS@ p 0@P- - -P0LM D@R80(0 h)- - -  b -LM,@0(SI0- b- -L M aPQ@ P$ P p0 pP@ $0S PQ ڴ00 p K00, 0P@U4p 000$p-- - b- -  -LM@fP  -L 0-8P8@L , $0hZd`|`P 0-1LQP1 1, 0@00 0 000C& R 00#!000 0C&  0 "!0h 0 R X0X CaD D00hJ(@bpRdtRdRdRd0 gfff_`]b -3L M0"40 40Q000 2, 040 2@T Ȓ10 0CS0 002 h Q5h0 @TBtp2,o ```, 040dQ0hPd0  d4Q `00r00h 0d0uQ``00C\Q 0!!  0!C6000 "!0x!0 RK0 `000 1Q <1 T 10S* $1.`00C\ 0!!  0 C6000 "!0  Qu hs,0 lP0#1!S ޠ0 0ʠWĩbdbXbRd - b pRdtRdRd0@b p- LM0 P1R@0``00BP0 0CS0 kPP 00CS0`ph\d p-0PLM`0 0 @0 .} @00@0`0`0C& R 00#!x000 d0C& \ 0 "!08 0 RpphtRdpRd@bRdRd0 p- 1LMPaP;0@0 00 00.10/ D00D04@0@0C& R 00#!000 l0C& d 0 "!0@ 0 Rpph$@bpRdtRdRdRd0 p-L1 M PK`ٴt 0PT 0  cR=9a  =  A 0  0!Q=9A =C 0P0 R0S @0S0S  000  h唴p  0R 0R 0@ 0S@bb?Bc( 11 R00 bb -LM10@Sԍ܍ԍ`lԍԍԍ,0 1 0S,0  >0Sx x000hhIm,0  O?Q0A 10<b]b_`bD `0< 0 0S0#0(0 R0 b]b_` p-LM`0@0$S$0# `0P00`00P0P0C& R 00#!000 t0C& l 0 "!0H 0 R01S,0 և ƇpkpRdtRdRdRd0@-@@@@@@0 00 00@$- bbbb -LM0@S`p>0S,0S00S7  0PS0U 0S PPpG0Si>0h 0T 0S <4sp00- l -QLMp0 4 ( ,  0  Q0$ ` V P0S 0 S 0B8S$P0S`V0 R ,Q $0S PP0,`@08JC8 1!Q4K 08SVb0- ̅ Q-Lp 0  Q0`V @0S 0 S 0B8S$@0S`VP08JC8 1 !Q 08SZ00b -LM|P04 H0( 0 `00 ,0 $0 JPp0CHAA0KP4K 08S,  -@Pp L4`V 0 h$W  04- p-LM @`PU 0 php -PLMp 0 QP @@YP` Q0S00C $@@00 PW2  X  0P @0S S $@0SP e 0R0 S0 0R,0 S00bb$ -LM`@/PpU PPN OJ0 S0 (0 @00B 0\! P7$` 0\V@@Tʄ@T@ P fA JV 0 !R0,0 ; yNZ0V|t+ 2S00S   1S Q0D|؆ -L P@p0`SZ 0S-QP V`0S S1 $0S R 0(10  0@ % 0A  T1S RR 0000S Q0 0Q B 0 R00$P   b 0- 0L 0PS-(@ 0 0(0P (@ 0- 0L 0PS-(@ 00(0P (@ 0-$0@SPL @ P4  0@ P0 0h'K@bt -xpL@`T 0P$ R U@U00000 Nb 000b0  B Q9b p-\0LM PR` $0S@ T  pP b p-p0LM PR` $0@S T pV V -P Z>b -QLM@0Q 0AT (00@T,00,0 -LM,0@0CS,0  0 0Sh -0LM@ QN00  0@@b-$ R$ $@@0^*$0S $@ @0S:$0S$$$@0^:T T0S$0S$0S$ $@0@ R:^:T T0R$0S82P *0P ": -LM@D 88#| , `0 aPDq <v8q004!01`  ,0 0< T` R6Z `T<  B?+$X Z 2 8`J0 0,8J,@`JPJ P< (0R00 ć̇ԇ0  0 ,b$b b P0-LP P0 RD0@T ,+HP @T000,b$b -LM@ @000000 -LM00@S(  e  0 Se Rd~SG PG`ӮH00< @0 00 0@ ,$b,b b -LM@| LR 0@00  0 $0 BR  @,b$b b, 400Sh40 -LM40@0CsP40B ,Kh(0, 0ahS00  `=94 = B4 00 p004 0pQ=9A =Cpp 000K Z UPX8@` p@0ʏ 40K*)H0P@ ,?BH 0 7@b 0 0@b -1Qp  80PXLH`@ @`0p0t0p0p0C& R 00#!p000 \0C& T 0 "!00 0 Rk鉽tRdpRdRdRd0 -LgM∑ 0,0 0$ D!(0("4400@$04 T` 0(a$!@0A* p P0 200-K0P$0*K?K "R .K 2 S0 S |0x0L0 ,0S \,SL00< 4`Hbh@bxr`edA$$ -LM ZFP@Z/ IE0 00  8@, R  00SS S 0 R$0t$0\t-  0`0b` -LM`@pPP  D pP0D 000 0  0@@- `8 0S00 R0 00  0 `` -LM@PP `Vt QpPk1 ^ 0S^ ^0FS 8XDd 0 -^6 PP!00D000 0C\ 0  "!0 00 0C&  0 "!0 0 R0 p!^ 0 \^ 0S 0\`0bpRdtRdRdRd0@@ R4 000 S00 `` -L M8@4^ 0 P'00`Pbh 0-@0L@PT ;EP @T00` -(0LM@T @T` -L MV, 0 XP. ,PGqD@0U 0(p$`,` 0 S0 0PE U `, 0 0 X0000  0000t 0  #  P@ 0-@LTP  @T000@T R000   00hk -L\`P@p0 0+ 00S00C 0pQ  0S W 00CQ 00@@hTW 0R 0000 H0Q 0 R  B 0S00@@P -LM Q @Pp`B: 0VP,  R 0S 0S * R 0~  0004 0P  # t -L 0R03:00S 00 0 0P000 0 0 p-LM0PS`  0R:0S00p@00@0@-,M@ 0P000^03:0S#\ 0^ *00  0S   @00 00 00 0000,Ѝ0\ 0^ : 00  0S   P0@-0(M @00 Q \ 00  0S  0000 00 0000(Ѝ \ 00  0S@0 -0pS0`0C0D0< L0bD0 R000Q  0S00``80 0C 80 hM@h0p)@0P0  P0P0C\ 0  "!p0 00 \0C& T 0 "!00 0 R pRdtRd`RdRd0 -LM `@|V`Pp0S:000 0`0B0@0 0WpUP@0? 0  40 Ph 0 `0L 8,0d$pT`DH000P0 RS 0 /">CXh05|%03h05 5P%(PB2|P5p% >`(>`>0<0`>PlP t0RxPPPPPPPPPP 0PP00 X@@XP0\0 @X (0 Pc<<L 0 P[ - Hb`LbT- hp|`x -LMX @R\0T \0\00X \0 P PQ  Q4Q0 (00  0S00x`T-  p-LMh0|0P` p0@0 0000@0@0C& R` 00#!p000 \0C& T 0 "!00 0 R pRd`tRdRdRd0 -LM`L HpP~ PU2fP@  PUT  L0HL 00T P d0` 0 d0l0rHL 000@Tg R0000 0 D H0 B0D H0 R00C0 R000  R 0PP0 00 S  R000 R 0P 0 P0b0D, 0Q0:.0S"0Sd0` 0 0S0P 4+HL P*]` 0-L(MT0h @ |0Pp0 Spa\h 0 0S0PPP 00C0D00 HD0d0P A H 0d0 R0000P!04 0S0T0  l0 R000  R 000Ρ<00CP 0 R000  R000<Kp 0 S:`P밊z -<@LAP<<P`@-P@  gpWT  00V000`F400 R0"40%T i -LM0$(S00pP 0@`p `@ F9h0) xt 0Q0xxZ0@ 0j@<D00@pD0 0@0 p@@ 0@0 S80p0S800p -D ,0LR@p:PP  `VU  0D, 0Q0:U p0S000 Q0-LP, <@@:<7<D ,0R0:0 Q0-PL <@@!<<40 p-LMPH`Q`3:Qq 0L`` <@@<<4p -LM0`S~@0T80  @T,K ᛠPU 8 00R8 K @,1 d@4 $0pLc^=9 =4p 0 00 40SKPX8P LqP R000 bh0p 8PUF @0000@0@0C& R 00#!000 0C&  0 "!0h 0 R ԯD0<,0lS:{\- pRdtRd`RdRd0 p-0@LM P0Q00 0S0 00`PP00C& R 00#!x000 d0C& \ 0 "!08 0 Rpph{tRdpRdx`T- RdRd0 0-@LP 000DP0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h>pRdtRdRdRd0 0-LM@PT $ 0@T0Ԋ -LM0SPp` cSlSpS0`S(h@ $0`@T,L<D H0V 0Sh 0SL 0S00S7X h0( Z% X"  0,`V  @P PU@Z`VXXH4@t̋,DX|ȌЌ܌ -L MT@0`VP  h0 Q d` 0`]pW 0`V R @N` 00p`EpW,4 p-LM@PT`  P@T @T  P@T@T  P@Tp-$00 (0,04800  0-L@PG R0000 0 0 p-LM@`P ,08 0 B8 ,00C ! \0 0pP 0SP00000=PP 0Sp( P `p -LM`pV 80080 0 1R 0 0`V 0SK`V,A,1P    P0P0C\` 0  "!0 00 0C&  0 "!0 0 RViL 540 040 00 ``0S`>pRdtRd|`RdRd0 0-$0LS@P0h( -LMP`Upb 0S 800C80 0B! @P 00S$0SM0SY> 400C40 R000 0 0  R000@ @0@0C\ 0  "!0 00 |0C& t 0 "!0P 0 RZ P鶬(pRdtRd|`RdRd0  || -LMR@p R0,0 v nR 0Z0QQP1! 0P00 ,00,0 P U Pxa00C\ 0  "!D0 00 01C& ( 0 "!0!0 R%Y00U00SP P ,K 7xP `90 S %`%!* "RZQPZ00Q0S pRdtRdT- RdRd0 -LQTpL`0S C3 1@ 0 00@0@0C& R 00#!000 0C&  0 "!0| 0 RZī0S P pRdtRdRdRd0 -LTP q 1`   0@ @T d0 .X@T00@0`00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 Rhdd pRdtRdRdRd0 -pLP`@XX^\0\0\00X\ 0X0 \\ 0  `\ VV000ߦ90 L ⷥ, c0, 0  ⪥V $d0V -LM@ 0@뀍 I괍 --LMxP0Sp`A \ LH0 R l^(@ 02@Pbȍ- H` -LM@0 HD00S S (Sy^hlhu^Ѝ-  --!LM AP00`00C 0ppP0P0C& R 00#!000 0C&  0 "!0` 0 R P0\ 0 `pjtRdpRdRdRd0 b p-LM`0@< 4PK0 o0\ 40[S  c0S >\ 0S pHb  --1LAMP0` 0ppP0P0C& R 00#!000 0C&  0 "!0d 0 R T0\ 0 p_tRdpRdRdRd0 b -1`PP1@p  T00SL h10SP@p00T00S@%10V00S VV 1 R 10  0\0P` P00 0R W 0V0Q00Sh\d00 S000h/PW  0T00Pb $b(b- --L0LM,  $!0 \ @b,0 $1  R000$!  P 00CS0b -p-LM@TP` 0S 0p )P P` --LM 0 --00LM Q0r -p-LM@XXP 0`@^00@ R `p- - Pb p-LM@\PX`k  0PP=00@ R Pp- - Pb --0 L M@T@ K ( T0   -L M@@T ( 0 K T0   -L\Mϟt  Y  0R p h P l , 0 h p H X H0 %PP p H0W0H0 X0 0  X0  pX00Y00S 0 H0 0%SSRO HT \  pH d ` H L H L  0BZS1P  |                                              L           8 D      t 0 x P`\  \ \  h`d `0V`S`T`T| \ @fT@Dp PX0W0  X0 p X00Y00SP } T@D`Q X  X p X00Y00S` e |\r dh @bT@Dp 0PX0W00  X0 ` p X00Y00SP F T@DhAqh  p P0W P0 X0 0X0 > pX00Y00S & h  Brh T0 \ @fT@Dp PX0W0  X0  p X00Y00SP  T@Dʯ:X ,0S ,20.\@fT@Dp 0PX0W00  X0  p X00Y00SP  T@Dm `  cT ` X0p 0W@0X0  p X00Y00S  XTX p X00Y00SL009L  D@Kx(0`x D0[ Sx  p X0W0  @X0 pX00Y00S v 0S ! x0@Tx0  D !0O0Y XPp <,WX L pX00Y00S O x 0@ TX0W0  X0 1 p X00Y00S@ 6 x0@ Tx x@Tx P X  >X p X00Y00S   OM  Ix 0 Sx0 Sx =D@K &bD@K&_`\H 0  H0 `0 HT T 0 0 SH\0 ܥ0c\0 H0T T H+0 H*QH L  L@00L S H L1H 0 L0 RL 0@C0Tpp0 @0Tpp000 HT0 0T0 @HL 10L 0 B0@C RH \@ }TT T  m 0`00 Vb WT0dp 0ãT0 d00Q0S-0KP0  R0 :R 3P0 x2h l% >P &B`PbP P(K 0a0Ch0 1!`PP0aP T  00S000aP V0 /P00cP0 0 /`PV PP000lP  U- Pu`` TT @ 0 Po0  PoTT T  0` ` wT00   T@0 00  0 P`P`T00T0 T  0`  T T@ 0 P`0 0 P`Xl T   0`00 T 0 00S T TT @ 0 P`0  P`0DK P 0 h0 ` D KH0T @H lR H  TT0 0/T  0X0/ +Hb$,H \dT 0X 0 T@ 0X 0 0 X0 0x0Px0L0 8 PuoL 30 T0P` l 0x T0 L 8H  V 0S# T   0`00 V0 S -Pu`` TT@ 0 Po0 0 PoR, T!x0 l L0  0` T000S T Vn-0Pu``0 iTT@ 0 Po0 0 PoL R D0KD KP0 h ` /t0Y00S00P0 P 2R W P  .P PaPh hp ` P0h l  w -L -@LMr 0- @LT0TP000@, 000  0 0 00A@0@0C& R 00#!t000 `0C& X 0 "!04 0 R0npRdtRdRdRd00@- 0P^c: 2#80S$H*,0 9,00 0]b -LM,0P20#0R0Sp` 0Qc : <"K#80S $H:@@n0S 2[02KoP E-Ƞ@0Sp0 p `P@ 0@s  0R0 s$0@S$P10 R$0 @$0@S 00C0 - -  - p-LMh`@qP T0T Q 0QUqU@@0p_0@P. . Ԏ,0, 0$ Q 0÷. . . b -LM0(h h`/\@\ 0 0S<:u/80 /m/000|b . . b000 Q 00 . . b. 0 S-L< 800( S $S ZhV꘸-  -t0@LMA \E0S,h8$6h2 n  -LMA0@Q!ڀ!0Qx @ ^d!00^G@HTHi W0SD00CSD0@0 (0+Q @0$Q0S WpW Q @@  81Pot Q@0@0@(⋀0@0<@0e ឵p@ < @0^ <@0oY*0#p@@ 80P3t @00@0|| 0SPp@0 p@0@0@0@0=<@08b0Q$ 0Q |0Q 8000T0Q L0Q0800S@0@000@0}ff@ s@~fs -LM$@pA`|0 Q>x  0,0CS0 p||s b -LM`lpS0 O \I\9夠 P000K<P00C\ 0  "!0 00 8C&  0 "!0(0 R#  0@D  D @0言 $P ";p05m  R @aT0SW 0S TG)W}p ^W~p\W; A0GS p  @ p p  pWpW p 0Wm0!0<"p! uW ZCx ҫW Z40xW W W{Wt 05 0 (0r05WY   ^DAp09_(0S-@#20W0S 5   x0ph 0@$  $ [pRdtRdRdRd0bb@xr`b -LM p0Pğ 0@d 0 d HP X X X X D a0HS H@ > 0; `0HSuuuuuuuuuuuuuuuuuuuuuuuuuuu4wPxr` -LM0@  (0 P0S0 -1aLMp @ P H0Spp% 0  0S H0Spp 0  0S p 0H PP @p00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 R7tRdpRd(/ RdRd0 0-L@PP 0 -1aLp  P @ (QSQMp0 >;-p0.( Ap00C\ 0  "!0 00 0C&  0 "!0 0 Rhւmp0! <!p0HQHP'P00C\  0  "!0 00 6C&  0 "!6  Q0S  0006 ,0S D,ɷW~P00C\ 0  "!0 00 5C&  0 "!5  Q0#  )~`P00C\ 0  "!,0 00 5C&  0 "!4  Q}$P00C\ 0  "!0 00 l4C& d 0 "!44@  Q0$|0$ R 0 XRd 0U 00aH0 S/X X!ڜ0PH /=P`0ß=p0Od P d eʤ0H0 SXe0 XR,H0C["P0 B H0 S;ژ p"2HpP00C\ 0  "!t0 00 `2C& X 0 "!(24  Q 00S#0I}P00C\ 0  "!0 00 1C&  0 "!`1l  Qv }td!?08PX_]P0pH|H0 SmxdR1d#pK KP ?  , ' x0P$ 0! 11F0S  x0@ t@9P0  q0|HbpRdtRd/ RdRd0@bb(/ @/ b -LM 2P0S@ 50 -R" B?D0CST@0?0S P-0B= ?  8CRԡ!0p000p 50>*,Kmp =P@ , hP@0p 5*DA0p 0 0C\ 0  "!0 00 0C&  0 "!0 0 R-=`b0V``V=J`VZ)|0@   p0  :p0\@pRdtRdRdRd0 Q0-L@PA  UPE0 -LMPPc ``1 (`(pK  P@ (N P@`P@ (= P@p0@:p00 0C\ 0  "!0 00 l0C& d 0 "!0@ 0 R0>0={pRdtRdRdRd0 0-p0@ 0L50 "20#0 P0S @P 0P0PU00S P ^U?@0hU0 -LM@p0 qt h'zxL0s S0s-t0 A!`?̠0 S S \h\ !h3 3#2 11>gfffON -LM`P,"0$"111;/"b111A|0St xQo @TPi zPP@@T10S4 S1 1R0 0l$K0, K͖ HAN=0S 0 $00!0 $0 q?B6c$ (N=0S(0 ,0 0 ,0 ( (0?B6c, h01c1 @R  1P2;P 0 <0(/0"bTd uD^dQ$@`ht|?BHhP0@-0 1@1P0 SR0C BSRP 2P# 0DS00 ER  R R 0R0S,  ,00 4 40R0,0 R4 40R0P` `0RS -!qL`0@ 00p P( (R3 P. `A`00C\ 0  "!(0 00 1C&  0 "!0 0 Ry @`00C\ 0  "!t0 00 `0C& X 0 "!04 0 RytRdpRdRdRd0 0-LMP  0NῪP>T00  bb -p1pQp`L 0 S@ 0> 0H 4q`00C& R 00#!000 0C&  0 "!0 0 R " ( H t00 h @0T0 0@I*yj@tRdpRd@bRdRd0bb p-!LM0@0C0 hQR 0\10  0 (H010 ` 0 b1B&! 02 S41b1 R0@@00@@`00C\ 0  "!0 00 0C& x 0 "!0T 0 Rpphx>bpRdbbtRdbbRdRd0 -0  L0 Q l00  (00H >1>1=1p00|  x0S0 0h0$0(Qbbb -LMQP`/00CS $PX`h000 Pi'-p0l0h0PpT0T@ 0 ֣ pkbbbbbb -P@pL >m0E/>1 `W>p 0 0P0  T -LM0@S0S000A?>> p-<1<LMP ` @T Q` 0 0c/.!1CQl 0S0000DS00 0@P00C\ 0  "!t0 00 `0C& X 0 "!04 0 RpwtRdpRdRdRd0 -p1pLMR`PpL0S 0\@l0% @l T@ 00S 00`d d0Vp /0SS@0 00 0C\ 0  "!|0 00 h0C& ` 0 "!0< 0 Ri7w0tRdpRdRdRd0 -1qLM @ `^ QU 0P e= ^N ?>1L 0S10`\A00C\ 0  "!0 00 0C&  0 "!0 0 Rv^N 0\` ^N 0 0H`F V0`bкtRdpRdRdRd0p@-H1HQ` Q000 0 QR @0Scc \ 0S00 ll 0Q  RR  @`00C\ 0  "!p0 00 \0C& T 0 "!00 0 Rpp@avtRdpRdRdRd0 -P"PrLP0@ 00 `R^ R0SP 0 0 0` 0 @\   ; ?>1 @  0 0Q00  0AP00C\ 0  "!`0 00 L1C& D 0 "!0 !0 Ru?>1 @  P0 @P00C\ 0  "!t0 00 `0C& X 0 "!04 0 RutRdpRdRdRd0ԖRp@-@) 0/.PaCPL  10C00&0b 0R000 Rp0a # B0!00p?>1 A! p Q-L`Pppā!000 R- R0SW 0 0V$ R! 0 @cR@cT@ `dPp 9 00S 00 0V  R@0 0C\ 0  "!0 00 0C&  0 "!0x 0 Ru 0 AYD P0pRdtRdRdRd0@-0@S 0 00\S Ch0P 0\Q 0 0c/.!1CQ<0 L`@- `0R   00\ La/.!0AS1@ L` p-@1LM8@ ` R 0S00C0 00B 0Q` 0n/.!1CQl0S0 0P@00C\ 0  "!t0 00 `0C& X 0 "!04 0 RpcttRdpRdRdRd0 -!LM0p 00 RAI 0S 0R/ A0 0C\ 0  "!t0 00 `1C& X 0 "!04!0 R,p t@D`KPDK@0 0C\ 0  "!l0 00 X0C& P 0 "!0, 0 R stRdpRdRdRd0 -`,0p$1P LP@U @ n 0n @%p -LM`,0p$1P HP@U m 0n @p -LM`,0p$1P HP@U m 0n @o 0-LM@,P$1 P \0Q T0Q  0Pn0$1 Q 0,0000at qt @-,0@$1 00S   @n@ 0-1!LPS 0 0S-@ T* 04@S!T:PU R0 0Ո0@0@d@ ll LP0h bC 0 E Y`bbP`b@bh`,0 P 0SPb -LM@P  P*0S S 4P: p-PLMP@` P P* R T 4P:p0SRV`0Sp -LMQP@!P P P U \*0S 4\:*00S E 00*Am1 -h0LPpU` @ T*0S4@  T:PUb p-t0LMP`U @ T*(04@S T:PU(0phF b p-|0LMP`U @ T*$04@S T:PU00(0aph! b gfff -PM@L` 0|p@@:p0 @2  007$0h2bDbL( , 0 <0N$ T0 b - 1 a ! pP0U0L0 @ T*,04@S1T:PU@p00C\ 0  "!0 00 0C& x 0 "!0T 0 RD 000vq tRdpRdbRdRd0b -Qȡ@P0L "   00վq@0@0C\` 0  "!`0 00 L1C& D 0 "!0 !0 R;V5 000  1C0\1 0  "!0 00 0C& | 0 "!0X 0 R 00!  pppRdtRdbRdRd0b -aԡ@P0L "   00Vq@0@0C\P 0  "!l0 00 X1C& P 0 "!0,!0 R>U8 000  1C0\1 0  "!0 00 0C&  0 "!0d 0 R $0 00  1 spqppRdtRdbRdRd0b -Qء@P0L "   00Խq@0@0C\` 0  "!p0 00 \1C& T 0 "!00!0 R?V; 000  1C0\1 0  "!0 00 0C&  0 "!0h 0 R  @oopRdtRdbRdRd0b -!Q p0!00L 1@0C1N 8P<0<0< 81 0 10 `Aqp00C\ 0  "!0 00 0C&  0 "!0 0 Ro (0S $0, $4$85 tRdpRdbbRdRd0b P-L@I a吡吁qP 000! 10C1O 8P<0<0< 82 0 10 $@P00C\ 0  "!0 00 0C&  0 "!0  QT!o (0S $0, $4:$<` pRdtRdbRdbRd0b -DbLM<@ 0R 0"  0ph @0@0C\P 0  "!0 00 1C&  0 "!0!0 RXUR 1x1 000  1C0\1 0  "!0 00 0C&  0 "!0 0 R`a1@``@ =)01$1`01Z 0j0Ó p oninpRdtRdbRdRd0b -LM -LM -LM`0 40 < JQ1  < X Vy 0X:cX`0,KZ,0 8 Ve u4@ 0\0"0嗻P@0@0C\ 0 !P5 0<%C604ş0  00#!%00 R/U9 !4! 0004  1C0^1 0 !x  0d$C600X$  00#!0<$0 0 R 00  !80UP <\ 0!0h S 0! 0 \W0$00$ 0008!818P 80T#<`1 0S 5p1P1l0:࢟ 00cl0 S01V01R@1@!  00 0 d dR0 0`d0 UX XP0"000~PXb@ 000Ӹ졟@0@0C\p 0  "!0 00 1C&  0 "!0t!0 RNW 1X1 000  1C0\1 0  "!0 00 0C&  0 "!0 0 R`a1@ ``@ `V =)01$`1 01HjjbbpRdtRdbRdRd0b -QLMp`1; 0+0S6* R3 0S 5P1`1pl0: 0S@1@!  00 0 pd dR0 00 VW W` L#000` W$$3@ 000#@0@0C\P 0  "!0 00 2C&  0 "!"0"0 RU 1p1L2 0 0082  1C0\1 0  "!0 00 1C&  0 "!!0!0 RZ1岡@ 0|0 0号P!$@0@0C \ 0  "!0 00 1C&  0 "! 0 0 R!$ R 1 0+10 (,U8 110 0 00  1C0\1 0  "!0 00 0C&  0 "!0` 0 R00000010aapRdtRdbRdRd0bb 0-@0TLPoqPP@ 0oq000S00 P0 0 0S00 -LM@h 0-Q@@TLP Q Q0h0RP 0SP 0-PL @T0 00 -`@LpPU P@ V0000P`U00 -@ ML 0@厭錘b -SL Mp2, @ mP` 0S+0SX2XT2 @2  㓮P0 0 @0 R000 0 0  @ `@P@,1a0 0C\ 0  "!X0 00 D1C& < 0 "!0!0 R,0P`0000P0 0C\ 0  "!0 00 |0C& t 0 "!0P 0 R`)]@bpRdbtRdRdRd0 p- @LMP 0 000 P0P0C& R` 00#!t000 `0C& X 0 "!04 0 RpD`tRdpRdRdRd0 -!LM䁟 p0P 00 @  0`P@) Qp00C\ 0  "!h0 00 T1C& L 0 "!0(!0 R_ 0S000U3 0UP0@ UPSp00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 R_ tRdpRdRdRd0X1 \1 -LM@Q0 0S| hQPb -,",bLM 0P00 p @T @T @T u @T R! 0 X 0 B?BS  `6@L!F偐Pp0 R00>00A00C\ 0  "!0 00 0C&  0 "!0 0 R_0  0Wp Pp $ tRdpRd HRdRd0 -LM0  0  -$1$ALMP ` 0; 00    0 5`` 0`pP00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 R^媳tRdpRdRdRd0 -LM0@EQ!` 000 1 0 * 8p@`00C\ 0  "!0 00 0C&  0 "!0p 0 R^^YP  0p-pRdtRdRdRd0 p- @LMP 0 000 P0P0C& R` 00#!t000 `0C& X 0 "!04 0 Rp ^tRdpRdRdRd0 -1ALMP  9p 0  0%p p`P00C& R 00#!t000 `0C& X 0 "!04 0 R]tRdpRdRdRd0 -L,M0 00` , 08 0P0H0 R4 00ȟY00S  0D0  0000D0 8P 0S 40040Q `0 :00: 0u 00:0=P 00000[0P/ 0 0    00V0S0000  C@0N0S0  @0 ;@0 H0L S 0@YXV@/0ORQ8Q00S H RT0@0PPN<P0 0CP 00#!P4;70770L `00C\ 0  "!0 00 1C&  0 "!@1@  QZ pU0x7ᑈ#|@L 0@@4 0   @Pp Q! zZpZ00W00S@ PT  -LM@`P p  0 ` -L4ML@2 @022P02[tat!p 000K2022GPPK02[02,0$0@p00C\ 0  "!0 00 0C&  0 "!0 0 R 0 00S<T0,2·pRdtRdRdRd0 -LMX`p,0 P \ 0 S*U ,0K0 0R ,R "R RU 0S0 R00000 \ 0S ,0K0 0 P R R@R1R7 R R  RU 0S :G@0CT@SL4MTMhMd1P| 7P01PL0T@0P0T\@\00RU 0S@000 0004  ` Q!l401#8S#00Sl0W  P0WS 0S 0S S et1 x1    -LM^P@p \ 0S*p 0H0 T` 0 &T T T 0 00`T@T  TT  T 0 0000T2 0T 0T 0 P 0T 0T 0T0tP 0@P0 3 003\   -LM@@ D0<sl@h鯾 p-LM!40r$@ r p0L@0080 0`00$ P 2$0200C\ 0  "!0 00 t0C& l 0 "!0H 0 RpR(0|@(1 81 pRdtRdRdRd0H1 0@-14 @0$00p0S0p0  Q0 0 0S00p0PS707@00C\ 0  "!p0 00 \0C& T 0 "!00 0 R00@RtRdpRdRdRd040$ L 0  191# 3S,000\0Q0@-14 @0$000S00  Q0 0 0S000PS:0:@00C\ 0  "!p0 00 \0C& T 0 "!00 0 R00@)RtRdpRdRdRd040$0  C0LS 0 Ŷ  191# 3S 0 ,0 0 0S 0R40$# P0 00   0-0P; 00  UL@  0S 6La0S |0hXLP0S 60ha -LM0@00 68 Ą|3L00S  -LM0@00 6. ᧄ|L0S  -L ML0H 2cC0Q0^,0 j3#0 ScʘӞPB )0@0@@ P00 <@`@DpC P0P(1 C<@` Dp"P@`PP@P@ @ , . @ 0PY L0S6,0 00 , # ᩟bQbt1 x1 R33  00330(0 (, 0 Q 0\30C3( Q,0,0,00(,0   0\30C3 | F -LM0@ 00L<0S  -LM"2 " @F崁P p-LM2@  ,P`02@ @F0`圁P2 02pX 00-@LPٻ202"00 $t$ 0h/O0< p2l p-LM|`@PP LP \0 S0\00S;0S p$7pQ@-L  0@Q  0$R @ S`1 P0H L07Rb -LM@00 0Q R 10S   -LM @00Q  0,0 0100000S0Q0 ! !101 ^Q-Q 1S( S  0,0 01000000 0R0Q ! !101 00Q -LMRp`  10 PZ 0RP B 0CS0Q\騂2@ 000Ӝ, @0@0C\ 0  "!T0 00 @2C& 8 0 "!"0"0 Ru,0Sp !  000 00"C \" 0  "!|0 00 h1C& ` 0 "!0!08!0 R;,01000,  0 /Up,0Z,P  0,0 010000P0S  0,0 0100000S,,  P,00N,N$嶣pRdtRdbRdRd0b R0-L@A 0R PQ 0\  C 0LS0^00S  0,0 0100000S  0,0 0100000S@@@0`̘ Q-L@`Pp 1 0\pW0S00`@TW U 101hh60SP !1R U. 1 \  00c<;  80S/ \!1R U@ @ 0   1P00001010@0@0  ; 0  0 00$00 00a\U0ܘ -LM0@S0S -LM@PT0`,0  VYT Q 0,B0a 0100 0c0p 0`a00!3 10C1 8P<0<0< 8 0 10 唣@@p00C\ 0  "!X0 00 D3C& < 0 "!0#0 RVTi QWȂȒТ 0,B0a 01000c0` 000!2 10C1c 8P<0<0< 8F 0 10 ,@`00C\ 0  "!0 00 1C&  0 "!1  QT Q T@,00 @T 0S@@@,00L (0S $0, $4]$啛5Lq (0S $0, 7$4\$z!0 f0 0  f Q,0S,@0,0 I,@ (尡pRdtRdbbRdRd0b -LM0PS@[ 0qܑܡ܁0  0,B0a 01000c0` 000! 10C1U 8P<0<0< 88 0 10 <@`00C\ 0  "!0 00 0C&  0 "!0  QT0S 009L (0S $0, $4R\$<ؚxpRdtRdbRdbRd0b -L @M Tp,0 ^P`Q TAdAd1P  X tH$P0P0C\ 0  "!0 00 0C&  0 "!0 0 R#$ R 1 0 +10 ,(<`8`1@ @  0 0 0 ,00K(妢pRdtRdbRdRd0 -LMp`(P)](K, K@P@0K (0 ( 00(0 D@T0 (0$ ((00(0( ,00C,0((0,,00!]~,>(B. 0-LM@ KPUK0 0wPP  ,00C,0(0, b~0$P 0-LMP KP@ 00$ @,00C,0(0, <~ -LM0`S  ,KPP0 KPP#0 < # #000$@0PT   3S#PM 3S0P3G p P@ 00 ( 8 j\0K4 K @PP40pt0 pI80 00 0 00" 00$pL@PP QN ,  0R,0  PP? 4>0B%B(P\< 1 00C\ 0  "!0 00 1C&  0 "!0!0 R ,0( 0C,0,}bJ,K _PU0 (00(00,00C,00(0 ,r}@@0603 0R3( @  (00(0,00p , |3SI3SG x 6F 0 P{PP3S83S 45 50#0$pRdtRd. RdRd0@$ -LM0@( K,0 PPo( $`0A?AS ,K0!PPQ,MPPK0A?AS` 聟! 000  3Sp6@!F0pzPP 0 3S U0S3lA0 0C\ 0  "!80 00 $1C&  0 "!0 0 R000( ,00C,0((0,Pu,|I(0,  B, ((0,$,|,00C,0((0%,|pRdtRd@RdRd0 -LM `P ,KpP@  0KP@t( 8KZ4K >P@d804 D0 0040 4 弑<K, 40$  m>P@G<0 < 00<0DK<00 $ 80,0@0 P@+0SF  P@!4 (00(04,00C,04(0< (00(0<,00C,0<(0 Z,|,|R<<]@000 DJ<4U@0,0 0P Z,P~750,P@ . -L(M 0@` @Kp8 0 8 K4@ , ( @P <` p9 -LdM0DK`p  $P@8 P#PPKP !<P@0 KW>P 0Hbcdʚ; -LLM @T`PD0 H0 l p LP D` PI pKP@`P80S&@ 0 0<P@|pW- 0R)@ 0  0! dP 0P0  p 0 $@, 0Y=@0TS (ʚ; -LM@ 0)R  0S S00 哖p 0- @LT P P0S S 00S00 @S 0S00  0000 P0hh뀙0 R P0S 0-@LP0S0000hmQ -LM0 4 0 0C#q!18  `sP40 0<0 (RZLZ<@ P,K  d!^5P@)0 P,0U1W<@ P0PU,0   B A8 <E8 0 4000 (RQ PUJQ4PUZZ( (R5PU<@P0,0 ,PU@b|b -L Mp`0S 3R 0 S 0A#140  0a 00c<  80S \OKB2P   "|$P0P0C\ 0  "!D0 00 02C& ( 0 "!0"0 R$ R 1 0+10 ,(<`8`1  p 7W@ 0@40X 00P (,K , 510`K\(q 0 PE2 0s 0s u0  0@D0 00000 40 X  PXڜp0`K Z0 H 0X0C 00@00C0  B  P$00 00a\UpRdtRdbRdRd0|b -LM ROqa@0T0  0:0@T@T  ` * 00C0 0*S E @TPUh1 &O@`TP R Q@@@TPp  0S @TZ@WP7@TZ&O00$0S 0R0 @, 0 0 0, $Q \0 R0 ` < Q  0Qtbbbb0 P P P-L@p T 1S Q@T 0 S\0 R0S0` 0C#1V P`X`VP   0 S0*00 * bP-,, 0 0C0, 00C06|b -QL  ^* 0S  ^: ^# 8 R 00C000 p.0 B6C00 T0T08 . BAQ00000ӓbbbbb -@ ML$Ÿt0 @  0Q* Q:聟1 d@P1  _pC`V@vP!t0@l!0| D00 V8H0:80 8pp 8 :R00? <.0 B608 0. B600`0S 0000@tP0 S00@@ 0V 0  ?C`? 0P0 000x S 0 S<0X X000ꤙbba`ba`bbhb!Cecbbbbbgfffbbbb 0-LM 0PJ00@  @0h00600;0 ,00,0@b -LM 0`p)00P ' @TPo\0 @T!00  006000:H0 ,00,000600:0 ,00,0@b -LM00P\ \ R T0S @0@bR 80S|0T  R Xx0t000x0t0000HA6*=@!00`000A 1 00000\ qp00p0`00C\ 0  "!0 00 0C&  0 "!0 0 R00400l:X X@S=F! pRdtRd@bRdRd0 p-LM00DaP E4!41a Q0S 000000 ,0 phVphB00 000@000!@0@0C& R 00#!000 |0C& t 0 "!0P 0 R@0 00000<pRdg`|`tRdRdRd0@b0000090000000 0000000 -3cp @ 008 ; S00L;0000" 00:00R00  p0S 20S|0000000\0So8 Rft.0 B60`80 >0PŸC& 0S0 0000@00"R 0 0SAŸP 1!0Q100(Ap00C\ 0  "!0 00 1C&  0 "!0h!0 RhL<00500mo0@ 0ndo00!000) 00 .0 B600 p08 . `B000000 @\08 . LtRdpRdbbbbbbbRdRd0bbbbb-h0`0"#X0 P P0 S P\0S00 䝂Sbb -DLM88P,Å , 8 0 40 $ʃ#30aV  P0SO `V,Q, K4P,8`0C0S0 8t3`TPPPP 000HP0P0C\ 0  "!0 00 3C&  0 "!0"0 R0_;\0r S|2@ 0000 \00 # @0 0CP   "!$"000 2C& 2  00#!0! 0 R{ );y000000@0 0CP   "!x!000 d1C& X1  00#!00n`LMVP80Sg 2*r,K , 00:00,0Q ,00,00p, 880H@lHT@! d 28 , 8 800d80,<08 S< ,ł80S:S1q1!@0P00, )a@00C\ 0  "!0 00 |1C& t 0 "!0P!0 R<: , 00000@00C\ 0  "!0 00 0C&  0 "!0 0 R,0H8 H fv280, 0f80,0<, 8`00:00,9$֎bpRdtRdbRdRd0 -0L Ms吓, 0`||#|ßP0 0Q0XXß 0RCH3H#0Q= 83 Q9 ,C$#0j2P @ C\ 0  "!0 00 2C&  0 "!X2  QT` h9\2@T5PŸ`@ 0` "jP00C\@ 0  "!0 00 1C&  0 "!l1  QTs .9 00\ 0R00@P00C\ 0  "!0 00 0C&  0 "!0  Q0\h0P0T0X040@0<0d0`0l00 000 D,@8qLl,pRdRdtRdbbbb@bcbbRd0bbb -2LM 2b̒̂r  0R0K,) 0@0T0P t00|"000P00C\ 0!! < 00"C6000 "!"00 Rg00 [p0S1 00.\ KP' 00300 0008 h1. Bt!80 P>0C8100 @00000@Te 0R8K(, 408b00Pc A=9 =@ @ < <0 @0So0 P   P0 P 80L H 02U Y00  006000RU <P0T00C0  TP2,8D S< RX00S 0K4  ,0Kq1P,~ 0\  X0Z00S03 0Q0 \xZ 04  00P@000, T UP U 02 ,00,0D0 T0 8S{<Rw4 Pr 0K,0K4 "1Ph,~e 0\  0Z'00S03 0Q0 @\@  DP@0KP P@40PFP 04D @00P 0 \0W R0 0 S 0!0 @0K@P 40DP Qv0Wp R0 0S0!0 g000 6000 ,00,0;@b -LM` LUpT`FVW 0 pCT00 p0000  c00p M +>C0 @0L0$^, 0 P0L0, @\ 0 ( 80@S  HQ a,T0 ,00 ,, 0 00^ 06000 0A ڛ00:00,^^ , 00L @0 00X +C -LMPQ@p`0  0008 0@0TpX 00@00@ Tp -LMpL00  L H0AP4q ` @ H+80Y080004;00 r07 SRX 00S*0S$R"*r X00St0 0 0SRr sus0suu0sXR0S0 uq000 0scg` -LM 0R ) 0 `R 0 4 Pp`0@  ( P0S@ 0R 0@ 0 R@0  0-L @\ P( ^,0,0,00(, 00._ \0 -L,M,0$ 000 `P 0S 0+P@ R@@T {000 0pCW :0S/S W0g 0c #0% %0 0 R2  0 /R @00@0T0S P@s f 020("S\ 0S0 0U0SpLP0K P@KH0 @00HK00 4 ,P Pp L D 8 (P@380[c  R?@# *\0× 0000/S @0 !zpR z00zz ?yp>@ '( ;0 pbzd^zPZzpGWc:0/S Y0+6 y)bb -LM$P$ 0` 0#40 @` Rp8  Q R 4` 00  ( @d0 < %, 0 /S k  , $6R  /R  2R0 /R, KR, ,0 lR ?`i00b0 /R076 00S09940S009900900S 0:00  0T (5 T <0 0  0@ T0@@00@0 c%00@060 %P`8 P<0 T0@  0@ 0T @ 0@00< @0<%0v 00`<QT0@  ` @00@0< R R0 i7ã000b0 0 i00 `0 R090@8 R^ RL R ` 00f100CS6< R5T0@ 180S, T0@  `2"0S J@0S E &P  @00@08Q   &*20S 0 0 i 0 ( |X   0 0S  8 R|X   &00K `V0@@ @ @@@00@0q 0.S0.S0:, 0/S  0b0i007, 0/S 0 b0b080S` 0S8 0Q0R00S`@090?b @ -LM80@0 p,0  $ `0SdV 0 R G$PP p _00ZT0@  P0  @00@00`0CS ZT0@ ,0S T0@ 0 @00@0,0S 0  %A0@ < RP 7 % d~x -@ MLll 0dPuX0X @T0@P@LLL L0@@@@h - ccc`ccccc Q-L Q ^ Ȍ 4P0 x4+4 -1LM` 1V@p |P $`VV }:8P@}ͱ0 P30 P ` 0@0 P0 00@0$(0@0 J/Y 0H@T2 @b -|0LM0Sh0@T 0S$@TP0 $ `T2 H- P h0S Pl 0Rc p-L M 0@004h0l0 S000t ` 044 P 0  PK P 0 0 0 0h0p|``c0S  0"S  L00 \ @0D0<0804000,0(0H0$0000 00 -LMăS@40 3T,0äs0Ŝ3`0  T , tC RRhC R 0SK PC`00C\ 0  "!0 00 3C&  0 "!0"0 R#_uPᷰ 000@8@@"0@2,040040P0@0@@'PR <0 3 >"P0 XPUA`00C\ 0  "!0 00 1C&  0 "!0|!0 Rt|40P'U @0S=XQ\0\0\00X\ AH00H0`00C\ 0  "!0 00 0C&  0 "!0 0 R 80S ,0|0<0iB'LD?|c `@bpRdtRdccRdRd0cԛܛT0S ` Rd0d0d0 QT0` S`00d d  -PL`Mu 0Kp d P0@0  P8p 0P 0 P Pc -LM800CSh2h"p2?0P`@T | 0VW @T$r$$2  0 S |000@ 00C\ 0  "!0 00 1C&  0 "!0!0 R|0p `| T0|0| p|0pP < +< <0;<03|& 5|8 80S@0S&  4PT Y80S  "  ⨐ 0p M140 840 )n@bcpRdbtRdRdRd0ԛ -LM@<0PX p   <<00!GWH @00Q00S< !000L RR X R\ X1J \0\0\0Ha H0 0H000C\ 0  "!0 00 0C&  0 "!0 0 R@0@0 $ PP @ 0X0 BR00S@ % X X R\ $0pRdtRdcRdRd0cp@-8!8AP000H L81P \H 0 0X0 X\ 0`P00C\ 0  "!0 00 0C&  0 "!0d 0 Rpp@_%0SX0 X0X0\00\tRdpRdccRdRd0 -LM@0H 0CS@@0  h! y!@0S h@b 0-l0@ P BR@ L@P 0{0S8 0hpX!@0S0hl@b -H0 L R@0SXP^\0\ D0\0 X\ 0X0 X\ 0L 0L0cc -`LPp @T T0S`@P T -LM 0P@  <0 D0S 80S @0S 000 800CS0 4 v@bc -L M@0 K  0 @ Pt -L M@P@U0@0<0`p48<,<0 W`<U5 V-  P#U @00CS@0L0S0t 4  @3#<0, 0< <<0ijW\Ey 0  0u 4cL -L@\ 0@b -LM<0@\ <<0#04U zT0S800CS}|\ y 0S00 S | 0S SPx0Q0 0ccT3 tc-|0S<0  0 R | 0 S  R8 80R0S -LM\P\@@0  0`004P ㍮ 4 @0 <@0\fd010@ v0`p X\ P@( \0R\0ń0d R>@!T@ 0\ 0   0V0P@@T@ 0004P M0401&10 R 0S  R 0\7@ \ $ \` aP@d0 Rd00Dzb -LM@0  010 p-LMP!`@4T  (000`VPZpx p-LM0`@P  0p80P@0<@0@0<@00 0-@0L @P R  01 R P 0\ 0@0  0-LP@P P 0S  :P @  0S 0@ 0S 0 @  -LM⨠`p@T  0P R0 U@X LwY @w ' P  w@bcĝ -0LM @000C& R 00#!000 0C&  0 "!0t 0 Rdv`0` R 0SDDhv= tRdpRdRdRd0Pbb -1L M 1R ,   ȁ đ0 !0p!c1QtPEU:a0 10S00p0tPEU*W , R 00 000 "0 'R@$pv1@ 000^00000@0@0C& R 00#!000 0C&  0 "!0 0 Rp ZXH,0SD2v1@bb'hba`pRd 0DtRdRdRd00@-QMP0 @-PT \ ,P^Ѝ0Ѝ0@AIdb,3 -LMA\-P   -LM@pPp `pPH00H0 0PPp0S P- L p00Csp0 H Sp HhQs -LMP`p`dd5 000hP V P0SR @R VP P0S00<000000  Z00:00U@4T0 0C\ 0 !  0`$C600T$0  "!04$0 RrT005000#0rOP@ S0 0C\ 0 !  0|#C600p#0  "!0P#0 RlQ  V P0S4RrVQP  s2B0 0C\ 0  "!0 00 2C& | 0 "!0X"0 R R P0S R P0S/1 00! @00!l0S㴑> 1娑@00C\ 0  "!l0 00 \1C& T 0 "!00!0 R@0 $P@0 0@00p Rl0S u@00C\ 0  "!t0 00 d0C& \ 0 "!008  Q WUpRdtRdRdRd04@X -LMr嬒P 000l@T 00 ` @RZ3 0X" a80S@ 0 @0P@|PU  00S(K T|PUT M`0 @T(`,G 0-LHM D040 X \ 8 0 \KP7P@ 0L00 -LHM`Ppw.@TdK   D0`@ @@ d <0 8P P@  0ST0 0WUT@00@0T  p-LM`PP@ P@8 0R@  p P@P  -LM@(p % KK PP 6 00 `  @0 0 P \ P p  000 kK  PP PP \ R0 P\ PP uP % 0@0 \܀ 000 $#  0K⤐K0 )K9KK  @0@T 0 @PP' P2 090@T4 0 0 0  P T0@ P80SP _ PP  # @Kd  p0K 0PP  0 (00(0 ,00C,0(0v ,Fs 3 c -LlMp0`$0 @J-PUK $0 S $L D0P dP `0 \@ P@KUx@2T0h0T 8K0$PU GHbp -LMC0,0 pP-P@ 00  l( $K KZP@` H`K P@pjPF@ 0@K K P@p 80S-@ 20S 80S@  P@ 0 P@   L0 @Kl - `d p`K 0 P@i 0 P@` D0p0D000 p0! 0$3  X0K``K0 $K4K DK @0@0 @>P@  a,0 S ,K  090  @ (00(0 ,00C,0(0$,E0S$  P  0- P@DHbc3 | -LMԀ0p$0 `+P@ $0 S $K@PK P@tPF 08K K P@PK  @Tp Hb -LsMp0`$0 P+P $0 S $VKzOK dP9P@F 0K{/K PsKT@0 P@048j/1 Hb -LMP`+P@0 R`0K@ 0 尠 嬐 ` 'P@pW@ K P FW]Yd KϞ 20:#: Q0 D - % Q @T0 0 X PK 7P@ K K0K @00  Q   Q㌐ 0c p-LM0P@0  0K 0  @ P0|`KSd t 0|0 00:#:x0 0Z K K0 pKD 0R pc -LHMd@Kp `@0<0 ` d @ 8` {PU%T@80Q0 `P @ <0 d 8` jPPT R0P  0 0 @ KP P@KP P T0R rTP -LMP`,^p0+4@TK&0 @  ` 0 "P@0@KSd ٝ 20;;|0 0 0K Kpw @L-_K 0R "@97bc p-LLM0P `K`80 \ ` <` 4P P@'P0S80L<K{ LP0P PPp 0 L0 LP< K pL* L0S p -LhM`0@PPJ 0SE$8 RA 0RppS, S W0SSK 0 PWlKlK0@T0@W0@T  -LLM0 `pP/00  0pK0 D0H0 l p L Dp P@`Q `l`@` P@0 E @  -LM` PD0K0  P pKP@ 0 @T0)0S<@ p ,0 -LM` P0K0  P pKP@ 0 @T0(0S<@ p 0 p-LLMD0``K@80 \ ` 4 < rPP  pP PP -LtM`0Kh0  l d` TPP pHK80SP u08 0b00K @@KH0 D 0 4P 0P ,` 8 P -LM` P@0K0  P P@ p0 0  T0@ @0s# M(P㄀K|d Ὓ0@0 0w @0儀K 0[ P@00CS@c -LlMP` KpP@  0$p 0}  T0S @0@0s/ (P㄀Kd p0@0 0* @  0,  B, (0 ,6A0儀K 0 P@00CS@c -LM0P#Q` K  @00   ` oP@0  p  p 0T0儀K@@Pd   0:#:0 0@c -LhM0`#88SP; KP@  0$p 0 T0S @0@@Kd ٚ0:#:|0 0@  0,  B, (0,@c -LM` P@0K0  P P@ p0 0 T0@ @)0s, 'P0 R 0儀K 02P@0KT@hd v 0x0 @ t 0-@@㄀K0s,3 c -LM 0PK`0 0 0 P P@ p0 07 NT0@ @)0s, &P0 R 0儀K 0P@0KT@hd  0x0 @ t 0@x@㄀K0s,3 c -LlMP` KP@ 0$p 0 T0@ @)0s8 e&P0 R, 0儀K 0P@0KT@d ę 0x0 @ t 0{@ 0,  B, (0 ,?@㄀K0s,3 c -LMpKP`Td 㔙P@,@K 0K40040  @0K0  ` P@ P0 0g ~T0@ @ (0 "c1, ah $ 1d0 \ ` 0@,K P@,0s0,0 $0s0$0 c -LxMpK`Ptd 4PH,@K 0K40040  KP@  0$` 0  #T0S @0@(0 "c1, ah $ 1d0 \ ` 0@ 0,  B, (0 ,>,K P@,0s0,0 $0s0$0 c -LMpP @0K0  P P@0 `  80@S @T0 匀K D@T@d  p0K 0U@c -LlM`P K`P@,0  X "00  @$P0 0c z80S@ P@  ,00C,0(0,.>@K4d Kh0K0 0@c -LM` KPPx p  0$@: 0 m PD ,00C,0 (0, = -LM0"P`D0 hK0@ d0 h <` @P@AX18!Q K0@ 0 ` .P@]PpU 80SQ 80S@ X@X@T$ KW @U=DKTTRPN |0Y`P4*Yt@=0 0TP 0 0U A0 0@KTXD K0@@80S@DKTtT ,,b p-LM0 `P0 K0 0  P P@@T|@Kd g0|0   ++x N0K KP@ pK1P pc -LHM0`@0 0dK< `0 d 8` jP@ TP8pWP@ @K PP PP@ <0@@T0 00 0PT@ K@ -L`M0pSH KP\ gH0 Y $0X0 X80SHQPPP0K P @ 4 L D0 ,P 0P ( H<`K `0  T0KDKXPPH0\ 0X \P6 40R4 P0 40RX<0 T @0   X @00@0XH $H0 0 `KI04 H0b0\ ,00C,0H(0\,\P <00<0 0-LDPLD@0 -L,MpP`@3 @0K0D0 0P KUH P` 8@ 40 L@ 0P , HK 0# @R800 Y   g8 P00R00S@HK 0 = -LM$Pp@`0  (08 R 0,    ,  l P` ` , -LM$`@8 RpP. PT0S @0 P0    0 p,   ,000c P$ -LtM0 K@ZP@x0t 0 800C S6ꌄ T d t ) @ K@$;DL  p@K8P|`DphHd K \0K(T K0@ P@`pHL P  090 @J@   *09@J -LpM$@P8`ApQ , , 1U 1U 00S 0 p(0 K0P l00b0 0 pT0PU $! 0P @@00@0|$!f@zfat $  -LM@`@@p< H 0X <p6H Pꤟ-$ 0 C$ -$ LM  40K4 -L(M    40 K@4 -L,M   0 40 Kl4 -L,M   0 40 K4 -L,M   0 40 K4 -L,M   0 40 K4 -L,M   0 40 K5 -L,M   0 40 KH5 -L,M   0 40 Kt5 -L,M   0 40 K5 -L,M   0 40 K5 -L,M   0 40 K5 -L M8 0  0 $  0 ( 40 (K$6 -L(M    40 KP6 -L$M   40 K|6 -L$M   40 K6 -L,M   0 40 K6 -L(M    40 K7 -L(M    40 K47 -L M8 0  0 $  0 ( 40 (Kl7 -L,M   0 40 K7 -L(M    40 K7 -LM00 0  0 $ 40 $K7 -L M8 0  0 $  0 ( 40 (K 8 -L(M    40 KL8 -L$M   40 Kx8 -L$M   40 K8 -L$M   40 K8 -L(M    40 K8 -L(M    40 K(9 -LM00 0  0 $ 40 $KT9 -$ LM  40K9 -L(M    40 K9 -LM00 0  0 $ 40 $K9 -L$M   40 K: -L(M    40 K0: -L M0 08 0  0 ( $ 0 , 40 ,K\: -L M8 0  0 $  0 ( 40 (K: -LM \  40K: -LM \  40K:  00 -LM@P0< W봡 -LPWġ -LM@P 0 04 0$6  p-LM P\0`S {P5 00;00 @000@0@0C& R 00#!000 l0C& d 0 "!0@ 0 RpVph_pRdtRdRdRd0 0-0@(P0 L 0)0S 04 08 -LM@P  - LYء  -LW p-LM<0@ ` P`<<00 P(3<0 p -0 L c 00 -L M`|@Td  00S0R  00 0 0SP" 0S8   PU  PU  "0"F P2 PU 0 z  0x"FP2`P U0 Q«40  Q 4Q1p  0 S @00g ȡp00C\ 0  "!0 00 1C& x 0 "!0T!0 R?|@,K 0PPp a0|0,000K0 PP ,卡M|p0000,lPP  00, ,0 0000s,q1| A@pRdtRd`bRdRd0 -LMP@0| S`p 0 0<0J  0 PL( 0 0#U<0 00| R#PP -LM 0| `P0<p0    0 @  00<0 -L4M0@^ 0 0| @K 0rP0 |0@K $rP0~f p-L4M@P A|0HK0 `|0 R$ |0 `A 0HK| \$ p drP _rP - L  Q00Q00 -`|PLU@ps 0 00CS0h 0 00CS 0] 0S 0S Wbp_TAT1T 0 b<1`B&! 02 S61b1 R0PP00PP0 0C\ 0  "!0 00 0C&  0 "!0t 0 R0|0pRdbtRdbbRdRd0 -pL|@TJ 4Q414 ` 0 b1B&! 02 S71b1 R0@@00@@`00C\ 0  "!0 00 0C& | 0 "!0X 0 R0|0ChpRdbtRdbbRdRd0 -LM@,V (V |0 V,0S S  (00S 0 < - -LTT@-| q  qL@H0 800@< $  2 02$ 0|= > N<0H4 0S  R80 Qxr`|`g`hdx p-LM0@| 8 P1 0Qa Qp` 1n\a D0!n1 R 0 p0SpPxr`g` - L80S 0E|0 0 1xr` -0L| 0 !001$ (xr` -LM, 80S; P 000l@T a00 6 R@,  0S) AP00C\ 0  "!X0 00 H1C& @ 0 "!0!0 RY 0b00. B00p000P00C\ 0!!  0l C6000 "!0@ 0 R@! !PpRdtRdRdRd0 0-@Lp0EPS 800S(0!e10bg`  Q00Q00 R00 -L MP`8|0Q p* QLP P<0  '40 0!*0 0S $1 U0$!0 0  @ 0@@ X P<0  '$  0!b1* Oxr`g` -0L| "88 #$~QТ00CS   < < $ 0 <  400 0 < 0 -L M@|  0 P@  -LGOG-p堑`aN`M\0[ xx1&V1d1后ETX1""ᓆ L"b l A N AD%X$1U`; P ! 10UPc "*0P  00U: QPc0 20\00{.L B40Zx000\ | 0Q0Sd00@a00Ѝ8 cųE.ccnm`xck_k P-LPp>;T!52c~HaȀ2ca10 0\რ+ <@4TP *[O[O @@R: 0``( AP*0 P@:00@C "b"b0#l00X d2111H"c#b1 `130$bPQccx` @-0PSpU0 0 000@ S  p`U 0 0R0@0 Sb0 S .000@ S  LpL`U 0 0R0@0 S00E-` M@p 0 0 \0 0.\T.0V0 Ѝ.\ D\ 0 S.S\Z\RP J0 S .S RP \ZUv R0`@e@c\ 0  0S Wpp0S 00Np ^\\pPEP*0  0S Wpp0S 00Np^00P0#02SPp3^_000S00W V @V^P 6!10F000nR^`VL 0 S 0n0 lS0d~0^ 0*0^ 0:bP0u S .S PR y0.STWVM0@-P| U@B .U@ 01 c0 C  0 R0Z  0  01 PJ0 R0Z PJ0 R0Z P J0 R0ZP0@0000  0@000|@ S .S A-@pP@  0Xx= ?0 1 C@nT0 7#30 T00SP-@T`,J 0P$0S!^Z@TJ 0P0S^Z@TJ 0P0S^Z0S0S p@-@?\00\0AS`P?@01 P0 0RPu2 0?0 1#0C0 R0; /R0 0S"QZ0 R0( /R" ^ 0SQZ@0 R0 /R 0SQZpp@Np00a0C0p00Np00a0C00a 0C 03  QZQ p R .RAQQ 0Ғ?AcON -,0L;0 0 cc -0LM0吐pP`,0 ࢂx 0  AT 0U @ 0V0W,0S  , P@bcc@- @  0 201 R 0\ R R  0^0T,0S cc0S R00  -LMt<0 L4Qp0@0 <  PP4 ,0KOP@C3`  0 S P00 s`00C\ 0  "!0 00 |3C& t 0 "!0P#0 R@!08(#@>,0P, @ @4@00 E@ ,YP@ ,T 0 0Z ,0t t0sn 4K  00K P@ \4 Q40 h 40 i 4 0464 0464 0464 0474 0474 0t4 04 84K,0 0庫P140PH@ `0T*^ 0p ^ r0S 0P4 H0 @0T `: rP40P 4ެ4ڬPP\ -L M$ ( h0 pe h0b t t0RpF R` 0`t0sY h0S t@\ T0D0bD` $K0RPp,$H0 P >  ~rP7t0 qD0 4Ht0T$p T q! (0 $催 (0K$p Pp( $\ W (0SD9@ f<0T$p<0R\h -LMQ@p``#T\P 0@30e^X05< 070 0`PP X 0X H +00\T D a0N 0-LM P0@0  @0 -LM,0$P0C0`p,0 P(K,KT PE5 0P@40K(, 0圪P@-0X0H0 R $0U  P 0 PE AX0 0S 0P@ 0X 00U00S«0快 -LM00<0 8 @ 80 @0jPG 0K , K0uPp9<04K,0 0APp*40H@ `0T*PU  0 @ H0 `0T: |W@ XqP 404pk4gP@\ -LM0p`P(K,K 0 P@(0K(, 0P00,H 0R *@T T 0S H0 0R:*P' # -LM⤐Kp  | PgP@@  0S   0@T8@0@-@T2PQ @0(0$ ,?P@|`80S|0" 0Q}0 Q @0 LM0  0P@ G @0U 0V@ ROT40 08  0,0000 05t0s/ KP@  0@*P000@KY 0صZa p0Y εZap | ~t00 03@ KxZ 0 Q10R`\ j0  0P@  ro m|` -LDM|` p< rPPH P8 V5 60@ 0@@P =U @00D0  0PPx04 8 5 @0 K0pPP0 ,0(H  P 0崠 OP|0@@4PD 0R p80S P8;A<귩 ZS4K,0VPP4 00;00040H@8 Fo8 P0 $@ ! 041   042 0 $" 04400 $" 042 $ x0 1QS 2S2?S8 "QL  0488<,0 0$(,0 8Q8P 020%L Rc840S_0 4SZ82 t0  048<840 048 00020x08 t \ 6 8tp\ 5 @Q? 0A<8 H0P70@40\T 0 Hq@T,0X P&@8,0!4@  8L0HX,024 80\p8 84 0@` $QP08<@@Oq8@D@@8 @D00cEq`08 p0HL x0 3P Z Z 83 \0 8 t0h3\@Q8 808h0h08hq8 ls8@ 1@\0BX0` s8@` 0RT4剨08 40 xQ 4K+0'PP40H@ WnP2 80x04m040 8 <L v80<`8PP@08010DQ8 80010d08 0<h l |0y nP nP nP{/l0h!d 4 88<|020C8Sa81 \0 t0a\0S^1R80 \0 t0R80  t0\0 I8" 4!0` 4` #,$ 88<<0D& %0Q4x0P 0 840,0hbhd00 -@L pP`0 A|`PQW`J<;@0 :@0! -LM0K"@P0   p-LM@`0P0` ` H0 0P T P0Z 0H0T` qZ qB| ~q D lp p-LM80@SP0 0<l0S 0\S `V p 00S0 y׾ -LMQ`0(  $0 ,` d0@Sph, K 0STL D 0xP$  N$8  -LM0@ 0K-P0 00  0000   0-@P L@'P00 4 0 0 -LM䑟0 ,0 @`t0 pS$ x0RP#N*K il\ KPPC00 K0 !P0 PK  DP @P 0  < 0 0/&00  K0]PP0   0  ,0 S ,1p1LKN KO0KJK00FKH KP0[ 0P0KHb̤b -LM 0@1νb p-L M@0@SpPP `K70 000 0  0 00lj i000n00rp h0 0h0 -LM 0hh0`0  0 $  10 !   0Rm -L M00PKp00 000 0 00000h t` Pt0s<h0($200 h0 0 !1@00#!  "  000 ` 000 0PH` x0 @000 (8 Dh0@ 8D000L` $ 0x0X 00@ 800(0 pi 80kx0S1\T \D<0L aP` 1 E,$P` lj i00r0n0j0rp h0 0h0Zm -LMP@0S` p0s 0s0s$0sH0sL0L s0s@0s 0s0s80St 0ql  0P(0s] 0 0R P \00 P 00 (0s (n0W00s 0rp 0Oh0 0 h0 p 00 Q dPh0h000h00 00Dp 00 Q NPDh0h0 0 0h00 00h00s0s -L,M@D 0尀S0`e 0Sh0إ0<0 x0 R0S}*T 'n, P@X0` 0@0 @ lx0Q1!< 0`Z!RR\ T00b380   RT2 \` a4KD0,0@04`0@ 0b SP1 P!T@0H A@4#T0SU<\D T0@  000Tx0 S\` a` 4KD80K ¢0K, K0P@4K,0 0哢@ -L ᤞP.\ K P'@ PK K 0@ PKD @ P PP0  0  0 ,0S ,* *;[0 [ 740w 5 <0QLKN KO0K0O0 JK0F0FKH KP0[ 0P0K6Hb? b -LMP` V$ P 0@ B`TᡶP`%ᕶ 0 @`ᡶᅶ -LM@ y- -hLWMH 0 ,0 `! `A L! h0\! 0d h! l! p  KKdd!0t1 P 0@ 0 7 ,0S ,dA `H0T SI 20 Pl1 P P\'P80BPWP7`   Rh! 00 w`00C\ 0  "!0 00 6C&  0 "!0&0 R{H!hA0@Hl `1t 1R2X1  t0s dpW \=K/=KT Xh`\A`PXd`0x a0`Wp!\P E\ p1K`N/KO?K PL 9QK8@!0ڜPL D@1@ H0bP!S0!Px1 0U*0S S0p1  Q @pA 8 H Px1  @ 0 PU:dA0SpHA R0l0l0t!d0TA00`MKx XxQH0 0LPH0 t0 pĂ0 4ȌD \p<3 (K 4 \p\- KK /A?(KA/(@K0K0000d0 Sp! :MK PL h1S lAh@D 0lA T0h DD吝A?( K K?K 0 48<S<1ST \D a0C<X1`p 1HF,`$`d2 (@K 0Kp!MKp DUr\/=KQ<0R0@ @@ S\A RrWnKA_t0 s<041 14 (KW 3 W) (K00000d!0S:MK>PL @ 0h1S lA@DlA Th1 pWڬ @0@ MK 0(KKK,0h@(0KKK,@h W @PD P  P?  P< P Pp  P5h  P2PX P-P P*HbbpRdtRdRdRd0XbxbbXbb8bb 08   08 08 0-LM0 P\0@ 0  ^ \  \ T bQ P] 0 -LM`P\ p80@0CS\TP0\@ | | 0L!D0400A0!P000冡P0P0C\ 0  "!0 00 0C&  0 "!0 0 R00T \T0`\pP0T0T|pH<aT@ -: pRdtRdRdRd0 0-0L@Pt 0@/[ 0"P  0 0.$/0鼥 0-LM 0Px @ 4000  B00Rx; p; p; <; \; p; x; ; 0     ;0 0 0-預@0 @$0 @ M! "Y lpb"`0%&&/@&0O% & "!! @!0P @`! ЍCCX8^n좙N -LM, 0 40 Q@ p@ h@ h@ h@ h@ h@ @ < @ @ @ h@ h@ @ 08 4 0, p Wcܣ@ 00"0%@0@0C\P 0  "!0 00 t3C& l 0 "!0H#0 RU8 01 00000!C \! 0  "!0 00 2C&  0 "!0"0 R| $00   8 0bW0?@ 0(0"0<%$@0@0C \ 0  "!0 00 1C&  0 "!|1  Q;$ R 1 0+10 ,( `0Kq:070A4 p0.0 c+0\ 0@$0  g\ 000S 08< 4 Ud Kd0S 0 0\0S0 āUh K \P*U 0 P: cR 0P*0 =X0\*W \*0 RUil K>l000} 0 RUUp Klp0w x0P:UD 0 P: cR 0P:0 ~ | `0Kx `0Kqt0àqǠo0<àl<ǠjhpfldbP07*0q[U 0 P: cR 0P* 00A S@-@**\ *!00S m m Ln Ln dn n n n 00@S S SX!0S * R:!0R0SS `S0SS 0@S S S 0SP `S PSpS S0  Q Q Q00S*00S:00*S:0Q @QA - @LM h` -LM│"Q0划,0 0Px0 hh 0 R1S D2 R 0 R0!R0r40S 0S 0R+ȑ\ 000R00R00 A  `TPId1 `1A` r`TP31`00 00 B R0 000C S<@K  Y0Q R0 0  R '0 ,0S ,j 8X  1X 0\0w $(A HbA A $A A bp -LM,1SA PWI0Z0J0@(@`  p(@S000 (W0I$H00` q l0R0 000  0,AV@ @@ p `F0V $A ȅ p-0LM` 1PS. 0@0 00O0,1@0@0C& R 00#!t000 `0C& X 0 "!04 0 RpphH$A pRdtRdRdRd0 p-0PLM `@0T00 3@T@`00C\ 0  "!t0 00 `0C& X 0 "!04 0 RpphtRdpRdlcRdRd0 -1qLM 0`00R0PU ,0S+PU@00C\ 0  "!0 00 x0C& p 0 "!0L 0 Ri@A0tRdpRdbRdRd0 p-0LM0`PS@ P00  `PP  0`S00@ ph A tclc p-0LM0`PS@ 00P  `0SD0 `0`00 @ph UA tclc -L M<0S 0 0 4L PT# -"䂟 0L00$40+S$2"0 2"`0 rPAT  (#P P!U.XPH R0 420  0 PB B R0000 0 0S^ 4 P  PQ QE0$ $01\1@T 0 R 010Q.@TA<%0 0C\ 0  "!0 00 0C&  0 "!0 0 Rm< R@0@ h0@0 < @0 [tRdpRd0 cx C c(dlc$A bRdRd0 c -PLQp` 0@S` TV@0@S0 0C0` X000 0-LMK@gPU 0S  0 -L@PPpD P`=  R8 4@ P 0009P0P0C\ 0  "!0 00 x0C& p 0 "!0L 0 R -pRdtRdRdRd0 -0LSp` 00C S `0gS0S0 C RV> PgU; 0S8 U0S6 0@T T0S  @TTPT UP\ x 1`?Bc00L` S g0 U R0PC\XP0S A gfff, ,00S0 000A hc Q00 00C0hc -LMЀ`0 V$0  " P0 @PPPTU 4pK U 5P`PU@00T00S$0 S $HbhcA  -LM0@S  NP, " 00ahԁ  Q 00 p-0LM`PV @T 0  R @T`Vp OP 4 0S 0 S OPplc p-0LM`PV 4 @T 0 R @T`Vp0S OPplc -LMX- 0pW @T 0S @TpW PU 0`\ *0 0#\:Z P  P 00 P$0  Q 0 lc A (A $A H0Q P 0 RPQlc -pL W`4 @T 0S @T XR 4 /OP Q 'OP0PP*0 0#P:P P-L`Pp @@T Q P P@ @ 0S0C 0 @@ 00\ 0 $0\   ȅ 0-4P0L4} @T ]S@TQ 0 S00 00C0;V0h! -LM4@04Y!h! 0-@PTL @VT00000 -(1(Q(! `@0T0L0p $4R0C/@T@`00C\ 0  "!0 00 0C&  0 "!0l 0 R\0hhF(40S tRdpRdlcRdRd0 0-@0L@PT NP @T00lc -L`TM , VP 7V 6V:FV6V Pp) 6$Vt U6V< 6V66V*6VZ 6VN \I p  0 $t0"   6 ,0S (,:F&P000P0P0C\ 0  "!0 00 5C&  0 "!0%0 R -eP0P0 \P4w D  %q< 00\4   D$P 000P0P0C\ 0  "!h0 00 T4C& L 0 "!0($0 R4=C#P 000dP0P0C\ 0  "!0 00 3C& | 0 "!0X#0 R4 P-0Sd  V2V0 *2V 2VPVPNPlPKp0K@ ^P@ @ L@ R82V42P{L@P0S  L0S Z1V1V*1V 1V!1V|1D H⋏P00X1V L1V D1Vl@K@ /Rp0K@ L01Vj 1Vfa /PV -&{Hbi$iyi zi xi Jii 2i Ii 1i i i ЦpRdtRdRdRd0qi$i i$Fi@FixHi Gi i i i 5i i$~i i 6i(Ki -L,M!P P0U,0  1 X 0S P @0@ 0RPCT PXP0Pl1 ,0S `,kP0pD1XU.LK  3P 0S7 U@` 0S<Kc$ PU ێZ 00pZ@ PETUXUP0 0eP  0 忎P p෎<KK 㮎P PE p Hblcئ -LM@Q 0 S00 00C0S -LMPU` KP4 PU  PP/ p@T KP( @T P@  Q000  0@0000  P j Ttc p-LM@`TP KP @TpT  R0000 0 00CS00 R 0000  01.ptc -LM⼀ 0R$0 0@T 00@T$0 S p$W@`TP 4pKV `FP ֍PP@THb -L$M@0Q0  $2 000S00 0 S h <44P2K4 K 000CS00ʴ4<44 Hbi  -L$MpA@ATDp Hp @ P2p Z  R`S 40 40 \0Sx `40q  TQ 6 R*VAp@p@ RƠ ̘ \ 4PK  @0P P 1  4  "KH R 0@  1  80S $00c~  RZu 1000@*K  LN HND0 S<Km@NXTX4@    0QC000S蠉p0 00p0x0 0x04  젉 p) c@00C\ 0  "!0 00 3C&  0 "!0`#0 R  4Q0c00@00C\7p7p S~ 0 B0 0 }  0h0h$0C0C  ^PU"0RH N@@4PK M@BKN0 R 0S0S 4PK M4p  40[1#$0$)!0QPH 1(  80S $00c H AQH H R 1000H0 @uMm qM SH B 0 0 0H0H  0c0a$0C0C@04PK  PjaP02K  /p@0D0 @0 <K@BM`0c\`PApo 40@ZP80`0CP80mpabpRdtRdRdRd0ʚ; p-LM@`PS ph -LMp`@ 0$   R \ 0S  R\  HPo  HP11<<1t00t0 l000l0!!48< #X4 ,6U5  UO 6U00SF0SA0S> 5R: R1 00C B 0 !  80S$00c  YP@T 1000 L S0 0C 0 0d0d$0C0Cb:S iO$t000df4P0   0Sn P00C\ 0  "!l0 00 X4C& P 0 "!0,$0 RFT `000 0R1000S@0@0@0`00C\ 0  "!0 00 t3C& l 0 "!<3H  Qr i黾000BO0S꯾000 00 +2UK 2U"r040|b҅x2P0   0S) PP00C\ 0  "!0 00 2C&  0 "!0!0 RQj`000 00 ܾ4i 4H!Hq0704a倅01P0   0S) P00C\ 0  "!0 00 0C&  0 "!0 0 RP000 00 劾m GPt ,A TSdpRdtRdPSdRdRd0 c5݆(dC @-@@:@0\#" 00  @Z00`4A 0-m/0LP@0 IL0 HJP,I 0mJ0140 0h#00@0  8000E  /n?@L0p  -LM!@R \0700!R\@-@ *,  0!\ "0! ":@-^p`*#!^ ",!1 #:  0-0LSP@/ S /0 J J0S0S 0S0S0S 3000  00 00l dJd0ST \JL 0^ 0 000  0 QA WA EA KA -t4LpM P00`K8K0p 0P@) 0dP00C\ 0  "!0 00 3C&  0 "!0#0 Rü00[ 80[A)lCP00C\ 0  "!80 00 $3C&  0 "!0"0 R钼T 9 E0S   @EP0xb00P00C\ 0  "!<0 00 (2C&  0 "!0!0 R S7 P@@  I  I00 p10S!00o?A0!TA !P00C\ 0  "!0 00 1C&  0 "!0 0 R4 @P00C\ 0  "!t0 00 `0C& X 0 "!04 0 R7tRdpRdRdRd0 -t3LpsM P00`K8K0 0pP@A) ,cP00C\ 0  "!0 00 2C&  0 "!0"0 R隻T q D0S  @DP00CS0) (BP00C\ 0  "!0 00 1C&  0 "!0!0 R Y R0700dA w10C1P00C\ 0  "!0 00 1C&  0 "!0 0 R4#@P00C\ 0  "!t0 00 `0C& X 0 "!04 0 RtRdpRdRdRd0 -@LMhs`A -1QLM` 0 S @00T pq`00C\ 0  "!<0 00 (1C&  0 "!0 0 R,T( mC 0 0 L0$0 0 0 XH0J I 0@4 0 ~m @tRdpRdxbRdRd0ȁ h |c -<0LM @P0 '0|c -LCM `, @pP 4P 4U@ 4 30S`0p0`0 p Q QßSs 000 0R000`#S`0`00`010L,30p   0S_ Sp00C\ 0  "!0 00 2C&  0 "!0"0 R7X0l 0X0 l 00C\ 0  "!0 00 2C&  0 "!0!0 R ,0 S ,饹꣹000  000HAJ00C\ 0  "!0 00 0C&  0 "!0 0 R7j  dI/4I40 3A0KK<01  ^Cd1, K0X,0pS0@ T*0S! T 0 0P0P0P 00P Q 0`0^00 00 00LT@ T*0S |&   >Ppg> 00 FCac`C cC ` 0R P* 0R P: p-LM0P@S0` 0 T\ k>00 00 0P0`@p p@ç -LM0 @ pQ8 Pl@ 80080l0S 40  0p0  Z h@K@8p 0 d` , 00 0pRdctRdRdRd00c -LM@ R <0S 40 -LLM Z000 i l7Pll@0S\Pl7Tl\ 0S 0S40)  \hK@7p0Pl KhKl 8P 4` d `p \0 lP\4P@ .40 040l }l PA@0c4c8c 0-LHMT@K@X 6XX K 0P0 H 0L 40$0 P$ 0 UX 80S08X -40L `0S  - L( - p-LM`@4,PP 0 R {@PPPpPPP 804 0C80 0 R @PUpPP -LDM`@KP@`p]60 00 \ X` Tp M 0-80PSL@P 0S9 4\P/\Q# 80S0S  RQ 0 4\3P080S 0800s4QQ@4P 080 - 6LMƟ0 ş,0 0@005qW0 /  0000 0X X+ ,şE00C\ 0  "!\0 00 H5C& @ 0 "!0%0 R04P VPP l500 040d /P 0R80 4Ps,Pl 0 X0 0@ 0<0Y 8 0 P` 0S ZP8008040   8P4 40)480S4 0C80V 0S0C 0 40 `P \P 㚼@!000 _vt nN 8 0 `LL 80` 080P00 7P \P dh0 )@8 t9l47 0 70 P0 4A XZ PU 40  <@0000D R0 00+0   P` oPP PP` 0  P`  40P 4 05\P 80PS0C80&0\0` @R800C8040 ` 0Y40 0S Z000`80S080 (pRdtRdcRdRd0ccL -LM0S0C00S0C0`p00pS 0S@ 0C00W @P P帺P@ . 0 8U   8㍻\P 80S0C800\040 P\ L0P0S PSPPW@-0 @ 0Q!0P*0 00P:P:`@3 -LDMl ppX`P[ h@K@300l K80 dp ` \ 4P XP` l@T 0 80S6XV"l@T 80@ 0CR80 T@0S 0S0C 0 @P 0<0 0 S l0    @080Y0SP@ 80@ 0CR80 Z :Y3A59P @ Vp7` 0-LMPXX0  H@PP<0 8P,0 0 0鄩Dc`c  (C 0-0L PR  㣹P@0 43H 0QP  00@0(C c p-L M@PT`"  R 0 0 0 R000 0 0V  \  l0S0C0 @T R000 p,0  0uDc 0-d@LTP  tR 0 0 0 R 000 0 0  0S0C0 d@T0꼩Dc -LMd@01TP`p 0S& @TAP@ 2p`Pd00Sd 0 0d0d@ 00@@0007 R 0 0 0 R 000 0 0  0S0C0 < bDc -1LM`q1!P 0U000 @T* 0 0S% R 0 0 0 R000 0 0 \F  40S0C07 @T 0 0SPU@00C\ 0  "!0 00 0C&  0 "!0| 0 Rl0 m5T0  0vbpRdctRdDcRdRd0  -LM(@PT`p c2P: @T0S P2S& 0W0 P@ 01 7,0U0r,0  P 0@@P00 @@P08U#x 2S ,00,0 C P40 R  2S R C  -L lP 2 S R,00CS,0R00000埸 C -L MQ, 00 p`@dd7X\3P 0P00 P0@0 $P00C\ 0  "!0 00 2C&  0 "!0"0 R@10T0W00S Pt00C0 P\00C0 PD00C0 P,( 00C 000C01P 0W00d1 R Z@0T0W00S$ Z1KS000 S000 Sx000 S`\ 00 0T1 0   U0@00P00C\ 0  "!0 00 0C&  0 "!0  Q 騧ͷ0, 00ꕧa Ҷ@5pRdRdtRdbRd0c@b.1@ Rt1 < T 0S0C 0 00 0@@+4 00<0 F !9< 0pH00< 0$ <T H0ScL0`P0 SeS[L0_ Tt VT l 00C0Q00 40H;40 Ph̰.1C b`X  Lccc cC |cpC -LM@ p, D /0P`. P 0@0@P):K -02K<<04K - - P-D -0 ;0K< K< K@0,0 S ,Hb,A  -L`!P@ ]   ^00 000  00QHpS TWJ T0Q P!0Q0S5 4P  P+ `TQ 40040 R  0Q T 0 000Q 40 040T00T0P@0  m?Lj0 R -@Z0 (P@p,A bC C  -LqMPR a䑟䁟@ 0T00P 0 S00 00C000C\ 0  "!d0 00 P1C& H 0 "!1$  Q9T9 16 0 S):@ "48<S /0S@ 0 00 Q : "48<#8 S  S3PP3PP@ @C pRdtRdRdRd0 -|%LH0@0 i &PDu /9Q 0R\ 0R\Hb cȪbC Dp,A  0-LM@Q  80S0\ 0PS 0 0PP400400 -PLM R 0p0 p`P@% 40 8 A R800 R VT 80S4 0 0 H `(- -@LMHm? 0 <0  - ^ "48<S -0 000^: "48<#8 S  S p-LMP@ "48<#80CSL) L) T) `) phph-|0 R p0 h`Q0mS &0S< D*( @*00C C C cc -LM0m,0 +0P`, P 0@0@%:K *=2K00<0<<004K  * P* *0 ;0K< K< K0 ,0S ,Hb,A T -0LM`P'0 p` P@0?0| P#P@DtD P0S D ) , )3C C C  cdc -LM K P0-LL @P<ET,@@T$ <T0h7lt!8t -@LMTD )4%(!hx R  -LM@TX048 0<|<0tS  @`@TD\H @H, (08DLXd| -<0LM@0T((  zc<- -LM@, `pPD@ ( Rx 0S@K$8#8#$0$#K7K0[ D[4 3[ @[@[@3[@[0 @#[ @[@2[@@VW 0S`pcVWVX  Q`VXXu<8#H$(8#HTT2LD@D ,0S  8,,\0uPgs UP0 U00Spe $(8#HT LD0@D0DPED0 PU"J0 @@0 @@0@@ @@1!@@1@@!@1@@ PU@ ZP J0 @0@@PU@ZDP $(8#HTLD@DPUJ0PU@ZD0S $(8#HTLD@DD u0,$D!HPPlu 0g0,$g8#HPAHHb̭ح 000`c 0-P@LP  0S P 8P  0  00 0 0 0S  ` 0-lP@LP 0S P8 ЩP 00@ 0 00`< P0S  P 008㘪` --L MTP000, @"48<#hdV000Aڲ1 0S*.P0P00 0p0d 00 ZP0000! 0`d0 0`0S S + 0,0 0$,u@ RQ 00S 000*4ppY t@<TYT 0, S Z @ TY t@<TY4S  L4R R00CSd6 p6 p6 6 p6 0Se`l%300$P 0 3R3Y t@<TYT `0, S Z @ TzY t@<TY0S04S `$`##211@2`S[000,0$S 0S 000`0R 0Sh` R 0,S < R 0,SR00 0 R. 0,S < R' 0,SR! t@T  0S @T 0ST 00   00CS9 9 5 5 9 000L00,0$ 0S0R 0S R 0,S < R 0,SR00 0 R 0,S < R 0,SR t@T  0S @T 0ST  0000S :S0 0 R c ccQ -D1Dq ` L 0 4SP   4@* 00@`00C\ 0  "!0 00 0C&  0 "!0 0 Rh鍘p  @@_@ #211@,0@tRdpRdRdRd0Qc00CS,< ,< h< h< h< 04S0$ 0 \ -qL0`PSN 1圁 1P  U`  t@1P P .  b T 0@ T@d @T 00 0 "4 40i8#8#$ 0$  0!0i 00 0i0  BD31 <1.X0 ,0S ,M0  00 0P  0 0@, T00T0MTz`Hb c c -L M 0@p@A`0d` 0p0#!dP~D0 0d0  0pp  -LMKEX? B8c0@ 2c2c@2`ϠAl  8 #, E.Mb -L MQ@`*0S S 0`*xp0 p厮``P PUPPLF DF HF p-L M@PP 40`00 @K@0SL L"P808 7PpppG 0- L"48<P#HP1 T P"48<#HTQ00ADT@Q<0L@| 00 T@ RL 0hJT:<0L T0L0P0SSP@0hF F -LMp0P4`K$0 ) 4P0S L00P0 $0S $ 0@P  0 D0<0. 10 S Hb c$D  - 0L VP8F  0  t T 0S p@T 3R ,0 S ,喩5K@0 R  3Q H0S <Q H0SQ P U 4SP1pP-pT 0S0  T 0S0 R ƕT 0S00S R; 2Q5 H0S <Q/ H0SQ P) U 4S@ T  0S @T T0pT;p }1P7pw 000s 0RP@ 0 <0K; K0@K80 @Q  0DX0 6S  Q? !   @0X@8 S(!Hʌ R tK 0 Pt\ lQ L!0 b0b S0l l0 P+ P@PLXTa0l!S0S0 eR 0@P  P t0S  H!R p00bS0`cV0ڸ\ !0R00B1ǁ ɓ`F0Vʹp0t˟0p0`$; 0O ˟ 00 0 f 1S0fӲ1 Ӷ0 6Sڀ^f0 0`bVX| V000R:@_0 6 S0 0bS(30S 0R*  Đ QEp00p0VX x0@  `1S S 9A @@ 0 p9Ap0L0p0  f0 f t0S pH1 0cST0`S00   T1R60CS$ \ \ \   \  =( 00 0%00 p0 6S* S0lSD(6S1 !S! & 10cSǟ0007 Plv7 l Pot ǟR` l R ,!R 010cSڤ7bN1P| 00p A 1TQ? 62S1X xP h0  HPP| 0SB0|@0b0| P:3 0 0bS6 0CS    U 0   R  0bSQ  R  P 6 S%L00S Ƀǁ 0 0cS L0 b00CSH00 @00J-0008[P0  0Sy 6 Sv(E(U 000p07e ep000C\ 0  "!0 00 4C&  0 "!0$0 RB 0R D 0K 0  p07p000C\ 0  "!0 00 3C&  0 "!3  Q^p00p0 6S SI8C80CS p | 0 `1S S \p0 - @2A J0@d2 2La 3x2Laڞ p0 0 p0 g0Sd6Sa 0  p07p000C\ 0  "!0 00 x1C& p 0 "!P1P  QppT1 R` ^ 0p0 0$0 00| @_0X|0 xP h0  HP<0 1 L@ 0S:   4cHb( cpcHPKd`K0S S  D0@ @KG0KH@KM0\K 4Kd@KcKCK0 &Q Qw ! 0 S- 00 %0 S   0P p  DX PR101I   R D5@T2 0R #3Rʌ tK 0Y P P P  Pğ1010 Sx1010偩P 0 M@( 4 0}  0H0KGK D d0K$KcK0`0 06K]3 *P   0R00 R Qd#101 0P0 LO 0 0S00 0z  00 `]0t0 0<4(<"4!7!p00 0CP   "!p!000 \1C& P1  00#!(!00! 0 R?P 1P@ 0 000p 'p 0 0CP   "! 000 x0C& l0  00#!D 0L 0 R0Z1L/LcpRdtRdRdRd0c44 0\0!0000 SQF -LMD@@6S S6St0 R`06#L0S|h 3QAQ @QB -L$M0@S`P r 0S R 0S0S0S R 0S0s VVq 0FSqdV V` 1 R U R \F  0R:<K|  <0K[#[0$V+ P 8@<4(<"4\!, DQ 00cS10cS00 R 03PAP @P < K_Pf 0<` p}(Plm Ds Dm Z`cc -LMtŸ0pS, @`XR;0S8 P6@2P8R 0@S,RWP[ TRR TP X$ VL 00 0;P" @<4<("4\!L D R 00cS10cS \1 ,0S `,iD1 R 3PAP @P<@K0 P<0K;K` cK8P  0f0 RV @P Ġ̌.Č 0h$LPP D R 00cS10cSF(PHblm G Ds Dm t ccG t D R61 -L0Mp0<`K@ 0 f4KP X DP @0 2 @Rp00C\ 0  "!0 00 2C& | 0 "!0X"0 R  2 ,0S 0,.|B5X: @ 0 2 000 @ 040 Ap00C\ 0  "!0 00 1C& | 0 "!0X!0 R/ KB040 00 0(K 0 S S X000@@0K HKdKc@KG@K\0K  tKPo 0 `1/<1t [000x  ㏿P11<<1@D0K GKd@KH@KcK `0K@I cHbX?0@0c80 !<\ P!TP 8PtU"\@P P< 0000  <)@@@ 0S ^Y 0KK 0@RK: 0S*  #MP0@K00` ?` 0@0CO0 @ 0cßK$ $@蔴 @;4 @ 0hR !   0P` <0<@_0 S:0S* c d0S Xʨ` 0S,|(PH PP@jd R`@d@ڨ`0@S`0`Rd %d@5l0Sd ` `Sd dh ^Dhl T0! 00000' 0T @0S\sʼz ^00)00,000g,$(P@ K_<00 /<00 000s/QhhPl%l0500;0000 Sm0Sj@@ gD00K  0%P@0 @@  0P;P@  0T6Lc -LMTAP0p@` <P  \0 0P  0 -LM, Tp0 P@,0pW4 @̠0h18 80  `<`  €0<4!0}[0SW  << 0<8,04 0 P W  \P,04 0`p P<0<<0Q004qpW4(A(!P000 >P0P0C\ 0  "!0 00 0C&  0 "!0 0 R)00@0040000 0`0A\LP TccpRdtRdRdRd0 -L4M\00X `P0Kp\ H0 D 4 ,` h T00O<H$K4@ K8 L P M (% 0HK0 00 TZUe 00Td;004X08 S@ 0@ 000@0@0C\ 0  "!0 00 l4C& d 0 "!44@  Q 1)Th,T K,X0K, HK0 T W00] < H0L P0 8 0 8Q Q |#40040@ K@00HK DRT08SO$K4@ K HK7TP8h\<0l0 T0< \OPl4 0 cRlPH\ @1@!௱@l@V_ <0\ \0X 0SW U  (J000M<`P(0d@P`F0T@H/(0<0,@0KPL` 0T T0 P 0 8` 00T K400\X0KHK KOW/:ZT0S[ 00 000,E:00Z400 ZB008 @Q@@ 000(a@0@0C\ 0  "!0 00 0C&  0 "!0 0 R00Z00;00H(\P\\`0`0d000;00\娠4<0<00 000,LcpRdtRdRdRd0(@bH -02LDM(Ÿ0 S, `| 2@T| 4 @TuTs LpK I`K 0P]` 0bPT[` 0KbP`HdK sPD@dg0~<K᫰d0` `8 >4PU PPPP1@ 0@ b0B&!P0 02 S6 1b1 R000@00C\ 0  "!0 00 0C&  0 "!T0l  QUT$z48(3 cpRdtRdRdbbbRd0Դ -LM 00/t` -LlMd` 0/P@T K0 Px!Pp @T@Tw 0 n/!01?0!,U 00 0 0Z/0 0 `p Rl0@ S0R0p S"\0K  T0S$ p "T0K   0R p "  0/ 0 0 0 0V P0Sl0S \0S p  X0S0 @.9.`t`I   -LMhp -#LM0`00PpU 00pPUV $#U000 0 ឦ 0PU噣`آ2@ 00"0`"@0@0C\` 0 !2 0p"C600d"  00#!<"0D"0 RV7 012 00!000!C \! 0 !1 0!C600!  00#!l!0t!0 RL000001 0S x1@ 0(0"0` $@0@0C\ 0 !0 0 C600   00#!|0  Q$ R 1 01+00 (0,0<`8`ZXVzJ J pRdtRdbRdRd0bb -LC&  0 "!.0.0 R/W< x^0hΟ1 0l00040!C \! 0  "!0 00 =C&  0 "!-00 R$0 00  1 8P(0SS8P00 e0004p 0 0!440h<  80 S$00 00h  @ 0"0, 0[<̟@0@0C\Pl弌 0  "!0 00  00n S 000 x<4(<"4&l<4(<"4!'|, $ ,8 fQa#$,̂KQ< ʜ1 QOPࠈ R 0 0 0 R0000 0 @@ 4 0l<0h0<xt 8嫄@  0PP 00 c!0S0 !0"0c0 0"0cP 00 c! 00|3 tࠈP4K,K0KP0q4|bM kL -LDML a@8 L 0P  L,0KX@ P ,00T0 X@\ T㼠 0 dJXP0K D T0>XpQ4  T !<00P 00c<  80S U< 4KPP8K\P0<@K@PKT @ P/P X^ T<0H  @0aS0@0 0,$,!$#<Z<0X@ ^0a 3SXP400@0 00 0R 0X Rv <0<4<, 4$!< , !$@,,@0p; 0 <4<, 4$!< , !$@,,@0p;0 <400`00` 000,0 0,0 0,00,0 <4(<"4!< 0 0,yPge$00  00aU^$00 @00aU0 x(NALcpRdtRdbRdRd0b p-LlMP@8 `0BRS]0 PU !0000 PH !000<!  0 P #008 R 0 |KPL0000p0  0|KP L0R 80S 0 iP h#0  p -LM@`8PUp , T0   0 t<0<0,00㨀<0 P, -L,MT0!0 \;<P@pFUD,pK D 0DU`0 !<00P  00c<  80S U(< 0K<PP@ 04K8PK<`K P `P@ A0@K @ P@4{1@00c<  80S Uv5@ 000"8ğ@0@0C\p 0  "!0 00 4C&  0 "!dp$00 RaW8  44! 0(ğ00 0$0!C \! 0  "!0 00 3C&  0 "!#0#0 R* 00!  U00p00p 000,0 0,0 0,00,0  <4(<"4 < 0 0,w?$00  00aU_$00 @00aU1@00c<  80S 0R02@ 0$00"7@0@0C\p 0  "!0 00 1C&  0 "!0!0 RMW6 d 000 0X0!C \! 0  "!0 00 0C&  0 "!0 0 R 00!  00p00p 000,0 0, 0 0,0 0,0 ]$00  00aSt(>LcpRdtRdbRdRd0b -L MP`D0sp,  p T0@ Oqa 800CS T0@ :0 0 0 3P@ ,D  K!0 UP@ 0s , D0  7!v h0s00s 0 (0s0sp0s0s00s 8\ 0 P@(0s0s{(0sx00su0sru- -LDML TOH \HP ,@K D T0 <  L0X vX0 P L  !<00`  0 0c<  80 Sx V < 0K`P @qX\ 0s& 01  00c<  80S lnl@ 0`00"d6P~@0@0C\P 0  "!$0 00 >C&  0 "!0-0 RU5 01 000 00!C \! 0  "!\0 00 H=C& , 0 "!0-0 R 00!  00P00P 000,0 0,P0 0,,00,0 <4<("4!<0 0s 01@00c<  80S l@ 0 00"5|@0@0C\P 0  "!0 00 ;C&  0 "!0+0 RU5  000 0@0!C \! 0  "! 0 00 :C&  0 "!0*0 Rn 00!  00P00P 000,0 0,P0 0D*,00,0  <4<("4!<00s 01@00c<  80S i̩@ 0 00"<5y@0@0C\P 0  "!0 00 p9C& T 0 "!00)0 RiU5  000 00!C \! 0  "!0 00 8C&  0 "!0h(0 R5 00!  00P00P 000,0 0,P0 0',00,0 <4<("4!<00s\ u 01  00c<i  80S] tgt@ 0h00"4Xw@0@0C\P 0  "!,0 00 7C&  0 "!0&0 R*U5 01 000 00!C \! 0  "!d0 00 P6C& 4 0 "!0&0 R 00!  00P00P 000,0 0,P 0 0%,0 0,0 \0,$,!$#, <4<("4!<0(q5 (5 Q 01  00c<  80S d줟@ 000"4t@0@0C\P 0  "!0 00 4C& t 0 "!0P$0 ROU5 01 000 00!C \! 0  "!0 00 3C&  0 "!0#0 R 00!  00P00P 000,0 ,P ,0$ 0,0 (<4(<"4!<0,<4<("4!<00q] 2 Q 01@00c<  80S pbp@ 0d00"e3Tr@0@0C\P 0  "!(0 00 2C&  0 "!0!0 RwU5  000 00!C \! 0  "!`0 00 L1C& 0 0 "!0 !0 RC 00!  00P00P 000,0 ,P ,0$ 0,0 0<4(<"4!<04<4<("4!<001@00c<  80S ` LcbccpRdtRdbRd0bRd(@ 0400"2Dp@0@0C\P 0  "!p0 00 0C&  0 "!0 0 RU5  000 00!C \! 0  "!80 00 L1C& h 0 "!0!0 R 00!  00P00P 000,0 0,P0 0,  , "00P4K T08`KC&  0 "!0 /0 RLU5 01 000 0L0!C \! 0  "!0 00 ?C&  0 "!0\/0 R 00!  00P00P 000,0 0,P0 0, Ο , 00<:$00 @00aSu.,$00  00aSX01@00c<  80S~ n@ 000".~@0@0C\P 0  "!0 00 =C&  0 "!0-0 RKU5  000 080!C \! 0  "!0 00 jlV( V( Q ᣶ R  <QQ 70V00S T0@ ``Q  0;0000  0S 0SX00 V`0K  PP @  0aP00 Y0,$,!$#LT@TژH`l0@ l P0 P0 3 0P0R00S   <S T 0KcP`x0 0R0 f 0 @ aP00 N0,$,!$#<<0崀  aP00 %0,$,!$#<k0 ;R0  060K  0P㴀 b0K  PYK  0rPP 0K  PDK  0 [P9 bk cPtXk <S( 0   -060T 0KƴP`00\0 0  aP00 k0,$,!$#P~01@00c<r  80Sf [ @ 0 00"!@0@0C\` 0 !  0*C600*  00#!0x*0 R3V5  000 080!C \! 0 !  0)C600)  00#!0)0 R0000`0` 00,0 0,P 0 0,0\  0R,0 dP 0,$,!$#, L  <4<("4,!<. O0 L04K8`K0@K pP@@P80@K cP@@P80 HKH P@Hw\Zu$00  00aS:01@00c<  80S `eh@ 0P00"@@0@0C\P 0 !5 0$C60ğ0 00#!0$0 R[U6 $  000 0x0!C \! 0 !D4 00$C60(ğ0 00#!0$0 R&0000 P0P 00,0 0,P0 0L0< ,$,!$,4 , < , 4  *<0?$00  00aSf1@00c<  80S Vvڴ@ 0"00 @0@0C\P 0 !d2 0L"C60DŸ0 00#!$"00 RdU8 !  000 00!C \! 0 ! 0|!C600p!  00#!<P!00 R-00V#00 P0P 00,0 0,P0 0,00,0 P<4(<"4!<0000,I[d#$00  00aV\$00 @00aV̸LccpRdbRdtRdbRd01@00c<  80S ``X@ 0p00"E뀀@0@0C\P 0 !0 0 C600 00#!0 0 RMU6 !  000 0H0!C \! 0 !|1 0!C600 00#!0!0 R0000 P0P 00,0 0, 0 0,0 0,0 NSQ$00  00aSt -LTMT T10NP S`P X \ l dP H0,$,!$#C& D 0 "!0h.0 R 00!  00P00P 000,0 0,0 0, 0g$00 @00aSy{y$00 @00a Ss01 00c<  80S~ tot@ 000"@0@0C\P 0  "!0 00 =C&  0 "!0-0 RKU5  000 0l0!C \! 0  "!80 00 $=C&  0 "!0,0 R 00!  00P00P 000,0 0,0 0, 4 , 0t$00 @00aSv01 00c<  80S{ k@ 0 00"={@0@0C\P 0  "!0 00 ;C&  0 "!0d+0 RHU5  000 00!C \! 0  "!0 00 :C&  0 "!0*0 R 00!  00P00P 000,0 0,0 0, 0gPN$00 @00aSyB@$00 @00aSʪ42N$00 @00aS&$$00 @00aS|L$00 @00aSO01 00c<  80S hĈ@ 000"qx@0@0C\P 0  "!t0 00 `8C& X 0 "!04(0 RLU5  000 00!C \! 0  "!0 00 7C&  0 "!0l'0 R 00!  00P00P 000,0 0,0 0,00,0 ~$00 @00aSurp$00 @00aSʤ01 00c<  80S ,f,@ 0 00"v@0@0C\P 0  "!0 00 5C&  0 "!0%0 RU5  000 0H0!C \! 0  "!0 00 5C&  0 "!0$0 R\ 00!  00P00P 000,0 0, 0 0,0Q 0@$<$,0 00<4(<"4!<00  0h0 (<4(<"4!<0, r  3BBa<4<("4!<000,$,!$#, 4 r x X3Ba<4<("4!<0ll$00 @00aS1 P%1 00c<  80S Vsڬr@ 000"됂@0@0C\P 0  "!\0 00 H2C& @ 0 "!0"0 R`U6 !  000 00!C \! 0  "!0 00 |1C& t 0 "!0P!0 R+ 00!  V00P00P 000,0 0,0 0\0,$8,#$,00,0 !,0 0\@ -O$00 @00aVa$00 @00aV [R?Pc3 MbpRdtRdbRdbRd0c1 0 0c<  80 S Vsppp@ 0|00"$대@0@0C\P 0  "!0 00 0C&  0 "!0!0 RbU6 8!  000 0X0!C \! 0  "!0 00 1C&  0 "!0!0 R- 00!  V00P00P 000,0 0,0 0,00,0 T0 <4(<"4!< 0 T@0,dN+$00 @00aV_$00 @00aV 1@0 0c<  80 S DcD@ 0P00"o`s@0@0C\P 0  "!0 00 3C&  0 "!0#0 RMU5  000 0(0!C \! 0  "!\0 00 p4C& x 0 "!0$0 R 00!  00P00P 000,0 0, 0 0,0T  0,0 ]}{$00  00aSt0NST50A\嚼T-tf 0-LM@ 0KPP 0s30 -L\MT TT X L  T0\ !\0T@0d <p0 @Q``@ h l \\0 l p0` `@ ` S0p00L ( \<  X,0Kcp^0 A X!< 00P@0 0c<0  80 S$ Uu < 0K,K͹PP `\e 00!0P 00c<V  80SJ U `@0K 0,K⬹PP p\ 01 00c<  80S [@ 0 00"5 z@0@0C\` 0  "!0 00 :C&  0 "!0t*0 RS V5  ! 000 040!C \! 0  "!0 00 9C&  0 "!0)0 R  00!  00`00` 000,0 0,0 0l0+,00,0 S 4001 00c<4  80S( X䈟@ 000" x@0@0C\` 0  "!0 00 8C& l 0 "!0H(0 RV5  000 00!C \! 0  "!0 00 7C&  0 "!0'0 R 00!  00`00` 000,0 0'0, 0 ,0R0&,0 H00&00000`  08pK4KLc c`'bccbpRdtRdbRd0bRd \0s 01 00c<   80S xPx@ 000"S p@0@0C\` 0  "!0 00 0C&  0 "!0!0 RV5  000 0T0!C \! 0  "!0 00 1C&  0 "!0!0 R 00!  00`00` 000,0 0,0 0X",00,0 \p<4<("4!<001 00c<i  80S] RĂ@ 000" r@0@0C\` 0  "! 0 00 3C& < 0 "!0`#0 R*V5  000 00!C \! 0  "!0 00 3C&  0 "!0($0 R 00!  00`00` 000,0 0,0 0,  , 0001 00c<  80S T@ 000"8 u@0@0C\` 0  "!,0 00 @5C& \ 0 "!0%0 RV5  000 00!C \! 0  "!0 00 6C& $ 0 "!0H&0 R` 00!  00`00` 000,0 0,0 0,  , 0001 00c<=  80S1 W@ 000" w@0@0C\` 0  "!L0 00 `7C& | 0 "!0'0 RV5  000 00!C \! 0  "!0 00 (8C& D 0 "!0h(0 R 00!  00`00` 000,0 0,0 0,  , 00\(q 9 Q 01 00c<t  80Sh DYD@ 0P 00" `y@0@0C\` 0  "!0 00 9C&  0 "!0)0 R5V5  000 0 0!C \! 0  "!T0 00 h:C&  0 "!0*0 R 00!  00`00` 000,0 , ,0$ 0,0 \(<4(<"4!<0,<4<("4!<0\0qA ; Q 01 00c<  80S [ȋ@ 0 00"{@0@0C\` 0  "!0 00 $<C& @ 0 "!0d,0 R\V5  000 00!C \! 0  "!0 00 <C&  0 "!0,-0 R( 00!  00`00` 000,0 , ,0$ 0,0 \0<4(<"4!<04<4<("4!<0~|$00 @00a Se01 00c<  80S} h^h@ 0t00"~@0@0C\` 0  "!0 00 >C&  0 "!0/0 RJV5  000 0D0!C \! 0  "!x0 00 ?C& 4 0 "!0/0 R 00!  00`00` 000,0 0,0 0, 4 , 5$00 @00aSw01 00c<  80S{ ^@ 000"A}@0@0C\` 0  "!0 00 =C&  0 "!0-0 RHV5  000 0,0!C \! 0  "!0 00   80S2 U0K,KH  0CPPzL04K8`KLJ$00 @00aUa$00 @00aUA?P1@00c<  80S Uv 5@ 000"ğ@0@0C\` 0  "!0 00 4C&  0 "!lx$00 RbV8  <4! 00ğ00 0,0!C \! 0  "!0 00 3C&  0 "!#0#0 R+ 00!  U00`00` 000,0 0,0 0,00,0 <4(<"4!< 0 0,= ꐰꎰ$00  00aU^$00 @00aU1@00c<  80S 4R42@ 0(00"@0@0C\` 0  "!0 00 1C&  0 "!0!0 RMV6 h 000 0\0!C \! 0  "!0 00 1C&  0 "!0 0 R 00!  00`00` 000,0 0, 0 0,0 0,0 ]$00  00aSt,LccpRdtRdbRdRd0b -LM` P0 @p 0 lT T0R PW nTk ჊UP{T T0R@0S0 R80S  1Pt s] @ 00 0 ,zP ]w X80ST 80S yy p-LMP` @ 0P@ `p -LTML TNx `   h d xh@ T0 000 H PP L,0KXP \P }`\0  L!<00P@00c<  80S U < ,K0KPP=Z0d@!0P 0 0c<  80 S U;0KP  0,KɨPP`0S T@0!<00P 0 0c<y  80 Sm U< ,K0K⧨PP0S0h@!0P 0 0c<  80 S U0K,K 鉨PP 4K08pKL0X@T<0{1@00c<  80S Urwܗ@ 000"2@0@0C\` 0  "!0 00 x7C& p 0 "!0L'0 R^V5  000 00!C \! 0  "!0 00 6C&  0 "!0&0 R* 00!  U00`00` 000,0  0,0$,, 08#$,0@0,0 $,0 0 v:/-$00 @00aUc$00 @00aUb=?P1 00c<  80S Uru@ 000"{䤟@0@0C\` 0  "!0 00 4C&  0 "!0p$0 RaV5  000 00!C \! 0  "!0 00 3C&  0 "!0#0 R- 00!  U00`00` 000,0 0,0 0,00,0 T0 <4(<"4!< 0 T@0,9us$00 @00aU`$00 @00aU01 0 0c<  80 S ,R,@ 0 00"r@0@0C\` 0  "!0 00 1C&  0 "!0!0 RMV5  000 0H0!C \! 0  "!0 00 1C&  0 "!0 0 R 00!  00`00` 000,0 0, 0 0,0T  0,0 \ԫҫ$00 @00aStLccpRdtRdbRdbRd01@00c<  80S Uslpl@ 0x00" 눐@0@0C\` 0  "!0 00 0C&  0 "!0 0 R]V6 8!  000 0T0!C \! 0  "!0 00 1C&  0 "!0!0 R( 00!  U00`00` 000,0 0, 0$, , 08 #$,00,0 *,0 0P e8/$00 @00aUd$00 @00aU1 00c<  80S Us4s43@ 0@00"nP@0@0C\` 0  "!0 00 3C&  0 "!0#0 RbV6 @A 000 00!C \! 0  "!P0 00 d4C& l 0 "!0$0 R- 00!  U00`00` 000,0 0,0 0,0L0,0 <4(<"4!< 0 L 0,7Zge$00 00aU_$00 @00aU;1@00c<  80S V @ 000"(v@0@0C\` 0  "!\0 00 p6C& x 0 "!0&0 RMV5  000 00!C \! 0  "!$0 00 87C& @ 0 "!0d'0 R 00!  00`00` 000,0 0, 0 0,0L  0,0 \Ʃĩ$00 @00aSt -LDMPT T0PP SL TP L 0 5T0ϟ|  L| 0 0 D X  ,0KݙX R0  !<00P@00c<  80S U< ,K0KHPPX0Ss 0QXP8 80D  <aP0<0 ő0,$,!$#$00 @00aVb$00 @00aV .?P<$00 @00a SX01@0 0c<  80 S~ m@ 0$ 00"P4}@0@0C\P 0  "!0 00 =C&  0 "!0-0 RKU5  000 0 0!C \! 0  "!T0 00 h>C& p 0 "!0.0 R 00!  00P00P 000,0 0,0 0, 4 , 0m`^$00 @00aSv01@0 0c<  80 S{ tot@ 000"@0@0C\P 0  "!x0 00 ?C& x 0 "!0T/0 RHU5  000 00!C \! 0  "!0 00 >C&  0 "!0.0 R 00!  00P00P 000,0 0,0 0, 0g̜ʜ$00 @00aSy꾜꼜$00 @00a S}01@0 0c<  80 S~ \m\@ 0P 00"@}@0@0C\P 0  "!0 00 P@FhD%$00  00a Sk01@00c<  80S~ f@ 000" w@0@0C\P 0  "!@0 00 T7C& \ 0 "!0'0 RKU5  000 00!C \! 0  "!0 00 8C& $ 0 "!0H(0 R 00!  00P00P 000,0 0,0 0, 4 , 0ꯒꭒ$00  00aSv01@00c<  80S{ LiL@ 0X 00"hy@0@0C\P 0  "!0 00 9C&  0 "!0)0 RHU5  000 000!C \! 0  "!d0 00 x:C&  0 "!0*0 R 00!  00P00P 000,0 0,0 0, 0g$00  00aSy ~ J$00  00a S01@00c<  80S~ kԋ@ 0 00"f{@0@0C\P 0  "!$0 00 8<C& @ 0 "!0d,0 RKU5  000 00!C \! 0  "!0 00 =C&  0 "!0,-0 R 00!  00P00P 000,0 0,0 0, 4 , 0vt$00  00aSv01@00c<  80S{ 0n0@ 0<00"L~@0@0C\P 0  "!0 00 >C&  0 "!0.0 RHU5  000 00!C \! 0  "!H0 00 \?C& d 0 "!0/0 R 00!  00P00P 000,0 0,0 0, 0g$00  00aSyԐҐ$00  00aSEƐĐ$00  00aS ʮ긐궐R$00  00aSꪐꨐ$00  00aSw01@00c<  80S m帍@ 0 00"}@0@0C\P 0  "!d0 00 P=C& H 0 "!0$-0 RLU5  000 00!C \! 0  "!0 00 }Pp^0 A !<00P@00c<2  80S& Uu< 0K,K⪆PP\f00!0P  00c<W  80SK U 0K,K 0዆PP 04K8`KHK DK h}P0kH@+om$00  00aSh81 00c<  80S~ ,b42@ 000" @0@0C\P 0 ! 0!C600!  00#!0!0 RKU6 h 000 0D0!C \! 0 !1 0 C600 00#!0 0 R0080 P8P 8040 04@0 040, 040 h؃փ$00 @00aSv,LcDpRdbRdtRdbRd01@00c<  80S Vvh`@ 0"00#@0@0C\P 0 !0 0 C600 00#!  00 RfU8 0!  0H00 0X0!C \! 0 ! 0!C600!  00#!!00 R/00V%80 P8P 8040 04@0 040040 P0@ <4(<"4!<0P0,`$00  00aVZ$00 @00aV1@00c<  80S PcH@ 0`00"ip@0@0C\P 0 !3 0#C600 00#!0#0 RNU6 $  000 080!C \! 0 !l4 0$C600 00#!0$0 R0080 P8P 8040 04 0 040 040 P0Zvt$00  00aSs -LM  T 0  Q  0;#;S L 0,$, $,#,0.O0 x t \ \ |0Kvrp !<00P 00c<O  80SC U< K|K{PPx1 00c<l  80S` ]ȝ@ 0 00"o렍@0@0C\` 0  "!p0 00 \=C& T 0 "!00-0 R-V5  ! 000 00!C \! 0  "!0 00 \`L KI9 nP%@0 0@0 )0K K?xP@H0K K 1xP0 KK %xP0 KT xP@@ 0a^00 @<4(<"4!̃0 a^00 0 KxP ]0K K wPS@0K K wPFZ@ 0 a ^00 D0 KxP1@;H -0 KK wP"0K K wPK  K0.zP  q0K K wP]~~$00 @00aSʔP `Lc|3 pRdbRdtRdbRd01@00c<  80S Usld@ 0|00"댐@0@0C\` 0  "!0 00 0C&  0 "!0 0 RdV6 0!  000 0T0!C \! 0  "!0 00 1C&  0 "!0!0 R/000001U%0`` 0|0 0|0 0|00|0 <4(<"4!< 0 0,$ }}$00  00aU]$00 @00aU -LM(p`G# 0P  \, 0 @0 䒟P00C\ 0  "!0 00 2C&  0 "!0p"0 R 嗗A@08 0R@0000   P40$" 0ppPW000 zR 0 .XS1P 1 1 bB&! 02 S5|1b1 R0@@00@P00C\ 0  "!0 00 0C&  0 "!0  Q0}< P0 0 ,K,0@|s :@GpRdtRdbRdRd0bbb -LLMTlMLT0  ` d P  X  \ H $ ,0KL m`0pS0  !<00P 00c<  80S U< 0K,KvPPY0d!0P 00c<  80S U0K,KP  0gvPPT04K8K@0@0C\` 0  "!0 00 4C&  0 "!h$0p$0 RbV8 08ğ1 0,00 0(0!C \! 0  "!0 00 3C&  0 "!#00 R+ 00!  U00`00` 000,0 0,0 0,0 0,0 <4(<"4!< 0 0,}6z4z$00  00aU^$00 @00aUl1@00c<  80S 0R0@ 0$00"@0@0C\` 0  "!0 00 1C&  0 "!0!0 RMV6 d!  000 0X0!C \! 0  "!0 00 0C&  0 "!0 0 R 00!  00`00` 000,0 0, 0 0,0 0,0 ]yy$00  00aSt(LcpRdtRdbRdRd0b -L1 00c<  80S Uvڨ@ 000"d"@0@0C\` 0  "!T0 00 @2C& 8 0 "!Ÿ"00 RbV8  000 00!C \! 0  "!0 00 l1C& d 0 "!4!07,<00<00, H4 ,0 0^0$0 PR0 p Rh<0pS( "?A3cPU80 0'P0% 4 P!< !0$0\0! d0, 3T0,6,<00<00, 4HT,0 0QT `P @! @,P Y  0S&40,0 @0HJ<0(0CX0/"b\0p P000 00,(Qp4H,\ -d3LM R  00 $5S @ 0dpPPT 00CP0  A0`TPVXPK0K  P0K KP0S Ppp 0  0`S 0K!0 Sf @ Ÿ  0JPM ` V!P0V P`80 VPW- Q0S& f3 T0S _3` V Pd00 TQ0 d03T0`80 VP22 P000Q 0 TW33  @`0 0K@92P0H00 @A 0 K0*2P @D 0 PHp ft3TP TPP -L M0p,0 00 P0SM j V@X 0,T@# VH L#0S 0C0D 0P`/ ,0T 0P@0@yW21S1pS 0S1610S01 q y\  ThL#0S0@ 0xԻ -LM P@,`t0 p4 l0<  D RD@/">C2"/P!008BS@ CR?#404p$@WDtCY8 ,0 <  004,  `:T@,5P@1@#W<-P@1T@XP2@p"S 0 S08 SL3 R2PPP2@p"S 0 S08 SL3 RPX P"00 SPPP#00@ SPDp5,@PD `P"‘\00pS04pS ࠡ`P PP ‘\00@S04pS ࠡ`P  - PL\`@pP 10SBt0 0Z8 0 T 1P-t@ `,@c`wVP3"0 SPPP#0 SP8 0W`X8 T`0l!`!R @ R D0| 2a <@8`& -LMPp  P,P ,@`VPUPa 0 P` ,@V,0`VP 0 PP`,0UPV -LM @PP4  T 0cSP\q8 0 B0C0 Y0 0 0! d ,K0/P`,8"HPQ@ 8  3S .12  0 T0XP<0 0!8?\>`0 0/ ?> 00cR#`[ P80iW00\!8?\>`0 0/ ?> 00cR#i P<PX!@!400C40 g!40040T0XP%0 @?Q>`0 0?>0 0c$00C$0 P B 40P 00C 00@0 00,<0 ,|,0XU b -LM @Pp4 PP0 00Uz 0 0 ! 0d 0,K-/Ph,"H`0S 3S w0Y00U 2  00U T08 UZ P !40 SPUUA 0 0GPp7 ^!?Q>`0 0ς?>00c  ^$00j$0 P j 40  0Z0j 0 40 j0C40!400400,x$/,Y,0 0 ,?p}0 8 Z00 ?Q>`0 0ς?>0 0c8 ^$0j0$0 P 4  00 0 40040,b/0 ,pU b -LMR pH @K 0Pd ( 80P(X`0ZC 4R`0 7  0*00C0 P B 00C0| P @P0 0` PE3 RX0  200000C0 l3 RT000T0 0C0 0員 800c 3 R`0` Z" PXQ0 P%R4 |080 <  2@ @!QT000T000Sj \28Q4 X0 20 0<,0 , @P0 0` }4 40@P`,P0S4 @T40TX P, 0S30 `` 0`<`80pLq4 T52000?00s2 q4 T52000@0@ PR`0  0PV.L5sX50 0S`0 RQ0@@0 0 lwhy`00 DmD@T,P0S@TPU (P -LM `Tp 1S0 0 ! 0d 0,K-P, 8 80"H@0S 3S 8Z.h$% 0WP0SPU 0PG0UC0SPEUT3 Q, 8 Uʼ000  P@ l?p >14 PHX P0 ^ 0 S40\4 \` 0n0rP02U8(@8  /P80PU,080 , 8 8|-80`]`0P,080 嵿U x -LM P`P@P00 0 0 0! d ,K0h,P, ,倂HpZ4  3S - 0S H2T  080  8 @>Z!\000/ > 00cR#= 081 a4 ^Ϡ\0.A00/ P  l1@R\0/ wPI <1 Z\0`000?0A0@ P@!#0.Z\0!00> 00c# 00 0C 0  P B 0 P0C0 ,,0F Y0 00 P 2 020 0U bܼ -LM p`0PR 0O0  0d\̾8T 0A0U2Sʼ@y0 $0X: %00 00 ! 0d  ,K0x+P,,$H@T 3S ,4  .00U 80A040 ?80 <448T`0.!48000?.a 0 bS1P4 0< T0USZ% #@?T>`0 0/ ?>1LQ l3T`0 0?>0 0cZ$00 0$0 P R  0 0 0480 24R`008008?.a 0 bS1P< 0j 2 `R4 `0RA P00,+$08 0a$08Pl 0l  000 P 000| 4@P|@P0 r0` nPEX1 RX0  2000000 1 RT000T000 0奿0` T`0PB P 0 R`0 |  0A000 P 0 000| P0 t ,D\U bh -LM @p,0 Ws*4 0 0 4 ! 0d 0,K*P`, ,x!HPX 3S f+L1  01aY\000?0p0S9. 0X\000/ 0900 0W0p500 0   P4  P000 ,*00C0 P B 4 20C20< =S0 U b̽  -RLM`, p{ @r?Q1 Q`000.,0Ae8崁/.  b  B020!Pp1 @R, `08P/.  b  B020!P5 00`,,08P0 eS0Y`0.!00/ > 00cR#0@g0P 0 S P Q,0` bXd, 0@ X8,0, @/>QU \P DXxG-M$PP0gl0h `Qpb?>1 E   @$?p > 1^ࠡD T! 0  S \ d@E? >j1^࠱D T!@  LP \l0 \ 1 Q0 110b1X10l1$5S!0SL\ T3Ѝ?>1 E -0LM 0  鴾 -LM pP@P 8500  Y b R00ZZ00 PP X P P@ P ʤ0 5R5=:\9:0 PU00 U00S Z 10 0@TPP`S PP` 0S:0S: P0   04(PP )T/ 8%0@0L 0@PT R   0  H  0 xK@ PP 0x 0 0  0S:20S/*@5L 0@0   xK 0rPP P  0P"* 0d x02T0 0<H 0@P0@ |0Kd KPP |0` 0C!|0 @t KT   0 0 dI0 K0'PPR``KH|0  \A T Q xK00  PP4x@0dI@ 0 P) d03 T0 d0KH<`_0@P'PP ?P00SA 0 B  '%((0t@KT` *0 y00 T`:P00 ViD 0C!0 d00!Q0Ad0D0 K0 'P `0KH  c''  0/ rK( PT@ 0!0xK 00 uPP x@P@ 0 0 P") d0 3T00 00!0A ''0<H0@P( Px  0 K 0&PPZ0 0f0 0 ( d03T0 0 xK 00  PP:x@0t@ 0 XP( d0pK3 T0 H<i0@P&PP!` !@0 0 00 xK0   0=PPP   0 Sx0 0  & k'85@%0 L00P DAȾ -LM0`K@0 @PeTT0@0 000  00@ 00R00S  T000T0 U000U0H0P@ N  ,5SAڸP` 0p0 0 0$@|x`0dCA0 ~85@0L 0 @0Kd 4@KK1" 4K1@T S0   000@ 0 EV%$@P P@ 0K 00PP@^ U P0 #0?Q5:^:P0@ I80S 0` H ' #$85@0L 0@T0@D 0OR:Q:P1Sk0P@00T 0S 僶@b( -L4M0 P0 80 P T 4 0\ D H0 t0@H@T H 8XH00@ 04D@ L@ ~%< 00 m85 ,00,0<0<0 <80&Q0 >< TPH^<8)PP08<|HT 0 PP  P$P80Bd4 P  QD 00 ttP00C\ 0  "!@0 00 ,4C& $ 0 "!0$0 R0 D3thA@ T0@ @<#PPT Dt H0@B4T 0cpa@DVHTp 80SRHfaV]D0SS b3 @ 0D2 bB&! 02 S;1b1 RD 0D D 00 xR@00C\ 0  "!D0 00 02C& ( 0 "!0"0 RP  Tm` p<00 :00#d "L0,K0P P,0TU T P  0R0d ",KT0P0PT0 ,0PP P0L0 00P0 I\<G#K(`4 foD @P P  P  P P P  P  PPt Pl P<2#0`L@bbpRdtRdRdRd0bbbbxbbXbb8bb@ -L M `PP@p  P 04 OR5:P:0 00 ,K0!P@ Z,85H 0,  ,"85@0L 0 A-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018Ġ\P  -80L0CS%L t      8 0S0 #Q00 L0 R0SD` -80L0CS! !(!h!D!h!h!h!!000 10B0  2 R0  00l -80L0CS!!! "! " " "!000 10B0  2 R0  00| -80L0CS!"""""""p"0S1 S20#B1  0S 00庳댿 -Lⴳ뜿 -L⫳븿 -L⥳ؿ -L⟳ -L♳ -L⓳D -L⍳l -L⇳ -L⁳ -L{ -Lu -Lo -Li8 -LcX -L]x -LQ -p1LMhQh!00`+7P@D1Dq#7P@ ,2P8   K5P@ 8  P@  0 0 R  0 00 0!0@Y ~,  H 4 Kt  00C0 4 nꈃ`ئb@b`hbyc -L|M` Kl P\) P@ p@&4$0S Q 10 pҝY 0  @0@3@00@  =S3@0TA@0T<Y$ @0! 0 Q=S@0 匴0  0 P@ ,l,LSQ @0(0$ ,0P@p80S@ 18|0" 0Q@0 Q @0 LMW0  00X@ YT@0K 0X | | 0S@7T0KY +ZaTKl cH 00S @0 p=Y YҐ  0 Y @000000LmY@K0Y w+Za0Y m+Za X@ D K(<P@ iɳ@d W0  0W@ 'YT R0 l@  @(妳@03@0@|`P -L M@@T,u80 U6\0  0=P4P尀`p"0 0 0$@ x`0dCA0  ,K08@T 0x,0 H 90,{ 6J| -L4M@0@pH D@  1`V 0H @@r=P XU0x@ KmWP@0L(@  ? DK 0*PPwD2H\%R0 R1Rh0 S)1PT3h PT30h0 SD 00:00D(5D02H 40@P PUL #8 P R4 i0@d 0 DKLP0P L0 +D0HD80P Y 0$%R ,0YT ,0Y$%H0\8 K4 00 8 ,` 6 H0到hdTcL+ -LDM|0R `0p9PP 8P6 V U@0 @@<P WU @00L0  0 VPP000 KpVP00L(@ ? 4 < %4@K  0*@PP 40H0@0 \5Q" 5Q OP|0@@4PL 0R U<0S /k<,kA.,@0 R5Rh0 S@0-0R0 0L0P0@0" @ ۱@@LL5s00 P P bjb< @h j<@0\%44R0 0@<@40h H@h0 S4 00:004<4P L @ 4@ @^@H $5S,0 AXP iXH@\D P)8 H@ @R4 l0@@ 4Kd  0 X UDPP D 40H4@4P 80X H0\@@$%R ,0D\T @,0\@$%< h!@@0S 0Sl0 0 l @@0(%:D @0<@`t0$0d <( 80,0\@Z|0@LP@LC] @80K!(8@a@<S΁>`K@ 0P K Q0O`0@\4 O PKP@05SP KL0S@@@0 0 @0@0000< 0%P@P PiLi@ ,L i@@,L@P@04⸰hbhdTTcE-0 LS03R %5p00P5,5S ڬ4S9Ӭ4հ4S@0Ӱ400tA/SpPo5@"p%$\ZH0L0SO/͎ -L M@0Qp `: P@ҍ X 00#00 P@р Lmi|  0: 0Q  T@3PUiRiOi@0:@0  -@0L Pp  r4P@`@0 S@`V _4P@P @ MS0 0T@ WU  -p`P\LP0d -40( 8$@<( @`@, T0C0H0VZ  Z Bl  D !嫭T p-LM0@SP  80S 0hl0S  Z2`V p  0T0S0 TK3 -LMq@@ -R`P =S@ 8 K8 4` , 0@ t38@0<K#=0T00 \ P S  <0 PP ST 0@ @ R  0S0S  PT7 @ =SPP$ &$; -LM4 qP8 8 Z4,0K<Ÿ /@T,G`0T"0b p@00@0, `,001 1PP@ ,2T P 0 0 0$ @mxy`0dCA0 0K0P@ ,r208  x Q00 H 9000 ,0K4OP@1S ,5S9Ѿ)1 !,080$0S01,0T @000,4280|ccP xcc@-@1T0, T:F@ 0000!  -L MP, 40@ 0 PPp#8  R4 g0@d 0 d H`w,QE I80p W 0\'d0T   c@000h 0C`00h HQL5H sP5,5S,>QS. 030P0 SHŒp011pGW 00P000 b 0-LMT@PTGD 0 0((@0h `c- @-QM@ 00CS C0C@CPC P0 Ѝ@-@Ѝ $  R R TP PP -L0-0<`L0 h0ckPl T l R  -LM80S <<4 0 00Ql pp`0,0 R@ 00300@Tl R@ 0 3P0S~ U@Wl p 0Sr0 #S 5`00C\XC 0  "!P0 00 <3C& 4 0 "!0#0 RD }P=2 0`00l R ,0S0C£`00C\ 0  "!t0 00 `2C& X 0 "!(24  Q  0S00 SSQ00j W P0Sx 0S p0S 00 10SHP00300ed00PQ3000`00C\ 0  "!0 00 0C&  0 "!0 0 R, R ] 0 ` lP+ 0SmP .S |00S @0 (pRdtRdRdRd0b 0-PLn@T 0 0崡@0c -LM@^Sh -L M @^ 0    Q -LDMT@d ` d0 h P`P尀 Pp@h pTXpKU\PK  0P@q R\ "1 (`!R0 0  R` V` 0h S0, 0Q0 0 B1RP\ p; X@i T3 U00d0P  0 00P @  H\@0X0T00S 0S $0`V * h0^1 ,1 S 0DS\0 pUz(0` 30000$ `V*h SH,!0 0Q (00 3&T00 6OL0 ,00,0 P@ K $P@b -LM00 T0, 01P<0 00 \b0 \8 D0 Dp@ L@  ɯRe <$0@' "p X Q@  g B@ 80SG@0l0`  c4 @ ,0bR 0 4 0 D0 , .@ 40 @ 8 S% <0D $@ PD 0 p0  0 @0OW@ Rc",0'&4 Pe P 04P ,0 00SD8@ 0`0l0bc4  -,0 L 0Ww0 0  ccc-X0X  00P0\ P0^Pcc -0LMxxpP@`0 0P 0T P0U$  +P @bcc -0LMTp@ 0`P\0 0!R 0U R00 R 0@@0V0 `\@bcc0S R00  -@1LM PR`@ @0S@9S 9S0  CMQ  , 0T @0pP 0 0000)0yp1   -(3 4 0-h0L PR @0SH@ 0P0N+-(3 T -LTM4 0d @t h d l ,0 p 0400@ 80 `\ 9 : S` 08@h ;KPP  8T0@  00CS8d PPl 0QQD <0 L H t 0<  00L0 8 l0TS1 PAx Q x  x 0@_So0Skp0P0 px0?T  $4K TX Q0\ @,PJ,0K/00PPp<0S;;S<@ H ,0H @0S" 2 R< R P  8 T0D R00000cCQL0Q @ D < P 8T0D 0R  R T 000 XRX p Q0PQP 0〠 BP 0,Pml0SS S 0l#70P00Sd 8 *4 08St  0S 0h 8MJPP#< R'xxP0@;DX X ?0/;?0|0 \0+S  8\p K060lQ @ DX0QX x@ ;;S @Tx0ax0LR pb$Pe8T0D R0S@D@ @ @40P X 0A8< P 0\ P0 S0 00800T D0xS00000 0 S:0 S*!J8xT D0S00000 000,tl 70R00S0?00l0S `l0P0Q00S t  et  /0S$ 8 T0 K0PP \0S t p 8J06000d00 Cd 8 08@00@0dp 8J00 K6080T0PP\P t 00d 0p 8HP0P60 0)<8p HP0600h 8%IPP0S 800 KT0PP0 d\ 0P;08p J06t c 08h HPP ;;STx0ax00S+ 8 T0 K0PP9  h0Q 1Q 00!R (\d Q 8\p KJ06008 @00@0d0 <0SH0@ 0rH0 H L0@ R 0@  00b< D0 8 @P %$; ;000$x0c$0K0/ 0KPx0S (0 000 -L M@0K_ap ,0KPP@,0T D0S,0 0 B0A0 T0@ @ 0s0000H@ -LDM0YH L @pK`P>L@DK 0 `@hDP*D0S'\ P P`YX0T DQ  R 0.SR 0.SH0P 0PX -L8M0`\@ p@: \@7 P@0< K8\08 pPPDP@@T0D R)0[*0[S""[0R0 0R@ R %@00T@ K0P@ @P T @P% @..(- -LM@ KP 0 0 0-@DP L@N*P00 4 0 0 -( L0S 007` p-LMP` KP0@0 9S !0R U%F@ p 0- D0@L PP0skI03 -p0 @LB 0  m PP0sRI 000H r %08PC&P3 0D 0  R  0S  000  0-LM0@ PR0K&:0 R 0 0000 H@0 t0  000 0000 H@0 0  b -LMDpP@ 80S(vvv(v(vv(v(v(vT0@ PW 800S  ! 0o) -LMp0P$K`90 RY 0T 00$00H H 0$@p1  0000  9:0  1 0 ! 0H0 0(0 , 000 4 080 < 0D0!@ 80S; ST0P $  1LO$K48 T0 8$0H0 00$00H H 0$@0  b -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s$ T0@  1R bP R0 2 RD00000D Q  20S q T0@ q 0Ph0s4 s 8 00KRj gR` 40pPN4, 0S:00 S*(qC T0@ = 1R bP \0  0CP(q00000(s00 000Pq T0@   0.u hG 00sT0@  R0s0ss~YD 8#8ST!880$0Qdb -@P1 LRp` 1bP! R 80S   bP  9:9): )<0 9  O -L M`0q00 AA0ppx Sn aPP A 00T000 1Y,0 00000 PP 00,  0  qPP,, 00PP$ 0 PPP<YT000T 0S9;9Y 0S9;9, 00 AP 00,J0   W X  `aP嚜HE p-LM080S 00S 0 \ `T *"("p>" 0 05u` FFt AF -"LEM0`,0 8 Rpq T T0RhW  AP[P1 PQ0QG0 0 0   0P' 0 0CA  0͕v Ew EW  xC!0 ,0S ,oMOK  0P CCCC CHbb\ -LMq 0R 0 P@`' R ÛT0D R- 0 S $R ' 0u0` pT0;0(!  A?K  K 4PK J/K0`dHbhb -TLOM`0 P,0 @@!|@@8P@ 6@<800 0 0/ @NK @"8Q  ?HbR  -LOMD0,0 P43)R `0 KKI>KP`P1 p 1! 1P` P` ] 1 PV T\,0 S P,}0I00P1 8  )0)0000 00) 0P`XT0D 1RSK@0L1  U?K@! 0@ <P`90 0 0 PzT1SKH  0P`1TV@P`MOK TP 0`V y B P10`Бy000)0A B0)0 PT$@Hbb$ S R -LMPp@` Vf |0S 00S Bu A &P 10S 10S 00C0  B  0P#w A )0 B00)9 0C 9 T0 @ @00  000   [ -LM0P@ 0  rPp0sWAUT0D`P 0 @  0     pp#;p -L1 1@R#P P; jH!0bR0S- PP0S$ P ]PP?>1!E , B 0H 0C0,6$0"Q , -L M P,劂@BP00  0ƕ&0,K+P^,0TH(` (`>1 1@R#@  d> aq oP/ 0lA0 P@!#.!1D0,0C000*  R0C 0,& 101,(0J"p `6P;  $ ,逽,Tt -L M @`P`$ U0: ӑ , &$KP$0$`HpZ?> 1@PR#  0,0 00D 00$`$; 囑坏\h -L M @PA \00\0SC(,,6倢0 Ɣ&0,KM0S-,0(H` Qp Q ;  ' 0,&0 00 00 Q,& 10C1X0,F< R,o; = ; -RLp`$P@ $P`A0Qd ZP 0l1 P0P LP @?P;  ꀽx< -0LM ; 5\ -L|M0   0 Q0p  0 Q0 Aa@T &xK0PPx00x 0x|K 0PP 0| 00 p &0P0x &|02T0 x0<Hmx0@P0Kd KyPP0` 0C0 !@tKT P   0dJ& xK0LPPNx``K H0QA T   0|K 0NPP/ |@dJ@ |   0&Pp 6d K3T0` H<0@PoPP0SL 0A x`xxN0t@KTpJ:Q! (0P ʀ0dKA`0&0`0x 00: 00x)0 @PW 0$B00 :0Ad0D& xK0Px `0KH xx6Tp:T=0! 0{|K 0PP |@@0| 0 pA x0P&0P 63T00 00<Hd0@PxA0 &K0RPPT& 0 63T0 0|K 0TPP|@X@0t@ &0Pzx &|0pK2 T0x H<x0@PxxPP`|  00 0 - -L M @^ 0    Q -LDMT@d ` d0 h P`P尀 P@h pTXpKU\PK  0P@q R\ "1 (`!R0 0  R` V` 0h S0, 0Q0 0 B1RP\ p; X@i T3 U00d0P  0 00P @  H\@0X0T00S 0S $0`V * h0^1 ,1 S 0DS\0 pU(0` 30000$ `V*h SH,!0 0Q (00 3&T00 k4L0 ,00,0UP@  YP@b -,1LM PR`@p @0S;9S R;pST0@  0S!$KZ'$0)00  30S  00 zp O(3 p -LM@T`@  0pK'P 00 T00 P HV@0 1 0 0P 00@(` 0@Dp`,V0RL$X6&4K0|P@ 4000$@240 H Y 44B b -LpM0 X` M8 P 0@S@@T P- 0@S  0@K X 3W1ƙ&0G PF000 @K 0 @\P  pmm p000  05G6Pp( &0 @@K  0@ @+P pFmm0eHݾm 7ƙ@0 & @4 6P@#!B0 6#1 |K a, 6< 4@D0 @ P$ 4@K1S4KPU BZ PU ,0@PEU 0C00 0 0K< |K< Xa"0  @ 6 #1 c< 6P35@ a B8 ` V&4K1@DSPUZ PU ,@` VPE 0@DU@ 0 d00p 0006 $ &@0K4K"1K ;4K1P  S0  00  eWcHT000  0 T0D0Q:S0S000@@b -L,MH L 0 40 8 \`8 < @ p PFF$1@P U@ 4X@0  0 %00D ]D@  5 ,00,00 <80&Q0 :T`1 P@-4H\U8 PP  P$P80BT4@   R< 00 hd@00C\ 0  "!40 00 4C&  0 "!0#0 R8 &<80&"!h! B׼ LP<@L 8@ 6#1PCU bpaPEV@Up4 RP@ aV\< RS R3 @ 0<2 bB&! 02 S;1b1 R0<<  <00hb@00C\ 0  "!40 00 2C&  0 "!0!0 RHL4 9D00 :00980&L0,K"0PL@,0HL H  0R08&",KH @,0LT L H H0D 00H0 \36C< @P P  P  P P P  P  PPt Pl P 0PL嫈@bbpRdtRdRdRd0bbbbxbbXbb8bb 0-@PLB/ֻ  0000 000000 -LUM\0 ,0 08`1 Q`0p h 0l t &`1 B@000@T `UoK TW?KT1 @ P XA DA T T $T80B4P 000P0p0 TX$P00C\ 0  "!$0 00 4C&  0 "!#00 R0S N 0 \q .Pd -D1P0c0Wx1 $*@TMoKPd  T`!>K0\ *XPd l1ğS t@t Pl1 xU:h!2 2@ 2 b2B&! 02 Seʐ1b1 R0pp00p<@@00C\ 0  "! 0 00 1C&  0 "!1  Q/0h! 0 @PQ`0S:  R d1Spt0a0 d 1 ,0S <,k0B 0S2xB$t  Al 0t!p! :A25 ~Ap @T T  T  T T Tp  Th  TTX TP THbbpRdtRdRdRd0bbbbxbbXbb8bb -LTM0 \ 06p0  d 0`0 \0h  , l @4 0` P,d@Pd8 T X d )t  4T0@  00CS4\ ^P@hPP< D @ t R0 00D0 40hT\1 PAQ Q`H `p0@MppL P Q0^@ ,P0,K/P@D`Yp0A 8 @ ,0H @0S 7 RY#  Q00 000cSDS080 < Y@8|@ 0@D80 \008 0b<0 Q  0R| 0L0 0L00 PRP `Q0HQH 0p BH 0,P[h0SSFt\C ;S@ 4T0@ 90` 4,P@HY%p@⸼p0x@P0 0p P@ὼp 00| 0 T0+S  4Tl ^-0608< P0\P x 0h#70\00S\ 4⵿P}00 ,0 000Sdh 70R00Sp0 l00hP Xh0\0P00S tQed /0S$ 4 T0 K0P@ T0S t\l 4,06000\00 \ 4 (4@00@0\l 4,00 K604T0P@T R t0S00\0l 4*P0@60 0 4l *P0600` 4+P@e0S 4 T0 K0P@X0 \T0 S0;04l ,06tQc 04` *P@;p 0LL0`x00xS+ 400 KT0P@&9  `Q 9Q 00)R T\ Q 4Tl C,06004@00@0\  80 000 0 4 (P< %p 0L0 0c ` i` H ,K/h0P@R  0-LM0 \P&@tl  00\\ 0SP 0S<P00 $@ce 0Pd -LSMh! H#hA0  ,0 ,3(@K 4 L0pS㰀 `0 9#60C S񟗯hpx A?(K h1KK  nhAx 0R 00l1 :@0J`4h_ 0KSK0谠lAMK`UK \ WKXA DA T @a 8 Pa K)P@`ax0 0R@Ppd0S0@ 0`p@d P px0U`0MKS >K>Kp @`l!d+0P0@0|Q 0Q*h1/ 0@ d b ` ^ \ Z X A?(K VHb -L M@0Kx RK/P 0+000Kb0K/P(000n+000 -LM@$K_` 0K pP#0 0 L0S+ `0( 9 #60C S8X`hpx00$9+0000000000 0  -L\!0S 3PSP1 0  ,Q@`? 0K@a &P D K ` $0 0%PP  &- &F0 `PP203 a$|`bP -L M@@T0 \0  0/ P.`@(p@Dድ,V0Rw$僵6& ,K0@T 0$@b,0 H , n~| -L,M@0H L 1  H L0 PL@ K0 $P@0,(  ?ჲDK 0 +_PD0@H@%P D1p+Ṷ0 c@[\0EOa.6 0`Ƈ& 6V@fS@$V( FXP(& R0DK0 P&D,0H{D_ 6PUL0H0 8 K40 0 8p , 6 ~hd -L$M|0R 0p<0 0P@ /Pڸ3 W 0; P@@00@0  0#P@0 KL0/$4K+ 04@ 8@ P@40@HxP@ b 8b/8  c88c.408 H+4804@ @`<8 \ 3S P2# C 0 c@E[\0EOa.6 0Ɔ& 6V@03@($6 F)( 7 6PU,& R04K0@P@*&4,0H奵44@ 6PU8 0< h @ *<0lD0@ 80<p68#1$0&0,0( |0,_84P "@ 0R " $80S F88C801Dhbhd -LMp=P@+Q<` R% 80 S|00H"< Q0"@, 888@0 :@0!CP303 -PL aP@H p  "0 0@#@ $ -1Ld1#pR@R(6L 0R&H d0E PU0S: RP6SS!/ Sa, RPQ0S6 0&U  0`0f 0 H 0T c 00   TZ 㠴Z 㜴 D ǯPQPJ|S 0-80LS@P0 0l0S 0LS  0S 00  "0P0 -LMq̠PܐY@8 K`'8` 00 , 4P U 8` \!  0"0S `e#T 0S80 0 [P`}{b -LM4 08 <0 < r8 P@<3 4,0KPPC3ßp   P 0`0 Rp00C\ 0  "!0 00 2C&  0 "!0|"0 RGbTT"01,0`,   p<  p 吀唀APP ,>U (PJ ,F0 B$ 6&0K0.PP ,0}80$ 00 H ㅳ;00k0(S$1YPP ,0K4PP @00@0 R0 0S0050500,T0@ 000,8 ,8 00&vG HB5`J80@hcpRdtRdxbRdRd0dclccb p-LM`0\0 \@@TP (0&\Fp0  KP @p 9S Q 0R q0F0pp 0000  - -LMpP0+p@+`HݲU p -L MP, 6Z p&ƕ R0`00&,@0H嶲,0S  6pV0Z0X00S  -0#LRL R0SR T0 S5S L?|`0 Qd0 S- 073 p-LM`p0!P 0 'P@ 000Hq08@@p3 0   0 0S  -LM   + v -LMp0`$KP0H 00$00H H 0$@1 0 000  9:#:0+ 9 0+ H0@ ,( 0400<8  D 0100D0 @ 80S; ST0P $  0L@$K48 T0 8$0b -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s T0@ |)0S ">PI00D01 0  00 D 10S 00  qk T0@ T 0P"0sX 80SS PSI 0pP(q; T0@ 5)0S =P \0 0P (q T0@  00000(s00 000Pq T0@  000sT0@  S0s0s -@P9 LRp` =P! R 80S   \=P  9:9): )<0 9  [O -@qPp))0``u[SL J=P );SR0[00Ri 0S9;9Q 0S9;9V;U =P -@L80SpP` 00 0  U  Pp+0 B00+ -P p80LS`N T T0REV  \P8@1+R.00&0 0+0 0P +0 B00+qV  K yP b -L\MP@H D T0T `R0pX0 \ `  H0T LHP  ^D\?V Q T0R0 0 0 P X PDx8L T +RL00T 0 0d0  X L9: S "H0P T S0L P0 ; L0 ; L 0GPh 0 DhX DT\0` P ` R  R XCPQH TL?0  HK ?P4H0P ST  0P0 P0S  PT 0RL0R vP0L 0R T9 + 0 R' 9R$ P9S PQT YL000X D(P L+0 B00+DxDP9: S YTL dP`Q00 S T0T+0 B00+TPY;0C; ;0C(; P 0P000H:00 0 0u DK  DPYC yL P PT YT0S PPD`P00 S PP; 0C ; P 000T@; 0C; 0 00 @ @K D 0P.0[S L `#"[T3R`040 0 0@ D 0 MT P P P;SBY 8=TL 0R` R00 S T0+P2RT 0+00PT 0PL uPE `Q00 S T T; 0C ; T 0DX #0 H0P0X00S+X#0S T L0R 0 0 L0 X DTL 0\ 0/0 .RdDX  0`X 80S H 2D000 0 0Q 0DK 0 D (Dd.. -L -LM@b-b- b -$bPphk-pc -LM$0  CLPH0"v!&`Q $0Ss0K 0S$Pp W a\0!011` g01$-$0 Ss, , 0 Ab +b +b +Y00X0S@0 bP` 0 40 ,@! @d໩ 0 <0 !< ᳩA@ ௤ 8 !8 ᥩ @ࢤ0 $R  !0喩00@ ᒤ0W$aP0000 !0011, ` 4bZ,8bW,<bT,XxbL, g0X b?,Y b:,Z b5, Ab G+P0 l$b(,0$0f -LML`$ 0C#6PH SpP@ 01@ST0S @ T0!@R00R0S TH 0!P y 0-0PUL@0 !P!R 0SC Q 0U0000hp -LML`\p0+S# $ 0l#6S <$HH0#X TXU:U : lH sPL 40040 k$  '$ 0S $ 0C#vP@ LP0SB \ H0  0! ! !R&\  l!㇣00CS0 $0Ss40 040H L@$0  CH"&0000000 0 ! 0 0040040  B i -LMLX30 1,0 Q@T< 0S%0 R"2`)"pW0  ```h7YW  30 0C0,0 q2A02k3XW8=020 Ko p-LM"V@``  00b0eS $0S 000  po$H -LM@ b )P$ !ˢ0 $R01 0$0 -L@ MT, p$PnP1``0@Sd\0!10 l1R0011  0S@SM !R1 B 0 0 T@T+Q1``0ASdQ00!a11\00!11`  J 0T V00!11`Q @T, 00QP00!11n000 p -0LR@@``TPp X$ !@RT01 0@\ 1  ! 1 @ 00CS0  Q00Q0S@ `FR00 -p@L`g@PAU0$ *  A0 0$bp (0S b0 (0S0 b (P0 b )b)h0pc$  ?#>C@0cd` -࡟LM|0x 0PbU|0`2,0 1, Pp` a1  0 S @00L l00C\ 0  "!80 00 $1C&  0 "!0 0 R$ P p0S00@@ , Mx 0 0Q0x  p0Q0p   b'(@8o4mcV pRdtRd`bRdRd0`$d |00`|0c-8p0P0 0Cp  0  $dc 0-@LTP 00ST 0S 00 0C 00TTp  0pP0002 020G6@$dc -LM 0@SH0 S p00Cp0cP0 R0S2B "0 -0L@pT` PU  PR00R00SU@TP` p-LMP |P` P p@ G `202~0 -(0AL0$1@TPop 0S @TP \e0@S000@`p@ =0S-P@ 2! 0W  8 02A,  , 0%& < %0@S 0< ^0  P1P@ 2"A0 2"T 3P<01 \ p`P 1S @:Pp` W W 0 %&:40   ,P@0  !L!0Q =F @@@1@T= 2 02Q0 0@S 04$P-2@02A DP0 2  4 XD202.30G 4P40 17\d p-LM@`Pu 0!6V0030  @T  p - LPhD -d0L@pT`  PU,0@T` -L@@\p`#(^$PP 1Q  Q R \P^Z0P P U 0!R00R0SP UP 0-L MP@0K K/@@ @ @@mP0  S /C 2I02m,0 000`` -L MßA pWP@`, 3W 3W UV  , 0p @ PjVP@T 0, R @T(c((@ 00Q00P0 r@00C\ 0  "!0 00 2C&  0 "!0"0 Rk@T 0, R @TP2 00@ 0@,0@0@0S 0  0$0P$T 1 @1 bB&! 02 S3ʴ1b1 R0PP00P@00C\ 0  "!40 00 1C&  0 "!0  Q[ 2YW#, (i"PeTU  0 00 0008F0d0X 02D/xr`77`pRdtRdbRdRd0U bbb`p000 p-LM@\!0` |D R$0$0$0  KHQH1H ` 0 b01B&! 02 S4 1b1 R0@@00@@`00C\ 0  "!0 00 0C&  0 "!0l 0 Rpph"E0L0p|`pRdbtRdbbRdRd0M0Ѝ -LM4, 00 (pb ,00!` 0`P14 1 00<0 p ^8p p0#20#W@@ T @:0Pp`WZ ! 0 04,  08|  < p& 08 0 P Z l 0 i0H54 P 0 Vxr`@b 0-LMPW P0 4 U 0 0t 0 0h2@ 040 U 0   40@b -L⠣M0p00 0RP,0 t0,0! 0!@T 00ST "!  "000\ U 0 "0BU` 0    0R0`00 0 `X "KC "2 2,0S)V U  0HccP000 0  @0 0/V U 0 iV U 0 x0006D"U 0 g ~` 0```-P@ U 0 M000  @, cU 0 <0H003U_@50,4! 4!'c@b -LMϟ@ϟ R/0 *0P < D @ 0 E DKP1 0@8P0 S180( D0P  4S R0 0 0  (0S  .0 DKΟ000( LQ00YPd.0  R`@pP @ $0 0l ` #6P`1`!0CS00L0p0 Y  KH a 0 d0@P0S Q P@T3 D0 KP0 K1) @TZ0.P00S  0S 0,^00S0 5 0@000̀ ,0 0K@40 b 000P0@ `K 0 0 0S  P@ P1sS@TZD0 R 0 aDK P@ P00 0R 0 P P  0S U 0SDx000 R  04 D0 Œ0@hP +80 :p h0R  2 \ (*8@0 D0Ez'202dʟ@101P` 0+ ^VV*80 V h0p R0 00 000( 2 A020@ 0Hc0h00C0~ 0+P  'P 000C000@ 2022"0A 2"`H(80 Y|j TG P`  ` 004 ``@T! 4x0,0! 0!Vȟ0 10140  00S    PD00 4 Œ@0P 2 C0280 P7p h0R,A2\ 4'2 C028@0 D0UA2&2  0!6 0```*P " E'2H0222020 @+P0 + kA2202&80 şp000SA_P` @| 0@@* Q00V@@T( p 2& 20280 `V 4Dp h0R =0x00dtğ 000ApH 10 1 4101&022@ 02i&0@ 0 cH0@us ,4104180x#00000 P0K ,4 @0 0a0000P0 0 0K P@ P 0">280 840 S000 0  0Y0P00 @%ST~22  0000 $% 202f@0@ 0HcSP T@80 T0 I %L0 00040 D04 0Q 00!202, @0p  K0DK P@tY 1S0K1T0K1  aP 00S2! D0V U  bc@bpRdtRddRdRd0b%4000D0 00RD4 \ 00Y PUPPUPv 00v , a@P 0PY fpN@T 200S2S/$!0 !80 m1!0P 0U00D`K L0Q:P0Q:PUB 00C\ 0  "!40 00 H2C& P 0 "!0t"0 RU{  P"  Q-Lp@`: 0JPPJT: T    -LMHp0@P` T 0 iJ@b -L M, K@P F TP8*0K bP; , $0U %, %D0S/ 00 "Q4pK` @/1l1 0^:0A^`:?0sd c!401P#Z U:W0b0 0 `0V dD -LM0 P 0 X` @㌡p`?  <P$ 0$  cR 540 X(@ 0 (0 @ 0 00U X 0 0  0 p 0 0d P000 `M< 0 |@b" -`LMPΌ@pTn@@0 ``0 @0 TP 0T0Q00S 00X$ 08V@3V @bV cba`- ^  0>0>0 S   -L MRP,A`  |*00΄S D  0o0 0_V x p-LM@ ,Q^,00`0,0*z*0,1pV 0 00@- @58 0  0 @2(  0P 6@c -RLMb, 0@00,0( tB00C\ 0  "!@0 00 ,2C& $ 0 "!0"0 Ri 4́,000C\ 0  "!0 00 1C& x 0 "!0T!0 RF,@1*0Pp?x,0`  10S0 ,004,0`00C\ 0  "!0 00 0C&  0 "!0d 0 RX p000  $^pRdtRdRdRd0V c 0-LM@P Q 10S Q\ 0Sl, - 0P P:,0 0 1C0SXbcb -0P@LT`p , 00S @TV 0 R@W m!@U0S10S SL0 Q* Qp `0SPXb"c V -1Q,@ L , `(a@00C\ 0  "!p0 00 \1C& T 0 "!00!0 Rh10 S, 8 p@00C\ 0  "!0 00 0C&  0 "!0x 0 Rh 000L,H0* 0h2tRdpRdRdRd0cV -|0LM\ d \0+ KK! ,|(w#$' ]c$dd -LM8 04 S8 p0CP}:wp 0`ZC%Z0>0>0S1#~0Zp<0  40,K P<   X00 P00S 0 X3ZP<@e, T @!8 z-!< P d0p` @000 `E900  sP0000,l 00K R X00 0P<\  $ 0 RV @b" -2LM ,0 0`xp,@p夐PLA P 0m,l^,K 0  n PP@ 0 P00(\dd$d`` `cKd'V  -LM>\0ǠȠŇ@`P'0 ` p P` P000?U 0 0 00 0P(m\ PP (` -0ap #6RL`QP: P@ 2% " ZU:%@T  P PU@  0S:P 0S*2 "!6pi% -0a #6RLP Q@: PJS% T: R p$`QV  @P 0S:Q 0S*5% -LM.0 L (0K^ #̌P#@ 0p` @ PC ,1, UL0`pc!  0 4#@T  ~0 04 gjzZEU``,4D0 h p0S ),0 V Kdc 0.  | -L M0@ࠟ`p P000 `700 P0000 . .,0K  d90 ,P  0 @b" -LM>L0‡~(K0p!l0 @ `P `@UPJ<1, WL04 c P` 0P@  4 `7W00S,,4P `00 @@@b"@Th40 44 4 zG(Z$d'V  0-LM΁LL0K! (P@ 0P0$d' -LMPNPA@Tp`Ll,K, T0   \$ 0,6L$d'0 p-0@LM P S00*yP0P0C& R` 00#!t000 `0C& X 0 "!04 0 Rp/pRdtRdRdRd0 0- @LP 0* 00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00htRdpRdRdRd0 -`L0S0 !,B$R0 00@T \p\P 0@0 T0,  S(<@0h}d\`V ddԊ0 3  -LMXXqXXX 0RF@ vT@P`TP P1 0000@0C 0 ^  0!!  0 C6000 "!d0l  Q,7` 0(4 5dV pRdRddtRddRd0 -414qLM  a  P@0T!6U @]5P00C\ 0  "!0 00 0C&  0 "!0x 0 R h 0S,)70 0C 0tRdpRdddRdRd0dp@- 0@ 00`000 C \P  00#!x0 00 d0C& \ 0 "!08 0 Rpp@pRdtRddRddRd0 -L$AM1, `  0 SP000 p`00C\ 0  "!0 00 0C&  0 "!0h 0 R0  ,00d PpRdtRd@bRdRd0 -`@LM,P00LP (@DH@@P@!0@7@@@0@00 00R 0PP`@0p0C& R  0 0#!t000 `0C& X 0 "!04 0 R i RdpRddtRdRd0 -L M0@Ā`p P000 `400 5P0000 ,0K 0 ,P 0 @b"000 p-LM0@0CS0pLP $Q$1$ ` 0 b 1B&! 02 S31b1 R0@@00@@`00C\ 0  "!0 00 t0C& l 0 "!0H 0 R phZpRdbtRdbbRdRd0 -LMPU 0S 0 0`0UpU @S 0SK 0S' @0 R 0` 0S0@  0V@@@`vPUPU 0S i0SP0a0S0  0UPR@T@PH 0@T 0S 0S  0R ` 0 /0@S0@  0V@@p`@T 0SP00S0  0UP@T@pP -LpR 0Sc0R` @T` PRd R 0S 0S 0S p0 0Q 0S!@ T0 0R0 0P 0S0@  0U@@@PPU*@ P 0R 00  Sp00S0@  0W@@@pPU R0 0}0Q 0p r0S0@  0W@@p`c@T@P{ZP `R[ R 0SR@Tu 0Sr T 0S  X0 0R0 0P 60S0  0UP'@T%P@` 0 00T Sp00S0`  0W```p@Tx t@0Q 0p 0S0P  0WPPpP@TP` -LM `R 0SPXPU  0SY   @pT p@TPXPU  0S@\PTp 0Spp 0RppU @~@T p-LM`@PP  0@Q : RP T0 0P \PPRpP  0 Q: RP0S 0S0SQ  0PR 0P  R 0P P0 Q0P ,0RP $0 $0cc0S  0R 1P 0R 1 0-LP@@T0 0-L@P(0Z0,PS 0h0 p-LMP@(`,0QV php 0-0L<1PU9 0010 0x@0T00Qx000C\ 0  "!0 00 0C&  0 "!0 0 RT0 T00h0 P \L@TPHL0@4Sb`pRdtRd$dRdRd0V dd(@-T0@`p0 0 0x00 0P0C& Rx 00#!000 |0C& t 0 "!0P 0 R@,, @bMpRd$dRdtRdRd0dd -<0P @000%P.0%0 P0000 ,0 40 PP D0V $40S000 y G,$0\f T  ,0R ,00 0R($000,00p ,04P$ (40404( 4(040 0408R8<0@<0@@DD@PL H   0H@L000 P p0p00 0R0 0 "0 W$ 0Rp%,0U (04SQ ,0 bPK0 P0K P Q40|808 Sx<0<St@0@SpP0DSlD0SiL0S 0Sc0P 0 W!0 !40S000 400S$000$000 00 !0  z0,L  a,Ȁ00 R* 0 t 0 PP0\ PP 0P00 @b"V d`dtdd0@- 1@P, \  ^:\ $0S 00000S( \ 0^5:$0 ^%:\ 00\ $0S\0000 0^:dd -LM @T`pP 0D @዇P Q0#03QP U ,0U 0S: -LM 0@UB@N@N@ -L4ML0 40 0@\@K@ P*0 P0\h\ , KYP, V,$0 D V* 0P  Q0#03QP D0 ,0R 0S:D4 Z  @PK0@400  D`@pK00K aP(Q, 0S:0$ R:X $0R *0S!* R 0S!$0 S: 0S* R 0S!, %*Q $ 00\*\0 5@pK00K #PR,0 R/*X $@pK0 00K P0D 0S*, , R 0S, %*0S05,0 5:$@pK0 00K PP`Z0J0 0  @  0 Q,0] Q[:D RQ 0SD 5$50 5:J,D 0F ,0RD $0 ( -LMLP`p V `1Wp!V`!, KPdP,0@n 0, R0%0%0 T0,0 A 0S>*$ WW:D0 S`aK40D (00 R?s0 $ d`1 $ L0( cc40 040( 0S0000C0  00, 0h V0 ,@ @ 0S:,000 $ L0( cc*$ v0D0L  0$ ,@ 0V0S00 KdV P0-L@P L0P40 ( 00S0@T0(I$ BH"& -LMpL`\4`5@P0 0 P  -LMP$ Kp`@P* $ 0S $0S(0SLQW# 0 S p0P 0$D$0U @p 000C0$@PTU0 S 0000C00$ 0$ -L R0ԑ00đ\0 0R010201<0 0R*000000Xbc V NN -L$M0 0 4 S@P` 0QT, K^P`>,0 $@0\A 0 S:2\7*Z`!>20K0  0 @]P 00 >2Q2^:40`, R ,00C,0,(0, Z ``0K "0 0,0 @p` -L$M`4 :#:S @>0. Q< "&0D P@  H 0@ H0 KzP @ 8 0,@PL@  1 0<S-*$<0Q*0 Sb 0S_$04 <S1( (0 $Q#0V)0K*)K j⊸Vp:00L00 S  0<S: 0H 4D @L V8 (*80S0)0K 00 HayP 0S)KZ )0[ S  )KjpNV:0 , 000c P ) K @ @b -LM 0  S 0` p @ 30S0@0S0 (PU`p >0~pW  0h:#:S P:SQ:Q:I q   `PS6 4 0 6P 0SR  R ,0( 0C,0  ,  0 @`` 0K !P000 P q ,0 0R,0 $ 80SS SPS P9 QS@@S- 0   000  : 0K  0bPH  10S     0@ |0 a3P80 J,0( 0C,0 : P,d VʦU_  R  2 0R.* [ )  -LMP`@53 0S0 *"*@S>0N`b@P $*T p  00l 0 T, KP,0$ @D( ` 0 CZ @b -L Mp0*"*0>0>0SpbJZD WB: W@ @0` P000 `00 P0000 0P ,0K 0 ,PnD 0 0  0 @b" -LM ! ^>0.@  aR0@  OP@ P @@ -LM*"*>0b^@0  P@ P@ -L0 *"*0>0>0S b^ TTTt| 0 /  0&  0 -LM*"*>0b * 0H ,6S# `p0d,$#&@PQ : 0`\:bP  c -LM!>0 a 0* FP   -0LS   0 ` P P # -L  -L$M00 R0, P4 8 0@000S ,0>0>000  #20#0 Y030"8S8 p`004$&0! 08 0, <  P@<^0Q: 㼂`p0 @000"`W00t P000@/ D2 H)&R R ,46S @ ,  !0 ^,0 0P@,p!0 E\ 0 80S 0@ ZT 0 < O <\ Thf 80S   |0@ 0 P 4 00 T|0 0 , :#:S !@b"c 0 00pRdtRd @-@00C& R 00#!l000 X0C& P 0 "!0, 0 R@SpRdRdRd0 -$1$qLM @`Ph `%60AT 0 S, @TP00C\ 0  "!0 00 0C& x 0 "!0T 0 R 0S0StRdpRd$dRdRd02S,2 R 000  0 " "00C02 0 R l0 000 202  B 00 0202 R  0cDdLdTd2-0C22HSD000   202  B Ddc -LM2@ P0 00  202  B 2 0h0h0   @@2402   G" @002cDdLdTd2 03 R 0+ 000 202  B 2S2 R00|00 0h 00  0<02 0   R  0LdcDdTd202 202i0@-04 "QP h@?!l!0 ^:0A^P 01:?01c10@0V d -LM , 0 "X00 ZY"0@0ŸT0d0l h`x ^ `Y0  a0<"6AB4  8 n0YCQ< <0 b40Zi8 1P0@8 04j Xf4 "*p@0&04`  8pj0>00 00>0 0 0P  P00( ,0d 0 @\00`T@@0DPXL@L  00 0 c8.=40;$dDd0V DbdB}DbcDbtd4V  -PL R: 00B 0 0 P  ;c  -LM,a> 0R^PA0 pW 0gS*:@`0S:>0 N@ T *$PK0S J $T:|lPh5*DD@Y0>0>0 08V DbDbPdKd| -LMℒ0SP&J1l `!db@0SP> 0p`S@`0A8 PNLZ0S J1` @ 0R:P@DLZ60 0 R    R  B1PP @P0UTY: 0R( 0R0S*0B60 0 B0CR0  R  B0PP @P0U 0R*60 0 0R0  R  B@0PP @P0U0V d$d 0-LP@KP@ T0 -LM,  \00 4 W 40SbX%Q*!p WN `Vx!0S`VT!0VZ: R`4A (A0!X:`V!0P0fUq څ1eAD PEU @, Z 00  00O0 0040t 00Z00 oX9T; @P 0<0~;4o{;(|9c H0V ddh, -2L M0`V"` 0C`V PUPUTBd1D">0> ,0 `p,0P0,0 { `V!`0V0ؑ1 0 ` 0E V `h0dP-Q^& Q 0 0 00 0 0h `0! 1 h `01 0h` !60!^` V00@0000C\ 0  "!0 00 0C&  0 "!0p 0 R `0W 4 , oM4o:0V d$dV pRdtRdRdRd0DbP - LM :0\ , 0` @,pP 000 p:8 00\,:(:$0$do:0V d$d -LM0K`C <04 R8 @0R D0RX 00S, 0 Q00S(0QP <383L Q ,3 Q 4p pV V.8 0!PU R0000 0   B 2 $00C$0Z 2 00` 008 08` 04"0KY 0 "0I "P2 Z 280Q2XK 1a @ h0`"& 000 0 xP@0@0C\ 0  "!<0 00 (1C&  0 "!0 0 R  0P " "0001PUhV`LL0!PU0ZQUVQ:cld@b$dcpRdtRdRdRd0 -LM`^pR B2P   0 h` #6\0! 0 0 00 0`P00C\ 0  "!(0 00 2C&  0 "!0!0 Rm R 000 0 0 " "00C0"0 0"WR 0"LP D1"p P @h0`"& 0@0@0 0 `P0P0C\ 0  "!0 00 0C&  0 "!0 0 R @ 0` " "000pRdtRd$dRdRd0 -LM2@ 0` V022P  䂟 0 h` 6\0! 0 0 00 0rP00C\ 0  "!h0 00 T2C& L 0 "!0("0 Rr R 000 0 0V " "00C0"0 0" 2a aR 010  0 " "00C02 0: R H12 000 202  B 2S02 00C 02<20P0000@0@20$ 0R00 D iv R d0V( 2 0 2pRdtRd$dRdRd0cDdLd4V Td -`LMVp At00TPPU `V2  "  0S 0$"2 -XaXqL0$ R0D0 2@ TPR1D@h R0000 0   B P 2<20 0S0@@@ 0$ 0 0$ \0 R 00S0@@@P 0 00 c$db p-L M K0 "Q `KP @/1l1 0^:0A^P :?0s8 c! 01pV0b0 0Kd0V d p-L MP`@ 5@@@_t0l l0@@ U00R0S 0̠ W0U0V00S 2T 0  TV U0P0UA  V 0!6 P0 U00R0S  0 0  0 0 -`0@LTpPP P W* 2$"  2 02l10@T0 $C02 zj!2022  0 p   0!6 000 X0 0,A0 0 0'd -LM800CV!   bp ` 4Z00@#:0#T7H@T 0Z0!02 02 @TrX 00 \P+ Рd2@ Z00S !2022@02H@Tb$P,)********************************** *(* -1qL!MQL 0Q 0@0`1 H 0P@ 00C& R 00#!000 0C& x 0 "!0T 0 Ri340 atRdpRd@b$dPcRdRd0 pp 0@-d@0/C2b,S03S0#S<0<<0bQ/BR@ H@0cVUUU -1LM|!xQ000d!C`A0\L0 0  "!80 00 $1C&  0 "!0 0 R0PPp `@ 0GpX 101k, 0V`0  @ ?CSD00D SD0\4 ,0PR0S/tRdpRdRd@b$dRd0cpVUUUc -L MDrDDDD <00\0@y P\"001 @00C\ 0!!  0!C6000 "!|1  QLU, 8 0 08 @0B6C Wp  402"  Q  2  Rg 2d0 `0K$ T  T63#202y 08! W8!  2  0a h0K @0 0@0!6 @k K ; P 202 @@ T  K 0 !6iD 0 P  ' 0!6X 0P P@ @@ 2(10(1,10,1#c -8RL101L@T@0T1A d0SsqP1d0Sf@D 0 ^pc@dlh0PN 1@T ZW ڸ X@ ZW"0S00 0C00"`Zھ" 0 P  W:<1pG0<1 0!6 P 2J02 J `2"02p T00R00 S n8,P101zcTdDdLd - Y3 LM>A0 0 dQQ:34 (0  0aS < 8 00`VԢ'PQ B/ 1b10 ^:0A^P:?Pu &Q` TB?!l!0 ^:0A^` 01:?0S p,1c(f1P12" Q4 0*R0#  R <P, P\ , 4pABP2#40,!0Q!0000 00C0" $00C$0" rppp" 000 PP,00S ,0 8 l0 < RP@0RD 0S@ 48,KP0lP,0 ec0V d$dld -LMp@T' P`Q0000 0002.00)0@$0$ 0R@0$0 D @Ti$dc4V -@0LM@T 0( T  /@HV | p-K0C+㸣P@A fT1`|$P@]0SEBKAG>KA0C+㌣P9 1` Y( PU! WpG 4 O#J6; 0P@An0$P`@(DTU WpG Y$@<0@d 4 Hb d`hbDbc -L|M@0XpP 0 0~P@80S S @0X 0 0}%$ d2!b10S pP 0OP$K8 4#RZ 0`E` 0 VP @QCN@ 0 !+0P C@\0PP@ 0R50X @00@0 0X!000dh00h04!T0H0 $4>0CFT0 0NP`d6+3+4)0 >P 0K 0P@qp KT$;H PP@cT0P H0L$4 R00P4qhbg`LV 4cb@dc p-LM0@( +($00PPP(0; (P` 0 00p@80S$ 0@ P0  t$h00bh0@;P aL0(,$0!0S\p@ (hbcDb -L M @ 6@O -L M@ 0@yO -LMT0O$K4#&:@UPI ($@@b0O&8#J6$Qkt7 QoA!P000@0T`P0P0C\ 0  "!h0 00 T1C& L 0 "!0(!0 Ri?1 @0 040@+00 P 000vP0P0C\ 0  "!t0 00 `0C& X 0 "!04 0 R i'pRdtRdRdRd0 -L6LH$M@08 0(Ɵ< 0$PX @ @0@0C\ 0  "!0 00 5C&  0 "!%00 RW@ 00  <0O8僄< RH @ H D 壛 80L$@D ?4 [4K 00K, KP"00s, 8  LD ?[4`Pp40D, 0 ` PeT\$p0p0CH0UP\@ 0!! 0$C6000 "!3  Q<0^$ P0l$ R': 0S#:06>0. U$ % @0 b$Kp @P$0 0c#& $ a8$  e$0 0e#&BA- p0Q:>a2 &#l"b0QPop*H00p "F!V: U p -LP)d0K`P%1 00 00`0 <0S(0 (0,0@0,<0@0 0@0?0 005|0 !b  K0 P0 (0S|0 h0!b1Q L#0D 000@  oDb@bPV g`hd8`000 0-LM0@C^/<0 0P<0 0 0h醧000  0S 00000  ( R,0,0,0 0 00 0 0-LM0P. 00@H000 X0S @0000t P0S0 Sj0    (Q,0,0,00 000h]!lx p-LM`@PV00  0S0S  ( R,0,0,0  00pVp.! M-LM t KP00K @@ P P *?0@PKp0@@0pKt0S@#&: pKPo`DF᠀#oጐXQᐐ \ t0 R Y PU Q$ x0RPUYtPw @@ l@ 0U0Y00S@`Y  Tp嘀W0; Y% `V$ xpRPP P 0|S: R 0S* "5 0 S Y   0R@`TpKt4  2Q. 2 02"H  2 @002"02"10# 02뺂 `✀ p 倀KhKtl l Kp0KP@ P| p`0V` 0{pWWl0P` TK 2D022 8021   2Q p 0 R 0Sᴶ\ T T娶D  !! 2 02᧶P20t SY` 2ᜀS  t  Qʚ0pSKtd Y 2ᜀSt P 0R@KtJ K"72 `K@: UpWXKt\ t0S @t0#00tP0P0St`0 tp=00 K @K 0KtP} 0|@Sq:`Rm 0pSi*202eK K Q_0@S[PKtP2K02@:`p\HPD p-LM P 0R 0Rp@8 @0`<P` P0SpT -LM -LM@8 000 p S0`P40 1 s @:Pp` W400SiP,  W 0 040 2! "0,00 1p P`P 1S @:Pp` W0W 0   3\0  ,  0!,0 @1\ B,\, # \ ,K 0P@,0"@ ",,01,2202, _,Rx -L4M@00# T p` Ẁ"0 @C0 0S 0S RT %P00SX 0X 0R0t T 0 SX0pP0 0 0S*pe0嬡@@0K`P KH  4 Lp D 0 8p , `PI 0S>0HK 0 0P@/ U8 W00W00SbP R00Q0#02SXT40 0C0 S UX0 aP 0HK 0 <PP TX @b p-LM0 PU@ p0 S@`@0P0@0    @b -L M0 p` 0S 0S0000P p-L M4a0P $ 1 @0T0 U+ T0S( (@T@T 01 P0S <0@T0 phg0  (Q,0,0, 0<0000S @0 0@0000S0@@b dDbDb0S@-*@,  0 000@|V xV  RQ-L 0P0000 P 00S000 RQ-L P P 00S00000S -L@M\TK K < 4 <#:0K [0*":("000v 0-PLMU^ KK @<4 Ġ<̌,ʠ#:0KK@ P 0[S*0":(0"$000K( -LMT2@P H2R@p 3S,0S00S}40Sz80Sw 0  QV 0`Sh0Sg 0  0P\ 0R,0  0S0sJ 0SI R 0S0S0S P5 02,\ ,48 <#R: P, 00:P @0  0,\,, P , #;010く/)d@b d -LM0@,0 P00 4 80  0  8 h0 2 "` 2"`tV;40S/ `@hT@D!ڰ00C0PP*` 48<#x6\ |,,08K:P s;4\400040  1h0` Q0`` h40S) `@fT@Dڰ000P:P` 48<#x|6\ ,,08:P4\40`4 ꪌf0` Q0` hP ` D D D D  d -L0M∢ 0 ( L H SP`0S/50S 0S 0S0s ,0S00S40s{ DKD`K<@KH0K Pk H0, ,pLKP L0S10L0 (0 S h(!H0S<0H0 Hn,0sS$[ 00S40S80S0 0@@9P0,0S 00S 40S80SQ  l0` x0cl R:1<4< 4l :0 l 1HbPxY` -L4Mß Ƞ, 0(,Y`P\0 "P 0S PŸ,0 S , R 0S0S0S R P0s ^ HK ID0YRX T0 Ÿ@KY2\\ 1@ 0TL0 h0p W@X YR,0S00S 40S80SH0S 40G 0T00\00S @0S l0:0\/  MP@0S X 3S@0S<0S80S40S ,@K MPZ 3 SP0\ 0RP0 L,@K MPT MP(HKsHb`Dm Z` p-LM`P@ PSM00P3,@0 p p-LM`P@ P9M00P3@0 p -LLM☁0\PKp`@K|A$0 ` MM8KX@TKD@0`KP ?@K[@K@PKP\PKP@3W `\ $0S $ 0; W` 800C80` 80S080``\ @V 0S0C 0 0` 0 0@`80 4W0,  $@2Hb,p 0-@LCPP 40 <0$wU800C800 p-0LM@PT` 0 LPPUʜ@TU pP 40 <0$ 800C80phE)dPx0 Rl0 P P 0S P0S 00S A (A Q@- 0`SP*0SP:P *0SB  RP *R 0S2 P*0SP: -LMᐈ@ppT, P` `8T VX P8T D8T 88T48 T (8T$8 8T*8T8 T 8T 7T 7T7T*7T 7T7 T Q 0Sl 7TB7T<*7T .|7T" l7T{ p7T d7T uD7T V 0S-,0 S $,: d0lY Pp P; K`PK ` 84K40[S/ Kd@KxK 1P 0 1\@0[d 0@0K@["tp0  K@ KT0 P uP 0S \00\0wK KuPpQd5T T5T4` (K`P&K ` K0[ pS (K@K K  1 0 1\K.uPp 0P WY u\00CS\0`4T? !T4T L4T8 r 10aR001#0p 10bP001#000|3T 3TV @J1.,OjVy @J1 qP#0000q4#0000L|g!3R/W2TO 2TZ1Z2T 2T2T |2TW Z p d2  R): p @2  R*0S  00SP 4#$0$  R 4R00$"48<#P g1T X1\1^d1Tt1T*81Vd1T T:X10SPW  0n$1T3e x^aWu 0T0 T 0T0T*00T 07FHbku$juPliHLi0UiViii`ei@gi`di@fi@ii"i !i i ixFixi %i i Ri Ii Qi Si Ti bi Gi Mi >iNi0WiHPi Oi Ji(Ki -\9LAM`VP0p, P 1  4 -0S S/cH0S U8 Q1 HPTP,蜠K D 0[S -0S h@ 0 SRh8 RU5 H0S |0SH|0[S\ q'0000q'00 00 0@P  =d00d 7@ 0 0Y0  p7 ,0S h, P0004S Y  P d0 ckK(I4$#Ġ0Č6xK7K4p0 0K0K0 .Kl 倀KlKt0 P 0FS0 000$1 0dKI\K0HKc0KdKH@Ɵ.D@KD0HKCKHKG0K|P@  NP 80S0C80Ų@T 80S0C80Œ0 .K00 P@ 00S 00$10h5 H0K P[ 4} DşHKCP@7  NP 80S0C80@@T( 80S0C80 .K xP 0S0 00$10Pp4 R(6  0  `GOK@pHH0K1 d0K1 (4(  0  \P   .K<P 0S0 00$103 R   0|oi@K@7HT3(0 H0K0 d0K 0 #P  U WI2 R a 0 Y hK HHP 000 ` P0 82 R 08L cPp 1 R0 1 0% P IRUS  7PP7 G00( 0 )0 X1(  4 p0`00|00 RP 0S  0SP00 0PR X 0 R 0 R 0[S0[0S[Q4#$0$)K$"48<#Q $SHbT\`b@|Lb`b<P,)dX p-LM@ P j0 `0S R Q000C Rph 7P0`00 0p 0 ` p-1QLM` @  R0000 0 T00 0S S 0S SS0080SD0@ R9 \00C\0 0@ 0 Ws 0S0C 0( @`00C\ 0  "!0 00 0C&  0 "!0d 0 Rpph߽#8 $tRdpRd)d@RdRd0l 0- LQP 0 @R T0hp 5 -LMM$0YZ,0 0P X1  4Q x4Q -`4 ,0S X,0S^0S[F/0SSV0SSRQO3XS O3X0P p@/`KxJF  J KJU00  3  R0TK\0KPhP 0@ X !xK JU0h0  d  .P` 0@QP@0pS0S 12XKOKF0)v2Xq  SK _J0T1 `V OK0 S `VT\ JJT< PU p ` 0S0C 0 00 R 0PV PpP 0ST PU p ` 0S0C 0 00 0@0S00PVPpP vhFb@-|0\ 0S \ Q @ 0 0R 0 0^@0 0hFb p-LMp`@PT 0S @T 6}@D0 0P0 S00@@ phFb -p0LM@T 0S @T P ] P R0600 h4hFb -LKMğ0ğ,0 0P! 00P1 \` 0S\,6 +Pp 0 0 PU 0S:PU6DD0 0C\ 0  "! 0 00 3C&  0 "!0#0 R P1003 ,0S ,頺0SU P 0 0 0R 0OOKp0p0cC T! T\MK00 3 (K P!00jP0S+MB0 0C\ 0  "!0 00 t2C& l 0 "!0H"0 RJ R0600 i 0S0C 0) A0 0C\ 0  "!0 00 1C&  0 "!0h!0 RhU DS/KT1PA0 0C\ 0  "!0 00 0C&  0 "!0 0 RP700/ٹ0S\p W BP 00 0S pHbpRdtRdRdRd01i -LIM✁0a!$0 0p P 00CS 0/ hAp00C\ 0  "!40 00 1C&  0 "!0 0 R $0S $w"M R000 P 0S0C 0 MOK-RALQBp`Li  *APUe 0 S\D@ @\P0 S HbDt -L M`0 X, 0 2PU8 O@KT1 PU0 R) 0 P@ 0X0Ÿ,Ÿ 0 0>> Y 0 0>>P@ 0 0 0>P@ 01 @T p0S @T00 R YDJ P?J8 $1 R 0 0 \ P00Q00Si"QPW,p 0@ 000, PʿP, p0bSʳX0 0 R PZ#0lcddL&d|Y` -LMw, @pT`P 0S$ @TW  @T 0 R @TU0 0 R`0 h0 RP6,0SW y  Pp0|Y` -LM@  @0T0  0 R @T0K a$H0SA  AR 0 RQ R\0400SL LS:00S S* S00S S:00S S* PlcV` 0- LP  @-? &? ?BM0 -LM@^M ` ] hY -LpMpxPK0@X 0 >x0 p`K ? ZC0 00   00#0 Q  tHb`bb p-LM P\ 0S \pQ  R H00G\`@\ \Z %P QP ;PTT@ >P , >P T# T 00#0  p  >P00 0  00  0 00   B#PT0S k>000   P GPT@#V`V` -LM@pPvPT T oPD P1@T T dP, @T+Pa0S  0S 0 @ ` PpP@ P`p 6 0 h`0S h 0 u @`0S 0 < `0S   lcT\`<d -LM\`0@KP x(0 = r=4$#000K 2 8K4 KK |0 h qPPK< @0 X0KWK,@ < 0@ PF@,P 40 000K`=a M@K@KKKK 1 !0 1\ڴ0[00K [ K  gP (0 S ( gP/P t0 R0 T  KP ,0 R   HbT\`P -L|MPK0`x@ p$0 6= <LKhKK8@0 @P 0KKT0KSKp0KoK,P (P 8@ OP $0S D$80 0\0t Hb,hT\` -LM⸁QR Q$ p`]\ 0 l R .R Q 0ll RL .RJ Q?QDKPK [ e< [000[S  A0BS 000S |@KX<~K ~ [PK~~<00l0 0 $"4 4  0 @$0 S $"lHb p-LMXQH 0R@0 ` K5R= L0 S*$1 R  0S p648J0 R   0 R ]P\,KhPP  H@P'0/S9S0BSHbT\`(V`,h -L(MĢ0p(0 _+L PU 0` RP U PU `0S4 VPDPKL;0Ÿ.D pp 048<@x 0  @;( ;0@0D@0 0$L@ 00L@0 @  0L40`(0QD0 0@ D0 0S"@ R@T 0 00SZ @@$ \PP9 $6 048<00 <$ 0\0  0@4<2DL   800,0#2P,6  0R0P00S@T  0S@T Q  0cPT  0cPP000D ` VD @ 0SX0@T 0"R@ 8 }T8P w0S P0SA㽽Z @0`C⵽0(0C8#88#$(," @"(  :( :8 0Vw* :80 0 B0 8 BD 00b'0倽00C080! S P 0P U8 X'H0@\ 1 0@80Ɵ4 6` 000 00C0\0 0  "!|0 00 h6C& ` 0 "!06<  Q8 PDPP @8@%ş0D 0b0 %00C0H R 1 0@ş@08 T=4ş45 0,00 00C0\0 0  "!0 00 4C&  0 "!4  Q锬d$ X4Tğ 0T00 00C,0\0 0  "! 0 00 3C&  0 "!3  Q^#3  0tß0x0 0@0CT0\0 0!! 8 0$#C6000 "!2  TLR R:07`PG@ @a9PE( \90 0@8 8 s@ D 0SL0@ 8e(50S( p5PmWmO!00C0\0 0  "!|0 00 h1C& ` 0 "!00#08 HQW 1 0@M80HP1D|40  08 4P E,0K8 pFP<080 { , 0R0% t*LpFblFb|dpRdtRdFbRdRd0hY`x d, ddY`t ddd4 -PLUp `2X !@@8( 80 >pZ P$4D 00b0c 00C0;x dt d0 0   00 80<808 8<<80808 < -`sLM T0, Hß00 0 0R0 #00C\ 0  "!0 00 2C&  0 "!Ÿ"00 Rb8PU U 00C08P<0 Ry U\\ 0RP0  , 0R0% *!`P~ -LM/R, 0 p^ 00 S0% I:X 0 ` P0 3V <+V V2 0R0% :P 3V0000`QQ@0 4 ,0S , 0K>Pp  0R0% * 0 S0% :X dK+0\ d0Kc K\@Kl  dK0L PS@@KHK+0 H0KGK@0 HK 00 P@: 048 <:R0D0 00 H K\p 倠 |P p x 儀 h`K ,3 (3!10S dK K0 $(,<4<!4"< K0 l 2 R53f\@K  / 0K0 ~=Ppr  00R0% k*,Vc 0@S0% :P9 0!4 R`P Q 0KY=Pp  0R0% *_ 0R0%@ /:T 0 0Ra% 0S" 0S0% :P 00020C0 `P 0K%=Pp  0R0% *+ 0K=Pp@  0R0%@ *<V0K0 =Pp  00R0% *$0P@ \ HbdddV`T\`4 -L M@0(  $( ,<4<,4"|P@U110SPHDPK*0 C0KD K<`K0SG  P, 40" L0P0SS<1 R L0R:1  R' L0R$*W*0P@ PpP 80S0C80ڔ0@T @T (0S `(L0W00S0$" KHbY`Y`Y`,dY` -(LDM0PTP ,0 0S80`0 dP hP @p` :Y  HK @l@ ,*0@K lG0KHK. TP@0[S 1U17 ,0S ,?0[0S 00f\ @CQ#00T T 0ST 0S S\ R T @0Kd4@ [Rq R` l@K *Ph \0SR SK \ R/<0`0 f6@ 000h딦@0@0C\P 0  "!\0 00 H6C& @ 0 "!0&0 RU !5! 000  1C0\1 0  "!0 00 t5C& l 0 "!0H%0 R !1$@=)01@ ?`0@S@ S.ʰ4@ 000$@0@0C\ 0  "!`0 00 L4C& D 0 "!0 $0 Rs$ R 1 0+10 ,(SKpA @a0@RSD0SA La0LRS00L S:WA @a0@RS `A@0@ \-P+^pG`PP@W Y @*0.S@00U* T:8 00 S*80S0C80  80 S800C80 00c 0X. 8 4 0 , ]+p@ 0,00$@0@0C\ 0  "!0 00 0C&  0 "!0  Q$ R 1 0 +10 ,(<81՝ӝѝpRdtRdbRdRd0bb -QLMP`pd V00UPT0 SRJ00SSFPES`FLSH0SBj0S>0S:0 S6?Q3 ?R0Q0E\) R0FP$ Q$ @R" Q 00S00S &P0pi0\0jS\ 0jSg f&P -L Mp, 0p  4p 0SAR0 > 0`V @ T 0 R @T40S` pV,0 `Y0P }P P  0   P  000P &P040 lc -LPRM40 020 pP 0$< 0 W8 `x U @T 0 R @TWPU0X0`P`80#2   X0#00 PK EP<  0 <  4 R- R0' 0R0"00c,$,!$#,,  ,K)  )00S 48 A 4 8 100S00,0 08 04<#$ 0P<0 <  <0 lcb -|#L4M0Pp,0 Pp 0R0% :Z- HK&%0 H0KG K0c HKT0 n@T: h0 A@TW2 h 20S'20@HKLP0 LP,PP |2 ,0S t,,@LK@0S  PK 0 ,2P@ r0:S,0S00S40S80S , $P0S 0S$0S(0S T $PQ 0"0 # W (!0b-PX  h 00S!X/@P0LHKX +LP X9,PP0P0 pi1,@L9K@0S  PK X0 L0K t6PP7 L 0R0% 0*HbGd? dʚ;4 -$(LM0'Q,0   (\ 00S:p:00(L00 (( 0@℠K 0 ( (K%$P` K`KPK( Kl 0K@K $K`KPK  Z 0 6@T 0  3$P0 @T0[Sp RE  X(` 0: 0000@S1\6   0:( @@l 401K<1 0P Q 1 0@Q 1 0C0@\ 񟗗4L5d5|544444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444455555 6$6<6T6l60S 1 0@\ 3 ,0S ,0S1  0@0S10S10S10S10S10S10S1 0S1B0S10S10S10S10S 1t@K "KK0  tP 80S0C80 R01 R<*|K0 0[0S1@  TȠ }0-P+^TPK(@L0( ,- 00@S*-PL ( &@0 R 4@40(0@Hb)dXY`T\` Ll*. -LM@Px`upr @0 Fb -&LAM0p,0 `@0PK ~&Z - H6 R<6 R 0R0%P r:Uh  Kg&K c&0[ST 0[SH 0[S 5 Rş@0 )5 ,0S ,lKx A0[0S0S <5 R K0 ,.H@K!0@K KG0KHK&?P` 0P 0S 4 R80S0C80ŲK KKV @K !P80S0C80ž0[`S 0[@S KK !P00  3 R K KK*NK(H( /0Pz!R0 ! 僑Q I0 00 S T3 Ra KK@ KKI0PI 0PP !@! 0K@7 !R3삟! I20SPBdPK@K!`K!!0KxK c0KdK0K0KKKt%\KK p%KK l%FK !0@wP@K KK0 0KKV%% 01 R K KK F0[0S@@RT1 R K KKd= 1 R K@ KKx 0 "0 R K KKj0[0S4#$0$.K0[0S4#$0$-K0P@ E?K 2P p P  0R0%P |*LHbPY`Y`T\`\d LY`Y`LK4ld4 -(L0R@!0 0 h 000 )PU&P 0Sl P 0Sa 0SW 0SM !@( B("("48<##80@@ 0:4( _ 40 0@@P Y 1 0@Y 1`P 0@ 0@1P@ 1 ,0S ,!00S000 00S0 0 000S000 00S0 0 0a) mbA)i00ST\R 0SO 1 0( I *"`hBW%U %P000 L0 "L@00S L YWrU;HbdPY`pRdtRdbRdRd0bbd0 -LM`@PT :Rp/U U S*` T % \(`P Q` `"`S*`0S` # @M"`0T0U00S% - 0L PY`Y`Jb p-L M@QPP 40`00 @K@D0SL LP808 PpppY`J - LMR 40 S L00P00 0 H - LMR 40 S 0 0 t p-L MQPPP 0@S0 `ph 6P 0<Pp*p 0 phpY`| d -LM@00K p" 0@ 00 "@0P ,` U0@K!!  U0K  ?@0@K H p0 -LM`Z4Z0@!0c48Z0!0c4<Z0 0c4 DZ0 0c4 D@!390Q 00R D ZpZP, @0|PP A0 R ~p0H, 00 S0 L 0C # 0 0 R XYp@ꫪb -LM, 0PR* L0Qڂ7Z, 0S*@Dp`@40x 2@T4<@0 ,0H 4 800 _,b0Z` -LZ` -LM P4 @ dB!2b2c621b1c00Sڜ0P*0 R 04P:l0l  *$h\ dB!2b2c621b1c1\ 04V`ddY`Z`(d -4@LM ;0h;Gd4 -qLMQa@0 T00 0 S00 00C000CQ 0 "!000 t0C& l 0 "!<0H  QT В(dpRdtRdRdRd0 - LM(080 0 4 !  0 S܋'=Ћ'=P@ 0S ! 0@4`P0@ 'R`00`S L+0@0S1  #0@4 ! 0@@T  R0S 0S$0S *0@0S 1 Q 0S0s R0S 0s Q 0S0S0S? R0S 0S$0S4 0$  R' R  R R R R R R 4 \ \p Hy0S 40ZP 9P@ 80S0C80H000 03BQ 400S 8 R  04,0 PU 4, (0AS:(Q 0S a(%40Sb Y\ `0S 0S0sN 0S0S 0sE ǟ0@Z 1 @ 0@7@U wgHL0 S4K8K @T480\ Tǟ011 ,7PP0@0S1 0 @04 & g6 RY!  P4 |Ɵ@04  ,04 (00yD&0@,K0K4 K80KP4` 04%,0S"%0@0S 1 8 0@40S 1  0@4 0 0)S0(P 00Ps" 5 R5P@ <0K( +P4  < 0R0% *$40@0S1 8 H<0H R@04 1910 @4 R; @ 00  P3P@ 0S 1 0@40 P 0SPT3 R X`Pp@ 0@0S 1 8 0@0SP@ T  pP@T400SATP04 C 40h00S+ !48<#,#80 4 00S 00S !48<#,#8 0 4 00S00S 04 d1P@ 00S 00S 04 00S 46(p?$P4 V!0@Wc 1  0@0*0Sl> @ 0T  # 0@04S1#=#= `ddd d )d(d)d)dPY`dpY`V`ddD&d[`dlddT\`(ddtd|c4 -L MPp 0)S0`(4P 0 0A( Q0%(":P `@D 02P`P @0 00K( Q*PP 0 0R0% *,0K( A*PP , 0R0% *Rld4 -RL M`p40 @0S SP V g* }pP P`eV@1P@ SN SVZAP 0/0K P00(<4<"4!<^00 S: 00g0 @P,0  00g0 @P,0  0g0 @P*0  0g+0 V R*K "[P"48<4 #8V0Pˆʎtdd -0L0@Sp S 4S S 0@ 0S 1  0 } @0`P``0d -LMh@, P{l 0 RM 1 0(@3T CT +T'  PP0 p3T0000aa 0V#3T T +T  )0%BP@,0 S ,<T 1P@ <T (YPP  00Q  )0A0ShDK )0D APhh@`K 1@ [R R Y 0S )00 APhhf?0[0S03K?0[0S )0APhhMHbld -L M,0K@ 0 !3T+0[+0[pcp00@ 0T00Ds@0@0C\P 0  "! 0 00 2C&  0 "!0"0 RU5 01 00000!C \! 0  "!D0 00 02C& ( 0 "!0"0 Rr 00!  UZ#U !0 00l<  80S G$00 00lZ* 0 0 s  @ 0800$@0@0C\ 0  "!0 00 0C&  0 "!0  Q$ R 1 0 +10 ,(0 B 00C\ 0  "!0 00 2C&  0 "!0x"0 R7"4 40\dl S P@<~0SPP U @PP$001 j  !0K4K 04` /KP@00C\ 0  "!0 00 t0C& l 0 "!0H 0 R } 0'SHCtRdpRdʚ;JbJbRdRd0Jb -LpsM`hh@0P, 0 4 ` `48 <$C00C\p 0  "!0 00 2C&  0 "!0"0 RW 01 000 0l0"C \" 0  "!$0 00 2C&  0 "!0!0 Ri$ 1!  (0 0!40PP 1E  80S0$ 0bc 80QPp1 8 0(0, 0  z 00! bB!112b3b21c12c!b`0 0`0 @0 P 0OPP 7 0 @7000c0c ||_xBdpRdtRdbRdRd0bbʚ;Ad[`*d[`[` -L MŸp0@0 04 `cV/VP0P 0R0% P :Ux 0 Sr0S000g 0P$Ÿ_0^5Ÿ"p 0@R/*1R, 0<A /V800`S*0S 0 00/PP 0p1 p1!b100X!(0P 0K 4 [5@ 0  00@ 00@ ;PL 00@@0 0@0  ,0K &PP0 s , 0R0%P l* ,2HBdXBdhBd[`[`*d[``BdPBd4 -LM0 0 PpK, 0 U pᬐ `  QQQ<Ql0@S @h0S 0@d0S 0@`0(S 0@0fT0Sv0`0(@CT00d:X pK# PpRpp0pK``PF` R X 00`  `0 <00l0S Xq 0 0 l  l00lh0S X` 0< 0 h  h00hdP XO 0+ 0 d0d  dP0S  0S0S0S 0S @00 S U  0S  0R0  40 0S 80S0C80Ř0 0R   000  0S  R X0<0 X0 400  1 <R1 1 P0@UE 0S<  R9 454S2 4*0@\ 1 X 0@A LKP L0KR |ɟ,0 S l ,YLP 80S0C80LPU 0s00 tKR0x@K0\0K @Pt \̠t 4    R  R  R R  R R R R l Rx0S tt ^ \: 04  (R1 h0@t<4\<("4 0n0C0t S 0 Zd0S  00 h0S   l0S,0 0  ,00  QƟ6 @000p@0@0C\ 0  "!0 00 t6C& l 0 "!<&0D&0 RW Ɵ01 00000"C \" 0  "!0 00 5C&  0 "!dp%00 R 0!01=$ )0 1  5p (@PP   @  0KP  0b8#8 #00S!$ 00l0  04<#$ 0 @ 0D8#8#$(,""(  0) Pd 0 S  0S000  0 !##<0 p0@P 1 p 0@KQ \ 1 `0@p00 W Y0 pZY22P@ * |@07 X2P@ y0y(P 1(Q1{ 0h1@010K0 |0K! P1 @01 E00S>000:00S4 00S,0 0 0( 00S"00S!0410 P 00S 00S 0410  00S  RchA@0 HbdHtRdpRdbRdRd0bbddd\Y`(A d[`|c dT1<^<1<0    000S0 U 0S Q0  0S U 0s000Si P  R 1 P0@0S 1 0@4S8!0@\ 1 X 0@3# P 0SP1 R U 0S 4 3 cP 0SP@ T P@P 0S   R X0<0 X0G P:00SvQ 4 200 l"`P30@ X 0@c  P _  SLKLK  }8h-\K  0S@  " B\K B@Dlh d `~8#8#$(,""(  pKPppp~ `K ! P_  dK !PS  hK !PG  lK !P; D - RL M, 0 b@ 000؂@0@0C\P 0  "!0 00 2C&  0 "!0`"0 RU 01 0000 0!C \! 0  "!0 00 1C&  0 "!0!0 RWp0Z0ppq 00 S 0 ,0P@ 00007$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0+10 ,p(pc*a0  [ʚ; -L`P@\ )R1S*P 0\0T00S T T PP0p 0 :RpW 0 :Rppk 0 0pT \  -@0`TLpP) P$`U` 0S{ԁUX sP P`@{㺁 @{̀@@b -L4MT0pP,0 D5\P W`@8 0FSAP|T R 0\0 0S$0S \,0 S ,ƪ0S@T5u@PKPP` d4 R X4 P 4`S10`0-0T RTKkT 0 Sr3T0[ 0 T RXKXX0SX0[0ǕT 0SP0S0S0S Qd 0SQS0SI 0HKL0 0 H0KG K@KLK>L0S <`V 4S0S$ @T 0\  @T\ K₷P@[ 0S0 000@0QPT00J00S4#$0$ 00S1`1 Rj1 Pe `fP 0(T% 0S"P0S0S0S Q; 0SP 81 RA,1 P< 0`S @T1 V 0S @T' lPT  R000 +00S1#$0$ P  5{Pp7 $0P 0 0PHb@b\Y`x A (A |c p-LMP`@ U  U U -p0 0V0 0pL0 0 0V00V 0 Q40\Y` -PLM@  R Q000彶 R5h -L$ML0QPp,0  @00 Rp 0S ` Rv Rs0)S     0000cS 0,0 S ,00CSYhP| RO 0S 0S> ,2 Q6*Q 2 Q/ 0S0S0S 0S HPKG@0 H0KG K@KoP Q 0$R 00S  100S1#$0$ *R  ~00 SY R 0 0R 0" 0%* R  0 10R f R0S 00j < R 0 10R0S0SHb A (A 0-0LP@ P4 1 0'S(4P)  P P P P  00h}00S00000S 00S0 0 0 00S0ʚ; -LM 0P(S0,0 P8r8@ 0,00@0@0C\` 0  "!0 00 1C&  0 "!0!0 R\VV 01 000 0d0"C \" 0  "!0 00 1C&  0 "!0 0 R$@0@11$ =)0 1@@ @0@ 00( B (0( 0P ,Pgt n7npRdtRdbRdRd0bP0 S00!0S00!0<S00!P00! -LM`P 0R@ K:T 0S20 0q Q0%@ :T   MP000 @0 ,0K P@` , 0R0%@ *#0S00q 0j0 @P0 0(0K ~P@` ( 0R0%@ * ldd4 -LMᤢ 0\(0 ` 6 0p00 S0l B 0@S 0S0S0S 0S 0S  R0s RS 0S S 1P@ (0 S (媦0S  R0S 0S$0S R R  0s RS$0S S8PKp Z0S  S0S  00S !48<#,#8 000S00\0a0 @P0 0(0a0 @P0 Hbd p-\0\@LMK` `00P` 00@pKbJbJb -X!Xa p0L00 CSd0+PU@00C\ 0  "!0 00 0C&  0 "!0x 0 Ri_\0  <&0L ?0#3 0tRdpRdGd lcRdRd0\`Mb -L Mp0`S, P@F PC V 40 40T 40 }PqTZ!1  ,  0  0r 0 4@围@Y 4G 1!S:R+ 8C8Sڴs 01P0 S @T 00!1 1 Ba  0@004!410  !01!1 0 ! P@ H0PA@P\0S @40c@0C\@P\< P@` 80< 0CR80H  Mb8\`H\`H0GS S S#S 5SS ʇSS S p-LM@!`\ HP P p3000  00  00p#P00pQ 0 0S XupPU⊥ (h p\ -SLMpP@` R00Q00S3R`U-  mP$ W W *`X ^n 0X0P00S` U #*`   -1L M0P40 1, 1`000 101`PpU0 @W(0 S(:PV(`(@U(W ,0X 0 4 0A 00C\ 0  "!0 00 0C&  0 "!0 0 R0]0 0D D ӭ00!!00 $!pRdtRdGdRdRd0 -3LM0P@0 34 2, 080 20 028 pW<  ,0S 8 ZMT@PT @08T#X1e< 18 < pXW,0S< 00  < 40R00 8 @ 2B 00C\ 0  "!0 00 1C&  0 "!0!0 R8#]8 @ @P?L00X  80 0< $ 0438 r0 H10aR001#(0\000P , T@PT 1e 0( S`"X@TS|0 0  08#X, pRdtRd\`RdRd0 -LMX0@,0 `p XK hK 0R60帐 0 弐 Đ 0% P@ h:T^ `xK 0S@ u0S.0Sş@0 |,0 S x,XK☣d ñ0S hK⏣D 㺱$50S xKⅣ  㰱~P{ @ 0袱X0ST0SP0SL0S&[4R t0S d0S`0S\0[Sx0[S S pG@K P R010 0S  0S 0S 0Y0R00Sh0[ xKSpp P`z K0P@BY I0 00 S 4s0S[ xK I0@00PXK PL T;X0ST0SP0SL0S 0XK@ @002Q0@0 XKx K-dŸXK$P"Ġ0 0Č2 XKx KKX0ST0SP0SL0S|XK⫢ ְH@K^xK@K0 H0KG KP@ 40  00 R TyVf SP` 0  p0S 0 R 困w0[0S4#$0$'Kp0S0P@ 0K PĀ@  0R0%@ *H(HbPY`T\`<d0hL<hd4 -LMK  0 ,  0S# W7I @ 0 0 0@ h o\@0@0C\p 0  "!$0 00 7C&  0 "!0&0 RW 6 00000!C \! 0  "!X0 00 D6C& < 0 "!0&0 Rv`$0&0``` `00S"W Z 0S @00 0     0@00 :0` d`K0HK@=: 0Z H0Kc KG Kd0K\PK   R0S R 0(S@@K  0KK-P @@K w(` x0(0     0 j Rr Rh ^H 0@#$(,""( :( @@ဧ K0R0 $  K@Y 1`P 0@ 0@`@0 \ 80S0C802 ,0S ,D ݪ P I@ 0 @@ 0P 01 0 I @ @  00S0 0 0 00ST2 R P 80S0C80$ꢪᰠ0 ڮTG  ጠPP@@@@KWJ4#$0 $<5K4P %KX T0 P@K\PK1 <1 KK吐 $1@ 0H00ڦ$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0+10 ,`(`i/030b 0 0 0Ba0➛ 0 xǩ0╛ `P\0 0i黩0⊛ <P00 0(f\`DKbtY`T\` Mbl 0-|0L PR0@P@ X R 0<00  0| fd 0 CS 0h{\`DKb -2b p P PL p P@ { H"0Sl 0RX0 S0 S RL0"00S= R0 10  0| d 0S0C 0( Ap00C\ 0  "!x0 00 d1C& \ 0 "!08!0 RhS 0 0  B 0 0 0Ba0 R  0⺚ xPt0 00⯚ TPרtRdpRd \`T\`DKbRdRd0L Mb| p-L MP0`b@T6 ᆚ 0 婨0000er 0 |囨  l喨 R 0T00  0| fc 0S C pphzph~@pDKb -LM00 0 0 @0@ @@ -PLM@ |0 0R h0 R 0P 0hEQ 0Shy000 \`T\`H -PLM@ R000h_اh -LpLM0P,0 `@ <K T2 l Rl@2 Rh 0S# (2 RŸ@0 51 ,0S ,ộP⸙ @ 0ߧ<0S80S40S00S5 0R0% A:P7 d@KH  P%` R 0 l 僡 I0 00 S 0 R <K~I0 J妧@ <Kl  0@0 R 哧0P@ h0K Pp h 0R0% *(0Hb`Y`PY`T\`Ldd4 -LpM0@,0 `1PK X6 R 0 0S# 6 RƟ@0 dƟ,0 S `,` P @ 0,.0[S 6 R K  0[0S 0R0%` Y:VO @KPE TP= 0 4 TPK8( LKLK0T<0K0 43K[T 8 4  <4(<"4%$Q0S !E%0$?0D@$#3 000  04 8 <4<("4!<0P;PP @ P,d0Si A TQ 0S& @Q  0 A I0 00S 3 RF KcI0 D勦<0K@ @k90 $(,<4<!4"L T:0SL  L SP1:PT0@S ~2 R * 0PS2 R  0G R 0S < R0S\ 0SX SR 0 SB K`0 K0KK0h [0  #h K0h [2 00h0K1\K 0$(,<40 R 0KdKddHdh -0LMPp`:0P:X@PH  P PE 0R08@8iiUdHdP -SLM@2~s H00H0( (0 -L0 h/TKb|]` -LP/dlt|Ħ̦Ԧܦ  $(,04@DH巒 0- <LM00CP@ SNt`````PP1? ?0 0 01 K"0 0 ,1  ,x; ,$0 S8(DP0 L  K20C0 10 XUU33 -LM\@  t\ u\\Q10` R`` J@`z, 0 V. @   | l,0q6S P Q q0` QJz Q sY QPF @04  @TZ00e/C1"/ 0bl SxEQPd ,0T,1D,`Hd x 0@L\ -QLM@|xh钓ꑓh厓`劓P兓$@倓H4,zD hvd|$L p-LM0~n0`pf5PP( 0f0V@0*` %Vx( K,0K JTZ:TV), P, 0 00( 0S 0H V KdKddHd -Lnp -Lg00-@P 6 018#811  R R  -0LP -LM`pEPQ 0 0S @QP|%> p02SN H%%>!D @A0AS= R ;%4 0 , %00 #0BWS $\\\\\\\\\\\\\\\\\\\\\\\\\\\\\4\L\`\\\\\\\\̴\\\$\\\\\\\8Lp|\\е\\$0\H\hp 0ts0A0CS Q X@@0S $% , R|2xl2D PL4 8<40$ 1?3?3  0  0x0!pn x ell%10?30 @U0P%  0?200  024P 0 < D 43L )oP  (%x4h(8 n0     T @ X \ d l |     0-@PL> `Sl h0 $$ à 0 < 0 $00      -pL`@Pu$ T 4 Z DU pP@TXD4(4P     3 -L0 Z\@`%Z' !00St 0t  rW\PD  e/ `  -O8@LMpOSP!b$ $00S 0 hdX@@  f @`    -@$40$&S !PL$pdxl dVH   `  T ) 000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A R- ᙌbs_notimpl_bs_mmap: args at 0x%08x - ጌbs_notimpl_bs_r_1: args at 0x%08x - bs_notimpl_bs_r_2: args at 0x%08x - rbs_notimpl_bs_r_4: args at 0x%08x - ebs_notimpl_bs_r_8: args at 0x%08x - Xbs_notimpl_bs_w_1: args at 0x%08x - Kbs_notimpl_bs_w_2: args at 0x%08x - >bs_notimpl_bs_w_4: args at 0x%08x - 1bs_notimpl_bs_w_8: args at 0x%08x - $bs_notimpl_bs_rm_1: args at 0x%08x - bs_notimpl_bs_rm_2: args at 0x%08x -  bs_notimpl_bs_rm_4: args at 0x%08x - bs_notimpl_bs_rm_8: args at 0x%08x - bs_notimpl_bs_wm_1: args at 0x%08x - bs_notimpl_bs_wm_2: args at 0x%08x - ֋bs_notimpl_bs_wm_4: args at 0x%08x - ɋbs_notimpl_bs_wm_8: args at 0x%08x - Ἃbs_notimpl_bs_rr_1: args at 0x%08x - ᯋbs_notimpl_bs_rr_2: args at 0x%08x - ᢋbs_notimpl_bs_rr_4: args at 0x%08x - ᕋbs_notimpl_bs_rr_8: args at 0x%08x - ላbs_notimpl_bs_wr_1: args at 0x%08x - {bs_notimpl_bs_wr_2: args at 0x%08x - nbs_notimpl_bs_wr_4: args at 0x%08x - abs_notimpl_bs_wr_8: args at 0x%08x - Tbs_notimpl_bs_sm_1: args at 0x%08x - Gbs_notimpl_bs_sm_2: args at 0x%08x - :bs_notimpl_bs_sm_4: args at 0x%08x - -bs_notimpl_bs_sm_8: args at 0x%08x -  bs_notimpl_bs_sr_1: args at 0x%08x - bs_notimpl_bs_sr_2: args at 0x%08x - bs_notimpl_bs_sr_4: args at 0x%08x - bs_notimpl_bs_sr_8: args at 0x%08x - bs_notimpl_bs_c_1: args at 0x%08x - ߊbs_notimpl_bs_c_2: args at 0x%08x - Ҋbs_notimpl_bs_c_4: args at 0x%08x - Ŋbs_notimpl_bs_c_8: args at 0x%08x -LMp,`@PL 8P$1( <0D $00H,!000wwww -LMY  `Q00SpP @ZJ $0 0T@TZ S@* $0 0@T T: -LM\  Q@@Tp` PYJ@ ( 08@#8 XPUZ TP*@ (0@8#8 PX U: -LM\  Q@@Tp` PYJA , 0@ \PUZ TP*A ,0@ P\ U: -L@p`P R ,0 10 "W\ W0.0 R,0 >x p 00eoo R ,0 10 V\ W_`bb 0-0 L@  ,0P   H0 RH 0ho0,4c@b_`b`2-@@Pr?0RW` <$0` B`p Bp` B`RE0C`R9`` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `x` B`p Bp` B`p RpPP2-B@P00O0RW` 4(` B`p Bp` B`RE0C`R9`x` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `p|` B`p Bp` B`p RpP2-D@P?O0RL` ` B`p Bp` B`R:08`R/`dp|` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR `0TH<` B`p Bp` B`p RpP% $0000% $00000& $0000 -L R l\000Х000 R 0 4 8 <0 R  R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R 0 R0#400#8 80 RR 0 R 4800 R## 8##,0R0@-0#88@$HHP%XX,ȠȌ8 R0R0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0RC-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480 p-LM0@S`P: S S00 S S R/ !R0 R R R =R 0 R R R =R=S Q `ȾP0  R R R 0  R R R0Sppb`0-2P? @P4@54?3P0p-2`? h@@PPP`5P65?3`pp-2`? @@ P dKP8\00S 0,!X0T  P L  HD  @<  8$4 ( 0,, 0 (4$ 8 < D H\  d 1 100 1`08<100g p-LM0 @P0 "!HN 0L`, @000phy4P Hph @bc001 -L,M \P` Y\ H0C 0P H$&R   R  R0Rႁ0僁0#q W 0P0 L P KpH00CH0 p 020P0LP 2 HK A @ j8!*P \$6BS -L,M \`p V\ H0C 0O H$&R   R  R0RႡ0僡0# XL P P KpH00CH0 p 020P0LP 2 HPK A ፻@ i8!P \$6BS@-,!@0 H@: -1A `L0 SP0 0- p`00C& R 00#!000 0C& x 0 "!0T 0 R-$=PtRdpRd`bRdRd0$ 0S00 Id p-LM R00A00( $1P 0 b 1B&! 02 S41b1 R000`P00C\ 0  "!0 00 t0C& l 0 "!0H 0 Rpphy-=pRdtRdbbbRdRd0 -` LMT ^LL @Q Q\ 0 @tN@bb (1 R 00f Id`Kb  -LM0` 0 !HAHP1UP`!p000PG4 1 UPR,1`t1AT  0P= @Tp4 H` 0`NW R ,0 10 6O\ P0.0 Rh R ,0 10 O\ OdɃTp  0M `m@bbc Id_` ^h$(  -`,1LM 080@0K(2PUK  <PU Kp0(  PP  %PU K0@ @ P_0$P00P0GH 0-tPtL0n@Q011!!PLP@0,!0*4 D 40L0C0ldLIdT`\IdbdHdXIdHTdKdQ&@H`xT T @Xp 0@D@@T@H|x}t 0@ 0@@ 0 Q 0Xpl dHdHd     -LMPpU' `V @ `\  0V PPP  @ @N@@P@ LL@N @@ @DTdTd -0LM0KSp8 <0 00 , ? `00V1* P&Q @Ϡ/ 1b10P:0APPϠ$:?0s1c4 1!00  0j 00V:< 80 R< O40KS0n40 00V d ->0LMnd`p4 R"P@L 40 R08 &8 P00U* V 08    0Z UJjF:804 0S80 @X, K00K`MP 0 0 00< 0SH |V dHdKdKd >0 >0 4!V M0@- 0@^0 0@T 0 P^0@ЍS0@P ! -LM8 \` 0p 0P0c <0  \V@ i 0@2Z, K00K , 0Sv 00 R!(8.:(#8 #: 4  08080S 4\@>0. T:00R \ RC 0 0c4 :#:  cP!\4 4<  000aP0S Q @ 0 R@ ,040`VP@0V 00 ^\ <,0 0S0":$:&4 0  4 KkKd 0-LMP 0 .@K PP@ PzMP*40 0\ @4:Q0 : @0 \0 0 0@-P@P`p. ^  R00\:\*R:^ >00 0 bS0!>0>00>000 0S0l0l -L@㬀TPp`  (0@T -L@, TPp` ,@ T -L@㬀TPp` 0  @XT -L@, TPp`1 @\ T@-^@>0.  Q:00R^  -LM@`TSp R a :@TVPbUP!W W `e L 0D@WHdHdHd -LM`0VPp R a :VP@bT@!W W `d L 0D@WHdHdHd 0-`@L\0P 0  ,0R 0 0S0hk|`IddHdD$  -LM`PV r @0S  2S @2lS2S~ X`TF|PC|0JS d d d d 0  1|0,|0@'|0 K"|1PAA0S 1 R$ 1 ?#+0AB%@| Z 11@T pp!m{`{ T{L1L ?#+B%00{0 ?#+0A{0{0 0X |z" 0|  {hm{ Id,hX\l|HdHdHdHdHdDId0IdHdd,bb! 01 ,   ! 00 2l 01  @bb`_`dHd`HdKdJd`!`($68`@d`03 6 !03! #@-p` PDq!03 `aPc_BCHd$MQ`pp50q0q180K0@<  0 P dHdc@bb\HdV  ]bDt p-LM( \@SP`8 0 zx vx (qxnxjxex$`x4]x00S8@< D SxHxPxhOvdIxH TDx L@x|(Px -LM \Pp`@  @p, 0p3B -LM, ^0P0p @`H   \f 0 `p0 ,1@  -l!LM000 0.!0 S@C$1Hpx,17 X1: `N @0 PP 0P Hm P   0A0.S4  0S00Tw  @0 R  0H 0@c@b\Hd p-LM@0P`XT" T {uKb0V0P00S 0[0ppTKr0V0P00S 00pKU0V0P00S 1[0pdHd 88#4S S - LM(4P`0Sp @"0pOQP`(0S00V00\00S 4@Q0 0CS ~V00\00S(TA0SPS(4 SJ, $$$$$$$$$,@\. 0 PD 0 :#:cQ! E`*  @Q`1h#R& P  D`0S000S pp`V  Q#  .*ܧ`00tJd4JdKdJd p- 88LM#Đd0`PP 06 ?S R:9P%&:FFp@b\`-@-0  80@0@ h0 T@ 8 H0D000H0D0 0,40,4440044Kd-88P0S P0S00 ,40C,4H0 Q H0D00C0CH0D0440C0C44Kd0@-8P @+ 0Q P00RP @0 0@0 P0 "  ,4,400C,4 0Q  H D0 0CD0H 0D H0 0CH0D  $4 0C4$$4 0C4$Kd -@ LM0|@  xhu \Hd8Td0@-x@PQ0000  00 0  0 Q 00  0P0[b- 0S  R0000 0 0  0 B 0S 0S0 <00 0 00  0[b -!LM!:Q(@T!h' 001PQ Ppp$ KP$0W 000p`0S &21(p,rp0pP@ ([bKdxZb -LM0P0b0@T- qP* @0`$0  2 0R ( U$ 0 R 0R0 S0 R6p&1?(00CS0 (0`i(pP0H0,0 @ R  0HKdJdKd[bxZbdHd -@LM+(0 R 0HKddHd -L  -L ݥ8 -LM8@PTp`  0S 0` @TH 0L\R S @Q Q Q \ 0h0hS 4S  0h @T\  ipL -LM8@TP, ` 0U Z 0`@TQP U00P00S V \ @R U Z @Txc ``` *(": 1(Q"( 001 0R  0*"%,`V pN W 0S6  10#R0 S& 2D0Sp0S `bQ `2 R 0R0S (2H20b@ 0S0S a 1P U P@R `@TU VZ`(*(": 1("(Q 001 0R  !!0 0p 0S"  0Sp0S 0Q 0 R 0R0S d0HP000S 00 0P `KddHdKdJdJd -LM@ 80 Q@ i @ 00 8 40  `0 :8p#*  !( #8R 001 0R  :#58PQ ,  0`  |"`0 0PPU^ 0\Sj  H0D 0C H0D 4 R 0` 80S U> 0S2  0S'P U ,1P R0S  0S@T00S p1 ,X!HD!@ 0S  P 0S  0S D 0S 0P 4$0C 4$U 0S  0 S  R L0@p4H 0S  PJdKdKddHd -P@LM`pg 10S 0QPP 0SK SI \W- 0S! 10#VR0 Q S 1D0@S0H 0S 0PT 0S 0S|0< p 0S \0Lp `V  Tp@p@bKddHd -LM8PU` 1L D H 0S 0ppUB X@ Ta !T^  *(":1("(Q 001 R``(40C(4 :#%,40C,40 01p R T, 0 R( 0R%  w0P6iU@X8@ 0S 0S| l0,@0S L @, 0S $0H@bKdKdJdXbdHd -LMlfl0 @000 ( 0 0$,4( C0S0404@4$XbXb -L,Mph P4 @# P9",KQP 8i/ 1b10 ^:0A^P8:?0sh1c, 1! 8WL   8 8Q 804P : #5 @ QH D H@( >0S @# # 8@Q h/ 1b10 ^:0A^@:?0s'c!001@ZH @0 L 40RP @0 U^H7Z P T  `< 4S44SSD0 SH0H0S S 6!aV@0`0ó @0` W  @0`00@0< D `00Q00SH  0S H  H 10#R0 S 5D<  0%W 5 Y^D0S8000($ ($D U` |5W} 5 Ry 0R0u @SP XE0Sg@5 YU  8$0 )2 Q  0SKH 0S? H0 0S4Z+ 4S44SSD0 SH0H0S S X4!AT@0`0ó @0` $W  @0`00@0 7 300S 3 3H@3H0 t3@\ 0SY P3PS *<fP< H  2W 8< v m0  uH 0S6 `4D U1 L0S. 2H(L4 h2QPU^W `2 YH2 PT  "< 4S44SSD0 SH0H0S S 1!aV@0`0ó @0` W:  @0`00@0< D `00Q00SH  0S H  H 10#R0 S 1D<f 0@ 0S 0P c00KS0l00 0+ `b)*(":1("(Q 001 0RX0l00Jd0V dKdJddHd\HdJdKdXb<X -L0S7<K1 Q V$ 5 R 0R P0@T:TPP  0 SP 00dX (HW:4L000S < KH P 0S0S 0@(4$0C(4 0Q\ `0 (DKP C/ 1b10 ^:0A^P:?0s#c!D01B@TA  4S44SSD0 SH0H0S S 2!QU@0`0ó @0` V  g@0`00@0Y 0S 0 0S00 \0 ` `ReX<0S V 2 R 0R X0z0X0 0S !HPP \@0K !< K‡P XzX P0S$ 0p0 R0S\0S 0S 8 ` R 0S  10  H 0S!0S@ <K1@T 0SP00P0 00 x Hh 00PL aY0l00$ P dKdJdKddHd0V dXb - :8PLM#ʠ (Pp#8 001 0R0*"%`Q000p0 U\0 R@0H0@@0KdJdKddHd -LM PP/*%:8#*!%( f V `!R#8 001 0R :#U@p*0SZU@:00g0l0 R U:Xh<0H,0@00p0KdKddHd@-0$,@0S!*4*6 ,<1(P 001P : #P 0S ( 8. :(#8 #:T -LMP0 ` 00S@e00 T # 3U8 4` *%:8#*%!( 0#8Z!R 001 0R  R Pt : U#o*@Th Uf 2$pQ b/ 1b10 ^:0A^p:?0st"c!,01bUNX2@ `R{Vp2 @0  @4pS44S@SD0 @SH0H0S S 1!AT@0`0ó @0` YH   _@0`00@08 R(40 040 8 Z U:0Um:8 R 40S 40 0S1,  0S 0 0S  0S 000S 0   T0H},0KS0l,0 0h$0H0V dKdKddHd A-LQ LLLLLLLhX -LM@0@0@ -LM@00@@ -LPM!(`Q%F 0 010 P40 > :#5p W8 7 \ 3 >0 U#F3 Q pϠ/ 1b10T:0ATϠ:?0s#c!,01" R 8\ 0V \ 0U\ 0 @00@0 U  8 2 RxI $4  0 2R  82 R2Z  2 R   0SW a0 j18@ uj>0 oj@ fj0HH8H,0KS0n,0 0{ #F0Q Ϡ/ 1b10T:0ATϠ%:?0s c!001" Rg 8\d 0V \]0U\X @00@0  b00KS0n00 00V dKddHd`IdDb`@b -,0L ^  08@bdHd -!*(":LM1p(Q"( 001 R0*"5P#F(K` PϠ/1n10T:0@T`Ϡ:?0sT c!(01P  0Z0a000V d - 0,Qp@Lt1 T ?= ?0SN HH!00`00  "! AR00  00#!0S  S0@ 00 0C\ 0  "!0 00 t0C& l 0 "!0H 0 R m@0Q@bpRdtRddHdJdRdRd0 0-0LS@P 0SP200T* 00S 0 R 0T 0 R 0S 0S  R00h00 0T   0 0 0P00dHdKd@b ]b[b -LM 0@S000L00dHd -PLM` 0S 0Sz00$00CS$0. V( 10S 0 R V 1 R 0S 0S  R00x00 0d   0 0 040s1$!V,q& 10S 0 R *I0  0 0$R444444 ic@00#!0 hP0 0  "!0000~Kd@b ]b[b\Hdbb`XbdHdP-0 R0P  0S 0S  R00L00 08   0 $00$0 ]bKd[b 0- 40Lt0U>0d 00\PSPP L@0 @0HJd[bKddHd[b p- LM400U>0 00PS`@0tt 0 SPR0Up@`HJd[bKddHd[bb - 0L84@4`N0@ @Ā@0pSp$00U>00 @RP00 D@HHJd[bKddHd[b[b[b0 0 JdJd -LqMXX||1 0, P `% *XTP1P@T @a 0$"*>!00\:@T060pS:<,, @ 00C\ 0  "!0 00 0C& x 0 "!0T 0 RHJdpRdtRddHdKd[bKdRdRd0 0-0 L"*("1("(P  \! 0 SP0:#%0;U>0H0 @@R4@ 000H\HdKdKddHd@- 0 0 0 21 0 0s#0@$ ! 0#:8#*!(#800Q! 0 S@ 020000\Hd@-`Pp !:H$$X 00S (| $:1(P 001P:#50 000!S$010 0-0@P$L 00 0S0ڀ0 R pP ` `000@0  0@0$0)$idJdKd[b[b -3崓LM00p 00P$0, 0 ppp p0S P U:YZ @:4s4C<,c00#S$ 0" "0"0"00a3C?6C#Z!"00#Rea!\"0T2@P"@L2  @@U4Ÿ4 0,,PZ0 "R@`ŸP 04T0D@Z 0@Z0!@j`0 @Z0!@\`< hPJT:k]eo`P@) E1? (P 0 01  @`P 1 000R ;P= 4e9W 0p(Ā +c)clKbKddHdJd[bJd[b[b[bJdXIdJd[bZb[b[b[b8- Wb8XbX'Xb0b`@XbHYbxZb4'TZb[b&\Kb p-!:LMP`0S@! 3P@' : # 0S 00 00SxP@`pTPH@0 R 00 00SbJdKddHdJd, p-LMS@P` ,:8l#*( #800R 0 SP*  ^0"5060p bKdT -80L0 00 Ơ \0 \`JdJdXbJd -d0L \R00#P00*0 $0h*bJdXb`V Tb`00 R 0  \05055bJdTb`Xb` -L$M\(\1"01@ +.  0 ;>00 @0+. R 00@0HKd\b`dHd -LM40 >0P, 0 0 S S @ 8 < Z4 # 00Z 3 #@46S``V 0088 00,^>>)*10S006J00 Z4!H,): R xG PP? 8#8ZS#0 @)`p@V ?>0U.!!Q 0@ST0ȌJ0 0H 0)6< 00U>!10 R0ʌ0 Jh0H\ `T0T 0 80 H0@ 0<0 u808 0 80 ,0(q`KddHdDJdJdJdJdJdJdx0Jd -``LM0pS P0  @P@/00 RJdP0P0S  \:00Q0SJd0@-l0@P 0S P  T :00U0S000Jd0 H 0R0 0 0  0 00. 0U0. 00 |0t t0t p0404 00dHd,JdJdJdJdJdJdJdJdJdJdJdJdJdJdJd[JdpYJd -L$0 0 0JdKdJdJd 0-80L@T (PT a0DT0XbKd -\2LMP, @ D,<a, 40$ a080 00 8 ,1( R 0S 0040 < R< 40 6R< 40 80 $Q8 0 X 0@S@T1S ?@4 Tf?p P@0D (?a 01!R.P I P u$u$u$uu$u$u$uu$u$u$uuDP>S 0PP0!?#=?00c?S a@Tjڢh a,@Y@ BP@CPmPFP$`Kd[br -LM(p`1S`>V#1(KPQ @/ 1b10 ^:0A^P%:?0s c!(01B@T H4$4D\`8@T W 0 *4`@TX0l00[b0V d8d -!LM!:1(P`U!0 001 `R8pJ$JT( 000p帀00 0+; 00 :P 0 R 0Hp@:#:S P@*:#:"*S:(21@(PX0 P 40 P [bJdKddHdZbJd - 1LM@@pPP1 K$$PU$: 8 #!( R#8 001 0R0 U.! 0 R*GP0H `  0@s%P4 $dKdKddHd0  ")0 )Р)0 ) ) -LM@p QoP 0SPTT0 R0 00b81Q00@R]`hb`\`db` -LMB2< r R0S tRP "88 #$0L~_H2`oP 0S@ l_th P0Up7*!A06T&*46!SAQ  Kx1 :Pp`UJ1 16T:0U00 pW0#02S0ES}}h}}}}}}}}}}}}}}}}}__S _^ "88 #$h^(0S} d0L ^| PU@`H@ $@K,0  $ 00ZUzj\a`Kd p-LM`00l H0N@0d0>0^P <0,0 L 0L0H p[Kda`A- QQQQQQQQ RA- 0@P`pQQQQ R -0LAP 0-LMP@EZh]D80<0  @00S0 00 0hD[뀇 -LM@Q"QdQQ?qp]?q`]\0qT]H}]X<y]d(u]x q] -YMLM⠒8 0pP<@ @%  ,0  0p"8% D (K0`d4 0X4 0S! ?K ?K! D 2% 0S7 0S-[nK`F`F0 P0S  1%D ,0S ,?0 |]0S50 L]0 8\[KHKH/?0S30 P 0Sp"0R  0CMD`/\0p2  0 \0S0H\08\Hbf0- <<Tx -LP 08@H$ Z p-0L Mx` P0 P K0S@ p/p@ T 0 @d1 \8jb@jb -0pL M00x` V0@ P  KP `0 04P`p?p 0 (@W01Z8jbx00P W )[ /P $0K(K K/X1 S s 0&W0S2  Q $^;? (0R r ` ZW $[?R`X!d \ W2$  0)P4` a/( 0`V0`\Z0/20  P W Z, KJ 0  p-LMX`X@0PD -K @Z KP 0S =pHb |H  @ -L-h4LPd Qd -QLM@ 0tZ$P jZX \  -0L׌P -2L"Ÿp$Mp4000&0P @004(00P4 (00@4 $H1X$H!@T@%XUXhZ04c/0\0@4/0\!1 pt!Lh1 p\!PL1 pD!T01 p,!X1 p!0\ p`@`@PK@  00 8@ 4 <` , @0@40 @ <@ @8 4 0@ @|0| Q WdWQdQdc`d e  H     LPdQd X c`c` HdD  p-LM004PO/,x`@ 0 R!040O/\004 ,d@ H0 DR 040 \VpgYeY c` !0  0a`a` 0- PL @ᙏP0c` 0- PL@ᎏ0 P0 0c`̕0 - . ~LMpNW`@* 5A0p0dcPP :#:0T0 *` 40J`TZ: V Kd -LW0!0 0>0>00lP  10rV -LVL!0%($-!R!$S ^  -LM@0K KK0S(00550 4 0-LM@P K0K K0S(0055 0!4P0 -LM5 @R4$ R R @0BS 0BS X0uX00 @4lXR R  h!! Q-@ L<0A ^  0  X  MV!\b!! p-L MN \@ `P0`PSp `p= ]b]bN  0O   ! -- -i`@0P @!1 ! ,OSi<ЍG-qԁA 090 1C&   Q 00#QY l  030Y P000 0& P0P0$0(@0,@04$00 00 ` 0 04 P(@,  0R  000 X0C&   R 00!QY]bRdtRd 0000pRdtRd @-@00C& R 00#!l000 X0C& P 0 "!0, 0 R@=pRdRdRd0 0-0 @P00C& RL  0 0#!t000 `0C& X 0 "!04 0 R0tRdpRdRdRd0 -LMpW!聟00@00#!a P00U00;00!00p 0!!0`00 0 0  "!}00#!000 0 0  "!g00#!060 0 0  "!Q00#!0X60 0 0  "!;00#!]bpRdRdtRd@-0  "!X@X0  0 "!, ,00Q@ZRdDpRd0 -0L Md C\0@T 0Q @0 ZE0  "!pRdRdRd]b -PLM Up8` +_0@!T  000(`,00p4PP00#! 00 @@X4 @09B 0!!U S]b"0b(" -LM4 \!0@  "! R0000 0 0!!]b -L "Mp"0W00 1C&  ,  &0@0p0`00 W|0  Q 0@!!@0  "!0   ! 00   0  "!PU ,, P(`V @0 PUV 0!!L0P000 @0C& 0 , 0 0C60ppRdRdRd0]bc -80LM@/040\Qd -LM܀004/0\嶌{'{W 0`0P40@/G$,| 00`pW@gp02.040\ @JW DTQdRdRdRdX" -0L`劉ppP*Ppp3:5Wl@ 004\0p0 40\0 040\P`Qd 0-L0@L2P00Ϡ(0Bl@D 00QdCRdRdRd -LM q0\ P S  0`T @< <0 00!A  8@B@@0Sp 0SX0 T @/HH0S0VRĩbb Qd"Mb"Ф""" -Q@LP <0Sa!p00/0004,X!0<0a8Έ0,0S0 =9C =CS 0\) Pp 00C\ 0  "!0 00 0C&  0 "!0t 0 R k0S00 R@0 0 0 QdpRdtRdb?B_bRdRd0 -dL 00Ba 魋h8d`4d` -PLMP? 0S  1P@, ,00C,0 , RUPEؠ/004,Up` 0/04,W0`05/0`000P`p0 `0@V:'0`U04\4d`Rp0(dX@00C\ 0  "!$0 00 1C&  0 "!0  QF0p0pL,0p0A0p0 lK0.\@^/, @Tp Wp00p0!0NHbXd`pRdtRdRdRd0# -L Ml 2"`  $(0QS0@4p$ R RK S KS S d2d"#8C@4, R0,0   R@  R`    . 0\[/,0\Z/0\! 00 !400` d, lh \0 09900( P0 P 0.\,0[/\0Z/\00@00C\ 0  "!0 00 0C&  0 "!0 0 RJ80 @tK S ʖ Sh SfXd`P`NpRdtRdRdRd0 -,1LM$ ` P!1p @x|px |P00C\ 0  "!0 00 0C&  0 "!0p 0 RU@ TPh02@T00 tRdpRdRdRd0P/ ld` -0@4P儀Lp^/,.!,`Y/,@V X p0  | DRx0<`|0 S.꒹ld` -LMl0hhp@P&0pP` 0 0 Ld`XSd\Sdpd`b# -,0L( &0XSd\Sdb K R-L`p@0 6KR- R+ 0 #8 C< SP P  S@P  S`P P P BD0.@P\0[/\0Z/\00 Ղ @K R ʖ R RP`N -,1,a4 p 1!@PL^/,.,0Y/P,@p00C\ 0  "!0 00 x0C& p 0 "!0L 0 R@U tRdpRdXSd\SdRdRd0 -8184 ,1(!P` ALp^/, @T0.\@^/, @T@0 0C\ 0  "!0 00 l0C& d 0 "!0@ 0 RmutRdpRdXSd\SdP`RdRd00 -LcK$ -L\K($0R R | 0\q 0 Q  -LDM2x0 \ t3\ , ~ t0"40t0 0_  P;.XK  @0S S P@0'\00$Mt tI 2 0S0H1H!\L1  |50|51  |5@0|5|5F@0 1/@ H_50%0PL100\0\0670hL1d! 0P Y @,1 ,0S (,&/\L!0`/͊_0@@%0LP0`@#Hh P 8`p@5͊P%00\`zLHb D$L$(`$pe`, |$$~$JHFD$% -1ap @ $LP P00$ ;004P$ 塽$PpAp00C\ 0  "!<0 00 (1C&  0 "!0 0 R3쀟 0PUb p@0SP 0@ 0UP0U p@0SP 0,@ 0UQLtRdpRdRdRd0|`(g``xr`, 0|6 -LMD`!88#|!4Pp02J /+b212b2c2cJ!{~TŸTp 0002c2cZ P 0002c2cJP0 0 S1   002c2cZ  1 !02c 2c"bJ"bZ1Ϡ Bl02c2cJ:_ Ue2e2cd!J \1 P1Pa`n(@2`!J0!!Gp@0/K30K,K40K- K.@K0PK1K2K04K400C\ 0  "!0 00 0C&  0 "!0` 0 R4f`e` by-nmf`E.ųQtRdpRdRdRd0 -d3LM\pp80S8c8#P(00000K8P' CP00C\ 0  "!0 00 2C&  0 "!0"0 R llBP00C\ 0  "!80 00 $2C&  0 "!0!0 Rp(0[,[1)[a-[1a`.0[+ [vL@ L1"b0"bS#JB!00*0[t!SMDJ1QpZF0 Q0818!0 Qp$02c2cP C0"b>CA 000X0@0Z <0TWp @h$ o0f5f#/@!bP Exf` lW`1CADLs  \@?2e`bpRdtRdRdRd0nmf` 4f`ųE.«*T* -L M8@4T 0 @@4_b`Sd+ - " LMp0P 00 `Rtܡ@0T!D@0S T6P@/ Xq00C0`tQp00C\ 0  "!00 00 (1C&  0 "!0 0 RRL?@p00C\ 0!!  0p C6000 "!0D 0 R$@tRdpRdRd+`SdRd0+ -LM @P6 00000Sh!`Sd p-L,M,@K`P p%x 0K@,K[ PP @_0S 0[ [[8[<40p| >p N+ -LM1(KJP`0p p,0 @p(@K@ @.0' -L M$PK@p`zp0:$0Kup  o  o  o$  o8k$P0 P ` PK' -LM1(KJP`0p Bp40(K $`KPp@ @0 -L M,`Kp&pL0PH@X@0 ,K@+PK(KP P0u' -0L@ p60S hOPu0P" P 0`V U004P< (0;4P00@ @00 0SV hZP 0,0h -LM0$ 0@0(X , 0 PPO KPO0SB 4a4!p000 0 P0!P0 Pp00C\ 0  "!0 00 0C&  0 "!0| 0 R 00Sp P 0,0 ;pRdtRd,RdRd0 , -Lp`PP` Y@ s` 0`$0  00 @0 000 020V9 app2 @ P0001P0P0C\ 0  "!0 00 p0C& h 0 "!0D 0 R  pRdtRdRdRd0 -LM,0@S4<<d00Cs0 0 00, 0S 0 0pl `%p ,0S0,0 ,$<0S bH,@BP, - PL0`04pSa0@0p0CS0ו Q.,,h8@@@H$0( R0(0Q 0  S0000@ R 0S R 0 @ 0S0,00 @ 0)S 00000@@@p@@B -LM0 S 0 D<,, 0-PL 4@ @0!qT p@D/<T4@ 3S05 00h<mx<0; 08< 4 0<S8! 4<0S 08< 4FPqPQ <PqP ;;;;0 S0@ l;d;\;0,L;0,u*** **+0+H+\+t++++ -8qLM@P}m 0Uă`9 U 0 KsU <0?R0S0AS(  ( (   0@0p| ;P0c0T  ;0D 08    0_b8f`uuuvv(v -@LMMT`pP1 )@T 0 S 1S 0S0t Pq;0S hr< 0 h`;pT 0 h@vXvvv - LBKBP@l0 0Q0p0P0`0C& R@P 00#!x000 d0C& \ 0 "!08 0 R,TdpRdtRdRdRd0 p-0LM 0@00 `R0P00 00C& R 00#!|000 h0C& ` 0 "!0< 0 RphtRdpRdRdRd0 0-0 L@ 0T00 0P @TP 00C\ 0  "!x0 00 d0C& \ 0 "!08 0 R0CtRd,TdpRdRdRd0 p-LM0`@V8 P/ P0[0X Z ,0SDh$0  B0[0$ phm 0Y0X 4(Tp0[0P:0,<:00 ph9 v wDw`w -LM`jP < 0A^0S  R0ˠʌ ʌ00ɌH0 `FP<Q!p0000   @0!@00  Ap00C\ 0  "!|0 00 h1C& ` 0 "!08~ {P4 3PU 4@n40 !PR i3U,c ph`6b`{f`{D{! 0-#@TLP441S@T 0h#"4# p-LM P@| 0`\ p| 0`\0` -pLM@`p iLP@0T 0!R@ 0Tf` -LDM0P,0 P@]|!0PY0XU 0 q0C Q0Q t$0 l pC T$0T 0 ,0S ,Tp 40!Ql@ 0l0 PP U h`K:Hil\l@TP U0 P@ T40 PHbf`l{-\0 S S S S SL\ 0 0S S S S S SL\ 0 S" SS 0B_S \00 "#0  0801000  0  L\00 ^ 00 \S00  SS -LM<Ÿ Q, @,6 0@\㢟0 { x\10 2 \o ࡟Z + P`K PK@K }  yP@1 Y 0h 68,0 S <,X7                     𤠟ꠠ꜠꘠ꔠꐠꌠꈠꄠꀠ|xtpl4l `\\Hbn{ || |P|`|h|t||||||||||||}} -LM4p!`1S8  ( xPP 0<@( 2 @  0p`nPs0 @R^ lRg RY V^ !0S1 !0S78: mPK 0,Kht, ^00S  101101 101,0S!1010 S0ձ00ű4K0  00 4P P@ 40!0Q - 0 x5 84: k0S`RVf`$`bxf`f`f`$H -L MPB p0, u`@᠟  0PES u@,0YZk 0 gP Ok00 000 vgPCk  mg0 P 0  00 R0 ,@ -L M0K@P p`gPPU0K/KPj '0 )KP P`(pK -L M0pK` PfZ%@0K)K K0 .KP @(PK -LMK 0i( -P@P0pS00Ł| |00` @L0\Q+  0 000  0d1h40g`f`() -1ap @ $LP P00$ ;004P$ $PXAp00C\ 0  "!$0 00 1C&  0 "!0 0 R-Ԁ 0PUb p@0SP 0@ 0UP0U ppx@0SP 0,@ 0Unl\tRdpRdRdRd0|`(g``xr`0 - 88LM#Tp%jP@u 0 Ԁ\P`j0PS6 0U Z` Z0 50  Z0 50 0 0D^ >XU 8U2 R`Q-000 -+P` U Z.P`000-hP`000 P0`00 0`f` - 0!4LM#`pP@4 0PP* V0 70  V0 700(PUP - 0000   / 0<0f` -D`!88#L`!PpU >U>U*>U>}>U>5y:T 0 @> ,0S P,D>UK 8>U T,>UM 3>U, =U 0Sdh 06'=U =U0d 000d00 d0X=U : =U @=U0000d0000d0<U- <U :<U <U0<  T<U :<U <U 0:l   $<U Y<UF  <U <Uod1  t;U ;Ub d1g e/g7;U ;UO 0dAOX;U P;U=Q d1  K 0@T@c@cPUJK!@0L\ 0 @p0N^J0D@T;pp -L M0`KP pQ]G0KP*K @(K8)K0 -K,pK+K@ @@ N -L M(`KPp .]@K}(K0 pKP @@ -LM@}̠ 0@ @ -L M0@KP `p\BU0K/[@/K&.K)K4 Π0 -pK*K`(`K -L M0PK` p@\CV0K/['Ġ/K)K8'KP0 *Kp (pKb p-L M`  0@PU 0 pP nP -LP -L 0pP' U0 60  U0 600 Q0  10S00 000    0<0-(g` -D`!88#L\!` Pp 4pK =U00&((*&<&%4K20K1 K0K/`K-K,PK p0P00 0 00<H0 @ 0   P@0S   )#0S2U6 !p2U t2U l2S  0& 00<01U 1U  ?K e/X1UE 1U 1U00 "   QL10S 00p2 : P  0 P0U 0p00+ |&4400 0 00Sh 0S00000]D0U^ 0H0Q(g`QQ @pd Q@mdedAsd rdAQmqdhdk~gdhQ` -LM⼑@ `e, S S0@pK(0 [_0 0P,0 Q8d0804 Y? R88 SY?0 !P!P8 W(0 4< n0*0X000  8d' (((0"4400$ 0  0 T| ,0S <, Y7WHb~~,*WEVh -0L  10S -L$M(K@0PKp SS(KP`0&$$X$t ʠ,K+PK*pK)@K` .K-`K 0- 40 L04@ p0CS00S 00S 0S P P 00  d 0PP H P0 (  @Xx@KL 8 8-#DLp$ PP) @0d 0  0S(0 4 @V  *0 P@*0sP@ (g` -LM`P8 Pd,88 #$"Pt00pU0YQ @(  UP< K U  U2P` 0SX`p.4PK +R(D&,&Ƞ&*040K2 K1K0K/`K-@K,KR0:00 0 x 0 0 P08 $ (<0,000 0P<<`b(g```b'R \ 0L_S BR\00 -L\M⤑lPK0p ,0 Q# @lKpP `0Kk P`ePKd@K@eP X0[\K0S BS 0 480S 0.< 0 08 <40S0,0 S ,+@T K&0@P D[C0[0[/ [H[G[4$  0@ 50 0 0SHb N -LM`(PKp,@bQ_Q@(KN,P0 &KP @$PKp -LLM P@`j0(pKS0 3Q?(K&K ,$KxKT0K @PJ0[K [I[480S 00@ 5  0p ->L4M0Y?P\ 0TpKX0   0POQ`[4@[ 03[4  80 VJ0[K[4I [80 00 S 0S 0 S< 0P0 S01@XX  < 0@ 00 P000X0   0+P$Q`[+ [ ,[ 0@4  VJ0[K[I [0ޕ ޕ4804 0   S0 0S< 000X0   0PQ[` 0 8< 40@ ^0 J0[K[40֕I [ ֕804 00@S P 0S< 00{ -L$MPp0@0Sڰ1,Kl  'P5,KT0L @` `0S0@00 5順 -LMK 0t. p-LMP0@LP0DX0Q`    < <0S0S  A?1!!000pd`0TS00D@0@4|g`f`ā́$ -0L MX@ KL0/0S X 0h0 4 0@0) -X0L`lP@p O0h00 p   0000 @S00 P00W - 8LM0 8#Ă,"RA0QU= L@,!0 , p 3W  P`!0W00 D0, S  00  0 S00000 K,0D00  000hg` 0- 8 8#T%2AL00A?S 0S0Xt L0000L   hg` - 8!LM8# 2A 0 ` PLp 醀@ 00 1lh 4<PP  40@0sPPPP001t d0< <00 0 0 01p R08 00PP l--0 @ +0 0004PPPPhg`0 -LM0p P@@0 KL`U@ -W@ 00!=00  L 0 ^P R T0R00<P <0LS7ppp@@@@@@@@@p00` 0R008 0LS(((((((((00;0000;<80Q 40 ` R  R  R 00 000R00000` 00` 0R00<ſ< -D0!#p0<!4#2PLaL 00T 8@PP:tAt!P000( $( (0$0p(U4P0P0C\ 0  "!0 00 0C&  0 "!0 0 Rh 04000<;00`@`0@ P000P PT0S P0T0hg`pRdtRdRdRd0P| -LML`p0S 0QU $ R(0(0(01(0 00   00< ;000@ 40完0S    00 0 <0+@400 000000 P00 7(KM00000<0 ( K(0K0000JK '0[80'0K<O 8 $&0K% K$K  0 < P0 0  Q 0 0³00 0 004`F0?<` -QL M`@p% Q00? 00$PKIL@$K`&&T0 "K!PK `Kp@@ @d00 0<0000#> -L0@ ^`Pp ^ 0000 P00V00Sa0 C 0^0 -`Lp$MV, K0@ 0P 40(KP V 0 0`I0L(K0 $`KPpP P -L$M`0p, K@P(KU0 00#>008IH0LW@@@0 (K@`'pKP P00u - `404 L@ P0p p0BS X ,,$,$$$$,$$$$,0S 0ҵ޵8ҵ<ҵ 400$Y 80 ( 0@ 00W 000(0@00B  00W 000(0@00S/40 0800 80 -L M@` p4PK 0g1`V00 0TT0S 4 00rcp`S00"c1a m f. -L M1@Ϡ PNlpa4PKV8\0p  h!8 n /T40s 4!,!?L3cS 08T0S$ ,0S0\ 81W< 0<0  ?B3cS!3$0J0$008 b0 mTf<cU U080S gfff.bMb 0-LM0@(()0K[ S 0K )a(^ PU 00++ 0KKa$0 c0(()KP[\0K  )Pa( 0- @L aP,00 0dS0@00@00Rc㛿 0 T0 0x -0P2c1RL@,p ` (H@D 0,0T (0 0S0T00T0Lķ -LM` @\ Ƞ!$C"a,Ƞ@Qp 0 @ @Yk0,P@000K$0T0 0`0 S00Э -L 0!0 0T  00 #(0 0 00   h0000@00 `d 00 (00000d(0Qc(00@0I\0SdX D(0XS 000<_̻$2S項$)Ѕ؅D)0@- @,PU @0T00\0#(# 0$ 0 T0PXP0< -LM `,Pp 0K NĠ@ KKPK]000  7_0T0 p-LMP`!"a,@  \40T0pgh 0 0 00 T0}.? p<8 -PL0 aR@,p `  4 0,0rb 0T0L(00T0<40 ( 40(S"4Sᄃ`40 ( 40(S"4Sᄃ` 0ᄃ` p-LMD@`PD DPP U @pp`( 0 PR ` -LM#P@ `\0@T 0SD S8 @T(0b Q-LP8 `Pp@aFQ00`V00S00@0@T 0S S @T`@P00@P0|P 02$04 4J b r p-LM@0s |`|P#40!cS!0S0spp0 0S S000`|`g` -LM⫺| 0 @000C 0 0\ 00#!0 00 l0C& d 0 "!0@ 0 RݶXtRdpRdRd! b`Rd0 -&LMf0弆 ,0 0 6 r "4"@ !$"R@pK0`&P PPH ,60(&@T }C 0K 5@Pn  0: eܥ܅pKⴐK Q R a x v @ 000s?Ps@0@0C\ 0  "!<0 00 (5C&  0 "!4  QU$QU0 S*R  0~P l40SQ ) Pd R R b  @ @ 000fsH?P`s@0@0C& R 00#!000 3C&  0 "!|3  Q~U 0K8\[*P 0SQ  ; 000b2,0 dTd$P`TdASBESTACDTdTdTdPTd\`LTdTd8TdTTdTdUdLIdHTdTdTdJdfdA\Hdl`dHdUUUUb\Idx W 0BSEρ <0RfPWD0W00S H R:0(0 80S)8 0T0<0#@0(00 <00 TyP\340 H@(0e?CT 43R 4 R$340 0@e?CT40SV 00:00bt4,0 ,P4 0S8"S4 Pp(He/`>4p R!0S 000S+ .S( S p 0 0^ *0S R: Rx 0> p rS S@ 0R@0 0D0 dp0S  0CSSp0D 0S 0Sx  P00SR 0S 0SPx x  0S 0SPx x   00  0! < Q08 0000,0S0?0,080S00, 80WEVHX -80LSP`p (0S KKT r> 1R0S  PV# >(@2@R0`! 0R 0R: 0S  P 0 0 V08e/r=e/l=WEV -LMp( @cuD@8P;X, `L T(0 "<00 @ w P@jHo@ <= 0S 0S`v  P00SR 0S 0S`Pv v  0S 0S`Pv v 0 01,0 0T0,0 @0(0<00  wP@H( @0e?C\ 0R 0e?C@T e/<000 w@00:00r0S6P (HWEV -LM(`< @PtD8/\") T0S`Q@ 4<0(` 4# S0 S00Y0 4 8:0@4000;0000 0 `Ȇ`0`0Ȇ`00 -Lp -L너 200 R 200 R 200 R 200 R 200 R 200 R000 200 R 200 R 200 R 200 R 200 R 200 R 2 R -XALM 0T!  0T! 0T! 0T! 0T h0T  0T 0T (0T 0T 0T 0T h0T  0T`-4 0,^0^ 0cab -LM܁ Q 00#QY Z  030Y P$0P00 0 0(p,` p0@` $40 0@ 0 0@ 0 $4P (p,`@  Q 00!QY 0SYQHPD@000! T0 TabUd`LUd p-RLM@P9  `!0\0\00S\r pQ< 0S,88pT0S 0Sr00V0S` OabĈ -@LQ`8 ~PPH T00T0SV1|1!qP0HTTT`0HM.$04 V000M.TP4 0(,04@?0@!! 00 PP@0  "!鄠 $04 V00T 0V P(@% b`܈ab`0b p-LM40@S  S R 1Q`00#! R0000 0 0!!Ǽ0S0pab( -TLM@ 0Q@0 Zr 0 @T 0abab@0 0Ud -0Lp 0AS`0t 1QU ,P(`V @0 PVUM0abH p-LMP`@U*T @T`p U*$$8#8&@pȆ` -LM0@040 T004 $ p-LM0`@040P T0P40 Tp 0-PL @ U   0h 0-L@P        H0 p-LM`@``P }Hvp00 0-LM@040x 00PU   }0g c KL HnDD( @ (K0  $@ P /0_hH* -LMpzsP`Us 0 0$  0Q< $P< <800S`P 40PP<00S<0   Zz ` <4<8  4  @h h0@K4@ , @P 0 P $000S$ 0040$0$40D`(00(0 x sr-LP`p  0 $@T uv u 80U 0@Tv D0VW WKP  Љ p-rqLMP`  0 $ R uv0@ u 80U T pv D0VT404040@< -QLM@8 0C?. B"0~ {d - 0L0\ s0 00 0-$@0 TLP,00 L0 P0@T0 0-$@LTP L0 0@T0 0-$@0 TLP,00  L0 0@T0 0-$@LTP L0 0@T0 -PPL0@& 00 1 ` ^{'i$8 80$8P 8T0@8$0P 8$8 4  T0  h. p-LMT P0`@H \ 8  0$ P@0 8$8P <8V @ $8P@40 }TppT0 p0h@T0 00 T00T0| `X08<#30$P 8T0@ \ 0 <$ 8P< (  p-LM(0a Pp0@000T8TP0$4P L0@0@0C& R 00#!l000 X0C& P 0 "!0, 0 R phpRdtRdRdRd0 p-LMPP 4* 0` p8 $48@P0$ 4@@ pd R0d0 `00S`0 L0`@ppp p-LMT0@![Y$80 P8}`$8P0 4P ` cVH0S T0  p8$;P8 T0hT -LL  -LMPP 00`Rp< L@$<0 T ,000@ 000@0@0C& R 00#!000 0C& x 0 "!0T 0 R iX, \00Q0S pRdtRdRdRd0 p-LMP0`, P@ @@04K0TT0`K@P`Tp 0-T0L @PP X0  v k _ U\0   B 1   X00H  00hT 0@ T d00<0H 00T 0@ T d00<0H0 0\0HT  0d0T 0+ \0T H 0d0T 0+ \0H( 0H0& X0H0& X0H0# X0~H0# X0sH0"iHPiQ- -LMT0@h0S 0 ?C5A0P 0S0Q T  (RL#R!&R$0RA0R#& -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000. 000008P0 $4P0@8$ 4T0@@ \0 -P   006    0000000  < 000 006 000@006 000 0008P0$ 48PP0$ 4 -L>P / p-LM@P`/  |(0tH0 L8 P`0 T0d  $8P4 00 X0pphX/ / 0-(0PL@ F 0ES (H H0"S 00 H0"SHp H0"S 8P0 $408$;P 80$ 8P0 $4V>8$0P 80 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000$8P0 4# 8P0 $4P0@8$ 4@ 000 006 @006  0000008$P0 4@ 0-@L8P0$ 48P0P $4$0 S8P0 80 -L)P p H0"S 8P0 $408$;P 80$ $0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 000008$P0 4  00000000000006 -LM 0T@U-P  @%#,00R0S ? cZ p-LM@P`(0H0 L8 P@00T0( `R ph $8P4 00 X0pphoX/| 0-(0L@P0  H0"S0ES0$0b_p00p먋 -LM@8$P 1<8 -LM@`PR L%?> p #C2F(0H0 L8 PP00T0P0 $840  X X0 \0  h,h $8P04\؋/( 0-(0PL@ 7 0ES ` H0"S 0TX0 H0"Sp H0"S 8P0 $408$;P 80$ %0 0-0LP@A,P 0 0q 0Q 0P00 -LTM0d ` h 0 l0 p  d00 80dp d0X40   p <2P P Pp X  Rx t t0   p 1("(RP Rt0x0St0  @<  0t X0 0P0 lh0Z`0 8@ \ D `LA$MD9pᰀP 0Q0P Z0Y0 Lqh0 2  0 ,  ${P  P@  #$ 0 (0 lBP@ ,K0K 0P@ @@NP !0,0+0!o 0 @  @ 1@ A0 @  @ 0  1 @  0 151gP@6&P1T! $@080 m hP@1 ? 04K PP X|UAh 04$ @P64@ (P T((<0 $1!_0000 T 0  1?L P 1@ RPt @ U#8Kᕈ0 $0 ?0T1w00  T1 =0#0Z00S080 `0Z T480@ 1;1 0 8 0  04  4 $3 $!3    mP}g0 $|30 $Q?!0 $PP0 T0 $= $0@ $@DO?0 T0 $p2!X`C1071a 0 @  101  0LR(T #!0 $P@@0 T [0TP0 T x0TH!0 T0 $ !0 $0 $08  $g0 $!0 Xh@"XX<>-0,>?BCEAr8!\8#\Q( "(R0SS S SS7777777777777777 p-LMl2AP@ @ 5 D` \4TPp0$  -PL p`:1V4141l2@ 1@W @ @X@@VHHl"Z@@0@ 0 $X000V000 Tl" 0 T -LMPpP`M  0pfPB ` 0T@ 0T 0T  0p}f0 $l p 0T@ 0T 0]fP@ 1 ,` 0T@ 0T 0TZ 1V! W00YX @{  0*@ 0@"}fP?P17ü10 $`0 $ 0 $ dll -0L` $@l2 0pb XR$0@c $@D (C@= 71+%l2 0X0 $ q/0 T 0TX\XPXDX8X,X (Hh -!Lp0 T@x!0 T1   hg8!0 TQ/0 T10 $``0 T@-0 TO?@H$80 TP$L0 T0 T@( 0 T1BCEA-A > 4 %lž01!05S<T2-A > 4 %lž01!05S<T2 -LM@P1 71A>,T"%0(1! -LM@P0 0 -LM@P0 0 -LM@P0 0-A > < lž0!10% S<!T2181 -LM@P0 0 -LM@P0 0-A>80 lž !10S101$ Ɍ@ 01! -LM@lB 0 SA>Q 01! !)<T2!P010l"0 1 011b1`-l" 0S,BA>T"  01!v-l" 0S+B@A>T"  01! -LM@P1 71 - L -LMl"@0S SB  A >  -LMl"@0SB  S 0A > 1 01 SC  -LMl"@00CS FFFFB > 1 01A C D   -LM0 `8 0@P  2  S S  ,Z  SO $K 0K P (0K 0$ 0P $x0( 004 0802:09"P6 0,K P,$p@0, (P@ NT tIpGdCj 40S , *0 4Lt vr, -LM0`4pP 0T 0X0B/0"@00 0 900000000 H@ 42:q0:)@@墀0!10 P00Sb 10 0 0 0 ,0 0& 90 02 E0 0? R0 0K ^0 0X k0 0d A? P 9 `03 A-Q$ 㣀 HT 9  00S ZB  I0TI `0T P0TP0 0 0# (0 02 <0 0F U0 0    -L P  0 0 D0) 0! L4[S 08#8T X0 (K4[\ S% T (KX X  Ƞ,Ƞ 0\ @T X XHbU  -4p0`PL 㶪( H L 00R  () A05R )9   !P909?@H$H0 X9A?AS  Z Z909) )  )MH$H 0@X p-LM4`0P@&0S pQ 7\ \0 lD0 Q08 K ƈȈ 0- PL@$%P  0(0 PP  -LM4p0 àa)0 0P0!0!0PS|a= 00 (0C"(0y (0"(r00@ P0(U"h 0b (0"([ (0"(T00@ P0(U"h@@ 0B 0E("(0: (0"(3 @08RP#h@@A@C@@ -LM@rh -4`0pL@H 00I X 050Z 0000O 000P 0d 0 0@ 06 0K 0h 0L 0IP 0 0P8U#H 0-L@P (w0 T y| u 0T 0T :X=0hB`sb -0 L$0@8 @S(@0 0@R8 P00S00 p-LM@P `$U*00 U00 Tp 0-0@LP T (0 0- @LP$00 0 T0 $  (0bs -0L $ p-LM@` P( 0P  (0#4 04 X ( p p-LMP` x $@ n@p -L@P`p[\ 0@@l -LM@ ` G $ pP U \ 0P T $P  &0 T    0T $ P -LMP`#pP@ 6 D6 A0 X0SdpCT@06 G 0- PL@( 0$  p-LMHP` $H0 X ph p-X0LMH$HP0` X ( < 0p -(LH"H  P`p  80<40 h 0-8@L#8P X ( 0 p-(LM"(H`0P $HX0 Xp p-LM8P#8` X (@ (H$HHp p-(LM"(@P0 `X8#8 %XX0 Xp -(L"(@ȠP0 ,x`XT 0X@T -(L"(@P`0 pXT0 X@T -(L"(@P`0 pXT (@T -(L"(P`@0 pXUڰ0 X0 XPU@ -`(VLp"HP 08 #X(U h"H - L@` pP 0X 0X \0 X (X%X W0 @ @@|U -0`4pLP@ (0"(@T0R 020U H aP008 @0< D  F   0X (P $P -LMPH$HXph 0` 0 ` 0?%X@d@D@`0 58#82 r04 m -LM(0K@KP 2[S   -L@p`P0 T  $P0P S (-L@p"hP0 X  ( V0P S  p-LM@P` @  (@H$Hp -`8 L#x@P08#8S0   @     -8LM`p#P @  0@8T#@@0-0  P`CR@    0@8T# -8LMp`#X@ 0P@ T -8Lp M, #@`P0  Ƞ ,hp0 SPpU@,0@@ 000 0-0P40 0P 400PC U, ` 0S V,@pP  /0 SPpU@400PU,0@  0 S40PpU@0  Ƞ ,h$0 SPp U@ -L M0@4P $ `( x 00 ,0 *, 9B0) 0 0  (` 0T 0T :X0 X ( x (08] #v`0] 0 0 0] 0 X 0 Tx ,08  P P ߐ -L4M4`00Z T0 e  X )Zp Z 0g ;1#X D0K40[ ("(0 H &@0[2 [0L0 30P0 $ HpW@ P* P +!"H (U0"( 0H pW:H00Z p $0P_ RU:L 00gQ00A0D0S 40[@@0 S<,00 [8[0Q,0  DKT 70[S% HS `0TH  0T :X 0X0 T20[080K7@K @ B ; 080K@ [)tL  0 RK jP0@00K |000  $!0 70K8 K`X -L$M4p0`@ w08M #X< ( 4 40"(0@0 /@@ ("((B/8 010 A  U< @ ! U  U Uh  U7 U 40" ("()0@P 80S@ 0<K 0 0K 0(T00U80EP P000K 00[S @忐 ("( 0@ 0 /0[S.0[S0  00 < 80y8 <00倐 P5@04(@ 0"(("(B?  h1  (0"(4@H$H 00 0 K u00K 08 P0 0f 00C 20@  8 < 04S 80< 8<0zSx 8080 00n   p-LM`P@T 6 0 SP Rp 0-LP@@T0 -HLM($H"(P`p, ("(3K"0[![ (0"((K"0[ (0"(![<@K"0[! [H$H0  0 80 -(LM"(P`p0 X (0K A[(H@ (K0[ [0  (K0[ [0  ( (K0[ [ 0  (K0[ [0  0- @PL:X 0X0 0- @LP(0 08#8 X0 0- @LP(086#8 X00 @- L0 ( 00P0S0P 0 ( P 0 8-#x@L@`P1 V 0FS 0F`` (!0 X (0!0 Xp  V `F(  0F0!0 X  -L@P`j 0 8#h] p0]  <X` ( < X0V8#h0] h 4B0>3 -0L (P0 P00 p-(8BLMS@P"(R B`` (008#80 X pp p-LMP`  $@ @p p-LM@P` @0 T p -LM400pK@P .`  04 @0 [PR @0  0K@@4  ("( 0#.[Q R.0[S/0[S@ 0 -@K/0[S,[8 P0",0K8 0-[0\:1  0\ -K8 80Sp< J^: 80S @ -[bBϠ 0-[0, [ 0p<0   00 @p0 BϠ 0 0 -[ 0  yp<0  b忀0p 0 0 0 <0 ῀Qu -[]pW  ,[ p< 0 p0  < 0 <0  4@0@,[   -0L M '0K& K( K%K$K@0`4p<`P P U(0K@2(0K$@K  -P@ 0L`p@ 0h? 0-L@P 0 @R2"0 -X0P0 R00224 LS0S"$P    -LM0@P`$004PP (pR  PU 2UU 0E8#B? $0| 2 x  P 0 RPi  P :^^ C^%^ ^^ Z^U^[0 00  , 9S  (^^! 0 000 00a 0  pP  P*0   W9S  (^^ 0  ;;S0 a0 P  P0   0#000 0   l0^ 0 00:L 00C 20 0`00I   -L M40p0 P`X 0 E@ 0 00S ,0 ZʐŅ(0JÁ@Y,0X  80 00    -L,M (`4 8 04< V@ Q 00 00C8#XH 0 0. K8 8- K ;1Q#xH 8 L L0EU8(0K8Q #XD +K,K+ K, K  @@;1("(#x 00K/@KHH 1D("(0 oH 0L8#8QH0 8 4@ <  .0[Q0E"(+PK,PKD .0K+K,KP -LMp0P@`04 0 % ;1#h 0@$ 0 0$0 @@ 0  0!0t 4 0    2@ 00C 20 0p@00  p-(LM"(@P0 `X 04 X 04 X0 X0 X0 X0 X1 X1 X 04 X1 X1 X 04 X 04 X2 Xp$ @0C1a!cP0$IQ0 00 0S`Q0S*0BQ -P[Q(L"(`p%X@ ~@@$@P@@T -p@T`LP: 0P@ T: p-LM6 `PU@ p6 0f6 G0dQT@p 0-6 L@P56 000hF p-LM6 `P#@p6 056 0d T@ -LM0pS` ;QX%(@dV` p-LM6 `P@p6 06 0 d T@ -0`4pL⛠囀@Pe0S ᛠ 0S t -L4MH 0P04L0 vP 0DKS@:;1("h  #xH\  0 0 @R*PalA0ST0 00@    ("(0  L0P>T -L,MH 0@04L0 &P 0DpKS`*P(;1#X0 ,A0S 0 `R*00d  H@\  , 0  7L0 -0L\M91 0`4p ᛀP, 0P0 1 ,0S , P@  0@ | K0OS|K4@|K  0]Ka^KX@ zKxK`K0 @0 0 |KP00  000㛀| KGP`B?  a A0Hb -LM00p40`@c!@P2`f0,0 B@ 0 PA0@U0 X (,0P0,0 ,0P0,0 뜠因, -LMH$H40 00} -0LM<`@Pp000, S04@P00S 0 00000 0$0S 0 R 0 J 0 S ,  0 00 0S , o&P 0 0 0 -LM@0S< 00S  0P  -LM`@ 02Pp 0UV B0UU00000U/ U B? 40 A0o LP U DP >PB/000 4PB/000  )P U | !PB/000X P000 4P, 000 (t8@ \@-@ 0R\ 0 00pRdtRd @-@00C& R 00#!l000 X0C& P 0 "!0, 0 R@赀pRdRdRd02`0 Mb 0- @LP0 00"2%d0C"2# P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00hgtRdpRdRdRd0 200Bar gfff -R夢@ 0L00p뀂@0@0C\` 0  "!H0 00 42C& , 0 "!0"0 RuVq  ! 000 00!C \! 0  "!0 00 l1C& d 0 "!0@!0 R?@$0_1@@@ @   0,  @0@ 00 2": 8@"2<t"\8<x"2\!P`9 30 3pRdtRdbRdRd0b -LM1bPV 2<20S S S S 2S 2@ S 0 p0WfN:3p 0 WfN2Dc  31S8"̌X$ʌ" 0i <3i ㎂ 0848<"\0pW@ | 0848<"\0pW@0pR0"p0W _ 8  f.0<"\0pW M 8  f.0<"\0pW80<t",00#q8<"0\8@" 0<\2q72 0280<t",00#q4!80"<<\ 8" 0<\2q72 02x8<"0\8@0<"\2@ 8@ 0<" 0\2ف8@0<" 0\8"08<"0\  -LM"@82 :';P:" 0 S12"<3S 2<22  P0 2"3Sh 2( (" -Lp 1R@U 1!0S` ,"`V8 V# V V  W`122S72x0S<80<","p "0S 80<",0 P"p` C P"0S 72P >P"r E0,2"  p-LM2@0P U U U U00UQ U03ph82S S 2gUa 2S()1 R ȧR3S pph$x0S080<", pph@Q 30S3$ " 0$"3"1"R ("00R x0S0"/02" 2 02: @0":2 02p1c2S񟗎|xxTT1"02~3  cvg0 2#c2SQ:”;\:0 0 10   SÄ"Ä3B2 0}. 02"3"R)2S$P0 g:"c phP) P3:PX x -LM2@ 2S h8<2x"\3 L 80<"<\ 8 0<"\2" 1 )@-Q pO_ ?n"0? Bp00= ? Rp00  2:02\\ p ? hh0 #? b \ 0@@ 4A>00 耖 A0 -LM@0227Q2+22<<€"2~ -LM@27;2p02 -LM@f2<2A-? π2#嶀 TP€P`8 $ "?NTp BScᰄrUe% =2: 02 ဖ2 Ɍ0 2 €ꀖ p-QLMP@ Qo 2Sk Q 80<",8`<"0\ /> Rph03Q3 U2 02U"      K?2-ph2S K?Q20032 020K/2": @0":pU2S  K?P"2003 " p2*<0+8*2<t"\40R22SP002ph -QL `Pp  x@ sH@8Q@P T P R6!R'W RW !R00R@ 0 (S00q0D@0 8Rpp\07@0 8Rp,0+ @0 8Rp p-LM`P@ 0PP@TU L0P00P0S P:p p P:UPEp 0  0  0  0;0 02302 -LM2@PSc$XH$2 4292\!9" 2" ` 2Si*2A 0* 2" p2 4"2 '30P  <  d 02" { `2S p{P242 0-2@SR2S;U UL2 1“ R7 R00R0S6 q72 020E Spppжжж2< 52 82<t"\02` 5<2 25<7< 27<5R8<"\ꀖ p-LM\!\08@ P`0P<"\8<"0\80<t",80<t"7\80<t",80<t"5\|80<",@002 5"0`0  0a7 0,0@ B 0p@B@ -LM!0 P8@0P<"\8<"0\80<t",80<t"7\80<t",80<t"5\P|80<",00S0 00S0020 " 0p`t0E@ `ˆ0a7 ` JR 2302 RR2 R2"0 Q 2^2|"# 2^ 2^6  t2^ ^ 05001 T2 L2 R8 5 822 ^$2  131B  2 1R1  g =!Q* !00S !00S !00S!2001 h1"5p1,"d1 "414,D1@1@!08!^# ,1^ 1^ 1^2< 1^ ^2< 520 4#l02  P0Tt \0 #,0 0X,abde Z  Ys! [JR!̊" -enPLt 3SE S #L1R @ 8132  $$m!=1!@1!0t dD0B e 02ST00 A00T 000000 |03t0- 4 C00H  V02 1  @$0<HX̊W 0-e^@ Ld#0BS=0S| S `&l0R 02  P M2:208 E,03R2<2PX $dp 0-eNPL -3S@Xd| !0#R|0 300h `0L03D @0 4#0R 0|@܋ -`Le 30CSw3qSs 1!@8P@@<"1\8<"0\d[v80<"\0_3 0@@@@0@THvC@DTD0 S 202;00:0;02SR0<02S0 R0002S0SR0<02S0 R0002S0 R000 $@ H@@s0 S @' -L MfP0U@ *ʟQ 0R PU@:U  ʟ0 00 040``&`$& 0S S3d*S8 2 0  D: 00,0 ZO*0S` ִ000C0 ? 40 R;p\ɟ0 ?RP 0 S P1SQ# 1 r00 Q p9S1 d90   q09)0000030000p,Z4`: h/BB!1317!b00 P  0h`0C0`(0h`0C008@<<" `\0U: T8P  Uk:0S0S^ 00P!u PUO 0 S 202 0$ 0 40 0$ 0 40"R0 r0<02S0 r0002S0Sr0<02S0 r0002S0 r000 @ H@@i0 Sg 8<"\ t 8  f.0"<\ PU: t 8  f.0<"\0PU:hş0 ?RP 0 S P1SQ( 0!0r0@  0400 $ 0 `40 048 0 04800AShD5 r00 4r0  2:02004r4 r0 000 P 0h `0C`00h`0C0 0U0fN`T:$$0P0 UfN8:0S0S+ 00Pt  PU 0 S 202 0$ 0 40 0$ 0 40 0$!2S0 S 8<"\ s 084"<8\ PU@: s 0848<"\0PU@:|ŸP0S 0 S P1S\L !00r 04800 $(  q090000 '0  000 0x0S<2:02Z, *dA們0 S?P 0 S P1S1S@ @ !r 0400 $ 0 40pQ,`Z:0CS r@ᶐ 0 r0 0l0 r0r@ᶐ!xh '?= = -L MT5CL5 T , . T0505 3f~ 15ş   0 4 P28 0S 3S2$<2#2  g P`f.= f.` 0`S4Vf> .`64S* _  2:28t`0S _@ P@ `1S2:23 ,0S ,Ψ 0SS`VVH g [Pl3l#d3d#@P\3\#`pT3T#04K  4K3K2@K1PK0`K/pK.K-0K<P_  g2P @ @P @@P"> @ @2P2 @ @P 0 SJ2AT 2 ; S  R@ZT 2  #3Rn> R2#;2#e e3 R   0 a002  2#;#2^f   PT P 3S13T1 R2<23S,A` 0S`VV1 R0 R 2<28<"0\`f^@80<",P0T@`V|0f3Hb܋@Tonmlkjihf`!sr' -LMpPL`@2 S@0%P UW "R 0; icd0_202i2"92 0$" p -LM@2P;2 1"R T0!P  Q202z2042v2S00"002  -LM2PF0 ("X2R <1… 0ڠ2YN002$rW` p`2@9  @YN $rW` p100X0 ʇ? 1 "> X ڜ2@:<: P2@020W0  0`0p!1`01" ? 0 "> 2گ!"101 f0S2@002į!!0 W!`p,A p-L M3"0PSl8<\"0\ ipV 2*<7;2X2+*<1 KDW8P00<l"\ KW8P0 0<h"\8@<\"1\0 00(#Q 0 S3 3 $30C$3q:΅3 S 00* 0P:υ3 S 00 * 0 #;;0 0P:4Q 0 S4383 <30C<3=V2  " e2 2?02p80<",80<"\3VKdH k 0-:LPI @D @0:  4 2"2@ 2"2"! 2+<*28<x"2\8@2<t"\2!0S 00h2"0,2"2@ @2200"2@0:0h -hL$M P@ D D0 S` @ H  <3Sv V p60 S 0S0   `V`V~ 0S{0  4X 0 S4383 <30C<3Z@ 43JS0 0S4383 <30C<3Z@"!888C 3 @ @\0T%0\00 R3033(%030 x3|300%%x3|3R 262@ `X00X0 V``H0X0S1X2D 7* <`K  00>0 @VP<!  0 0S 00 0@83S<340T8<3SIڜ272E3@ 000۸@0@0C\` 0!!3 0x#C6000 "!@L#00 RV}  3! 00000!C \! 0!!2 0"C6000 "!lx"00 Rc$00 08  1 @ 0400l"$@0@0C\ 0!!1 0!C6000 "!!00 R'$ R 1 + 00 1, ( <`8`1@ H0S0 0 B 0@ @8Kت,`jjjb 0` 08K P T -2<JH  4X 0S438C@<30C<3@@KdpRdtRdbRdRd0bb -:nP PL&0S"0#+  J 2@!12122!#  0S00000" :;: PP 2 Zګ/0000 002"8@0,2"<p"<\8<x"2\8@<t"2\CpT 0S 3$30CP$3G~ 8  0 00`30`3 \30\3 d30d300Sh30h3l30l3 p30p3x01 S L3 0L3 P30P3X30X30T30T3p 3  zL@ -L0M@pPPK (@  @ 0XX@T`  0 S @T`y (0S (p T h2 ) 2P!" ^,[Hb<<  3 H  p-LM@`80<p",2P 008<p"0\ 2"0 R 3 0S  Y7”  2 0 9 S# )92"202 8<t"2\”10 S 2 htK2622 )62"80|"<,8t##8 h1t#0S 2” 382<t"2\38032<t"0\80<p",  8<<p"\2320%0;062 2"; 2"2 pWph 0 ( 1 僿(@ h  0-0LMP@0  PK CT0 -LM K00! -cLM@ 000ѵ@0@0C\P 0  "!0 00 2C&  0 "!0x"0 RU 01 000080!C \! 0  "!0 00 1C&  0 "!0!0 R]pp $00R0pp1 p>@ 0h00d$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R!$ R 1 0+10 ,p(pPÔ0P U q e>P. pP幻3` L\0妫222Sp,iЦ"H,̈0 DLG-1M`P 00@p0ppbp r吢 p匠plr p2b0  P`@  匢2`"dRhpbtBx€|r\Ѝ -L @M 0 . 0454 0$0H #8#8SQ00Q0S QQ -L8\"0<0\ hng -L8MPpU`  0   0   0@@ 8x%#8S $P@ P@ PK P X@3@#TX>XT0(" 00K ( K0,0K([0DSn>,[2902"XT2$02T202TT202TTC T 2  262  hp @/>@ 4K8K 0P@ @@- P0<1 @ e>, $@չ}  0 @  f2"XT 02002T29B0200X00S282 (嬹 X@3@#L     r , pRdtRdRdRd0 4 v̈X  * 8#8- SP 0S P 0S\^ 0\꼍 -LA```!` -LM8 P8l0@ pl0@pD l0pH , l0pT @ @@$41 0@00 4 @98<48 < p,@!8,27, 2<O^< p4Qlp 0@ l@p 0D lp,0H l@p00T 8o[|4! 0T0`X "2 QQ 2Q 2Q 2Q 2Q 2Q 2Q 2Q 2Q 2Q d"=A 0CQSmP2Qj H2Qg @2Qd 82Qa 02Q^ (2Q[ 1RC 800 ( &  1 ,!`, 4< 04 < R <cd @9[<  0R0` N` @9 R 000 0R0玁0 0 0'0  R0000 0S0:0 0 S:'0 00'Α0 0 00 h$!$J$K$$$$$$%o&$` -  808 0 0 0 !````E-08 P` @TP0 p0P:P 00^0:0SS00Q  00QQ0 0Q```!` 0@-P@ 000 000 00!```` -LM4 `)P+4x0 S0 1!00d 0 405 1Q^ _1QZ 0601l`0 080< p@ 8 8 80pWP  g0Pᨀ 80pO^W Plp80@ 8  0h%ۭ4[lŕ\ ,0K4 @0K@6\8 8 lŕ4\ 0`0,0Q0)AttC!it -L MP`0l0p00 0H 40 l0pP 0l@0c,Ÿ2p@ ,  p,@ pWOYElp0H l@p 0P  |! 0T0g! 00 4 2 00, 8  R00ą 0g a 12  07\00L000Ũ0 ` 12 # 0# 04h0 PQ 0 0Rg0 000g0B=8 t -LM)0`40 |P  0 l0@ l0P 2%XU 2U 2Uu ˬ060 V0x0 S0  60+SL2 d000 008"040` <584X80pWP4 P㨀80pO^W Pl0@ p g0280 h%刬40  l5S `A,0K0K 4 @l5S P l5S l5S  4080lp 0@ 0SR00U0?SH0{D0w0Sp0U d0Ui\50hP0U H0U_t0)|J!I1G1w11 -LM`)P3 X兀  x0S 00 A>000d 00400 6 <80`05pP \p  (0K80O^W P(@,K@#)H1! -LMP@l0H pl0pP 0\"0c2#pp.2  ,2  2Q2 R020ĕ!0SQ00ė`, `VYalp0H l@p0P  |! 0T0f# 00 ? = 00 6 b"f, Q0|  Q  Q  00| 06\00L000Ř0 ` 12 # 0#d0 ,0 s|00Q fjn*`1`<`D`?`7` -LMlpQ0 @3g1pP `*0 S(0#4 0 P @ p!p1W0`4p@0P!QWL5Ť4Fڤ4S$(> W 7 04 0 W4S@,0K0K @4S 0b(P W @ PP  < 4P  0G$4➪ bItO -l0`LpP l0T p 8 pW P@4S PONU @UU P8 8 p -`L)P`p@V0 <00 x@880T +80@T -LM*0pS(0`#4@ 0P @ 'x0 S0 !00 !Qc [1Q0 1d00<01 `04 8580PU@ 4SONP @80Ul@pPp <<p <T0 00 T0l@pPp 04p lPp@x 04x 6 D0Q40 00 0 00HF)SVI -LM8 8 0 4 ,4可^4 0Q8o`80| 0! 0T200,0  a002Q 0S0@0 20,0 04  00 8l`0ppS4^VPTP@  !,22 4Q[PXP8 l0@pAs@ 80pPl`Q@ @0sPAp40  0P Q55 @0080p@l0As@  @RA80@*R40ȁ60S4040pAlP`s@0p< 0 @A 44< ml0x p8 @P00@  O`T`I` -0LSP p`l0plPp`@P @00P hl0pT lPp`@T $L4<T -LMpP~ xyx0 S0  `1 00X16 d00<0H1lPp@ 4 5`08 00 l@pP 00 lPp` @ $H@8@8 80PU@ 4SONP @80U()X[ -L$M8 4 803a410* <0 (0R8#4 @ 0p!@0  h1<\0 44`<PE 8 20D0 D0lP @pp `@A 44  Z8@ 0 @0<S0$0@座,0K40K<@ @<4S4<8 @0,$,⣧,lx!Ld -LM8  < 0 p0l@0 8@ !  , 80,4 *40叟0S40 8@@A@@ ,00 @0 R8o/8<0 |0! 0T40,0 , j 0080 S"` BX@ 0 SP4 84 @,A08@T@D0 @,0 0010"00"`P @ R0!@2@ 04 00 0@  88@ @  00P0 @007 8 4@0!A,0`@08X@Dp0@ ,0 @TXPh&PA04@ @ &l04 @0 4 0.0 '80@4 0`A, @08\@Dp0@ ,0 @TXPh&PA04@ @ &l04 @:AHN -L$MP [^p7[P1 0   @0  (R H  0RT 0 $ @ įP00* %0 S:ӌ0Ո0 0 pqWsX6W p0 Sr- 0@ ,`6 R 0D ,0S *%0040  R @ \0 S *%0p RH 0D \0x0 S00 40 P%A> 000d 0 506 050%`0080h <* (0R#4p80`pVSP \`  ,0K80O^V P@D0K@4S `xTx$`0 00lpD0l@0p ,`0`0C\ 0  "!0 00 3C&  0 "!0#0 R [NS#`0 00lp@0l@40p 8`0`0C\ 0  "!0 00 2C&  0 "!0"0 R4 N2B"P0 00lpD0l0p HP0P0C\ 0  "!0 00 1C&  0 "!0!0 R MA!P0 00lp@0l0p TP0P0C\` 0  "!0 00 1C&  0 "!0 0 R M 0  p p8p0  py|厤` 0 @  0 0@ QP)hj!pRdtRdRdRd0 -Lp  ,0^\RQ1 t1 1Pt@  0\ m8Q81` 0 lp l@0p `0`0C\ 0  "!0 00 0C&  0 "!0x 0 R M T0 ,,LpRdtRdRdRd0 -Lp 0,  Rdp?T&0L!01QxN  6\P&0 01Rx  <\O%0 01R| 0 ,@0S Tk@kXkpkm \m陣 H0m钣0S   O0S] 0  0P4ğ  UP 2200T200C\ 0  "!H0 00 44C& , 0 "!0$0 R 70#P P m.,)L 0 $  $ 0 $ 0 P $  0Ty (dB2P 0 lp l0p P0P0C\` 0  "!t0 00 `2C& X 0 "!04"0 R@KQ1` 0 lp l@ 0 0WN H 0 MN $ 0 @ 呫Ps00 2R0m  0\0x0 S0 4 d"A> 000d 0 506 D2D"<`0h 8 0(K P`   0($ @P1(p@ (Pt U! @18 3d1TP@o0S 4S `H匡U 8凡 兡(Q(1` 0 lp l@0p `0`0C\ 0  "!0 00 0C&  0 "!0h 0 R] IJ[PL)hj !  8 rpRdtRdRdRd0 -d!L`1M, H `, L1L0,0D!D0P 04 , |040 8 8P1 @0e!pS1#D 0   PP%U4 80 0R4 80 , 0 , 0, 0 , ||0,t t0 0 0, x0,0Lx0 oԠ&$((L0ztzz{H{ -L03a`^q\0@@L0 hŇ`XPU$T h%墠̏` -L M1 p`$$t 1,0 $, @0 Q 1D!00 0 0 P$  os04 <0M>000 P$013$0@ P⊡ X00P  PPX, 001  8  04$L(X`L -LMx0@  001<@$0 01 $ p-LM0 h0 P@` 0 <@Tp 1 0  -00L!|0D $ -40LM|@0D T -00L!|0L $ -40LM|@0L T -40LM|@0T \ -LM`P) P W2pPQ0 Q0 m@0q gMP@b x0 S10 !000㘡d @40 0`<58 @h(WPB L1L!  @:/ 460( K,0K 0 0 04S P 4S 0-lp 0|,K (0KXPx@Dx@x),~lx! -LM810,0 Tp P `,@0(`VOl0pL 01pp,0wpP  Q10ҪY |! 0 T 0w 0Wp <040 P0S RQ0mp`u`0@-p0"R 0\P0X@00"R  ^0S0( 0R%98cb܏`$0(#00"(R0 Q(0S009 -LLMp0lpH  80l0  )PP` |V85 0 l0@ l<  0`K80 P@% 4 0S0060 $0   x0 S0  `4P00X$X4d 00 040< 85PX4lPp``0P @$H@P @88P 8 x80X` P80OnX `{Xl0? X: 0  24S Cd0KhK  @4S  0>P Xl0l 0 l0 l l@pPH l 88H 4S `l $Dq02lPp``0H @H $D@<@4H 1l`pP`0P @P @00P lPp`P @$HP @ZlPp`T @T $L4@<T 0 Q 0   0 l0@ l0<  8 `KPH D 00   6LU06`@06@8cb )D!HUp -L Mp` O,P, l0pT A 100p0@000 0Z_Yo |! 0 T % 0S000 PR0C 000 ,00,0 lp0 ,00!,0000@l0@Q@ p@A0  H0!80,000,0 0 R0 0Ņ̑ -LMP@2p0,0 `,@0YO` l!p@ 0Zo  |! 0 T0,0 .0S000 PR0C 000S0,0 0\ ꐉĉĉ1 1 0 00lH p 02 0S00ą,00LS @@hd0   H՛@0  0 0 |‘ -LMpCP4峛 @x0 S20 "l@pP00d T 00T lPp`@ @@ $D@@<4@ x!l040` <85 p D῀8l0p@ p`l@PP@ @PP00@ 80`VP q\ 080`O^V Pĕ\  (0K L@,K@~ĕ \ 0 4h -LM0 4 , ,0C, 叏 R, 40S00^lPp`@ @$D0@ @L<4@   |0! $ |0!0 T |! 0T00 7010!08 @,lP@Ap`D@@  822 , @lP@AppE@` @A844 ~0 RC0S0 ,0,4  0.4 ꄏ```` p-LM|0`!$ |0!P $| 0PP!0Tp -LMl0pp@ 8  Y P `@4ZS PON U @`  |0$ H8S0S$ 8 -LM`)PH x0 S0 (!(1d $!000840<56` 08R:000480pWP \ 080pO^W PPĕ\  (0K T@,K@ ĕ \ 0\`)! -LM0 !l0pD 4 ,`0Xo,Q ob00|,! 0T00l0@80 A@ pl0D@ p 00)  &  0, 0 , P0@00840lP!@ A1@ plD@p 000   00P, 0 , Вh -LM4 p< P4x0 S0  <0S000 < 0R000<0S006000#;00d #l`pP040` <85P @P $L@@4<P lPp`P @P @@00P l`pP@ @@ $L@4<@ lPp`L @L $D<@4L l0p 8 8 l)p08  l0p 80  ,<0SM80`VYP P㨀80`O^V PJ 0S h%4b 04 l5S < 1RA0K@4,0K @l5S4 0Pl5S '80l 4p 80 lPp`H @H $L4@<H )p! -LMT 8 l0p0 ~2"0 40 , ,P,可P, 8T l00p4 R o80 |4! 0T@,`01 0.00 0000 d 00 0 H 00@,0 10! P0 4,  04 ,80AlPpZ@pt1 `@A 44 8H lPp`@H $L@4<H @ \000 QS0L00 0S0@@000 8H l0p0 PO 20 S2Ʌ0SɇGjz``n -l0`pt L8 XP @4pS PONU @5 P0S  8  -LMpP *08 S(0#4 0偠 R R R R R  ~x0 S0 #3d #000` <04508  SR6 R R t͖04 8080PU"@PS ` l0p4P 0 12#  P}80PONU @ Rm R' R% R# R! 0BS8RQlPp`X @$L@TX !@ @4<X lPp`P @P $D@<4P l`pPT @T $D@<4T lPp`X @X $H8@8X 80@S4 ,0K  , K00Kll5S 0 0 &h0K h% `8 0BSR:80S0 6040ꅠ80AS)` -L MPX l`p@ 8X 00CSix0DSW1堑, 00 p,@0pWOXo |! 0T l0 !p@ 0  00 0bZ30 0S00ą  0l !p@ 00,  Q 0S0@0 0 T DD0D@@0@8h0000Ԏ`````` ` `,`H`\`h` -80ZLP `@p|0 $ 0S 80`ONVp @ h0S0 -|0 T -LM0`$) 9PP 9P 9P 9P 8P 8P 8P l0pP 4  PZ (8QQ x8Q p8Q h8Q `8Q X8Q P8Q4  4 (8 QQ 8Q 8Q 7Q 7Q 7Q 7Q 40 徔 K000 7R 7RR 7R 0tǟ S00:00x0S 00d'A>000d P@4P5@ RR wR R 6R R 6RR 6R 6R R R R R 6R R 6RR 6R6@ L&L6QQ @6Q 86Q| 06Qy (6Qv 6Qs 6Q(&o 0`  <08 5RR` 5R] 8%5QQi 5Qf 5Qc 5Q` 5Q] x5QZ p5QW 5%|5t5  8p〆  W%8 lPA` p80ld@0p 80pW 4RR 4R̄  |80 \|0 $|0 T|0 $|0 T80pW P P&80pO^W P0#3QQ 3Q 3Q 3Q x3Q p3Q h3Q lp40P 0#3QQ! 3Q 3Q 2Q 2Q 2Q 2Q 2QQ 2Q0 4 '$u 0  4S 0"QQy D2Qv <2Qs 42Qp ,2Qm $2Qj 2Qg 2Qd 2Qa 0K0B  ,0K@4SO !1QQ( 1Q% 1Q" 1Q 1Q 1Q x1Q P 0d!QQ* T1Q0& 4  '4  0 0QQ 0Q 0Q 0Q 0Q 0Q 0Q >2//:  0'@0K:jꠀ0 L0P 6Pr060o000:00&hMhbiMibuuRurv33M8M0M)Ԯ````\  -LM`-0 t3RR^ h3R[ p,@PpWOYom|! 0 T +  2 "   0P2 2  <\W  l !p` 0 P2P"008 $2$"008|0 $l0pP @ ;:   20S`1  1 R20SU!0S00Ƈ  20S T1  H1 R20S020ƅ(!0S00Ƈ  20S0 - 0 R) 0B|0 T0 G  000S |0  00S 9| ! \00 0B0208M0M``````jn -(|@qL` 0 T| $0@* , 0P^hq| 0T   T  0S00 -LM|0` ,8pWP @4!S PONU @;2 \  0p 8Y -8 ZLp `4S OnX ` 4S 0 0QQ' 0Q$ 0Q! 0Q 0Q 0Q 0Q |0! $8 MP8  p0|A  0T|0@ $  hMhbiMibuuRurv3 -p03a`LMP5 @ iy|0$|0 10 T5%$|044 \ -`pfL  P 0m\|0$|@0 0< T| 0\ -LM`)P児倐x0 S0 1!00d 0 405 0!>C0CS LX(((`060H1 < `008!pS00W80P v\ (0K80pO^W P  0 0@d  :9d x@,K@uĕ\  0 4S 0S00)ܼ -L,M, "0 l0p@ 4 l0pD l0pH 08 l0pT @ @`00 00"0!D0 4D0` 8 n,0 < 4 8 ,@4YOlp40@ l@p 0D 0!Q lp80H lp0T <Q,oq@0|< 0T,DpT10 0(H0 1L0 0H T0 40!2P 8T 40 8 ( & 0S!PL0 bH1< 0h< l0, p00  0200 00   H0<0< 0  < u000rX] -80ZLP `@p|0 $ 0S 80`ONVp @ I0S0 |0 T -L MPPL *0( S"4ppx0 S0 |1|!00d 0 405 00CSXxx0600!0`  <08 `@ P80`ONV @0 R l0pH l0p8H  $0K x$ K(0K4S 0 0 v(K300)! -L MP0 R l0p@ , t3,l@ pD , !00 p`,@ 6pWO`0 R$ '0 R lp,0@ l@p 0D l@!p,0@ lp 0T |0! 0T00) ' 0 R  22 2 1!,0 0, 0  111 2 00% # 00 0S h1h!002,!, 0  0'0 ~$1$!0,04", 000 0S 0 002,!, l0pH l0(8pH Op0p 0,04", l0pT !0, .G@^NQTY -80ZLP p@|0 $`80pONW @ $0|0 T0S  S ZS -LMp0l`P ) 4 P: x0 S0 1!00d 0 4 50Sa beS^ S\ 0601 `0< 8 80pWP 3 g02P80 娀 80pO^W Plp40P 48 0h% plŕ\ ,0K @0K@,lŕ\  0|B\  0 484 `0S oS0) -LMPl0P plpX l0pp\ l` p0j!2#0,0  p@,  @Tό,0Slp0X l@p 0` oC|! 0T00  0 000c1`,  0$, V00Ft `000`00c1s00  00Q ```` -LM8XpP `@4 S PONU @`|$08<0S 8 -LMlp0`@ l0pP @rP8ox0 S10 !00040 1d  6 `0<58uLl@0pP 80pWP \p $0K80O^W Pl0p@ lpP ,@(K@`)|! -LMP`l0@ ppl0P pl0WT X p0 07 80 0, 40 ,A)^όlp 0@ l@P p 0lWT X 00p,0So|! 0T00"  0S40 00 0 55$$‘0 ,@ 0N,@ X000H000S8 00  04@0  Q0$0#(@0"(R (0#(#<S R P -L$M `ߊ  ,ĠXX 0ъ0p0<,` HKH 8 4 D @@ V@P < ?//7x -LM` , !0 , 00 r 00, P   ^>P@0 S –P@@  P;H–  P <B(0S/, 00 ?Y,00  0 ,000 00?Y0 –(0Sd0  $0 (< 0,, #$0 (7x -LM`4p(0S"P0@T00U0– (JJQ@DC 0–(0S. t20,000 X20–(0SX\00\0 }X040PX0n–^1 $0 ( $0 ( $0  (\0 0\0pH83.) $@08 10,000 00–(0Su 0 $0 ( –(0ST0  $0 (,0  $0  (Ax`x 0-4\0L0\0P (008#8 X1K1 ( @T弄 0000T 0 0 \1 (008#8 X1 (0@08#8 X0'  p-0P4@LM40S1 0S. `0 K6R&  d00d0h00h0 h00h0h0`x 1h0`Q,qP 0R   0Sp000pν002$1 ( @TT,L 000pT 10 0 \p (04\4 ;4 -$!$Q p0a0@00L0 ⧂0E  @dp00C& R 00#!000 0C&  0 "!0h 0 Rh,Ńz8000tRdpRd 8 RdRd0 -LM4p4P] 0X1 ( Hv10SA lkc10SGP210S 10S% d0!0d00S 1 (008#8 X1 (0 08#8 <0 X0SF ;   V3L.x+p(h$\00\0c 0X$ ""Hdt -Ld M@ 0P 0, 00 wyԣ@0@0Cp\P 0  "!0 00 3C& | 0 "!0X#0 RU  ! 00000!C \! 0  "!0 00 2C&  0 "!0"0 Rp00p $00R0p1 p?@ 0H00 y$@0@0C\ 0  "!0 00 1C&  0 "!0!0 RY$ R 1 0+10 ,p(p~T 9~5~aet0~p2l, X)~  `   @  P< 8  ~  0  0  0  80< S07H0`0R B:70P }0m<0 ,K P,$ pt2, P (P0 $H2 (Rr<2R825W:0=倂$8 "#8S: 0   0 0 V^hP0,408(  0   0   00  L20L2 :A !10CQS1Q0F VS VL2 0L2R 020V 0VV  VQ }0R 0h0R0t}W d|`|408(  810I$) ( r" ۄ8 -@LτR` 0 SA01@\ \T2|"x2`p"/00;l4/90P2, H2 DRDr"\2@ 04`"00bbbb{Pr0 0, P`0$2>C^0 P $ 0 PL@4`4Ph:/%PT4P<- y_ ᡲ 'bj? R cgI|* 2S 04K2Sd-h1|B ? m\%|T!|ܑ`$t.h0X P76 0-P? LR@ R P R 0S000C040S04T4;400 0- @P0L00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R0$tRdpRdRdRd0 -LMdğ@0Pp0 0 b$@0@0C\,  0  "!\0 00 H4C& @ 0 "!ğ$00 R, R,4S3U3UU*3UE 3U , 3@ 0001 @, k9\ß@00C\ 0  "!(0 00 3C&  0 "!2  Q $@ 404;0 R ᣆH f, , 4R4@0,0 (Ÿ@0  $(2S+ !@!00C\ 0  "!0 00 1C&  0 "!l1x  Q #  gP1U> :D1UZ<1 R0ñ@ 000 0L \2f @0@0C\ 0  "!0 00 0C& | 0 "!LX 00 RZ`0U/ 0j, k#pRdtRdRdRd02i 1i i i 5i i >6i( 0-@L2P ,0 040^0S04@04md00d007z0 0-L@0P4\1X1,   H!D!< 002 S>l4 S0("0*\P 0h zQP z0hb; P  4 @04$p0+$ Zp% 020\2 S( `%04$.hXT 0- @P0L00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R0"tRdpRdRdRd0 -0"00P00L0 ,P@`0p)Q00C\ 0  "!0 00 1C&  0 "!0p!0 RT" =4@3`V@ 0S)A00C\ 0  "!0 00 0C&  0 "!0 0 R" 74MaY02#],0&YtRdpRdRdRd0 -@LoP 2 ,5 0S) 0 0 ? R 00 "R0 00dS  S = R060 060#00S00&0-00/0S0-+ 0-PL 0 SD0S6$$$$$$$$4$$$$4 00/00@B00 06Sx0 h0 T T006S  0bx 00 00 -L\MC0 S`l d h pt h0 S8Ė?0` K@0 @ 0 P8Ė0` d P@`3( QʼĖ$T\lP h@ Yp #\` ,0 @r4`0000 2 !PUPt p0`0p0 (0p QĖĖ\8"4$T00"h0b0`00d t `008Ė(0S 040 Q 2Q!!0\2 S d = R_` $0 (0,0 \0KG @T*\0K 1h P@h  4 4 t r P T K04 0 00 UPT :4l08$`$4748$048$0`44 044704,.88 -2L@1\`! ,0᳠ X Up 42 0!X \(P"x U]P0"@X^L \paK>P@ m7W88$. 0- @P0L00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00htRdpRdRdRd0 -= RL  + 0B>>Q P4$0bS4% -LM2@l2\`d" ,2–@\P@"C.,U 2"rR  ,2"聟QR@  ,T2!,2@!,T2!,P2+,"@0+\2"R  4\2"R  4\"4 \"4 \"0+\2 @,JΆ@0 蠔88844(4 404 p-LM2`,,2 P0@,4,  PP ,0p\P0\p -LM2@,,"0,\ -LM2 S, `0pZ ATP @ ˯K 㼧0S4`<4V P T`@V*K 02S ,0S ,W2,,2@0,\!?  2,,2@0,\2,,? @ 2@0,\!Hb p-$1LMQ `0@00E00 R 4@/H0 @:U`00C& R 00#!000 l0C& d 0 "!0@ 0 Rp tRdpRdؑ` RdRd0 -LM2@ ,P pPPmW \\X0 0Pt00s0S `($ =t` -2L@ ,0P `V- 000cK0hW\0-K -LM@  TT`0@4=4 p-LM_ 0@  o 00S Tt0 00 0 ?2 0 0 p0,  T0 / P02 0CS02p#tT -LM  P[ ψ30ẟOP @P}PO2S!@ 0  0`CS@@'T`ψ0 M_ P@ P`q}P(@ 0,K P@,$ P|0,  (Pd Ps@sU 0s,s l l r 0-dPQL@3@3dSS 03@SS0S02,#834<#, 0-_@L 04P)P' Pz2 , ?? ?QL =0-{Ds0 p-@LM P<10`8!T041$0!0,1 (!00A0_00@!0c ” \0* 0# c 0c 0&c 0b 0b 00b 0 b coRph^b +0ʚ;0 D P.+#&0 -LM? @R2S a0S 1  SU+ U 0S303_"pK  2[:2K"[ K0SSP P2[<2K"[5"K  2[S  2[S  2[  :2K"[ 3 0R3 aP P2[<2K"[ -LMPp  p 0` P@M 000p p *,P@70 04P@%˜0  0P@` r  80 00 0 00 4q0 q q0h -LM0@ $  80 00  0-LP@L  *P4 ᙣ0 q 0.$ p-LM2@84PP4`  ဣ 0S $T(Tp., -LMp4",@RPB.+0\2—`1\5H! 0\x!@0l^d! 2\2—@\8!0C.\2—@1\! 0\2P0CS 2S "0A.\2—@\ 3-\2S2+l0\3 $S40$04"34 \8$.8(888  8,8 p-LMP4P 0` @V 0`S0x 00@V4P84S084p*04484$84k. -\1LMT `R0A (D 4ƒ 44q& 0@S `0 0`08T(0S+$8480  4T@ 0q X(D ڴ4` ;40X0 H0 X 80峀04$0 (8T., -RL MP`08 $0 0 L 3R)ptĚAp 0 P`P,0`$@ "tĚ(0S $0  (]@s3@ 000f"@0@0C\P 0  "!0 00 2C&  0 "!p"0x"0 RU 01<2 00,"0000!C \! 0  "!0 00 1C&  0 "!!0!0 RT$0001h1``` `@ 0h00Bf\? T0D8#H 7Pv @40L T2RL2 0 S 0c081#102 !RXRLB R@Z9x4S 00|dxd 1Y01 |$ 00i 0x00i0|4`|$x0|40 008 R x44  40X 4 PX x$Rx4xV0|4x4|xE,K ጣ 00 0 ℣‣0 R000 ,Ks 0 CC J4 04xP0|4x4dꥦ`2\6\20` $0 (p$tĕ(h2S 0@ 00 0 0`0`S 00 0 -LM"@<8 \2 ,"1 \ -2L 0\ -LQ 0 0\ -L M@K @ AK 0鹞P0 -LM0 0 @ 0  0-0L 0 P@  0 - L 8 0  - L 8 0 A-` ^0P@p00`0A  S R0 ApQN `000 000p0 -LM 2S 2 , 2+,M^PRn0@T+0,` 2),}p`+0@N~0,p`*0@N~0, p`*0@O~0,p`t*0@O~0, p`D*0@|0,p`*0@|0, p`)0@Q~0,p`)0@S~0,p`)0@S~0, p`T)0@}0,p`$)0@}0, p`(0@U~0,p`(0@U~0, p`(0@V~0,p`d(0@V~0, p`4(0@W~0,p`(0@W~0, p`'0@}0,p`'0@}0, p`t'0@Y~0,p`D'0@Y~0, p`'0@Z~0,p`&0@Z~0, p`&0@[~0,p`&0@[~0, p`T&0@}0,p`$&0@}0, p`%0@]~0,p`%0@]~0, p`%0@^~0,p`d%0@^~0, p`4%0@_~0,p`%0@a~0,p`$0@a~0, p`$0@b~0,p`t$0@b~0, p`D$0@c~0,p`$0@c~0, p`#0@}0,p`#0@}0, p`#0@e~0,p`T#0@e~0, p`$#0@f~0,p`"0@f~0, p`"0@g^0,Pgn0@"0, `˜ \ %0h $404Ř00,% 000\0%40d02!,} p`!0@M~0, p`!0@Q~0, p`p!0@R~0, p`@!0@]0,Pm0@ 0, ` @8@@@@@ @(@0@@@H@L@P@T@X@\@`@d@h@l@p@t@x@|@@@@@@@@@@@@@@@@@@@@@@@@@@ @4@<@@@ -L M`@!i2 , h2,, h2”P\!-,2p|!, 0hh2”P\P!B/,2p,!, 0hJ΄K h2”P\ C.,2”P0\p  , 0h0 h$h$xh$lh$`h$Xih 8,8 (,(L|888,@\ 0-OPL@ ahM t[hR `UhQ LOhN 8Ih] $ChS =hM  7h 1h  +hR  %hS  h h  hU p hY \hZN @ H0hh  4 T x      !$! 0A @>-: 0p01K![p d <@8# Nsq!y012 9:C|S񟗅^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^________0S S000000 0 0000 0 0 0 -LM@Q00)d0R \0R Q000 , 0 0 0({ p-LM0@S 0 0\0,0\ 0+\0 `,`0 ,0P S S 0CS񟗀```bbb``#-00C Skaaaabbbbbbbbb k0 , : \0 ,}S0S0 S S 0 0\0 ,0S p8 j0,, <4<,\0 , : \0xt 3 \ 3 !0b51' X N p-LM`P@ p08 0\PU Pb @0PP!R,,0@\T0S>0S S $0S 0@S0!, 848l!\@K  K1[[`0`S "Q* 01K[ K0 , 0 \ 0,\0 ,Y8 0,\0 ,>j(8 -LM0@S 0S S0K  P ![,0R 01K![yP -LM0K P PQ  R00R0S00RTf 0S`0( p1\0, <\00 1\ 8.\0`0@\D!0Z/\0@$!\.0\0S  @8\ Z/1\0@\8 .0@\8| Z/ 1[02 \1[:  S00v00r`!h! -0L`@ ,0PS^ 'P PP50SHijjjq0^/0\ 0 \0 ,Xp60S 0 ,P P$0 ,P1U2U0\00\0P\pp0Sg'  -LM0P ,0S0@ +0 \&P@ P@0 SSl SSf Sd Sb S` 0S"pKp`V "pK P@`2[;2K"[` "KQ񟗝tnl ln2[ 02K2[ 0R2K2[02K"[P@ P@2[L p0R2K 2[<2K"[,"K"[P@P@ 0S^ 8/08(R/08"P@ rP@2[<2K"[P@|0S800` [@T #T@T 2[E08#h V\0SP@ Q P@  P@XP@;P@ 2[`0d2[@0a-P@) 0,, <4<,\`P@"pK P@0 S Se2[:2K`"[:P@0S @08`S0@S008 S(   P@"[ 0  V< V  P@1 ;2K"[V:*"K2[; P@2[02K"[P@  P@2[:2K"[ P@2[ :R`2K2[: R2[: 2[:2K00"pK l2[02K"[00a-0 \i: -LM K@NP  K GP1[>1K1[![ 01K1[,@01K1[!K01K1[<1K 1[<1K0S`rrrr1[;1K![rP![ l1[;1K![+!K1[; -L M0@@ `,P" K[P@2^-2[ :2KRR2[2[<<2K0BPPS"[2[*"K2[=Ã@0Ó\\Ń2K 0 \0S&K P@ 2[`02K"[P2[@92K"[P@ 0S4 BKP$pK @T O@TJ2[O 0E8#X0SA P2[p~  @T /z0EP@8)#X0S  jP@2[p02K"[P@ YP@2[;2K"[P@ P@U&K ;P@u2[:2K"[*"K"[P@u꠆ -LM0@+, 9:7+\0 , 0-LM0P ,0KSM  KP1[ @@1[9 S  SL 0 \0L KP1[ @@1[9 S  S -LM0@ ,0S xLxXxdx0S0 \ 0-LM @0BS\0SR 0SP R0S0PK }P wP1[   KnP KhP![  1[  T0S 00K K@P1[SP; S ; S T0SS 0S 01[; S1[; S0 -LM0pP ,0` ,@0DST0ST| TP 0DS@ 6T 0^/,P' 0-,@0 3@0T0^/,P0 , @ X0^/\ @0 \@0\0S0\0 X01^/\0 ,0A`0 \P` 7 S&pK P` P`{2[@0SH 0S<@P``0S (K* KH2[S 0S 0,,0 0,\@`[0So 00,,0 0,\\!P`%0-,@pT0S00 -LM0@S?`p0)00PU 0S "K P2[P  PdQ Q2[@002[  0 ,?@d0 000 p-LMP-@`K \ \0 1[  0D8#Hp p順 -LM 0@6 \0 , h -LM 0@6 \0 , ht -LM@8 #80CpP S,U  `K 0 066 0 0  0\0 , E P -LM0`@ ,pK 60' \0 ,vP8#hm0 ,0 0 `w0PUXm p-LMQ00\00.S@P`  ph[P p p-QLM@`P.0S0(6 \@2 0 ,@?Tpp 8; 0 2hp p-LM@QT 0.8\P` #H phP p p-(LMQ@"hP*0S0(B6 \@i 0 ,@ T:pp 9280 p 0-0LSP@0 , 1@ \0 ,(+  0 \0 , 0 S S 00,, <4<,\0 ,0L@0 \0 , 0@0 ' -LM0@ S  KP 1[91K![)P0S r 0-LM K@PP 01[8H0 KP[H 0 BHL Rꐈ̈؈؈؈؈؈H T0RPTPP0H 0H 0H 0P A0 A A -LM @0S  0 S0 p-L M 0 00@KP P p1[`K0 JP1[);5 R0   ;P1[*:6B& 0K K P2[![002SPS0nS0S000 p-LM0`K 0@ PP p1[K 03 0 , P1[0 P![("@0C3R0=30 P1[*:6B& 0 p-0LM0000 00000@SP`K P p P1[ 0S Npp0 S0SS0 0 0-LM0P ,0(@0C SE000000@000000200 R 0@000KBP1[;1K1[ S  S  S @00<00< S  S; S::;0 0000 000000 0000200<@00000   -LM0@00  \0 ,h  -LM0@00  \0 ,h -LM0ȠP ,Ƞ`H0L |4,(0(@S$ 0- S* $PK$00$0 $  $0\0 ,p$0 0$0  \0$0 -LM0@ Ƞ P<,@ T$ `*$pK8#Hh0 ,0`0@$0 qV: -0L` ,0PS(p@%@T T 0P0 \U0P0 \0P0 \0@P0 \0 ,30#P 0@P0 \0 ,30#0@T0#02SP p-LM0@ ,(0PS(`' S p0P0 \0 ,P 0 \0 ,ph0P0 \0 , P0 \0 , P0 \0 ,P 0-0LP ,(0@S = S @@Q 00\@0\ @0 \0 ,` @0 \0 ,N@@0\ 0-L@P"H0 208#X!0U 0U0 -(pL!X(\@"h:V00 eV0S P(0S S fX*  !I0X:P!0USQ   !X*$ 4 <X0:% -LMP`@pK0 08P#H 1[?T08#X0U麺 p-0LMP1K@`K0 m08P#H1[![>T01K[0 0K a c? Ppp麺 -L!X\( e`"Hp:T00T0S P(\ 0  @PN@' (-"@TLP!x(`:P6' =!0WSQ  . !(T*0 "! 08#HgP T:T: -LM(p Ƞ,Ƞ H.P ` B("(V$+*  !0 @0 ,0208#HTT 08#hV:  ("(  B("( p-LM@K0 `Pp\0  [ ȠdP0![00 p p-LMP@`K0 O08P#H! [T 1[#4000CS @08#H T p0 ,00#0p p-LM `@ PR1+@ 0\ 1R!;0D0 0@\Tp -LMp`Wl @ PR1+@ 0\ 1R!;0D0 0@\T@ PR1R,,0@\T@ T* PW0 np@ TP:h0Sğ0 2" 0 20 3" 0 -LM@ 2RPaaR,,, 0Rx 0RR,,0\ 0PE!R,, 0SR,,0\ 0S11R,,0 -L0p@`P 48@U1+Q@ 0\ 1R;!0D0 0\ -LM@PP` 0P11V,,0\ 0pA!V,,0 S11V,,0\ 0S11V,,0 p-LM`@ PR1V,,0@\Tp p-LM0@Sp0,,0Kx| P>![0RR 01K`P1^3 @R |0!22|00@S Ht\Ht\Ht0!22008#Q0!22|0!22p -LM0@0C SXXXXDDDDD     tP 8  P0S S  |0,\0,, x000 -LM0@0C SXXXX88888$$$$(Px0,\ -LM0@ ,0S:SS 0S S  0 \ 0,0S -LM0@ ,0S:SS 0S S  0 \ |0,0S -LM0@),0 (',0  ',0 &,0 &,0 &,0 &,0 &,0 d&,0 H&,0 ,&,0 &,0 %,0 %,0 %,0 %,0 %,0 h%,0 L%,0 0%,0 %,0 $,0 $,0 $,0 $,0 $,0 l$,0 P$,0 4$,0 $,0 #,0 #,0 #,0 #,0 #,0 p#,0 T#,0 8#,0 #,0 #,0 ",0 ",0 ",0 ",0 t",0 X",0 <",0  ",0 ",0 S0!,0 !,0 !,0 !,0 h!,0 L!,0 S00!,0 !,0  , @@@@@ @(@0@8@@@H@L@P@T@X@\@`@d@h@l@p@t@x@|@@@@@@@@@@@@@@@@@@@@@@@@@@ @4@<@@@@@@ -QL0T  Q(P \X -0LS p t S\)0\0 *\990 99L \0S \ 090 \XG-`0M@O0L 0P 0  @P@ P(P,PP00 ^`@0@00 `P0@ Rf  0P@ `0\K @\A \4 \! h1\ X1\ P1\ 0Ѝ0P@ @0pW P@0`PU` ` P `@0 P J0S(1S 0@0S0 -LM0@S0 0$000 ,)0 R$ Q 9 S0 S00 000 0 S0 00Q00 0-0D@L LPP0 \0@P L,0 -0D@P`LLP0p  \0@PL 0\ -@L M@@0`Spဠ7 S 4KL 'P*K040C !08P#X2[0A 8}S HZ!UT I0j8 #H7#H  0AS0 0* KP2[=3SDXdp|2002P0Pn0n00𫪪 p-LM0@SP S p`K P![9 S0 0 P1[x    KP1[00 -LM0@S K S K P1[ 020P1[? -LM4`KP@ z0S TM0S @0S -P@x* P@3,P@@ -P@&Kp H@T2[92K"[)"K"[08P@# X3,P@00(K* K P@2[S6K8 K0S/ @\3[1S&K  p P@`  08P@#&0[pWWd`X:0@0i AP@w 3[1S&Kp @T2[92K"[)08P@#X00ș5 -LM@Q 0S0K P1[L'S  R  P P p-LM0@ S SP p`K PU 8S/S S p1[01K![P rP1[01K![P1[01K![P YP1[01K![P p 0-LM0 S@!K S 0 K;P 0 PPK -P1[<1K![{P uP P1[;1K![fP![`$ 8 #8S 08 ,( #P 08S0R,8 S ((0"(R,8S(0!S$` -L M p0 4 `  X  P   @ , < 0  dXN  0 0  ,0  00<  -88LM0 ` 0P<p  @@0     @,   0K,0K fWPl?,00 0P@04K<2  P4$ @74 p (P0 M(@&L$8#8S D$(6"(R} "6R 6R6 R. $ t!"(MdF0 0C\ 0  "!00 00 6C&  0 "!0%0 R5 S^ 5 ( RRN RL X %> R5    |5% P0 SS& SS %> RR 0B RSR(5  Q%0S006Q , 4Ph29h2 @ @A0 @ 0h p$%>hh"%>H4 Th"P$ 8S S\h"/ %>Th"P3R& 3RK3 S P8 }h" -%>h"  8<P\ Tt38  Ǘlh2 < 0%.h2$L3 S1 D3 S <<# 8SS %0D Sh2:h2h2%. < 0h2$2 SCh2 <%. 0h2=Th2%>;h2Ǘh2?%.0LJh2$h"%>*T2 h"$\2R -P2R" H2R@2 (R R 02R h2$!%>h  LI 0  8 Sh?1R 11R 89Sh" / %>Th")P$X1 Sh" %>0,Th"P1 STh2%>@00C\p 0  "!0 00 0C&  0 "!0 0 RW,K 0 ?,P,T(pRdtRdRdRd0 -LMȠ,Ƞ Ÿ@ 0R@ `!@000P, ) a@00C\ 0  "!0 00 x1C& p 0 "!0L!0 R, 0$ @00C\p 0  "!0 00 0C&  0 "!0 0 RW,K 0 ,P,?pRdtRdRdRd0 -LLM02c10 @Q0@Sh8 &&@ -LM@ 04 P*0S 0P: -cLßM@PU@p ࢟0Sy (PUR00C\ 0  "!0 00 |2C& t 0 "!0P"0 RN0e PPE 0 `@p 0@  0,P/ 04P00 0 P 0PP 8 0eu0S: 0S:( @R,0,0,0 00 C B\  0!! x 0d C6000 "!08 0 R F? l1 R001 P1 X0SP PR ,@I `00XP!U00R00S@U2I? PePU T0S # 0PUYχ 0 0S 00 4 PUT T 0U 0 13 p-LMPP!4P L0@`TeLP XPephee@T4 - @LX `Rp 0PS 0 1< h` .PQD.X0X01X P1S.ooop@-|` @P  0 Č$ L0#Q `P8Sp0 S0S S -LM@ 0 S0 S  -EMLM5BNKP@D@D;`0P , M. I.00p>0dt S S$40$ 9. VP 0S  t,.Lğ,0 S \,KL LD4h (K_04(K)@(KC>ğ@(0K pEKğE>K0CI ppK 0KI V0LUpNe#(0KZ00P00SQ@ TKNN?>1 1DQ@ T # Z308#Q4ß4 -Z 0f Pp 2THh 0S00S 0S E.K B BP| `Ph 00ST -W f0T0`840` `3PPP 00>0S S f Pd P010  P 0S}?d0000d>0S0 Sp \ T @ 0 T4p090 fP@ TG 0--&-01 0CĠKh$UNK V0L#Hb%(%, 8oDohoo\zoEo p(pDpI`ppp -L MT p, 90S 0S,`0Vʆ0AP P , `0VT 0 DXZ  P T0S  0S<  3 K P  T, wP 0  0 00  `PP   ,  |,    d 0SS00D ],4 X,0 pp q1 e!\:0> 0C0 n>S -LhM ` PPpK $P@ < R RXp0 SD0Sl -LM 0@S " P 0S0S   -MLM4 P0p 004P( BNK@D@D` ;)0` ) vP 0 S t)0\0 (0S p( 00S< L2Rz KA!-K A Bf0@ PP @DHLFO\ kml>FO ]00Ba` Q -L(M0PS`| LpX @ W*0@ 0SLK S <00p0 T:!P]P @T*0P\i@T:@T*0\O@T:L0W> P>Q1 P @ LK0|  @ET8A00C\ 0  "!0 00 0C&  0 "!0 0 Rc LK[qQ*0P \ Q:0LKpQ*0 \ Q:0,LK ppRdtRdRdRd0 -LMm? R`1S  K` T!R\13 0K <\ 0[D!2 0K HQ 0[P!2 0K K0`0 Q-L H0Q 00(0Q`1 W@W@ W -0PLPp@0S' p+0\1c?@L`c a_[ 00@W0@m004\$00DcbHcbLs p-LM00P@K4U` 0 000000p 00C& R 00#!000 p0C& h 0 "!0D 0 R 00C0pRdRdDcbtRdRd0 0 lUd -L|M`K0 K pK@XPP< @0S<6[S4 t0S 8\X 80Kp[Ƞ 80S4^00 1S80KḀ@40Oφh P40RφL P40Uφ0 Pssst8tLt 0- LP@0PP 0 ~P 0S 000CSPPP 00 -LMMBKHH@` ;, 3#000 4 080PPXY\` 0X0 Y 0\0 ` 0S47Pp X0S0S  S0 ,0S ,,&X0Y0S 00CSnnnnn$k0Y0  #X0S SY00CSnnnkn#0 #U 0S0PU<0S =Q X Ru R00e 4D0 P;4<@0 P4X0SL 00PpHPPp& UX 0S1 8S. 0S) Sʀ2Y T00BSl m ml,mAP0 t ,.#n  '#R  #1P X S4>H0 zP P=   #B>0S? 4jP 0 S00S=  X0S 0PUf 00S> 00S<   "PJ > < : 8 6S'000S PS00Hbht%xt|ttttttu,ř()$u(u0u -L`p@P@PRPU@ZDAD!P000  BR GqP00C\ 0  "!0 00 0C&  0 "!0 0 RAT Pw0X1 *0  3 ;@ppRdtRdRdRd0 -Q L1-  Q S 0S -L`p@PPPU@Z@P`@PPU@Z@`p p-LMP @ 0`@TP@ Ƞ,Ƞ P@@p p-LM@HP8P #8 T0 000Pࠁࠓp -LMP@U`1p @0<0L00MQ0PNPOPRPSP L0 -L ML0Xp 0 8@8P`DD!LMNORPPQ@S` -LM0p,  40 0`0  N=WP$ FFFL08 >0U0d0S B0e f0C 0g 90K Xh 0C4i0 j k000mno@l`9pK9 [qp , srẀ00`040080@00D00d @#0SoȔ` p-L M0PS@- 0BSu0wv8wu8wLy|yyT 0R0P RA R*R# T00CS000@  0PPpphC0\#   W 0 !T T 0Q0ph VD 0@@@ 0@ T R 0\`@ `@48" <S^  hi0jk 48 R 4+Q P 4;4Q 0S000C04P4 ;$4 -LM = PR0p}4@ 鬒2 @ yo @Tڴ4   7P8 b7P~ 4H    :d2S9 4A@04$+$00C\ 0  "!t0 00 `1C& X 0 "!04!0 R O  1od=P @00C\ 0  "!0 00 0C& x 0 "!0T 0 R\ o7D3 jpRdtRdDyRdRd0 `y p-LM@? ?PPP? 3PzPP? *΄%&Pd @oPP ̠d ` Pp 4p  `L|yyy 0- = LR}_'> ( R $@T 0@TX0 0-@L}OPw000,  0 -@ =PLP`p2 |2 \ l2\j*d2\Z \2\* pPB0 0C\ 0  "!0 00 2C&  0 "!0!0 Rf$# = S =@S @ 8C8pt2g$t2  . nt2 # @ 404H0 R0 0%4Pp4@p0?0\ |0\p0PL|z`0\w}/ 0XpqpRdtRd2i 1i i i RdRd05i i 6i( -LMd0@0Pd0a!p0O000 K0 0S(@p00C& R 00#!|000 h0C& ` 0 "!0< 0 R饻LbpRdtRdRdRd0 -LMP0p@ T adPVhP=lP$`PPP`PP |P'.4=4e|Kb_됂KbP lAP0l2b I\ CP h+P0h2L x3F d-P dPdR7 ,1 yyz@0TA KPK0K 0?0 0K00K0K0K@K@KK@KYPPP[ -L M+>@TA K0K ?0 0K00K00KK@K@KK@K9P0 [0[4 p-L M+>@\AdBT0 K  p@0  0K00KPK`KK@KKKP00 0-LMQP@ ?0@00K AĠ0EKK@KPK0KKK0KP0 0-LM?0@P K0K 00KK@K@K@K@K@K0PS0r0z -LM0p4`,#> <4 #>?\ !#>@?\ QU@ P4<4$ #>@;;10"  I0S ;;!00U@P4,A -L M+>@ \K @0 0K 00KKKKKKKeP x -LM 0S4 0 0)P 00` -LAM(BNKP@D@D;p` (   P R!2 `/2`-.2/2C.K2rr BP l (0S T( 4@0PT4Px 0 Sl00S" `0@TBNK@D @DQ!`000 iy F1!0@4 |1|!0 P 0pH }l@1@  `0`0C\ 0  "!0 00 0C&  0 "!0 0 R  !00S "00S"  \lHb%0xTxXxzpRdtRdwLRdRd0z -LM@}A(   0 qS0P9 1` 000$@3=P00`00C& R 00#!000 |0C& t 0 "!0P 0 R  駸pRdtRdRdRd0Q-0 Q+>0 -RLM`P P$ ; 0 0L Pr2@ 000Ԣ@0@0C\P 0  "!0 00 2C&  0 "!0\"0 RU 01 2 00000!C \! 0  "!0 00 1C&  0 "!0!0 RQ$0001T1``` `@ 0T00$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0+10 ,`(`LP`p0@5DD!0W00$+$9 WW( A00C\ 0  "!0 00 0C&  0 "!0 0 Rm酶d00d0 `{ W(0`00`0 F p0S ppRdtRdRdRd0yP+> R  0-+> LRi@0P 0]h0 0kh0Vh0m0h0Ph0 0h0oIP\00\0 p-AMLAO0P `0{I P  0 C40 (\\  %"P202p  p'z -LM@+> R4+Q P 4;4Q 0S000C04P4 ;$4q -+> LRP0p4@ 錢2 @ " yo gd@Tڴ4`   7P 7Pz ($ # "  $2S9 4A@04$+$00C\ 0  "!`0 00 L1C& D 0 "!0 !0 R }O o0moM8P @00C\ 0  "!0 00 l0C& d 0 "!0@ 0 R_ m 0 pRdtRdDyRdRd00 `y p-LM@? ?qPP? hoPP ̠$ L Pp  p yy -@+>`LPPpXX2 L2 \ <2\l*42\\ ,2\* p B0 0C\ 0  "!0 00 1C&  0 "!0!0 R铴$% = S =@S @ 8C8pp2$p2  `d `p2 `W @ 4040 R0 0P4Pp4@p0jP0\D0PL~|pRdtRd2i 1i i i RdRd0i  -L MP0+.@ qTo d00d0 0$K000 f$ =0S'@00C& R 00#!x000 d0C& \ 0 "!08 0 R ܳpRdLbtRdRdRd0 -LMP0p@` T}$PS(P:,P!`PPP`PP |P4=4|+Db됂%DbP ,P0,2  P (iP0(2 xq  dk P $SP$Ru ,\ o V yyz0 -RLM`P P$ ; 0 0 Pr2@ 000Ԣ@0@0C\P 0  "!0 00 2C&  0 "!0\"0 RU 01 2 00000!C \! 0  "!0 00 1C&  0 "!0!0 RQ$0001T1``` `@ 0T00$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0+10 ,`(`LP`p0@5DD!0W00$+$9 WW( A00C\ 0  "!0 00 0C&  0 "!0 0 Rm遮d00d0 `wW$,`00`0 > p0S EpRdtRdRdRd0y p-AMLAO0P `0A P  0/"-C4? 0@ $\X  KHPh20h2pA (pH| -LM@'> R4+Q P 4;4Q 0S000C04P4 ;$4 -L M0`4P@ 阁1p @y0 @#. 004  00 @ |>7PA 7P;  2S- 4@@04$+$p00C\ 0  "!0 00 0C&  0 "!0d 0 R i鐭P (@p0(pRdtRdDyRdRd0`y p-LM@? ">PP? oPP ̠  L Pkhpf Mp_ yy -@'>`LPPpTT2 H2 \ 82\k*02\[ (2\* pB0 0C\ 0  "!0 00 1C&  0 "!0!0 R$$ = S =@S @ 8C8p,2$,2  #>  ,2 #>  @ 4040 R0` 04Pp4@p 0P0\D0PL}pRdtRd2i 1i i i RdRd0i  -L MP0'.@ qTo d00d0 0$K000 $ 0S'@00C& R 00#!x000 d0C& \ 0 "!08 0 R F!pRdLbtRdRdRd0 -0pPLMT@ PS$P:(P!X`PPPPD`PP <P4=4< \ h 0 \2pp0,R 0 \p KP@@,`0h "0 T@DP/  -2L@`p+  Q,10 XW 0Ra R R P-L P ?#?00cS\!l!t!|!h^^P Q hQ h - PLM@`PA T9 T# ,q0@<\ 0 ?01 <0!! <0 <0 <0 <0 <0(02o@ 0(@"P00R00S0P 0200 RpP0 bꠕ`~tUd -LM0Pp 0弁p@9*`M*@D0S0ץ0CS`` p0  00CP0ҥ0CP0p 0l"!0pP (0 o: (0 p (00(0oꠕ` -LMܠHp0$H 400pP*`) 0p < P)$p 6 :w0 )`)P 0頕` 0-h0 !Xp0 L0  8#UP@008#HTꠕ` -!LM0, p 0岂@)1 8C00C8#0 p04`0p0@)Py)  0 P8  X#, R Z 0J  X頕` - LM0p 0尢K) J , 0 8p C04p@0`Q)P5)  0J8 P #,0XY0I 頕` -8!LM`p0 P@)10`00C8#8 4,0 )p (0P  00 p04`0p0@)P ( H0 !0 R8, Z#X0H頕` -TL M`p0  @JX( 0`8#84,0 (p(0P   00 40 0Jp 4p 0`@(P( \ 0I!48#00 R, X040S0C040 4頕` -LMܐHp0$H X0`40t(pX( 0p 8%X h`#80A40Z(p>(  1@T@頕` -H!LM0 -L"R ! B0,0 `0T00 S0R !0 TS2 a0 BRDPH@0S 0 l eR`1`!aL^HD H@DP34fQ @XQ- "PQ(0T@PS>0 eR`1`! b\ Ġ$4 T@>$f44$.cQ0S$ T 0Q3 0/S58bbPbPbbbPbbPbPbPbPbPbPbPbPbPbPbPbPbPbPbbPbbbPbcPbPb c c c c c c c cPbPb c c c c c c c c0@VP `VXK 0\@K@IPX0\ @004 8PJ?dpi?h?l?p$? -LM@P`p 0@0 00P+ 0@`@ 0@@`@ 0@ 00@p@`00 0 0-PLU@ U$L } ^0 /R 19R00C P^L0 0 C000^L00CAQ$4f4fe4f4f4f4f4f(f4f0f4f4f4f4f4f4f4f4f!R,00 ,R ,0,00,0 p-LM,@AP0CQKxggggggggggggggggggggggggggggggggggggggggg8hgggggggggggggggggggggggggg!R@ ,R@,@p!R@ ,R@!R @ ,R @ !R@@ ,R@@T@` @` 0V!R@ ,R@ p-LMP@p !0@Tp`@t 0!0@T@`@x 0!0@Tph$$ -LPp@| !0@TDD@`01| 0 !0@ TT$ 4S!3=8S>08S, >8 ST3T#1 $t2Q h2Q `2Q L2L2H2@2Q 82Q,2,2$2$2222Q 2Q 2Q111Q 1Q1111Q 1Q ʼ1Q 1Q1Q 1Q1Q ʈ1Q 1Qx18 h1Q `1QX1T1<1< @1}<1{81y41w01u,1s1k n1!10 101;C <`@7؀܀ (ܕ`08@DHLPTLcb,`53 0-PP0@0 L * 0h  -LM0PS#0000QS 0BS0%pa 00C|a2\ 0  "!0 00 2C&  0 "!0\"0 R&0 0#B Wp ΰ0`00S@g00P0T0SpWWp  ᵰ`pg@p0T!2@兼P`0Q HA00C\ 0 !1 0!C600  00#!0 0 R -@00C\ 0 !x0 0d C600X  00#!0< 0 R#(pRdtRdRdRd0X -0@PLpA 0R p) `P00C& R 00#!|000 h0C& ` 0 "!0< 0 R麊tRdpRdRdRd0 00000 Q- Lp 00sS0S  -0L Mh0`p d 0Qx\x ~ Rp100D d 00 ` 04 0 800< T0 > P?00 lP0@0|0SPx @0 s i0`=Ph |5$t$00 000w8#,#|\cbv```Xcb| p-H@LM 0`PW$ $$P`0 p\cbl`Tcb -$0@LM@@@0@\cbTcb -,1,q` L 0@S hP PU000K0PUh0 0 ,!@`00C\ 0  "!x0 00 d0C& \ 0 "!08 0 Rh雉tRdpRd MbRdRd0 -LM 0 Pp 0Syd0@@S1  0SL a!p000  BR 0H00 R000SS0SJp0h!2c1|P:HAp00C\ 0  "!0 00 1C&  0 "!0 0 R0P ,0 S P0 'fx0$ 00-00SXcbpRdtRd ́RdRd0`P|xr`ԁ -LM0@Sp. Q' 0 fPPhP D1P 81 ,!i00!Q`V00h0`<VhP T0S P0`@`P ?#<0 Pc 0U   pxP0S0S 0$ i鞩00ᶻ i Mb p-LMh0PS`p<@V0@@T 840<@ Q- L0S h0S840 0- ((L" P 0AT 0S 0S TPU@T YP0000d`@- @.@d` -LM@@00ET -t0LM Ƞ Ƞ,A0@S 000/0 0CS0  d`@-$ @.MЍ@d` 0-LMP@@ 0@0CS00 -LM\  p0\ 0p  0 0S0\0(0\T$1  P ~f}fvt -dL M^P@`p C@$^> 4$^ ,4^00 84p 0  84l p 3^ 3^ 00 3^  00  l|<3^ _D3^X +83^ 0S!1p ~ RP` Z  p0 p2^P`X P X2 P2"#  02 (2a"# 00000qy |1^& 1^]n l   0     0 0 Qp1^E0\0 ! RBᓠP`C  0p    t  0x0 00084- @< S 00 K  $@ qP`b0@ 0< Si< 0S dWW @W W@WW@ W @`W@`W W W  MbWW W- 0 Ƞ Ƞ,@od`D0P  0(1S h0SPd` 0-L0LM@T@0P  hP0Xcb` p-LM@d0QhPPSU h`VUhPP h`pU 0 (pph`Vp(hP -PL Mp @0P0^ 0@ST@0\  <@d``P ,0R0!R rd` -0LMP) 00S P" @P`p0 KS0C$ K0 0l $ 5000 0* R0 >; S  TcbXcbĖ`\cbPcb -@0L R 000 0S 0S 0TcbXcb\cb -4L,\ \ Tcb\cb -L MPhP@`; S, $ R R R 0 @@ @ @ @R <0T 84  0<@ PP PP_ P  @0`0RQ 4 0; X 0 0 @@ @ @ @R <0T 84  0<@; S) 0 @0E U  8:S00SP 2UP 30E8S0E8#X8UP 008#XQ0Q12,R0T0 R002Pp 0 ; 0 jl2R d2Rc0Sz 0 ; 0 Z RSp,"O <600嘺00S 0 00000S 0 00000S 0 0 0 000S 00#00S 00#00S 0 0@0@000S 0 00000S 0 0<<00S 0<#U 00S 0;# 0 yU 0S 0 R R0T0T00S 09#,pK | @@ @ @< 0@U 0 <0T84   0- 0P @@ @  @ @RL <0T 84  0<@0R  Q 00# 0Q 0 000 -p!LM04 S\q1Tq080 0K  8P`@`V@DPEAJ3[ S"[00b0cS  0KX8@ @08@ 040`၀?000 R # 3 R?H0`?À 4@ 0R # 3Й`Ȗ` 4S @08#<@8oS: S>; S P 0 R0,Rt -LM@Q ꀕ<0000000000000000000000 -<00000@ L `+ p\&0S \\ 0PP*; Sh!,\1R 0P: R: S:#:A >; S= ^; x   Sp , d0R P0 R:U  hK P0S _ D p-LM0`PP@ SoP ゐ0\  00  00  0 \p -L,M@  `^Q 0S `^ \ ^PK aQLXPpPKa @0T*<@8oS: S >; S|p2Q} @ T:XZ WePKa @p0T[* ; S1QO: Sʠ,ʠ >; S<@8oS: S <= S= 1P: 1P7 |1P4 TP*00@ ;   S 1Q P0 R:U 1 c0 @0Tp:XZ s 10 p@: S:#: >; S Pw: SZ%Zr >; SPPm0SO l0Q 0`c -LMpPW9`0S  jPP/ 0P0!!0P?1@ RP  UU L0P1 1P!00 ``؂ p-LMP`0@T 00U@0 0C\ 0  "!0 00 0C&  0 "!0 0 R}0S SUooaW}fvt`WbWcWpRdtRdRdRd0 -LM`@`Tp P 0S   P0 @TY P -LMQhpp``WP: hZ5Whp  `@T 0S V 0 R0 R @TYW  \P0`0 RhZ(hP(0$8 Q!0  Q:t0@-P(P  $08@Dt @\ 0 0 A\(@Dt0 -0` 0p@0T0L0P  @T@p00C\ 0  "!t0 00 `0C& X 0 "!04 0 Rh|tRdpRdcbRdRd0-LQ@0 0R, 0 S cb`cb,0 P 0SPcb -LM0@`PUp@ T0 0$ R, PUA`00C\ 0  "!l0 00 X1C& P 0 "!0,!0 R{W 0 RZ 0( RX P@`00C\ 0  "!x0 00 d0C& \ 0 "!08 0 RP{pRdtRdcbRdRd0 -LŸp0@P`XP@r U ,0U 0S?0,PV 00V 0S300`00("X0XAp00C\ 0  "!$0 00 1C&  0 "!0 0 Rz@p00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 RzPpRdtRdRdRd0 -0@0`LpP10  `0P0C& R 00#!|000 h0C& ` 0 "!0< 0 RU|ztRdpRdRdRd0 -0@0P L Pp 0(S"x) `P00C& R 00#!|000 h0C& ` 0 "!0< 0 R6z6tRdpRdRdRd0(@-0S4 S/0!0@ ^@(00^$ 0lQ T00^ 0@bS 0 S00T0P00SS0,` -LM P`1p@T K0  KKppp\! K0 !K@ K0 KK@@@4 0S 0P 0QVd 0-LM0P S 0s# @ K0K0b0@@P@ P00[4S {0P0H p-L$M@Ph` V) K0 0)K0400 P00@@ (K0(` $ P <p ~000 0)0K0) K```_4`ꀇVdts p-QLMP# 4@T00 0 K 00b`0@PvP@ 00P@4` ppp0^ K 00b 0TP@00 ]4@lQ0@-P0@0 " Q 0* 0 S0R R R00 0  0  0\ 0 0 0QEQ QQ 00 -`L@pPwh00000000 -LM@00KK0[0 80 K0 -L M@ K00KP< m 0-0LMQ@P( 0Q0 0 00Q 0Q 0 00KK0[0 80@ K0@@ 8 W@W@ WW -LM<@T 0VdVd 0S 0VdVd p-d`MLP@ 0Q K 00b0@@@@ pVd p-LM@`P| 0 P p  _ 0QR*0S b R*0S -R0 0c BSR48 R p-@P`x BRpR0 BRRRR-0^0  R R0 R00-P@cbP L0 p-QL MP@`S K0 V Ks 0K Kp@rPp`@- a0`S@@BR0-P@ 0bR3 B1 010QP:  QQ0Q00 0cc 0S !1 0S 00S  p-QLM`P@S 0 8V pp@rP`&p`R 0R\ Q- *0 Q*0  aQ! -LM`p3 P@! P P @T00PU0S p@W l`FpGP  PH00PW pW`F괃r-0 R 0Q cP 0 S Q!0-P@P !20R0-P@ 0bR03 B0 -QLM2p`S)P@WU (W # 3f g0T0e 0d0 "2R0c0 0 Z  p @rP*`ppp@-(Ƞ !8"(,ȠP@p^`b `n0 # 3\ c l0 "2R(#ȃ 0(BR00.8 c0(R0#03 8 " P@p0(R0#03.8 -LMK0KR @0S R -LM -LDM@PKP@ 4\T QP 0P KSR0S0PK0 P@[[TK$P@KK ,PT@,83K#[$8KK[[R3KL K0KKK4pK@KX d0 d@@DTd@ 0S 0d@S@d`@ p0`SL` `` \JX0@\@ZXp3QPX h h P Uh R `0d@Dh \ l l偀 0 RPh H  `\ 8R \0`FP(*SdP\l 00 L cPe%88cP\X%X@ʷ0Pe%8P d`F\P l@00 L P\P%X@ʷ000l`X\l ` R" h0S d@\ c0 Sh0`@.L0#\ ʌ0#[[[2[P T PK $[[[4[P T P KP@V8#C0HL8#90HB8#/0H8\ h "  P T P0K`p@-^`@ Pb 0 2%$^ 040p@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  0-LBP|@ 0S L| 0SPeT 0S \00LS `00000S  0SbQ1QR0@-P@ 0bàR? B0QQ000-P@P@0Q0-P@P%@ 0Q1Q3:P: R0P0QcP  R0-P@P@0! !Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R@-@08#8S  0   t` `! R0-P@ 0bR03 B00```0 B`3`1`1c11c!0"b2c3c0acP@`_ NR- R 0S0 \R000Sa@\0S S0S0S  S 0S R  0R P0Qc\R0@-P@0 A@P `R00\00Sa@ 0zR @R00Q00S ZR 0 PP ^0b0Q &,'$(#80x25Pp 80x25Pp80x25bfPp 80x40P(p 80x40P(p 80x40bfP(p 80x50P2p 80x50P2p80x50bfP2p L d X,,H d"*' "eYj$@@h>@@h@<`>` Bh@xM0Lp90j^Q 1W jvQ^Q09`0pj^r0@~100MW@ 1eX` @xj"` x@ h x jjjxP0jHj]jjHj]j&z=znx=z=1=21NyeXfxf1f21f|@fhie AWe@aj^Q q xe@z=zx=z jeAe^e@ h j "xee>00  0T0xee4T4x 44 x4@ 10z0?|eX y0jp]@j>] y j]]x0 yjp]e@@le "|e 0e]?*d# e]?*d"De"deBD@je 0e]?s@j:0jteAdjj]dldtdtjbtdt#dJtd^taj^e]QqeBD\|Qj`]Q\dT|^lAj^e^D!j^e^DjV]0eAX| 1f fQ4L=(d|e> 10eeLj"j eeTj"j eeeLj"jeeUj"jl0QuQ]Q 1e6E?>6ue^Pefj Bnj jDj^ j];&1;\nj ee^eTf &eFjj `nbn|n|n|ndd0fpffv`f=d(e`F& ~nbe^e^e^e^00000004l21l21l21l21l21l21l21l25~& nj nB~1jv4jv e BfAfj^jA 10jvFB 14A~14e"1jj 8m(m(m m  Hm m Hmlm Hml"l%0l%l* Hm- l1 Hm208m2 Hm3(m5l7 Hm8l< Hm=lG HmHlK HmLlO HmPl[$@8m] Hm^(m`(mi8mm Hmn0(mn Hmolp Hmtlu8mw Hmxlyl|m8ml Hml Hml Hml HmlT 8m8m Hm llm08m) xlTl98m. Hm/l2xl7l8 Hm:Tl>@l@ 0l@ HmAlF HmG8mKlR @lRlSHmT0lUle00leHmkxluHmzTlzl| $l}llTl%0l Hm l Hm% xlxl Tll Hmlll 0l Hml@l xlTl%@ll Hm0l Hm 8m l) Hmla8m Hm0l Hm 8m Hm0l Hm 8m Hm%pl`l Hml HmHml Hml Hmk%mH HmIkLlNmP8mV HmX8m[ Hm\l]0@l^Hm`li Hmklo*0lq"Hmy& lz"m Hml Hm mlllm Hm lllllml HmlBmRl Hml Hmlk:ll cl Hm@l Hm0k Hm Hm#0l/K HmAmYmZ Hm]xl^ma3 Z]agikkm%2K} }}}%}2> > >>> > > >>%+2>K}  4x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`884t5r@`X@`PP``XXP``@4zhh5~~4|X4zhh5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`@@@`HHxx5r6r           xxxx(C|z%2K} }}}%}2> > >>> > > >>%+2>K}  D^d^p^^H8eHDeNAPe NC\e [she .6te %+2> 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| n;AvXaM ְdx xLT<DP  7Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2005 OpenBSD. All rights reserved. http://www.OpenBSD.org 8@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@netconnetclsnetionetlck!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~U L T 7H 7X  h 7 d n;0&AvQkkXaM~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@,&q8qq(:;@=?(@@BB4rdqqq @L4rvmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJ,8thhh )) ) p  p 0$ p `, p p4 P < P @ P @D P PL  TX`XTd`dLP DP lP tP |P P   3x43x4@  /Po0/Pp F H-  @ ` x     0 @ `      0 @$P(`,p048<@DHPT\T |T0`T@dTPhT`lTppTtTxT|TTTTT   0@P         $   ,  eqnecsccmiplvsvchilsgeltgtlenvdaiadbibedeafdfalsllsrasrrorpmzsdep0.01.02.03.04.05.00.510.0T\P X ` h p x           P     x           P   h p x        X ` h ,8DP\h      t`          ,x            ,` h p x            ,8D          P X `  p ,          (X ` h p x           VA PVA VA VA0 VA8  VA@ pAH qAP qAX qA` qAh qAt rA| tA tA A A  A A `A  `A  `A  PT A   A  D  D  i L  i (  i 0  $i 8 0$i H  ,i 8 0,i H !i XL !i `L)i XL )i `L-i XLAi h -i `LAi pAi Ai $08DL\llx ,<LxPdxx4Hl@````` ```-----.4.L.p....1//8/X/x/////0040d000101\111 1 2 `2 223L3x33334,4`4 x4 4 4 4 4 4 4 5 05 P5 \5 5 5 5 6 ,6 D6 d6 6 6 6 6 7 @7 t7 7 7 7 7888T8p888888949L9l9 9 9 9 9 :(:T:t:::::;D;`;t;;;;;<8<T<t<<<< =4=`====>4>\>>> > ?P?????@4@`@|@@@@@ A4A,ALAhAAA A A B 4B XB B B B B C @C dC!C!C!C"C$D$,D$B$B$DD$`D$|D$D%D&D&D&E&E&@E&lE&E&E&E& E& F& 0F& LF& F&F'-'F'F'G',G'HG'`G(|G(G)G)H)H)4H)XH)pH)H)H*H*H*H*I*I*4I*LI*lI+I,I,I,J,4J,XJ,xJ,J,J,J, J, K-DK.hK/K0K0K0K0 L0@L0hL0L0L0L0 M0 (M0DM1\M1tM2M2M3M4M5M5N50N5PN5tN6N7N8N8N8 O8$O9DO:dO:xO:O:O:O;P;4P;`P;P;P;P;P;P;Q; (Q; @Q; `Q; |Q; Q;Q;Q;Q;R;,R;HR;`R;|R=R>R>R> S>$S>DS?pS?S?S?S?S? T?(T?PT?lT? T? T? T? T? T?T?U?4U?DU@hUAUBUCpWDUEUFVG0VGDVGdVGVGVGVG WH8k?D8T8\푠h홠px[CuPAQARAXAğpA̟rABB6C7CTC XC,TE8BGDDGPIG\LGhMGtNGOGPGQGRGSGTGĠUGРVGܠWGXGYGZG fInI$BL4DL@ELLFLXGLdILpML|NLPLQLRLSLWLġYLܡZLfL FM$LM<DNTJNhPNxdNDPFPRPĢDQТEQܢFQGQLQMQNQ OQ0WQ@YQPZQ`lQpERFRGRKRLRHSKSȣLSԣMSNSFTLTRTTV(UV4VV@3XL5Xd8XAYaYdY`[Ĥp[Фa\c\D]p$p0<HPGTCl|Х ,8D#X#`@#h@#p@@xP!D DDD`Ħ `̦ئVD$E,FG HI M0S<TDXPYX]`^ln|v|}~wħ̧ԧ  $ C0D8X@XHXP XX!X`"Xh#XpPxQnoxytK@K@̨K0بtcsg}?,, ,(,0,8,@,H,P,0 X8`lx̩ة $`0`L`T`t@BCFGHIPȪpԪsܪ115 @qNC( 4< <20H30P40H@<p@`@t@@@@@ȫ@ܫ p )+0283P4`5t@Cil`m`Ȭ08`x04P@,' Pd3p6pC$/ƨYYЭY,@XpDp\pD8̮< xxx$x4xDxPxdt|  į ̯ԯܯ !("8#H$\%l&|Fe(((Ȱ(Ȱ(( (԰((((Ȱ(((((!` ĕ@$30@8KDLPD\DDlD|DXJuб#H$@5Ț 6T.Bؚ0B>Bd$xtqtPtX]]hIJ]iв]x]]]]]$](@]8(T](p8'ij'г6 FP$p,4<D<T<d< t<(<)<0<1<HĴ<Tܴ<<<<(<<<)P<*\<.d<xȵеص 3\33  4@ "H.X6d>pWxpOI"Pж`I$9, 4 @)T*T,T0`2tķ` b d 0DX p  ̸,,D``xȹ&'(,)D0L1T2T3`4`5l6l7l8`9T:T;`<`=T>`@|CHPTQTYduv,wx,yz{ܺ|$00 !$01$20a@ T"\#h&p'()-.04Ȼ5ܻ7<KP(`0`@aXbh`x!#$01$$̼$ؼ$$$$ $(!$4"$@#$L%$\&$l($|@$B$C$D$E$F$ȽH$ؽI$J$K$L$N$ Y$,]$,$8$D$T$D$h$|$D$$$$$Ⱦ$Ծ$Ⱦ$$$Ⱦ$$$ $Ⱦ$0$@$P$`$P$t$$P$$P$P$%%Ŀ0%п1%ܿ2%3%4%5%6%@%A%C%$D%<E%TF%lG%H%L%P%R%S%T%`%a%b%p%,q%Dr%Xs%hv%|x%y%{%%%%%%%%% %,%8%H%X%d%p%|%X%%8@&Q&R&X&Y&Z&[&\&`&b&d&f&j&n&o&02 @3,A38u5Dv5Xw5hx5555555555555555( B4!BD#BPR`Rppp p0pqqqqq q!q"q#q $q8%q@qPqPq\q\qhqpqqqqqqqqqxĄńʄ˄,8T p!"ART~`r8`s8( @0a<aD\0d.0lvpvxv|vL7L7 !L7L7L7L7}}f727d7  @$A<B<C<D<E<F<G<H<I<J<K<L<M<N<P<Q<R<S<T<U<V<W<X<Y<Z<\<DXXPX\Xl xd12%( 4 T p= C@CACBCCCDCECFCGCPCQC`CaCbCP+ + +<+P+h+ +!+%+ +++++y!+'% ++4+L+d+|``aWWWVWHA@A  i,i<iLi \iPliVxY01       " 0 < H T d t    а353F3t3}3X33X3<(<P%dxA b c5E`Qw  ,JP4@ !012456PQR       ! 0 1 2 @ A B P Q R ` a b  PX`hp|     !0 !"#$%` 4txNHXldl0p] #]9#]=I]HS  (),-78V W `d$e4f@gLhLjXkll|m|n,<H\l|\(<ThxPQRSpqr(t8uHvXxly|z{|$4@Pdt ,888888@\hxPQSXY["$$4)4CHN\dlt!|EWńEXŐEhŜEhըE!ƴEEE"Ea !@(4@L Xhx BMyxfffff ff ff,f8fHfPfXflffffff f!f%f'f010qfff ff ,8vwP@LZSXZ3M`Z8MlZ8 xZ0 Z0MZhMZhbZiMZibZuZuRZurZ3Z3Zq3Zu3Zv3 Zw3,Zs38Zr3DZfPZ&f\Z)fhZ ftZ!fw w"ww@wwww!w"w#)) 89i$e,f<uLv\wlx|!QRz 3S1V3S3S3S3S3S3S= 3S3S 3S,3Sˆ83SÈD3SЈP3Sш\3S҈h3Sӈt3S3S3S3S3S3S3S3S3S3S3S 3S!3S" 3S%3S(3S43S@3SP3S\3Sl3S.x3S3S3S3SʨA}HCH CHDHH J J J$JF,d8@9P9\9h9t9|9 9999t9999909@9P99 909395 9@(9E09F89H@9PH9QP9RX9U`9Xh90p93x959@9A9E9F9H9P9Q9R9U9`9 9a 9b 9c 9d 9U 9U9U9qU(9U49U<9UD9UP9UX9bh9bp9cx9c9%c9&c90c9p9p9p9p9p9p9p $o8o@o HoPoXo `o h)l)|)BI) aM M9M,+8P<TTLUTXdp!  hq hr4be =!,=!D)d ipx;';4;5LL=L=LL L L L4L HL!\L#pL$L&L'L)L*L+LLLfLL(L8LHLXLhLxLLLLLL L!L#L( L@LA,LB<LDLLF\LGlLH|LILJLKLLLP LQLR,LS<LTLLU\LVlLW|LXL`Y/ / //y`yyy  y y0yDy\ylyy# # ## ## ## # # (#P4#`@#L#X#d# t#@#%#`###P#P##$0<H 2\ 2p 2 2 2 G```````:g`(`j0`8`H`T`\`d``l`t|6` `aqv,8HXhx& q 800@0@C0TD0dP0tQ0S0W0X0Y0e0h0t000 11$101@1X1d1p"1x#1G1H1I1w1112'2aĕr15,8HXhth  ( 0 8 @ HP\ht !"(#4$@%L6X7d8p9|:;<=>?fghijk mn$o0<HT`lx`a  $,4<DLT\l|112BJtPP@P@ Pe PPZZ(Pf4J@]T]\] ]]ls|ssss s s sss 8 @W` a=pu  08 H LX`d,xt"#%()+,/369<BCD E$H,J4K@LLM`NhPxWZ]`afikstwx}~ ,4<@L`p ,8DLXlt|  $ 08@H\'`1p8x<BHY]fy 4HT\p?DY[]l`$l0o@tPyXzdpx JM q(v0@HPX`hp| =Oa H 0$@8D;Tbpx8`}7 ;T}4<DX`h3p==x@83@OIJFP3StcJx.l'Y$> #$sH6s#6@6 PH#6`OH#6`bF M#asM΁3swO 33i`J`c,c<3 #hM #h##acj3 Nv3 6-3PNPDF##Ɓ#a Jac6-3#hW`愀#愀sKa O#AObHFV#s)Bg#sw2|<LزjNgc-xfjn3|P`P##< #%aOo##$+fj 3cCM #a15l8?#a31 5 9=~-   x33|`B~`)1`C~"X<\"3%|>`> 3B~#:nl8?B~B؃|3/B؃|ă3&8+26##k#c 3|`  k#c-<4830| ` 3 #b cZ3cd# v3 3B##"#"(#"#"B#JaE#3 bG# 3 bC##D#sM3'##&KOO"va F$Hڀ#4#Ja@#AK`#I0I`w#]b#c3-c#Ja#APb#Ac̆_+gcz|#hH##c|#cJa6#Ac37 #c`c#|ocKARaN#Ac3 b#Acg#cc#|gc3@ bcc|+@c|@cC|g@c|#c3*c +3)Ccކ3 bڀc|{c3, .c,|3=gc D|#acrqpcrppqrqppcrppqrqppc##3H#HCڇ#c nCvwc nCvwc#tC@Dt$&$scuZF&JudNsc{cv3>gcc8+8+2 1 c26:>c26:>c8+@2@6@:@>cZ @]cs #ss#f ##bswhA###BT+hx"##$%!%&&('' (4@LXt          Ъئ \ Ъ dЪ\ @@@@@x ,Ъ( Ъ(|Ъ(@Ъ( Ъ(hЪئ+)hUU72|12896|256128|512160|1024%2K} }}}%}2> > >>> > > >>%+2>K}  }}}} } > > > >  >> ! >> >  @DHL  @DHL     &(`& 0&0 0 `"0 0  JtT4$   rq! 2r!qq! 0  S1B1SSA1B1B11qw!! RSQQP@064a2-"-01p1q1q1$1!$1J$1K$1$1$1$1$1$1$1$1%1%1%1o&1Q&1R&1 t@t@At@it@@Y)Y$]$   &'(uvwxyz{| (((((((((2222222<<<<<<<<<FFFFFFPPPPPPZZZZZZZZZddddddddddddddnnnnnnnnnnnnnnnnnnxxxxxxxxxxrrrrqqqq)ȳ P@ & 4JPJ.0TdlP ''$' 8'D'!0X'Fl'''''''!0'X' '' ''@''@' (@'$(@'8(@'<( @'@(@'D( @'L(A'P(A'T('X('`(:Fh(|(:5h((:5h((:FPh((g (((" ((@ ()` ()`($)(0)(8)h@)X)h!@)h)ha@)x)hv@)) ))T))T)) ) )-1** *(*8*H*X*l* X*l*43*O x********a ** ** ** *+ *+ * + *0+@+H+JT+\+)d++f(++++++++r+++,p ,, ,,, <,cP,l,G1!,,G ',,,,',,,, ,,',,' ,-!,-!,$- 4-H- l-t-!(3|--W -W --W --W -L7W --W@--o -3-.3-.V- .v-@.v-`.v-.v-.v-.v-.v-. //84/P@H/c8hT/\/Vd/t// P/ /  /  / ̌ !/ 70  0 00D0 00\0 00h000t000|0\ 0\ 3 000ng00"f0 "f1A0f1C0f(1E0f81G0f81H0fH1N0fX1# h11# h11# h11#7h1111 11@11e6!2 2j42L2j42\2h24Ih2x22222222222 2t-2t-33233$3v,3JP@300X3 ql3|3 ql33 33x3333 3 344(4v84L4\4@h4At4X|4 4' 444444I444444`e45y5i5$5B05H5$05X5=>=,>=<>=L>=\>=t>=>=>=>=>=>=>=>=>= ?=?=,?=8/?9:;<=>?@ABC D E FG HIJK,LMN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c..d\|e 2"#6&$7'%8(&9)'0--=.^~/@`0[{2]}3;+4:*5\_\|9mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/02'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$2*3m4%56;.7:/8!d<> 2" 3!4$"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]13@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~4'@5``d\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-`?./[0+*]1}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]2`3m4%56;.7:/8=+~d<>\ 1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?.eEz/[0!]34{5 2$}y6,;7.:8-_d<>\ -'?.^`~0!]/[34{ 4*O :ZZFNJM   & J J<X 6 N 6 [0iiXopsXsXu{z{( @ v @  @ @  W 1 Q `@  ؀@  0 2 A` A @  @  @ @ @ @ P0@ P@  A @ @ h@ } @ } } } @@ @ 85@     L+ L XL2@ D@   O  {@o ! A! F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF |9  T$ȘDL@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0\p   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000vt100?p@RiAB  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_ABCDEFGHIJKLMNOPQRSTUVWXYZ@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?$<(x 1!2@3#4$5%6^7& 8* 9( 0) -_ =+! qwertyuiop[{]} as d!f"g#h$j%k&l';:('")`~*+\|,z-x.c/v0b1n2m3,<4.>5/?67*89 :;<=>?@ABCD E F G7H8I9J-K4L5M6N+O1P2Q3R0S.W X  / ,-.2"36&7/{ 8([ 9)] 0=} ?\ qQ@z+*'() +#',y2mM3,;4.:5-_V<>| '`+*~)^2"@3#4$6&7/{ 8([ 9)] 0=} +? |'()+'*3,;4.:5-_V<>\ '`|^~ +?\'()V<>| '`|^~ \'()|V<> \`^~&12~"3#'4{(5[-6|7` _8\ 9^ 0@ )] =+}az$q'm(%)+*,w2,?3;.4:/5!V<> 2"34$5%6&7/ 8( 9) 0= '? ^{[+*}]'@(#)\|+3,;4.:5-_V<> 1!2"34$5%6^7& 8* 9( 0) -_ =+('@)``+#~V\|2"6&7' 8( 9) 0 -= ^~@`[{';+(:*)+]}ps\_y{}\|1!|2"@3#4$~6&7/ 8( 9) 0= '? [+*]'({)\+}3,;4.:5-_V<> !1@-2_/3#;4$:5,6^.7& =8* [9( ]0) ?+' xX%eE{wW}!'(")`~+qQ|-34fF5\9 &1|2@"3#'4(56^7 !8 9{ 0} ) -_az[$*]q'm(%)+`,w2,?3;.4:/5=+~V<>\ `~)<> W  FE7JG7H8I9K4L5M6O1P2Q3R0S.-N, [{ ]}'",<.>pyfgcrl/?=+o e!u"i#d$h%t&n's(-_,;:-q.j/k0x1b3w4v5z:; <=>?@ABCDW X 6^6,7&7.qQwWeErRtTyYuUiIoOpP[{]}aAsS dD!fF"gG#hH$jJ%kK&lL';:('",zZ-xX.cC/vV0bB1nN2mM3,<4.>5/? 6^6,7&7. -_ =+qQwWeErRtTyYuUiIoOpP[{]}aAsS dD!fF"gG#hH$jJ%kK&lL';:('")`~+\|,zZ-xX.cC/vV0bB1nN2mM3,<4.>5/? 1+|2"@3*#46&7/ 8( 9) 0= '? eEz[!]'({) +$},y3,;4.:5-_V<>\ '? ^`~!]['({2"@3#4$6&7/{ 8([ 9)] 0=} '? <>+*'()\|+3,;4.:5-_V<> 1!2"3#4$6&7/ 8( 9) 0= '?\ qQ@+*~'({[)|+}]3,;4.:5-_V<> 1!2@3#4$5%6 =+[{'()'"+]}5;:S.V\|s/?2'3^#4+$5%6&7/{ 8([ 9)] 0=} *?\ -_qQ@I~'(i)"+,;345.:V<>| ''+,;`eEoOaAsS&lL,zZ-xX.cC1nN 1'~2"3+^4!5%6/7=` 8( 9) qQ\wW|zZiIQP!fF["gG]$jJ'$()0+qp,yY>-xX#.cC&/vV@0bB{1nN}3,?;4.:5-_*V< 1!~2"3#^4$5%6&7/` 8( 9) 0= '? +*qQ\wW|zZ!fF["gG]%kK&lL'()+,yY/vV@0bB{1nN}2mM3,;4.:5-_V<> O B Zb FV  J M 4D      .  R CKN@# H@ J  [4X$   Ei@ J= W H0^   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzOpenBSD3.7RAMDISK#84 @(#)OpenBSD 3.7 (RAMDISK) #84: Mon Mar 21 03:33:05 MST 2005 OpenBSD 3.7 (RAMDISK) #84: Mon Mar 21 03:33:05 MST 2005 deraadt@cats:/usr/src/sys/arch/cats/compile/RAMDISK dackirqsizeiomemiosizdrqdrq2channeldrivetargetlunphydevfunctionconfigurationvendorproductreleasereportidconsolemuxslotwsmuxloopbpfiltervga_init_screen: no font vga_init_screen: no fontvga_common_setup: couldn't map vga iovga_common_setup: couldn't map 6845 iovga_common_setup: couldn't map memoryvga_common_setup: mem subrange failedvga_free_screen: consolevga_doswitch: disappeared vga: pcvt font support not built in, see vga(4) vgadrive at %s channel %d drive %datapiscsi at %s channel %dwdcspl%s channel %d: reset failed for drive 1 drive 0atapi type: %s c_bcount: %d c_skip: %d missing untimeoutwdc_probe_caps%s(%s:%d:%d): using PIO mode %d, Ultra-DMA mode %d, DMA mode %d using BIOS timings%s: transfer error, downgrading to PIO mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to Ultra-DMA mode %d wdccmdwdccommandwdccommandext%s:%d: %s %s(%s:%d:%d): %s physio split wd ioctl request... cannot proceed user_strat: No ioctl TagSCB %d - Abort%s Completed. Bus Device ResetSelection Timeout%s: ahc_intr - referenced scb not valid during SELTO scb(%d, %d) parity error detected %s. SEQADDR(0x%x) SCSIRATE(0x%x) non- Unexpected %sDT Data Phase Illegal CRC packet request No terminal CRC packet recevied CRC Value Mismatch %s:%c:%d: %s: Someone reset channel %c %s: Transceiver State Has Changed to %s mode %s: Spurious SCSI interrupt NONEaic7770aic7850aic7855aic7859aic7860aic7870aic7880aic7895aic7895Caic7890/91aic7896/97aic7892aic7899Illegal Host AccessIllegal Sequencer Address referrencedIllegal Opcode in sequencer programSequencer Parity ErrorData-path Parity ErrorScratch or SCB Memory Parity ErrorPCI Error detectedCIOBUS Parity Errorin Data-out phasein Data-in phasein DT Data-out phasein DT Data-in phasein Command phasein Message-out phasein Status phasein Message-in phasewhile idlein unknown phase80.040.033.020.016.013.410.08.06.675.75.04.44.03.6%s: WARNING no command for scb %d (cmdcmplt) QOUTPOS = %d Attempt to queue invalid SCB tag %x:%x %s: brkadrint, %s at seqaddr = 0x%x ahc_intr: seqint, intstat == 0x%x, scsisigi = 0x%x %s:%c:%d: unknown scsi bus phase %x, lastphase = 0x%x. Attempting to continue %s:%c:%d: Warning - unknown message received from target (0x%x). Rejecting ahc_intr: HOST_MSG_LOOP bad phase 0x%x %s:%c:%d: no active SCB for reconnecting target - issuing BUS DEVICE RESET SEQ_FLAGS == 0x%x, SCBPTR == 0x%x, BTT == 0x%x, SINDEX == 0x%x SXFRCTL0 == 0x%x SEQCTL == 0x%x Unable to clear parity error. Resetting bus. %s:%c:%d:%d: Attempt to issue message failed data overrun detected %s. Tag == 0x%x. HaveHaven't%s seen Data Phase. Length = %ld. NumSGs = %d. sg[%d] - Addr 0x%x%x : Length %d Bogus TAG after DMA. SCBPTR %d, tag %d, our tag %d for saftey%s: BTT calculation out of range SAVED_SCSIID == 0x%x, SAVED_LUN == 0x%x, ARG_1 == 0x%x ACCUM = 0x%x SEQ_FLAGS == 0x%x, SCBPTR == 0x%x, BTT == 0x%x, SINDEX == 0x%x , A == 0x%x SCSIID == 0x%x, SCB_SCSIID == 0x%x, SCB_LUN == 0x%x, SCB_TAG == 0x%x, SCB_CONTROL == 0x%x SCSIBUSL == 0x%x, SCSISIGI == 0x%x for safety%s: No free or disconnected SCBs %s:%c:%d: Missed busfree. Lastphase = 0x%x, Curphase = 0x%x %s: Interrupted for status of 0 (?) ahc_intr - referenced scb not valid during seqint 0x%x scb(%d) HOST_MSG_LOOP with invalid SCB %x %s: Missing case in ahc_handle_scsiint. status = %x Unexpected busfree %s SEQADDR == 0x%x %s: %s: Infinite loop in critical section critical section loopscb:%p control:0x%x scsiid:0x%x lun:%d cdb_len:%d Shared Data: %#02x dataptr:%#x datacnt:%#x sgptr:%#x tag:%#x %s: ahc_alloc_tstate - Target already allocated DT%s: target %d synchronous at %sMHz%s, offset = 0x%x %s: target %d using asynchronous transfers %s: target %d using %dbit transfers %s:%c:%d:%d: Bus Device Reset Message Sent Abort%s Message Sent ahc_intr: AWAITING_MSG for an SCB that does not have a waiting message SCSIID = %x, target_mask = %x SCB = %d, SCB Control = %x, MSG_OUT = %x SCB flags = %xNo or incomplete CDB sent to device. %s: Issued Channel %c Bus Reset. %d SCBs aborted Protocol violation %s. Attempting to abort. Completed command without status. Unknown protocol violation. No SCB found during protocol violation Target did not send an IDENTIFY message. LASTPHASE = 0x%x. HOST_MSG_LOOP interrupt with no active messageUnknown REQINIT message typeTarget MSGIN with no active message(%s:%c:%d:%d): Target Initiated PPR (%s:%c:%d:%d): Initiator Initiated PPR (%s:%c:%d:%d): requested %dBit transfers. Rejecting... (%s:%c:%d:%d): refuses WIDE negotiation. Using 8bit transfers orderedhead of queue(%s:%c:%d:%d): refuses %s tagged commands. Performing simple queue tagged I/O only (%s:%c:%d:%d): refuses tagged commands. Performing non-tagged I/O %s:%c:%d: Message reject for %x -- ignored (%s:%c:%d:%d): refuses synchronous negotiation. Using asynchronous transfers %s: %s on %c:%d. %d SCBs aborted Unsupported adapter type (0x%x). Ignoring %s: WARNING - Failed chip reset! Trying to initialize anyway. hardware SCB structuressense buffers%s: ahc_init_scbdata - Unable to allocate initial scbs %s: No SCB space found SG spaceUltra Ultra160 Ultra2 SingleWide%s%s Channel %c, SCSI Id=%d, %d SCBs%d/%d SCBsTwin Channel, A SCSI Id=%d, B SCSI Id=%d, primary %c, shared data%s: Host Adapter Bios disabled. Using default SCSI device parameters %s: unable to allocate ahc_tmode_tstate. Failing attach Infinite interrupt loop, INTSTAT = %xInactive SCB in Wait List scb_index = %d, next = %d Waiting List traversalWaiting List inconsistency. SCB index == %d, yet numscbs == %d.found = %d, qinstart = %d, qinfifionext = %d First/Second Qinfifo fixupInactive SCB in qinfifo qinpos = %d, SCB index = %d Loop 1Disconnected List inconsistency. SCB index == %d, yet numscbs == %d.Disconnected List Loop. cur SCBPTR == %x, prev SCBPTR == %x.Inactive SCB on pending list Bogus resid sgptr value 0x%x %s: Program too large for instruction memory size of %d! ahc_loadseq: Could not malloc%s: BMOV not supportedUnknown opcode encountered in seq program%s[0x%x]%s ahc_print_register:(|================== Dump Card State Begins ================= %s: Dumping Card State %s, at SEQADDR 0x%x ACCUM = 0x%x, SINDEX = 0x%x, DINDEX = 0x%x, ARG_2 = 0x%x HCNT = 0x%x SCBPTR = 0x%x SCSISIGIERRORSCSIBUSLLASTPHASESCSISEQSBLKCTLSCSIRATESEQCTLSEQ_FLAGSSSTAT0SSTAT1SSTAT2SSTAT3SIMODE0SIMODE1SXFRCTL0DFCNTRLDFSTATUSSTACK: SCB count = %d Kernel NEXTQSCB = %d Card NEXTQSCB = %d QINFIFO entries: Waiting Queue entries: %d:%d Disconnected Queue entries: QOUTFIFO entries: Sequencer Free SCB List: Sequencer SCB Info: %3d SCB_CONTROLSCB_SCSIIDSCB_LUNSCB_TAGPending list: Kernel Free SCB list: FEATURES = 0x%x, FLAGS = 0x%x, CHIP = 0x%x BUGS =0x%x ================= Dump Card State Ends ================== Untagged Q(%d): (SCSIPHASECard was paused %s: failed to allocate DMA mem for %s, error = %d %s: failed to map DMA mem for %s, error = %d %s: failed to create DMA map for %s, error = %d %s: failed to load DMA map for %s, error = %d ahc_createdmamem error (%d) ahcahc_attachno longer in timeout, status = %x cmd fail %s: board is not responding SCB 0x%x - timed out again Other SCB Timeout%sBDR message in message buffer SCB %d: Immediate reset. Flags = 0x%x Queuing a BDR SCB %s: Hung target selection sg[%d] - Addr 0x%x : Length %d %s: Timed out SCB already complete. Interrupts may not be functioning. Timed-out target SCB but bus idle%s: Illegal cable configuration!!. Only two connectors on the adapter may be used at a time! adv%s: unable to allocate control structures, error = %d %s: unable to map control structures, error = %d %s: unable to create control DMA map, error = %d %s: unable to load control DMA map, error = %d %s: unable to initialize ccb, error = %d %s: unable to create DMA map, error = %d advccb%s: unable to load overrun buffer DMA map, error = %d %s: unable to create overrun buffer DMA map, error = %d %s: unable to map overrun buffer, error = %d %s: unable to allocate overrun buffer, error = %d %s -set: tag queuing enabled w/o disconnects unknown warning %d I/O port increment switch enabled %s -get: Chip is not halted Couldn't get MicroCode Start address I/O port address modified EEPROM checksum error IRQ modified adv_init: adv_find_signature failed%s: bad signature%s: unable to initialize board RISC chip%s: unable to create control blocks %s: WARNING: only %d of %d control blocks created %s: unable to load MicroCode%s: unable to initialize MicroCode%s: adv_scsi_cmd, more than %d dma segments %s: adv_scsi_cmd, error %d loading dma map timed out AGAIN. Resetting Bus %s: exiting ccb not allocated! %s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled espESP100ESP100AESP200NCR53C94NCR53C96ESP406FAS408FAS216AM53C974FAS366/HMEout of memory %s: unknown variant %d, devices not attached : %s, %dMHz, SCSI ID %d %s: unknown revision code, assuming ESP100 %s: resetting SCSI bus ncr53c9x_ecb[NCR_INIT(%d) %d] SELATNS [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] [0x%x, %d]->%d [ncr53c9x_scsi_cmd] [ncr53c9x_poll: rescheduling] [ncr53c9x_poll] %d:%d busy [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)requesting sense sense=0x%02x resid=%lu %s: QFULL -- throttling to %d commands [ncr53c9x_done(error:%x)] [flushfifo] cont [rdfifo %s (%d): %02xncr53c9x_rdfifo: bad flag[wrfifo(%d):ncr53c9x_sched_msgout %x %d %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT %s: reselect with invalid selid %02x; sending DEVICE RESET %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d %s: unexpected MESSAGE IN; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET got %ld extra bytes cmdcomplete unrecognized MESSAGE EXTENDED; sending REJECT %s: wide mode %d async mode max sync rate %d.%02dMB/s SDTR period %d, offset %d extended(%x) save datapointer restore datapointer disconnect %s: tagged queuing rejected: target %d (rejected sent tag)%s: sync transfer rejected: target %d %s: wide transfer rejected: target %d msg reject (msgout=%x) noop unrecognized MESSAGE; sending REJECT ident TAG %x:%x%s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET gotmsg(%x) state %d[ncr53c9x_msgin(curmsglen:%ld)] %s at line %d: no nexus %s at line %d: unexpected MESSAGE OUT phase [ncr53c9x_msgout(priq:%x, prevphase:%x)]%s: waiting for SCSI Bus Reset to happen %s: identify failed, state %d, intr %02x selid=%2x %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] %s: target didn't identify backoff selector ncr53c9x: no nexus%s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] MESSAGE_IN_PHASE %s: unexpected bus phase; resetting MESSAGE_OUT_PHASE DATA_OUT_PHASE [%ld] COMMAND_PHASE 0x%02x (%d) DATA_IN_PHASE STATUS_PHASE ncr53c9x no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] <>%s: target didn't send tag: %d bytes in fifo [%d] %s: STATUS_PHASE: msg %d %s: can't get status, only %d bytes %s: ICCS: : [intr %x, stat %x, step %x] %s: invalid state: %d sync nego not completed! %s: unexpected disconnect; sending REQUEST SENSE %s: SCSI bus parity error %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: DMA error; resetting %s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: SCSI bus reset regs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] [ncr53c9x_intr: state %d] %s: nexus in reset stateDMA activetagged DT %s: target %d now using %s%s%d bit MHz %d REQ/ACK offset xfers 13.3??3.33async siop: can't find my sync parameters%s: unable to allocate script DMA memory, error = %d %s: unable to map script DMA memory, error = %d %s: unable to create script DMA map, error = %d %s: unable to load script DMA map, error = %d %s: rejecting invalid wide negotiation from target %d (%d) %s: rejecting invalid PPR negotiation from target %d %s: ppr negotiation for target %d: offset (%d) or sync (%d) out of range %s: ppr negotiation for target %d: transfer width (%d) incompatible with dt %s: ppr negotiation for target %d: sync (%d) incompatible with adapter %s: ppr negotiation for target %d: no DT option %s: bad offset in siop_sdp (%d) clear fifo failed %s: timeout waiting for DIFFSENSE to stabilise %s: invalid SCSI mode 0x%x %s: switching to differential mode %s: switching to LVD mode %s: switching to single-ended mode siop%s: can't alloc lunsw for target %d %s: unexpected phase mismatch %d %s: selection timeout without command %s: unexpected disconnect without command != NULL%s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s %s: script interrupt (0x%x) with invalid DSA !!! unknown irqcode %x %s: done without command, DSA=0x%lx invalid retval from siop_wdtr_neg()invalid retval from siop_sdtr_neg()%s: extended message too big (%d) unhandled message 0x%x scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x our reject message was rejected %s: reselect with invalid target %d %s: target %d lun %d tag %d reselect without command %s: target %d reselect with invalid lun %d %s: reselect with invalid target error, DSP=0x%x reselect failed %s: reselect with invalid tag %s: bad offset for disconnect (%d) %s: command with invalid status (IRQ code 0x%x current status %d) ! %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x parity error %s:%s: phase mismatch without command scsi gross error %s: DMA IRQ: dma fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid parity bus fault illegal instructionsingle step dsp 0x%08x dsa 0x08%x INTRF %s: unable to load data DMA map (for SENSE): %d request sense failed %s: untagged command already running for target %d lun %d (status %d) %s: scsi bus reset cmd %p added to reset list from urgent list cmd %p added to reset list from ready list cmd %p (status %d) reset with status %d, xs->error %d cmd %p (tag %d) added to reset list %s: unable to load data DMA map: %d %s: can't alloc siop_lun for target %d lun %d %s: can't malloc memory for target %d siop_start: bad statustimeout on SCSI command 0x%x %s: unable to allocate cbd DMA memory, error = %d %s: unable to load cbd DMA map, error = %d %s: unable to create data DMA map for cbd: error %d %s: unable to create cbd DMA map, error = %d %s: unable to map cbd DMA memory, error = %d %s: can't allocate memory for command descriptors %s: can't allocate memory for command descriptors head siop: resel switch fullsiop_stat_intr %d siop_stat_intr_shortxfer %d siop_stat_intr_xferdisc %d siop_stat_intr_sdp %d siop_stat_intr_done %d siop_stat_intr_lunresel %d siop_stat_intr_qfull %d lc%s: fatal RXD error, attempting recovery %s: recovery failed -- board disabled %s: reset: EEPROM checksum failed (0x%x) PIO mode (internal 2KB window)2KB windowchanged 32KB window to 2KBchanged 64KB window to 2KB%s: address %s, %dKB RAM, %s %s: disabled due to error %s: command never completed! %s: eeprom failed to come ready %s: reset didn't complete %s: bogus xcvr value in EEPROM (%x) %s: choosing new default based on card type %s: WARNING: no media options bits set in the media options register!! %s: this could be a manufacturing defect in your adapter or system %s: attempting to guess media type; you should probably consult your vendor %s: unknown device ID: %x -- defaulting to 10baseT %s: guessing MII %s: guessing 10/100 internal %s: guessing 10BaseT transceiver %s: guessing COMBO (AUI/BNC/TP) %s: guessing 10baseFL %s: guessing 100BaseT4/MII %s: guessing TPC (BNC/TP) %s: guessing 10/100 plus BNC/AUI %s: rx load failed %s: bad receive status -- packet dropped %s: transmission error: %x %s: initialization failed: no memory for rx buffers %s: unknown XCVR type: %d %s: watchdog timeout %s: no carrier - transceiver cable problem? %s: failed to read station address : can't alloc list mem : can't map list mem : can't alloc list map : can't load list map : can't create rx spare map : can't create tx spare map : can't create tx map : can't create rx map xl%s: warning: SCB timed out fxp: %s, address %s %s: no phy found, using manual mode %s: Disabling dynamic standby mode in EEPROM, New ID 0x%x, cksum @ 0x%x: 0x%x -> 0x%x %s: Failed to malloc memory %s: unable to create rx dma map %d, error %d %s: unable to create tx dma map %d, error %d fxp_stop: no buffers!%s: device timeout %s: fxp_mdi_read: timed out %s: fxp_mdi_write: timed out fxp-d101afxp-d101b0fxp-d101mafxp-d101sfxp-d102fxp-d102c%s: timeout loading microcode %s: failed loadfirmware of file %s: errno %d %s: phy_read: bad phy register %x %s: phy_write: bad phy register %x %s: failed to force tx and rx to idle state %s: reset never completed! %s: MII without any PHY! %s: no memory for rx list -- packet dropped! %s: failed to force tx to idle state %s: no memory for tx listdcne2000_attach%s: setup failed %s: where did the card go? ne2000_detect%s: remote transmit DMA failed to complete ne2000_write_mbuf: negative len%s: %d silo overflow%s, %d ibuf overflow%s : unknown uart %s: console : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, 16 byte fifo : st16650, no working fifo : st16650, 32 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: can't establish soft interrupt.comprmcomstartcomcninit: mapping failedkbdauxkbc: cmd word write error kbc: aux echo error 1 kbc: aux echo error 2 (%s slot)pckbc_slot_enable(%d) failed pckbc_cmd: send error pckbc: command timeout pckbc_start: command error pckbc_start: send error pckbc: cmd failed kbccmdpckbc_set_inputhandler: bad slot %dpckbcintr: no dev for slot %d pckbcihaerror %d loading SG list dma map buffer needs >%d dma segments error %d loading buffer dma map iha_init_tulip%s: couldn't create SCB SG DMA map, error = %d %s: couldn't create SCB data DMA map, error = %d error %d loading request sense buffer dma map SCSI Parity error detected SCSI OpCode 0x%02x timed out %s: target %d using %d bit %d.%d MHz %d REQ/ACK offset %s: unable to allocate SCBs, error = %d %s: unable to map SCBs, error = %d iha: invalid EEPROM, bad signature or checksum version %d.%d%s %s: unsupported OHCI revision %s: SMM does not respond, resetting %s: reset timeout ohci, legacy support%s: blocking intrs 0x%x %s: unrecoverable error, controller halted %s: resume detect %s: %u scheduling overruns ohci_add_done: addr 0x%08lx not foundohci_rem_ed: ED not foundohci_abort_xfer: not in process contextohci_root_ctrl_startOHCI root hubohci_setintr: 0 interval %s: isoc TD alloc failed ohci_device_isoc_abort: early return rd%drdattach: device name too long RAM diskfictitiousrd_idleAll breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d %-12sdb_commandCount missing Bad modifier Ambiguous No such command Malloc debugging not enabled. the kernel did not panic procscalloutbreaksextentsmallocobjectpanicpoolprocregistersuvmexpwatchescrashhaltrebootpoweroffmachineexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallshowboothelphangmandmesgddb> Bad function %#n Argument missing Too many arguments ELF[ %s symbol table has bad start address %p ] ELFbad magic[ %s ELF symbol table not valid: %s ] bad e_machine.strtab.symtabsymtab unaligned[ using %lu bytes of %s ELF symbol table ] symtab corrupted= 0x%lx %c\%03o%-*ld%-*lo%-*lr%-*lu%-*lx%-*lz: %*d%*o%*r%*u%*x%*zAddress missing Value missing Syntax error Symbol not found Divide by 0 Negative shift amount ^R String too long Bad escape Bad character Bad character in number End of stack trace. --db_more-- -%*lo-%#*lo-%*lu-%#*lu-%*lx-%#*lxFaulted in traceback, aborting... Starting stack trace... %-12s%#*ln %s+%#lr[after %6d] bsd[ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s%s Sifting table %s: db_printsym [%s:%d]+%sBreakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! After %d instructions (%d loads, %d stores), radixmaxoffmaxwidthtabstopslinesUnknown variable No value All watchpoints used. No map. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx Unknown size %#8n = %#8n Nothing written. () Score: %lu/%lu db_hangmanloadfirmware/etc/firmware/%s%s: address %s dp8390_initdp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed rndrdextract_entropyarc4_stircd9660_lookupcd9660_inactive: pushing activecd9660_reclaim: pushing activeRRIP without PX field? RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_P1282RRIP_1991AIEEE_1282SPcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: directory crosses block boundary %d[off=%d/len=%d] fhtovp: bread error %d fhtovp: crosses block boundary %d fhtovp: lbn exceed volume space %d cd9660_strategy: spectag VT_ISOFS, isofs vnode elf32_load_fileOpenBSDexec_elf32_makecmds#!/dev/fd/%dswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init/sbin/oinit/sbin/init.bak/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initinitclocks: unable to register softclock intrfileplfdescpldup2: fdallocclosefkqeueplknoteplkqreaduser mapping failed kernel mapping failed %d init died (signal %d, exit %d)waitppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: unknown locktype request %dlockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: upgrade exclusive locklockmgr: processor %lu, not exclusive lock holder %lu unlockinglockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: draining against myself lock type %s: EXCL (count %d) by processor %lupid %d with %d pending not locked lock type %s: SHARED (count %d)malloc: allocation too largemalloc: out of space in kmem_map%d,rwlockrw_enter: locking against myselfphysbufphysio%-16s %-8s %18p %s %5d %5d %5d %d %#10x %-9.9s %-16s COMMANDSTRUCT PROC *UAREA * PID %-10s %18s %18s %18s VMSPACE/VM_MAP PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSGWAITPPIDPGRPUID PID %5s %5s %5s S %10s %-9s %-16s usage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info procplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0idlestopzombiedeadonprocADVLOCKCTTYINMEMNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCFSTRACESSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDSWAPINBIGLOCKPROC (%s) pid=%d stat=%s flags=%b pri=%u, usrpri=%u, nice=%d forw=%p, back=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawn%c%5d %-10.10s %18p %18p %18p plimitplsigaplpauseissignal procfs debuggingpid %d was killed: %s sorry, pid %d was killed: %s coredump%s.corehashinit: bad cntsysctlsysctl_disklocksysctl_doproc%s,denied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleep%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func smashed stack in %spreempt: cpu_preempt not yet implementedsetrunnable not configured unsupported >>> %s probe returned %d >>> probing for %s* mapply: no match function for '%s' device>>> %s probe won >>> no winning probe root device %s not configured %s at %s%s (root)config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: duplicate %sexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: device name too long%s detached config_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structurewrit%s%d%c: %s %sing fsbn %d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dfilesystem type %d not known.. assuming ffs dk_mountrootcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0bufq_default_alloc: no memoryintrextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundFLWANTEDWANTEDNOCOALESCEFIXEDextent `%s' (0x%lx - 0x%lx), flags=%b 0x%lx - 0x%lx extent_print: NULL extentklogmtx_enter: ipl not implementedphpoolpcgpoolpool_init: too much uptimepool_get: %s: page emptypool_put: %s: page header missing page %p, nmissing %d, time %lu,%lu POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p no log curpage %p pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) kernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %slogprikprintf%llx%llobug in kprintf: bad base0123456789ABCDEF(null)0123456789abcdefaddchangeddbdisableenableexitqfindlistquittimezoneverbosev--- more --- 0x%x0%o*UNKNOWN**FOUND*%3d free slot (for add) Unknown devno (max is %d) %3d at disable %s flags 0x%x ???%3d %s count %d (pseudo device) %s [] ? Unknown argument %3d can't change free slot change (y/n) ?%3d %s changed flags changed out of memory. alreadyError unknown state %3d can't disable free slot %3d %s can't disable pseudo device %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before more enter ddbdev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst don't know toggle verbose bootingUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Device not complete number or * is missing Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d Unknown command disautoconf verbose %sabled Unknown command, try help User Kernel Config UKC> Continuing... sys_ioctlpipelkpiperdpipewrpipeclpipeplttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk empty foreground process group putc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersmbplmclplm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0: off %d, len %dm_copydata: off %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_copydata: len %d < 0m_apply: len %d < 0m_apply: null mbuf in skipm_apply: null mbufm_apply: off %d < 0m == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREFsbappendaddrsbappendcontrolsemi-panic: sbcompress sbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 4uipc 3piusrrequnp_attachunp_bindunp_connect2unp_disconnectbremfree: lost tailbufplgetblkallocbuf: buffer larger than MAXBSIZE requestedgetnewbufbiowaitbiodone alreadynchplcluster_read: DONE bpcluster_callback: too little memoryClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocksvop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvnodesvfslock%s_mountroot failed: %d v_lockvnodefree vnodefree vnode isn'tvgetvrele: cannot lockvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevvgonel: not cleanmissing aliasVNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADtype %s, usecount %u, writecount %u, holdcount %u,vprint flags (%s)|VALIASED| VBIOWAIT|VXWANT|VXLOCK|VSYSTEM|VTEXT|VROOTkinfo: vp changed WARNING: some file systems would not unmount retrying unmount of %s failed with error %d syncing disks... giving up done softdep vwakeup: neg numoutputvinvalbufvinvalbuf: flush failedvinvalbuf: dirty bufsvflushbufvflushbuf: dirtyvflushbuf: not dirtybgetvp: not freebrelvp: NULLsyncersched_sync: fsync failedmounted on: %s syncer vnodesys_mountmount: lost mountunmount: dangling vnodesys_statfssys_fstatfssys_getfsstatsys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lockvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_leasevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_whiteoutvop_getextattrvop_setextattrvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfifowfifortag VT_NON, fifo with %ld readers and %ld writersfifo_badop calledspec_read typespec_write typespec_ioctlspec_fsyncspec_fsync: not dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calleddos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largemsdosfs_reclaim(): pushing activemsdosfs_inactive(): pushing activeextendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath(): .. not a directory? RRaArrAamsdosfs_sync: rofs mod dev %d, %d, %s msdosfs_createmsdosfs_write(): bad file typemsdosfs_renamemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_mkdirmsdosfs_readdirmsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED)bpf_detachd: descriptor not in listbpf: ifpromisc failedbpfbpfwritebpf_mcopybpfattachif_attachsetuptoo many interfacesif_attachhead: mallocif_attach: mallocif_clone_listifioctlifconfif_getgroupifpromisc%s: can't handle af%d lo%dlooutputlooutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedrn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtentplrtfreertfree: %p not freed (neg refs) rtfree 2ifafreertrequest deletertinit: wrong ifa (%p) was (%p) rttmrplrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputroutearp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: can't allocate llinfo arpintrarp: attempt to add entry for %s on %s by %s on %s in_arpinputarp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to overwrite permanent entry for %s by %s on %s duplicate IP address %s sent from ethernet address %s arp: ether address is broadcast for IP address %s! arptfreearplookup: unable to enter address for %s revarprequestrevarp[NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p (%s) ifa=%p genmask= gwroute=%p llinfo=%p (NULL)Route tree for AF_INET (not initialized) in4_cksum: offset too shortin4_cksumcksum4: out of data in4_cksum: bad mbuf chainin_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectinterneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeouticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dipqeplaeshmac-sha1deflateip_initip_dooptionsattempted source route from %s to %s ip_outputip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputm_pulldown malfunctiontcp_pulloutofbandsynpltcp_outputtcp_output REXMTtcpcbpltcpqepltcp_inittcp_respondtcp_ctlinputtcp6_mtudisc_callbacktcp_timer_rexmttcp_usrreqtcp_identudp_inputudp6_ctlinputudp_usrreqipip_inputipip_input: should never reach hereetherip_inputMD5Finalrpc denied, status=%d rpc denied, error=%d RPC timeout for server 0x%x krpc_call: sosend: %d bind failed nfsbioread: type %x unexpected nfsbioreadnfsvinvalnfs_doio: type %x unexpected Process killed due to text file modification nfs_boot: using network interface '%s' nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%drevarp failed, error=%dnfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: server_addr=%s hostname=%s nfs_boot_initnfs_boot: bootparam whoami, error=%dnfs_boot: no suitable interfacenfs_boot: bootparam get %s: %d nfs_boot: mountd %s, error=%d nfs_boot_getfhnfs_boot: portmap NFS/v2, error=%d nfs_boot: bootparam_whoami: bad reply nfs_boot: bootparam_getfile: bad reply nfs_hashlocknfsnodeplnfs_inactive: pushing activenfs_reclaim: pushing activenfskqlcknfskqpwnfskqdetnfskqpollnfsconnfscon sotypenfs send error %d for server %s nfsd send error %d receive error %d from nfs server %s Egad!! short receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthnfsreply nilnqnfstrynfs_requestis alive againnot respondingnfsndlcknfs sndunlocknfsrcvlknfs rcvunlockKerb nickname short Kerb nick verifier bad Bad kerb verifier Not fullname kerb verifier nfs server %s: %s build > MLENnfs S too bignqnfstimrcld kerbnfsd initnfsidlnfsionfsauth1nfsauth2nfs_mountroot: root/root on %s nfs_mountroot: getattr for rootswap on device 0x%x nfs_mountrootswap/swapswap on %s nfs_mountroot: getattr for swap WARNING: no swap nfs_mountroot: can't setup swap vpnfsnfs_mount_diskless: vfs_rootmountalloc failednfs_mountroot: mount %s failed: %dnfs_args: retrying connect nfs_mountnfsdismnfs: writerpc iovcnt > 1nfs_remove: no namenfs_remove: bad v_usecountnfs_rename: no namenfs readdirrpc bad uioEEK! readdirrpc resid > 0 nfs readdirplusrpc bad uioEEK! readdirplusrpc resid > 0 .nfsA%05x4.4nfs physio/asyncnfs_fsyncnfsfsyncnfs_fsync: not dirtytag VT_NFS, fileid %ld fsid 0x%lxbwrite: buffer is not busy???file system full %s: write failed, file system is full ffs_realloccg: bad blockno%s: optimization changed from SPACE to TIME dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optim%s: optimization changed from TIME to SPACE dev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocpos = %d, i = %d, fs = %s ffs_alloccgblk: can't find blk in cylffs_alloccgblk: cyl groups corruptedffs_clusteralloc: lost blockffs_nodealloccg: block not in mapcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corrupteddev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %u bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free fragffs_blkfree: freeing free blockdev = 0x%x, ino = %u, fs = %s ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sffs_freefile: freeing free inodebno = %d, fs = %s ffs_alloccg: block not in mapstart = %d, len = %d, fs = %s ffs_alloccg: map corrupteduid %u on %s: %s ffs_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizeffs_isblockffs_clrblockffs_setblockffs_isfreeblocksoftdep_flushfiles calledsoftdep_setup_inomapdep calledsoftdep_setup_blkmapdep calledsoftdep_setup_allocdirect calledsoftdep_setup_allocindir_page calledsoftdep_setup_allocindir_meta calledsoftdep_setup_freeblocks calledsoftdep_freefile calledsoftdep_setup_directory_add calledsoftdep_change_directoryentry_offset calledsoftdep_setup_remove calledsoftdep_setup_directory_change calledsoftdep_change_linkcnt calledsoftdep_load_inodeblock calledsoftdep_update_inodeblock calledsoftdep_slowdown calledffs_mountroot: can't setup bdevvp's ffsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck WARNING: soft updates isn't compiled in ffs_reload: dirty2ffs_reload: dirty1no UFS2 support ffs_statfsupdate: rofs modffsino%s: typeffs_write%s: nonsync dir writeffs_fsyncffs_fsync: not dirtyffs_inactive: pushing activeufs_reclaim: pushing activei_ffs_size too smallmangled entry%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact2ufs_direnter: compact1checkpath: .. not a directory chown: lost quotaufs_linkufs_whiteout: unknown opufs_whiteoutufs_renameufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_rename: lost from startdirufs_mkdirufs_readdir: lost in spaceufs_strategy: spectag VT_UFS, ino %d, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lldufs_makeinodemode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_nodealloccg: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedbad block %d, ino %d dev = 0x%x, ino = %d, fs = %s ifree: range: dev = 0x%x, ino = %d, fs = %sifree: freeing free inodeext2fs_mapsearch: block not in mapext2fs_alloccg: map corrupteduid %d on %s: %s ext2fs_inactive: pushing activeext2fs_indirtrunc: bad buffer sizeext2fs_readdiri_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryext2fs_direnter: newblkext2fs_direnterext2fs_direnter: frag sizecheckpathext2fs_writeext2fs_mountroot: can't setup bdevvp'sext2fs%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsExt2 fs: unsupported inode size Ext2 fs: unsupported optional feature ext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_rename: lost from startdirext2fs_mkdir: blksizeext2fs_reclaim: pushing activeamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereamapplamap_wipeout: corrupt amapcownowpagecownowamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countuvm_anon_add: can not allocate %d anons uvm_anon_adduao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: hashinit swhash faileduao_create: malloc swslots faileduao_create: asked to enable swap on kernel objectuaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getuao_getpageudv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_pmfail1flt_noram3flt_noram2flt_pmfail2flt_noram4flt_noram5fltagain2uvm_fault_unwire_locked: address not in mapuvm_fault_unwire_locked: unwiring non-wired memoryuvm_fork: uvm_fault_wire failed: %duvm_swapin: uvm_fault_wire failed: %dschedpwaitscheduleruvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: submap allocation faileduvm_km_suballoc: unable to create submapkm_getwait2km_allockm_alloc1wuvm_km_alloc1: non-released pagevallocwaitkmthreadkmallocvmmaplkuvm_mapent_alloc: out of static map entries, check MAX_KMAPENT (currently %d)# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs= PAGES : <%p,0x%llx> refs=%d PAGE %p: %b flags=%s, pqflags=%s, vers=%d, wire_count=%d, pa=0x%lx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) checking pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< uvm_page_printit page found on pageq list anon backpointer is OK checking object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on object list uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_pageboot_alloc: pmap_growkernel() faileduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: bad free list %duvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = BSEARCH number of buckets = %d uvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! pgdaemon%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retrys)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern/kmem)=%p/%p swapsysuvm_swap_init: can't get vnode for swap deviceswapmapswp vnxswp vnduvm_swap_init: extent_create failedswapdrum_addsys_swapctlswapctl: copystrswapctl: miniroot copy failedswap0x%04xswap_on: miniroot larger than swap?Preserved %d pages of miniroot leaving %d pages of swap swap_on: unable to preserve minirootdisklabel regionswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getuvn_getpageuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin6_pcbconnectin6_pcbnotifyin6_ifloop_requestADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_controlnd6_prelist_add succeeded but no prefix prefix ioctls are now invalidated. please use ifconfig. in6_update_ifain6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to get interface identifier %s: borrow interface identifier from %s %s: got interface identifier from %s %s: got interface identifier from itself in6_ifattach_linklocalin6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) %s: no ifid available in6_ifattach_loopbackin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattachin6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetach%s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICMP6 checksum error(%d|%x) %s icmp6_notify_erroricmp6_notify_error: in6_embedscope failed icmp6_mtudisc_updateni6_inputicmp6_rip6_inputicmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d /usr/src/sys/netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d (src=%s dst=%s tgt=%s)icmp6_redirect_inputICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_input: invalid ND option, rejected: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s icmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s ip6_savecontrolip6_nexthdrip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_mrouter_doneadd_m6ifregister_mifdel_m6ifadd_m6fc: %s o %s g %s p %x dbx %p multiple kernel entriesdel_m6fcip6_mforward: ip6_mrouter socket queue full ip6_outputassumption failed: hdr not splitip6_setmoptionsip6_setpktoptionsip6_rthdr0nd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsduplicated ND6 option found (type=%d) too many loop in nd opt nd6_options: unsupported option %d - option ignored uninitialized ndopts in nd6_optionsln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookupunspecnd6_lookup: failed to lookup %s (if = %s) nd6_freend6_rtrequestnd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) nd6_rtrequest: malloc failed nd6_ioctla router(%s) advertises a prefix with non-link local address default router list contains a non-linklocal address(%s) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) nd6_ns_inputnd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad NS target (multicast) nd6_ns_outputnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_inputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: invalid ND option, ignored nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid target address %s nd6_na_outputnd6_na_output: source can't be determined: dst=%s, error=%d %s: starting DAD for %s nd6_dad_start: memory allocation failed for %s(%s) ???nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_timer: called with null parameter %s: DAD complete for %s - no duplicates found %s: could not run DAD, driver problem? nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: DAD structure not found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required nd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_ns_inputifa == NULL in nd6_dad_na_inputnd6_rs_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_input: invalid ND option, ignored nd6_ra_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid ND option, ignored defrouter_addreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlinknd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_offlinknd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlink: %s/%d is already off-link in6_ifaddin6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_usrreqrip6_detachudp6_outputspsrr1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spFaulted in DDB; continuing... address %p is invalid address 0x%08lx not a valid page framedb_fetch_reg: botchbranch_taken: botchscp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08xBad frame pointer: %p Bad user frame pointer: %p %sr%d=0x%08xtrace: pid %d not found swapped out at %p frame address = %08x frame address must be specified spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbuscpufootbridgemainbus_bs_alloc(): Help!mainbus_bs_free(): Help!%s, #0x%03x-imbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfrndsqtloglgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcund%s %08x %s%s#0x%08xp%d_f%d#%s[r%d]cpsr[%c - unknown]%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d, rrx, %s r%d, %s #%d{r%d-r%d}^[r%d#0x%02xf%d, c%d, No support for this CPU type (%08x) in kernelcpu.cachecpu.nocachesa110.cachesa110.icachesa110.dcachecpu.writebufcpu.nowritebufsa110.writebufUndefined instruction in kernel Warning IRQ's disabled during boot() real mem = %u (%uK) cpu_startup: system table size inconsistencycpu_startup: cannot allocate UVM space for buffersavail mem = %lu (%uK) using %d buffers containing %u bytes (%uK) of memory cpu_startup: not enough memory for buffer cachecpu_startup: no room for system tables; %d bytes requiredsinglekdb-a-k-s_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POSTunknown buffer type %d _bus_dmamap_sync_bus_dmamap_sync: ARM32_BUFTYPE_INVALID_bus_dmamap_sync: ARM32_BUFTYPE_RAW_bus_dmamem_map: size botch%s: SA-110 with bugged STM^ instruction rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step 0ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzunknownCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15** IDC disabled IDC enabled WB disabled WB enabled LABT EABT%s: %dKB/%dB %d-way %s unified cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. %s: %dKB/%dB %d-way Instruction cache %s: %dKB/%dB %d-way %s Data cache branch prediction enabled DC disabled DC enabled IC disabled IC enabledunknown CPU (ID = 0x%x)%s %s (%s core)Processor failed probe - no CPU ID Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P) uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Non-emulated page fault with intr_depth > 0 data_abort_fault: Misaligned Kernel-mode Program Counter kerneluserFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortInvalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x badaddr: invalid size (%lu)mmrwpmap_enter: no pv entriespmap_enter: failed to allocate L2 bucketprefetch_abort: page is already mapped - pte=%p *pte=%08x prefetch_abort: pc=%08lx proc=%p process=%s prefetch_abort: far=%08x fs=%x pmap_init_l1: can't get PA of L1 at %ppmapplpvepll2dtblpll2ptpplpmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: No L2 for L2 @ va %p pmap_alloc_specials: no l2b for 0x%lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_chunk: no L1 table provideduser pmap (%p): pmap_kernel (%p): domain %d, l1 at %p %08lx: %c |0000 |8000 |10000 |18000 |20000 |28000 |30000 |38000 pa 0x%08lx: krw %d kro %d urw %d uro %d %c va 0x%08lx, flags 0x%x dumpconf: bad dumpdev=0x%x dumping to dev %u,%u offset %ld dump device bad aborted from console i/o error device not ready succeeded area improper area unavailable dump to dev %u,%u not possible pagemove: size=%08lxvmapbufvunmapbufisaisaattach: can't map `delay port' irq %d drq %d drq2 %d/%d iomem 0x%x port 0x%xisascan>>> probing for %s%d succeeded >>> probing for %s%d failed >>> probing for %s%d >>> probe for %s* clone into %s%d %s: iosize not repaired by driver >>> probing for %s* finished >>> probing for %s* nonepulsededge-triggeredlevel-triggeredisa_intr_typename: invalid type %dcom_isa_attach: mapping failedkbc selftest: %x pckbc_attach: couldn't map%s: unable to establish interrupt for %s slot %s: using irq %d for %s slot : can't map i/o space %s: overriding IRQ %d to %d %s: warning: can't establish shutdown hook : can't map mem space lemac_isa_probepci bus %d%s: Cannot map registers: DC21285 rev %d serrsdram_paritydata_paritymast_abttarg_abtparityfcom%s: Unrecognised IDfootbridge_intr: ctrl=%08x footbridge_intr: pcistat=%08x footbridge_alloc(): Help!footbridge_free(): Help!footbridge_pci_intr_map: out of range interruptpin %d line %d (%#x) pci_intr_map: no mapping for pin %c isairq %ldirq %ldfootbridge_pci_intr_string: bogus handle 0x%lxNo memoryfootbridge_intr_establish: IRQ %d out of rangestatclockhandler: Statclock overrun clock: hz %d stathz %d profhz %d clock%s: Cannot install timer 1 interrupt handlerstat%s: Cannot install timer 2 interrupt handler/usr/src/sys/arch/arm/arm/softintr.csoftnet_intrhand != NULLsoftintr_establish: unknown soft IPL %d: consoleserial_rx%s: Cannot install rx interrupt handler%s: Cannot allocate rx buffer memoryfcomstartfcomcninit: mapping failedfcomcons_alloc(): Help!fcomcons_free(): Help!wd: <%s> %s: %d-sector PIO, LBA, %lluMB, %llu sectors wdattach%s: WARNING: unable to establish shutdown hook CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors LBA48, %lluMB, %llu sectors %s: IDENTIFY failed __wdstart: bad return code from wdc_ata_bio()wddone%s: soft error (corrected) , retrying device faultdevice timeoutST506/MFM/RLLESDI/IDE disk%s: %s wddumpwddump: try againwddump: device timed outwddump: unknown error typewddump: %swddump: drive faultwddump: DMA errorwddump: polled command has been queuedST506wd_get_params: bad return code from ata_get_params%s: flush cache command didn't complete %s: flush cache command: drive fault %s: flush cache command timeout wdc%s:%d:%d: not ready, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad statewdc_ata_ctrl_intr: state==RECALrecal%s:%d:%d: %s drive fault error (%x) %s:%d:%d: %s timed out piomodedmamodesetmultino media/write protectedinterface CRC erroraddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detected%s %serror not notifiedtodclockClock has gained %d day%c %ld hours %ld minutes %ld secs %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s off INFO: 0x%x (VALID flag %s) SKSV: %s FRU CODE: 0x%x ASC/ASCQ: %s COMMAND INFO: 0x%x %c Incorrect Length Indicator Set%c EOM Detected%c Filemark Detectedscxsplgetxscannot allocate scsi xs could not get size scsi_scsi_cmdscsi_execute_xs: invalid return codescbusyunknown error category (0x%x) from scsi driver probe%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess DEnied - ACL LUN ConflictLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Begining Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedCD Control ErrorPower Calibration Area Almost FullPower Calibration Area Is FullPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullDEFERRED CDBParametersError in %s, Offset %d, bit %dProgress Indicator: %dActual Retry Count: %dASC 0x%02x ASCQ 0x%02xDiagnostic Failure on Component 0x%02xDecompression Exception Short Algorithm ID OF 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)host adapter code inconsistency unknown error category (0x%x) from host adapter code User command with no ioctl User command with no buf scistrcmdlen too big physio split the request.. cannot proceed DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S SEAGATE ST19171FCST34501FC iomegajaz 1GBIOMEGAZIP 100ZIP 2500661467MICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibusscsibus at %s: %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun linksscsi_probe_busPLEXTORCD-ROM PX-40TS1.01FUJITSUM2513A0800DELTIS MOS321 3.30MICROP 1588-15MBSUN0669vendor-uniqueremovablefixed targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sscsibusprintdirectsequentialprinterprocessorwormcdromscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: impossible device type offlinescsibusprint: impossible qualifierNEC CD-ROM DRIVE:260cd%s: not queuedcdioctlATAPI CD-ROMSCSI CD-ROMdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_disckeydvd_read_bcadvd_read_manufactcd_scsibus_set_pa_immedcd_scsibus_setchancd_scsibus_getvolcd_scsibus_setvolsd%luMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lu sec totalunformatted mediadrive offline%s: not queued, error %d SCSI opticalSCSI disksdgetdisklabel%s: removable disk stopped - not restarting %s: respinning up disk %s: respin of disk failed - %d %s: ..is spinning up...waiting sd_atapibus_get_parms%s: mode sense (%d) returned nonsense; using fictitious geometry %s: could not mode sense (4/5)%s: WARNING: cache synchronization failed TDC 3800 ARCHIVE VIPER 2525 25462SANKYO CP525 ANRITSU DMT780 VIPER 150 21247VIPER 150 21531WANGTEK 5099ES SCSI5150ES SCSI5525ES SCSI REV7EXABYTE EXB-8200 263HHP T4000s TANDBERG TDC 3600 ????TEAC MT-2ST/N50 rogue, %s: %sdensity code 0x%x, drive empty or not ready %d-byteprotected blocks, write-%s variable%s: cannot set selected mode %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d %s: not queued st_mode_sensest_mode_select%s: block wrong size, %d blocks residual %s: bad residual %d out of %d %s: %d-byte record too big atapiscsiwdc_atapi_start: not ready, st = %02x wdc_atapi_intr_command%s:%d:%d: device timeout waiting to send SCSI packet unexpected data phasezero length transfer requested in data phasedata transfer direction disagreementdata phase where none expecteddata transfer direction disagreement during senseunexpectedly in command phasewdc_atapi_intr: warning: device requesting %d bytes, only %d left in buffer wdc_atapi_intr: warning: reading only %d of %d bytes atapiscsi: Shouldn't get here %s:%d:%d: device timeout, c_bcount=%d, c_skip=%d, status=0x%b, ireason=0x%x Device Reset WaitIdentifyPost-IdentifyPIOMODEunknown state%s:%d:%d: soft reset failed use one of: %s[a-p]parsediskboot_file: '%s' rootconf: device name too longboot device: %s. root device (default %s%c)swap device can't figure root, hope your kernel is right rootconfroot on %s%c boot device not knownboot device: lookup '%s' failed. rebooting... The operating system has halted. Please press any key to reboot. OpenBSD/cats booting ... Incompatible magic number passed in boot args(hd0)wd0diagcan't init serial console @%xinvalid geometrydos partition I/O errordisk label I/O errorno disk labeldisk label corruptedisa_alloc(): Help!isa_free(): Help!stray interrupt %d%s ; stopped loggingintr_alloc: bogus typeintr_establish: bogus irq or typeintr_establish: can't share %s with %sintr_disestablish: bogus irqisa_irqdispatch: %x dsrtc: cannot map I/O space : lithium cell is dead, RTC unreliablemii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_phy_setmedia: MASTER on wrong mediamiiautnsphyDP83840 10/100 PHY: %s, rev. %d qsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYexphy: 3Com internal media interface %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYukphy: Generic IEEE 802.3u media interface %s: OUI 0x%06x, model 0x%04x, rev. %d %s: no media present dev %d function %dpciprintpci_io_find: bad requestpci_mem_find: bad requestpci_mem_find: bad 64-bit requestmiscellaneousSCSIfloppyIPIethernettoken ringFDDIWorldFipPCMIG Multi ComputingXGAvideoaudiotelephonyflashhostMicroChannelNuBusRACEwaySemi-transparent PCIInfiniBandparallelmulti-port serialmodemGPIBsmartcard8237 DMA8254 timerRTCPCI Hot-Plugdigitizergame portgeneric386486PentiumAlphaPowerPCMIPSCo-processorFirewireACCESS.busSSAFiber ChannelIPMISERCOSCANbusIrDAConsumer IRRFbluetoothbroadband802.11a (5 GHz)802.11b (2.4 GHz)standardTVvoicedatanetwork/computingentertainmentDPIOTime and Frequencysynchronizationmanagementprehistoricmass storagenetworkdisplaymultimediacommunicationssystemdockserial buswirelessI2Osatellite commcryptoDASPundefinedOZ6832 CardBusOZ6836/OZ6860 CardBusOZ68[17]2 CardBusOZ6922 CardBusOZ6933 CardBusOZ69[17]2 CardBusOZ711M1 CardBusOZ711Mx CardBus Accelerator3c9853c9963CRDAG675 (Atheros AR5212)3CRPAG175 (Atheros AR5212)V.90 Modem3c9403c3393c3593c4503c555 100Base-TX3c5753CCFE575BT3CCFE575CT3c590 10Mbps3c595 100Base-TX3c595 100Base-T43c595 10Mbps-MII3CRSHPW796 802.11b3c556 100Base-TX3c556B 100Base-TX3CCFEM6563CCFEM656B56k Modem3CCFEM656C56k Global Modem3cSOHO-TX3crwe777a AirConnectGig3c900 10Base-T3c900 10Mbps-Combo3c900B 10Mbps3c900B 10Mbps-Combo3c900B 10Mbps-TPC3c900B 10Mbps-FL3c905 100Base-TX3c905 100Base-T43c905B 100Base-TX3c905B 100Base-T43c905B 10/100Mbps-Combo3c905B 100Base-FX3c905C 100Base-TX3c9201 100Base-TX3c920B-EMB-WNM3cSOHO 100B-TX3c980 100Base-TX3c980C 100Base-TX3cr9903cr990-TX3cr990-TX-953cr990-TX-973c990b-TX-M3cr990-FX3cr990SVR953cr990SVR973c990BSVRVoodooVoodoo2BansheeVoodoo3Voodoo5300SX500TXDeltaPermedia500MXPermedia 2Oxygen GVX1Permedia 3Escalade IDE RAIDFE2500PCM200TE100PC4800 WirelessPCI35x WLANPC4500 WirelessMPI-350 WirelessACCM 2188 VL-PCI2051 PCI2051 ISAATP850U/UFATP860ATP860-AATP865-AATP865-RAEC6710AEC6712UWAEC6712UAEC6712SAEC6710DAEC6715UWMPX 5030/5038EN2242EN1217rtl8139RhineIIAWA-100M1435 VL-PCIM1445 VL-PCIM1449 ISAM1451 PCIM1461 PCIM1489 PCIM1523 PCIM1523 ISAM1531 PCIM1533 ISAM1535 PCIM1543 ISAM1541 PCIM1621 PCIM1647 PCIM3309 MPEG AcceleratorM4803M5219 UDMA IDEM5229 UDMA IDEM5237 USBM5247 AGP/PCI-PCIM5243 AGP/PCI-PCIM5451 AudioM7101 Power MgmtAL981AN983AN985ADM8211 WLANAIC-7810AHA-2940AU/CNAHA-2930CUAIC-7850AIC-7855AIC-5900 ATMAIC-5905 ATMAPA-1480AIC-7860AHA-2940AUAIC-7870AHA-2940AHA-3940AHA-3985AHA-2944AIC-7880AHA-2940UAHA-3940UAHA-398XUAHA-2944UAHA-2940UWProAIC-6915AIC-7895AHA-2940U2 U2AHA-2930U2 U2AAA-131U2 U2AIC-7890/1 U2AIC-7892 U160AHA-29160 U160AHA-19160B U160AHA-3950U2B U2AHA-3950U2D U2AIC-7896/7 U2AHA-3960D U160AIC-7899BAIC-7899DAIC-7899FAIC-7899 U160AAC-2622ASR-2200SASR-2120SAAC-364AAC-3642Dell PERC 2/QCAIC-7901 U320AHA-29320A U320AHA-29320LP U320AIC-7901A U320AHA-29320 U320AHA-29320B U320AIC-7902 U320AIC-7902B U320AHA-39320 U320AHA-39320B U320AHA-39320A U320AHA-39320D U320AHA-39320DB U3201200A1200BABP-930/40UAABP-940UWASP-3940U2WASP-3940U3WWaikato Dag3.2Endace Dag3.5Endace Dag4.22GEEndace Dag4.23AT22AT24AcenicAcenic CopperBCM5700BCM5701AC1000AC1001AC9100AMD64 HyperTransportAMD64 Address MapAMD64 DRAM CfgAMD64 Misc Cfg79c970 PCnet-PCI79c978 PChome-PCI53c974 PCscsi-PCI79C974 PCnet-PCIElanSC520 PCI751 System751 PCI-PCI762 PCI762 PCI-PCI761 PCI761 PCI-PCI755 ISA755 IDE755 Power Mgmt755 USB756 ISA756 IDE756 Power Mgmt756 USB Host766 ISA766 IDE766 USB766 Power Mgmt766 USB OpenHCI768 ISA768 IDE768 Power Mgmt768 AC97768 Modem768 PCI-PCI768 USB8131 PCIX8131 PCIX IOAPIC8151 Sys Control8151 AGP8111 PCI-PCI8111 USBAMD8111 LPC8111 IDE8111 SMBus8111 ACPI8111 AC97MegaRAIDMegaRAID Series 428MegaRAID Series 434ADSP 21535 DSPAD1889 AudioSafeNet ADSP 2141Antares GigabitBanditGCOHareHeathrowPaddingtonUni-N EthUni-NUni-N AGPGMACKeylargoPangeaPangea USBPangea AGPPangea PCIUni-N2 AGPUni-N2 HostPangea FireWireUniNorth FirewireGMAC EthernetUni-N ATAUniNorth AGPUniNorth PCIIntrepid ATAIntrepidIntrepid USBARS106SARS0303D1000PV2000PV2000MT2000MIAX88140A/88141Radeon 9600 ProRadeon 9600Radeon 9600 XTMach32Radeon 9600 Pro SecRadeon 9600 XT 2ndRadeon 8500 BBRadeon IGP 320MMobility M6Mach64 CTMach64 CXMach64 ETRage ProMach64 GDMach64 GIMach64 GLMach64 GMMach64 GNMach64 GOMach64 GPMach64 GQRage XLMach64 GSMach64 GTMach64 GUMach64 GVMach64 GWMach64 GXMach64 GYMach64 GZRadeon 9000Radeon 9000 SecMach64 LBMach64 LDRage128 LEMobility M3Mach64 LGMach64 LIMobility 1Mach64 LNMach64 LPMach64 LQRage P/MMach64 LSRadeon Mobility M7 LWRadeon Mobility M6 LYRadeon Mobility M6 LZRadeon Mobility M9 LfRage 128 Mobility MFRage 128 Mobility MLRadeon 9500/9700Radeon 9800 XTRadeon Mobility M10 NPRadeon 9500/9700 SecRage 128 Pro PDRage FuryRage 128 PKAIW RadeonRadeon QERadeon QFRadeon QGRadeon 8500 QLRadeon 9100 QMRadeon 8500 QNRadeon 8500 QORadeon 7500 QWRadeon VE QYRadeon VE QZRadeon 8500 QlRage 128 GLRage MagnumRage 128 RGRage 128 RKRage 128 VRRage 128 SHRage 128 SKRage 128 SLRage 128 SMRage 128Rage 128 Pro TFRage 128 Pro TLRage 128 Pro TRMach64 VTMach64 VUMach64 VVRadeon IGP 9100 HostRadeon Mobility IGP 9100Radeon IGP 9100 AGPRadeon 9200 2ndRadeon 9200Radeon 9200 SE 2ndRadeon X300Radeon X300 SecRadeon Mobility 9200Radeon Mobility 9200 (M9+)Radeon 9200 SERS100 PCIRS200 PCIRS100 AGPRS200 AGPS5933 PCI MatchmakerMyrinet LANaiAR5210AR5211AR5212AR5210 (Early)AR5212 (IBM MiniPCI)AR5210 (no eeprom)AR5212 (no eeprom)AR5211 (no eeprom)AR5212 (emulation board)AR5211RefIDE-2015PLVortex 1Vortex 2Vortex AdvantageAVL2301AVG2302ALG2301ALG2302ALS4000LP-PCI 4 SerialFritz ISDNFritz v2.0 ISDNBRI ISDNPRI T1 ISDNF5D6001F5D6020V3F5D6000VME 617VME 270655015601BCM5702BCM5703BCM5704CBCM5704S_ALTBCM5702FEBCM5705BCM5705KBCM5720BCM5721BCM5705MBCM5705M_ALTBCM5705FBCM5750BCM5750MBCM5751MBCM5751FBCM5751BCM5782BCM5788BCM5789BCM5702XBCM5703XBCM5704SBCM5702_ALTBCM5703_ALTBCM4401B0BCM5901BCM5901A2BCM4306BCM44015801580258055820582158225823BT848BT849BT878BT879BT878 AudioBT879 AudioBt8474 HDLCMultiMaster NCMultiMasterFlashPointGPPCINitrox XLCinemaster C 3.0 DVD Decoder643106554565548655506555465555685546900069030CL-GD7548CL-GD5430CL-GD5434-4CL-GD5434-8CL-GD5436CL-GD5446CL-GD5480CL-GD5462CL-GD5464CL-GD5465CL-PD6729CL-PD6832 CardBusCL-PD6833 CardBusCL-GD7542CL-GD7543CL-GD7541CS4610 SoundFusion AudioCS4615CS4280/46xx CrystalClear AudioCS4281 CrystalClear AudioPCI0640PCI0642PCI0643PCI0646PCI0647PCI0648PCI0649PCI0650AUSB0670USB0673PCI0680SiI3112 SATASiI3114 SATASiI3512 SATAAAR-1210SAGigaCardEX110TXTriflex PCIQVisionQVision 1280/pSmart Array 5300Smart Array 5iSmart Array 532Smart Array 5312Smart Array 641Smart Array 642Smart Array 6400Smart Array 6400 EMNetelligent ASMCPCI HotplugUSB OpenHostSMART2P RAIDISAPnPNetelligent 10/100 TXNetelligent IDENetelligent 10 TIntegrated NetFlex 3/PDP Netelligent 10/100 TXProLiant Netelligent 10/100 TXEmbedded Netelligent 10/100 TXNetelligent 10 T/2 PCISmart Array 5300 rev.2Smart Array 5i/532 rev.2NetFlex 3/PNetFlex 3/PBRL100-ATX 10/100PMAC 9871356k WinmodemSoftK56 PCIHSF 56k HSFi82C599 VLBCY82C693U ISAFEther CB-TXD 10/100FEther II CB-TXD 10/100CG-LAPCIGTC-Bus II-PCISoundBlaster LiveSoundBlaster AudigySoundBlaster Audigy LSPCI Gameport JoystickSoundBlaster Audigy Digital InputEctiva 1938Cyclom-Y below 1MCyclom-YCyclom-4Y below 1MCyclom-4YCyclom-8Y below 1MCyclom-8YCyclom-Z below 1MCyclom-ZIQ80310GXm PCIGXm ISACx5530 SouthCx5530 SMI/ACPICx5530 IDECx5530 XpressAUDIOCx5530 VideoDM9100DM9102DM900921050 PCI-PCI2104021030Zephyr NV-RAMKZPSA21140TGA2DEFPA21041DGLPB (OPPO)ZLXP-L2 (Pixelvision)21142/3Farallon PN9000SX21052 PCI-PCI21150 PCI-PCI21150-BC PCI-PCI21152 PCI-PCI21153 PCI-PCI21154 PCI-PCICompaq SMART RAID 42xxSWXCR RAIDPERC 2/SiPERC 3/DiPERC 3/SiPERC 4/Di i960PERC 4/Di VerdePERC 4e/Di8139Viper/PCI550TX530TX+DFE-690TXDDWL-610DGE-550TDGE-560TDGE-530TSmartCache/RaidSmartRAID (I2O)SmartRAID 2005SMemory ControlPCI-SCIDMX3194UIS64PH ISDN155P-MF1 ATM (FPGA)155P-MF1 ATM (ASIC)25SS-3010 ATM (ASIC)SpeedStream 1023QuickStep 1000 ISDNLight Pulse FibreChannelLight Pulse 8000Endace Dag3.6DEndace Dag4.23GECB-1410 CardBusAudioPCI97AudioPCICT5880ES366H Fax/Modem (early)Maestro IISOLO-1 AudioDriveMaestro 2EES1989ES1989 ModemMaestro 3ES1983 ModemMaestro 3 Audio AcceleratorES366H Fax/ModemES2838/2839 SuperLink ModemES2898 ModemRoadRunner HIPPIRoadRunner Gig-EFreedom GBusWL11000PATM PCA-200ATM PCA-200e801 SoundTMC-18C30 (36C70)GL24110P03GL24110PGL24110P02PR103WinTVPN672TX 10/100Visualize EGVisualize FX6Visualize FX4Visualize FX2Tach TL FibreChannelTach XL2 FibreChannelJ2585AJ2585BDiva Serial MultiportElroy Ropes-PCIVisualize FXeTopTools Communications PortNetRaid-4MNetServer SmartIRQ82557B 10/100 NICPluto MIOzx1 IOCMercury Ropes-PCIQuickSilver Ropes-PCI77516500781179517814/7851/785480658165815479567955/7954MCACPU - Alta LiteCPU - Alta MPISA w/PnPCPUAuto LANStreamerGXT-150P82G267582351 PCI-PCIServeRAIDMiami/PCIOlympici82557B 10/100FireGL2PCIX-PCIX77201/77211 ATM (NICStAR)WDT 50x Watchdog TimerINIC-850 (A100UW)INIC-1060 (A100U2W)INIC-940INIC-941INIC-9508849EES ISA2114580303 IOP80312 I/O CompanionPCIE-PCIEIOP331 Channel 0IOP331 Channel 182375EB EISA82424ZX Cache/DRAM82378IB ISA82426EX ISA82434LX/NX PCI/Cache/DRAMGDT RAIDi960 RP PCI-PCIi960 RM PCI-PCIi960 RN PCI-PCIPRO/1000 (82542)PRO/1000F (82543GC)PRO/1000T (82543GC)PRO/1000XT (82544EI)PRO/1000XF (82544EI)PRO/1000T (82544GC)PRO/1000XT (82544GC)PRO/1000MT (82540EM)PRO/1000MT (82545EM)PRO/1000MT DP (82546EB)PRO/1000MF (82545EM)PRO/1000MF DP (82546EB)PRO/1000MT (82541EI)PRO/1000MT Mobile (82540EM)PRO/1000MT (82540EP)PRO/1000MT Mobile (82541EP)PRO/1000CT (82547EI)PRO/1000CT Mobile (82547EI)PRO/1000MT QP (82546EB)PRO/1000MT Mobile (82540EP)PRO/1000MT (82545GM)PRO/1000MF (82545GM)PRO/1000MB (82545GM)PRO/10082559PRO/100 VEPRO/100 VM82562EH HomePNAV.92 ModemPRO/2100 3BPRO/XGBPRO/100 MPRO/100 VE (82562EZ)PRO/1000MT Mobile (82541EI)PRO/1000MB DP (82546EB)PRO/1000GTPRO/1000MT DP (82546GB)82815 Hub82815 AGP82815 Graphics82806AA PCI64 APIC82559ER82092AA IDESAA7116EE Pro 10 PCIEE Pro 100EE Pro 100 Smart8255782437FX82371FB ISA82371FB IDE82371 ISA and IDE82437 PCI/Cache/DRAM82441FX82380AB Mobile ISA82380FB Mobile PCI-PCI82439HX82806AA PCI6482870P2 P64H2 PCI-PCIP64H2 IOxAPICP64H2 Hot Plug80960RP ATU82840 Host82840 AGP82840 PCI82845 Host82845 AGP82801AA LPC82801AA IDE82801AA USB82801AA SMBus82801AA AC9782801AA Modem82801AA Hub-to-PCI82801AB LPC82801AB IDE82801AB USB82801AB SMBus82801AB AC9782801AB Modem82801AB Hub-to-PCI82801BA LPC82801BA USB82801BA SMBus82801BA AC9782801BA Modem82801BAM Hub-to-PCI8256282801BAM IDE82801BA IDE82801BAM LPC82801BA AGP82801E LAN82801CA LPC82801CA/CAM USB82801CA/CAM SMBus82801CA/CAM AC9782801CA/CAM Modem82801CAM IDE82801CA IDE82801CAM LPC82801DB LPC82801DB USB82801DB SMBus82801DB AC9782801DB Modem82801DBM IDE82801DB IDE82801DBM LPC82801EB/ER LPC82801EB SATA82801EB/ER USB82801EB/ER SMBus82801EB/ER AC9782801EB/ER Modem82801EB/ER IDE82801ER SATA82820 MCH82820 AGP82850 Host82860 Host82850/82860 AGP82860 PCI-PCIE7500 MCH HostE7500 DRAME7500 MCH HI_B vppb 1E7500 MCH HI_B vppb 2E7500 MCH HI_C vppb 1E7500 MCH HI_C vppb 2E7500 MCH HI_D vppb 1E7500 MCH HI_D vppb 2E7501 MCH HostE7505 MCH HostE7505 MCH AGPE7505 MCH PCI-PCI82845G/GL82845G/GL/GV/GE/PE AGP82845G/GL Video82865G/PE/P CPU-I/0-182865G/PE/P CPU-AGP82865G Video82865G/PE/P CPU-CSA82865G/PE/P CPU-I/0-282875P Host82875P AGP82875P PCI-CSA915G/P/GV Host915G/P/GV PCIE925X MCH Host925X PCIEE7221 MCH HostE7221 PCIEE7221 Video6300ESB LPC6300ESB IDE6300ESB SATA6300ESB SMBus6300ESB USB5300ESB USB6300ESB WDT6300ESB APIC6300ESB PCIX82801FB LPC82801FB SATA82801FR SATA82801FB USB82801FB PCIE82801FB SMBus82801FB AC9782801FB IDERCU32 I2O RAID31244 SATA82855PE Hub82855PE AGP82830MP CPU-I/O-182830MP CPU-AGP82830MP Integrated Video82830MP CPU-I/O-282852GM Hub-PCI82852/82855 AGP82852GM AGP82852GM Memory82852GM ConfigurationE7710 SMCHE7710 MCH ERRE7710 MCH DMAE7710 MCH PCIEE7710 WMCHPRO/2200BG 3BPRO/2225BGPRO/2915ABG 3Bi960 RD PCI-PCIPRO 100 Server82371SB ISA82371SB IDE82371SB USB82437VX82439TX System82371AB PIIX4 ISA82371AB IDE82371AB USB82371AB Power Mgmt8281082810 Graphics82810-DC10082810-DC100 Graphics82810E82810E Graphics82443LX AGP82443BX AGP82443BX82440MX Host82440MX AC9782440MX Modem82440MX ISA82440MX IDE82440MX USB82440MX Power Mgmt82440BX AGP82443GX82740 AGP82450KX/GX82450KX/GX Memory82451NX Mem & IO82454NX PXB82802AC Firmware Hub 8Mbit82802AB Firmware Hub 4MbitI2O RAID PCI-PCIRCU21 I2O RAIDRCUxx I2O RAIDRCU31 I2O RAIDRCU31L I2O RAIDS21152BB PCI-PCIS21154AE/BE PCI-PCIPowerstorm 4D50T5526 FibreChannelPRISM3PRISM2.5AEONGV-BCTV3AGX016ITT3204 MPEG DecoderIT8212FIT8330GKTIHSSIDS3SSIDS1Appian LiteDual SerialQuad SerialParallelDual ParallelDual Parallel BS3 805Leadtek WinFast TV 2000LXT1001EG1032EG1064PNICPNIC-II8031K56flex DSVD LTMODEMLTMODEMVenus ModemUSB 2-portUSB QuadraBusFW322 1394LS242 DVD DecoderPMAC 98715PMAC 98727MX86250Smart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 CardbusPresto PCISmart 100/16/4 PCI-HS RingnodeSmart 100/16/4 PCI Ringnode16/4 CardBus Mk2Collage 25 ATMCollage 155 ATMi740 PCISKv2YukonYukon 8035Yukon 8036Yukon 8052Yukon 8050Yukon 8053Belkin F5D5005MGA PX2085 (Atlas)MGA Millenium 2064W (Storm)MGA 1064SG 220MHzMGA Millennium II 2164WMGA Millennium II 2164WA-B AGPMGA G200 PCIMGA G200 AGPMGA G400/G450 AGPMGA ImpressionMGA G100 PCIMGA G100 AGPMGA 1064SGMGA G400 Twin HeadMGA G550 AGPMGA Millennium G200 SDMGA Produktiva G100 SDMGA Mystique G200 SDMGA Millennium G200 SGMGA Marvel G200 SDMN-120 10/100MN-130 10/100Powerstorm 4D30TGUI AccelMPC105 PCIMPC106 PCISM56Raven PCICP-114C104HCP-104ULC168HDMA4 serialDAC960P V2 RAIDDAC960P V3 RAIDDAC960P V4 RAIDDAC960P V5 RAIDAcceleRAIDeXtremeRAIDMTD800 10/100MTD803 10/100MTD891 10/100/1000MV1000NCP130NCP130 Rev A2DP83810 10/100PC87415 IDE87560 Legacy I/ODP83815 10/100DP83820 1/10/100/1000SCx200 ISASCx200 SMISCx200 IDESCx200 AUDIOSCx200 VIDEOSCx200 X-BUSSC1100 ISASC1100 SMI/ACPISC1100 X-BusNS87410PowerVR PCX2I/OVersa MaestroVersa Va26D MaestroMagicgraph NM2070Magicgraph 128VMagicgraph 128ZVMagicgraph NM2160Magicgraph NM2200Magicgraph NM2360MagicMedia 256AV+MagicMedia 256XL+MagicMedia 256AVMagicMedia 256ZXMA301GA620GA620T1P2S1P4SCMI8338A AudioCMI8338B AudioCMI8738/C3DX AudioCMI8738B AudioHSP56 AMRNSP2KNetVin 5000Universe VME53c81053c82053c82553c81553c810AP53c86053c1510D53c89653c89553c88553c87553c151053c895A53c1010-3353c1010-6653c103053c875JFC909FC909AFC929FC919Packet Engines G-NICFNW-3603-TX 10/100FNW-3800-TX 10/100NX82C501 PCINDR4600 PCIBS21 10/100E-mobility WirelessImagine-128Imagine-128 IIImagine-128 T2RImagine-128 T2R4NV1DAC64Riva TNTRiva TNT2Riva TNT2 UltraVantaMCP04 LANCK804 LANnForce2 ISAnForce2 SMBusnForce2 IDEnForce2 LANnForce2 USBnForce2 AC-97 AudionForce2 AudionForce2 PCI-PCInForce2 FireWirenForce2 400 ISAnForce2 400 SMBusnForce2 400 IDEnForce3 LANnForce2 400 USBnForce2 400 USB2nForce2 400 PCI-PCInForce2 400 SATAAladdin TNT2nForce3 ISAnForce3 PCI HostnForce3 PCI-PCInForce3 SMBusnForce3 IDEnForce3 USBnForce3 AC-97 AudionForce3 250 ISAnForce3 250 PCI HostnForce3 250 AGPnForce3 250 SATAnForce3 250 SMBusnForce3 250 IDEnForce3 250 USBnForce3 250 USB2nForce3 250 AC-97 AudionForce3 250 PCI-PCIQuadro FX 330GeForce256GeForce256 DDRQuadroGeForce2 MXGeForce2 MX 100GeForce2 GoQuadro2 MXRGeForce2 GTSGeForce2 TiGeForce2 UltraQuadro2 ProGeForce4 MX 460GeForce4 MX 440GeForce4 MX 420GeForce4 440 GoGeForce4 420 GoGeForce4 420 Go 32MQuadro4 500XGLGeForce4 440 Go 64MQuadro4 200/400NVSQuadro4 550XGLQuadro4 GoGLGeForce4 MX 440 AGP 8xGeForce4 MX 440SE AGP 8xGeForce 4 MX 420 AGP 8xGeForce4 MX 4000Quadro4 580 XGLQuadro4 NVSQuadro4 380 XGLGeForce2 Crush11nForce PCI HostnForce 220 DDRnForce 420 DDRnForce 220/420nForce APUnForce AC-97 AudionForce ISAnForce SMBusnForce AGPnForce PCI-PCInForce IDEnForce USBnForce LANnForce2 PCInForce2 AGPnForce2GeForce4 MX - nForce GPUGeForce3GeForce3 Ti 200GeForce3 Ti 500Quadro DCCGeForce4 Ti 4600GeForce4 Ti 4400GeForce4 Ti 4200Quadro4 900 XGLQuadro4 750 XGLQuadro4 700 XGLGeForce4 Ti 4200 GoGeForce FX 5600GeForce FX 5200GeForce FX Go 5200GeForce FX 5700LEOTI107OC2183OC2325OC232682C092G82C557 Host82C558 ISA82C568 IDE82D568 IDE82C621 IDE82C70082C70182C82282C861VScom 010LVScom 100LVScom 110LVScom 200LVScom 210LVScom 400LVScom 800LVScom x10HVScom 100HVScom 200HVScom 200HV2VScom 400H/800HVScom 800HVScom 011HExsys EX-41098PMC/GNIC2RZ1000HSP MicroModem 56PCIHB5I/O BridgePCIHB7CNB20HE HostCNB20LE HostCIOB30CMIC_HE HostCMIC_LE HostCNB20-HECMIC_SL HostCIOBX2CIOB-EROSB4 SouthBridgeCSB5 SouthBridgeCSB6 PCIOSB4 IDECSB5 IDECSB6 IDEOSB4/CSB5 USBCSB6 USBCSB5 PCICSB6 LPCPCI/ISASAA7130PT80C826PT86C521PT86C523PC87550PT86C523_2PCC-ISESES1849I/O 9050I/O 9080DC5030PDC20246PDC20262PDC20263PDC20265PDC20267PDC20268PDC20268RPDC20269PDC20271PDC20275PDC20276PDC20277PDC20318PDC20319PDC20371PDC20375PDC20376PDC20377PDC20378PDC20379PDC20617PDC20618PDC20619PDC20620PDC20621ISP1020ISP1022ISP1080ISP1240ISP1280ISP12160ISP10160ISP2100ISP2200ISP230085008580RT2460ART2560802981298138816981805C465 CardBus5C466 CardBus5C475 CardBus5C476 CardBus5C477 CardBus5C478 CardBus5C521 Firewire5C551 Firewire5C552 FirewireRS56/SP-PCI11P1 ModemViRGETrio32Trio32/64Aurora64V+Trio64UV+868ViRGE VX86C92886C864-086C864-186C864-286C864-386C964-086C964-186C964-286C964-386C968-086C968-186C968-286C968-3Trio64V2/DXPlatoTrio3D AGPViRGE DX/GXViRGE GX2Trio3 DX2Savage 3DSavage 3DMSavage 4ProSavage PM133ViRGE MXViRGE MXPSavage/MX-MVSavage/MXSavage/IX-MVSavage/IXSuperSavageTwisterTwister-KProSavage DDRSonicVibesSafeXcelMagicLAN SWL-2210P984x GESK-9821 v2.0SK-9D21SK-9SxxSK-9ExxTigonSTG 2000XSTG 1764Kyro-IISTG 1764X64GXDVDmagic-PRO86C201 AGP86C202 VGA648FX AGP86C20585C503 System5595 System85C503 ISA5597/5598 VGA6215300/305/630 VGA85C50185C496SiS596530 PCI540 PCI550 PCI85C601 EIDE620 PCI630 PCI633 PCI635 PCI640 PCI645 PCI646 PCI648 PCI650 PCI651 PCI652 PCI655 PCI658 PCI730 PCI733 PCI735 PCI740 PCI741 PCI745 PCI746 PCI748 PCI750 PCI751 PCI752 PCI755 PCI760 PCI900 10/100BaseTX961 PCI962 PCI963 PCI964 PCI551155125513 EIDE5571 PCI558155825591 PCI55965597/5598 Host620462056300530 VGA650 VGA6326 VGA6330 VGA5597/5598 USB7002 USB7007 FireWire7012 AC977013 Modem7016 10/100BaseTX7018 AudioFDC 37C665FDC 37C92283C170 (EPIC/100)LynxEMLynxEM+Lynx3DMLynxELynxE+Lynx3D910Pirahna 2-portTulip, power, switch extenderFPGA I-Bus Tracer for MBDSZB6120CXD1947A FireWireCXD3222 FireWireMemory Stick SlotVelocity128PCIO Ebus2HMEPCIO Ebus2 (US III)ERI EtherGEMSimba PCI-PCICrypto 5821Crypto 1KPsycho PCImicroSPARC IIep PCIUltraSPARC IIi PCIUltraSPARC IIe PCICassini EtherST201ST202140XX4018ASurecom NE-344S2PSpectrum24 LA41X382C10182C10382C10582C565 ISATamarack TC9021 GigETamarack TC9021 GigE (alt ID)DC-290(M)DC-690CDC-3x5UTerratec TV+Terratec TValueTerratec TValue RadioTLAN3DLabs Permedia3DLabs Permedia 2TSB12LV21 FireWireTSB12LV22 FireWirePCI4450 FireWirePCI4410 FireWireTSB12LV23 FireWireTSB12LV26 FireWireTSB43AA22 FireWireTSB43AB22 FireWireTSB43AB23 FireWireTSB43AB21 FireWirePCI4451 FireWirePCI4510 FireWirePCI4520 FireWirePCI7(4-6)10 FireWireACX100AACX100BACX111PCI1130 CardBusPCI1031 PCMCIAPCI1131 CardBusPCI1250 CardBusPCI1220 CardBusPCI1221 CardBusPCI1210 CardBusPCI1450 CardBusPCI1225 CardBusPCI1251 CardBusPCI1211 CardBusPCI1251B CardBusPCI2030 PCI-PCIPCI2031 PCI-PCIPCI2250 PCI-PCIPCI2050 PCI-PCIPCI4450 CardBusPCI4410 CardBusPCI4451 CardBusPCI4510 CardBusPCI4520 CardBusPCI7510 CardBusPCI7610 CardBusPCI7410 CardBusPCI7610 CardBus (Smart Card mode)PCI7[46]10 CardBus (SD/MMC mode)PCI7[46]10 CardBus (Memory stick mode)PCI1410 CardBusPCI1420 CardBusPCI1451 CardBusPCI1421 CardBusPCI1620 CardBusPCI1520 CardBusPCI1510 CardBusPCI1530 CardBusPCI1515 CardBusPCI2040 DSPPCI interface5634PCV SurfRiderR4x00TC35856F ATM (Meteor)R4x00 PCIToPIC95 CardBus-PCIToPIC95B CardBusToPIC97 CardBusToPIC100 CardBusFast Infrared Type OSD ControllerVirtual NorthbridgeMem1Mem24DWAVE DX4DWAVE NXCyberBlade i7CyberBlade i7 AGPCyberBlade i1CyberBlade i1 AGPCyberBlade Ai1CyberBlade Ai1 AGPCyberBlade XP/Ai1TGUI 9320TGUI 9350TGUI 9360TGUI 9388CYBER 9397CYBER 9397DVDTGUI 9420TGUI 9440CYBER 9525TGUI 9660TGUI 9680TGUI 96823DImage 97503DImage 9850Blade 3DCyberBlade XPHPT343/345 IDEHPT36x/37x IDEHPT372A IDEHPT302 IDEHPT371 IDEHPT374 IDEPyramid3D TR25202ET4000w32p rev AET4000w32p rev BET4000w32p rev CET4000w32p rev DET6000/ET6100ET6300UM82C881 486UM82C886 ISAUM8673F EIDEUM8881 HB4 486 PCIUM82C891UM886AUM8886BFUM8710UM8886UM8881F HostUM8886F ISAUM8886AUM8891AUM9017FUM8886NUM8891NUS2013CP5610V961PBC i960 PCIV292PBC AMD290x0 PCIV960PBC i960 PCIV96DPC i960 (Dual) PCIVT8363 HostVT8371 HostVT8501VT82C505VT82C561VT82C571 IDEVT82C576 3VVT82C585 ISAVT82C586 ISAVT82C595 PCIVT82C596A ISAVT82C597 PCIVT82C598 PCIVT8601 PCIVT8605 PCIVT82C686 ISAVT82C691 PCIVT82C693 PCIVT86C926 AmazonVT82C570M PCIVT82C570M ISAVT82C416 IDEVT82C1595 PCIVT83C572 USBVT82C586 Power MgmtRhine/RhineIIVT6306 FireWireVT82C596 Power MgmtVT82C596B PMVT6105M RhineIIIVT82C686 SMBusVT82C686 AC97VT8233 AC97RhineII-2VT82C686 ModemVT8366 ISAVT8633 PCIVT8366 PCIVT8653 PCIVT6202 USBVT6105 RhineIIIS3 Unichrome PRO IGPVT8361 PCIVT8375 PCIVT612xCLE266VT8623 PCIVT8233 ISAVT8751 PCIVT8237 SATAVT8235 ISAK8HTB HostVT8377 PCIVT8378 PCIVT8237 ISAVT8378 VGAVT8231 ISAVT8231 PMGVT8363 AGPVT8371 PCI-PCIVT8501 AGPVT82C597 AGPVT82C598 AGPVT82C601 AGPVT8605 AGPVT8633 AGPVT8366 AGPVT8361 AGPVT8235 AGPK8HTB AGPVT8377 AGPGDT6000/6020/6050GDT6000B/6010GDT6110/6510GDT6120/6520GDT6530GDT6550GDT6x17GDT6x27GDT6537GDT6557GDT6x15GDT6x25GDT6535GDT6555GDT6x17RPGDT6x27RPGDT6537RPGDT6557RPGDT6x11RPGDT6x21RPGDT6x17RP1GDT6x27RP1GDT6537RP1GDT6557RP1GDT6x11RP1GDT6x21RP1GDT6x18RDGDT6x28RDGDT6x38RDGDT6x58RDGDT6x17RP2GDT6x27RP2GDT6537RP2GDT6557RP2GDT6x11RP2GDT6x21RP2GDT6513RSGDT6523RSGDT6518RSGDT6x28RSGDT6x38RSGDT6x58RSGDT6x33RSGDT6x43RSGDT6x53RSGDT6x63RSGDT7x13RNGDT7x23RNGDT7x18RNGDT7x28RNGDT7x38RNGDT7x58RNGDT7x43RNGDT7x53RNGDT7x63RNGDT4x13RZGDT4x23RZGDT8x13RZGDT8x23RZGDT8x33RZGDT8x43RZGDT8x53RZGDT8x63RZGDT6x19RDGDT6x29RDGDT7x19RNGDT7x29RNGDT8x22RZICP82C592 CPU82C593 ISA82C594 Wildcat82C596/597 Wildcat ISA82C54182C54382C53282C53482C53582C14782C97582C925Virtual SVGAVirtual SVGA IIP9000P9100WD33C193AWD33C196AWD33C197AWD7193WD7197WD33C296AWD34C296WD9610W83769FW89C840F 10/100Linksys EtherPCI IIW83C553F ISAW83C553FW89C940FW6692 ISDNLinksys EtherPCIX3201-3X3201-3 (21143)CBEM56G Modem724734738737740740C724F7447541221PCI-ST32Genie TV/FMDVDMartin-MariettaHauppauge Computer WorksDynalinkCompaqSymbios LogicATIULSI SystemsVLSIAvance LogicNSTseng LabsWeitekDECCirrus LogicWestern DigitalAMIAMDTridentAcerDellSiemens Nixdorf AGMatroxChips and TechnologiesToshibaNECFuture DomainSISHewlett-PackardPC TechnologyAsustekDPTOptiElsaSGS ThomsonBusLogicTexas InstrumentsSonyOak TechnologyWinbondMotorolaPromiseNumber 9UMCI. T. T.PicopowerMylexAppleYamahaNexGen MicrosystemsQLogicCyrixLeadTek ResearchInterphaseContaq MicrosystemsBit3OlicomSunIntergraphDiamond MultimediaCMD TechnologyQuantum DesignsBrooktreeSilicon GraphicsACC MicroelectronicsSymphony LabsSTB SystemsPLXMadge Networks3ComSMCAcer LabsMitsubishi ElectronicsSurecomNeomagicMentor ARCAdvansysMolexMacronixEvans & SutherlandNvidiaEmulexIntegrated Micro SolutionsTekram (1st ID)NewbridgeApplied Micro CircuitsRealtekNKKIO Data Device IncInitioCreative LabsHighPointSigma DesignsVIACogent DataSiemensAcctonVortexEfficent NetworksIDTFORE SystemsPhilipsZiatechCycloneAlliance SemiconductorSchneider & KochMutechXircomServerWorksRicohD-Link SystemsCorrollaryAcardZeinetOmega MicroMarvellLite-OnV3 SemiconductorPinnacle SystemsAT&T/LucentDolphinMesa Ridge (MAGMA)Analog DevicesZoranPijnenburgCompexCycladesEssential CommunicationsO2 Micro3DFX InteractiveAdvanced Telecommunications ModulesC-CubeAVMCoregaASIXIntersilNortel NetworksSilicon MotionEnsoniqTransmetaRockwellDavicomITExpressPlatformLuxSonorTriTech MicroelectronicsAlteonUS RoboticsNVidia/SGS-ThomsonAurealADMtekPacket EnginesForte MediaSIIGDTC TechPCTELCNetLAN Media CorpNetgearMoxaLevel 1Hifn3wareAbocomSundanceC-Media ElectronicsLavaSunixMicrosoftOxfordTamarack MicroelectronicsAskeyAvermediaAironetAvlabInvertexBroadcomPlanexConexantMyson CenturyTopic/SmartLinkENEAralion Inc.TerraTec Electronic GmbhSymbolSybaBluesteel NetworksVMwareNational Datacomm CorpZoltrix Intl Ltd.EumitcomNetSecSamsungAtherosGlobal SunSafeNetLinksysNetoctaveAltimaAntares MicrosystemsCaviumBelkinHawking TechnologyLanergyRalinkTekramHint3D LabsAddtronIndustrial Computer SourceNetVinGemtekS3c't MagazinIntelAdaptecAtronicsNetMosTigerJet NetworkEndaceBelkin ComponentsARC LogicINVALID VENDOR ID"%s %s"unknown class 0x%02x, subclass 0x%02xclass %s subclass %sclass %s unknown subclass 0x%02x, rev 0x%02x) rev 0x%02xvendor "%s", unknown product 0x%04x%svendor 0x%04x product 0x%04xunknown cy82c693_init: bus_space_map failed (%d)cy82c693_initcy82c693_readcy82c693_write%s: External SRAM, %s access%s, %dbytes/SCB : unable to map registers %s: couldn't map interrupt %s: Using left over BIOS settings : couldn't establish interrupt%s: Enabling 39Bit Addressing %s: unable to allocate bus-specific data fast, parity checking enabledslow%s: PCI error Interrupt at seqaddr = 0x%x %s: Latched PCIERR interrupt with no status bits set %s: Data Parity Error has been reported via PERR# %s: Signaled a Target Abort %s: Received a Target Abort %s: Received a Master Abort %s: Signal System Error Detected %s: Data Parity Error Detected during address or write data phase RAID functionality unsupported adapter at unexpected slot %d unable to map to a channel %s: unable to map device registers %s: couldn't map interrupt %s: couldn't establish interruptadv_pci_attach: adv_init failedAscInitFromEEPAscIsrQDone: completed scsiq with unknown statusAscIsrQDone: Attempting to free more queues than are activeAscIsrQDone: Corrupted SG list encounteredAscExeScsiQueue: Queue with QC_SG_HEAD set but %d segs.AscExeScsiQueue: Queue with too many segs.AscResetDeviceQUANTUM XP343011071NEC YAMAHACDR400CD-ROM DRIVE TDC 36HP %s%d: %s%s pass %d.%d%s address %s 21040 [10Mb/s]21041 [10Mb/s]21140 [10-100Mb/s]21140A [10-100Mb/s]21142 [10-100Mb/s]21143 [10-100Mb/s]82C168 [10-100Mb/s]parity errormaster aborttarget abortreserved #3reserved #4reserved #5reserved #6reserved #7transmit process stoppedtransmit jabber timeouttransmit underflowreceive underflowreceive process stoppedreceive watchdog timeoutlink failureDEC DE500DE450ZNYX ZX3XX SMC 9332DST 9334BDT 9332BDT 8432Cogent EM100TX EM440TX EM100FX ACCTON EN1207 EN1203 EN1207TX Asante tulip_read_macaddrframe too longalignment errorbad crc%s%d: abnormal interrupt:tulip_print_abnormal_interrupt (switching to store-and-forward mode) (raising TX threshold to %s)%s%d: system error: %s tulip_txput: different mbuf dequeued!tulip_if_start: txput failed! tulip_if_start_one: txput failed! %s%d: transmission timeout %s%d: %d system errors: last was %s (invalid EESPROM checksum): not configured; limit of %d reached or exceeded de%d: not configured; 21140 pass 1.1 required (%d.%d found) , couldn't map interrupt , couldn't establish interrupt: %s%s: warning: couldn't establish shutdown hook : can't read ENET ROM (why=%d) (%s%d: %s%s pass %d.%d address unknown: unable to map device registers : not configured; 21040 pass 2.0 required (%d.%d found) : broken match/attach! : couldn't map interrupt , using %dK of on-board RAM, can't map on-board RAMpciide %s: device disabled %s: couldn't map %s cmd regs %s: couldn't map %s ctl regs %s: couldn't map native-PCI interrupt unknown interrupt%s: using %s for native-PCI interrupt %s: unable to subregion %s ctl regs %s: couldn't establish native-PCI interrupt, (unsupported maptype 0x%x), unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers)%s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s:%d: unable to load xfer DMA map fordrive %d, error=%d %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x %s:%d:%d: bus-master DMA error: status=0x%x channel 0channel 1%s: %s cannot allocate memory for command queue%s: %s disabled (no drives) %s: no compatibility interrupt for use by %s configuredwiredcompatibilitynative-PCI, %s %s to %s: DMA%s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers not responding; disabled or no drives?other hardware responding at addresses%s: %s ignored (%s) , (partial support) (unsupported): no DMA%s: %s ignored (disabled) %s:%d:%d: multi-word DMA disabled due to chip revision : ATA33: ATA66: ATA100: ATA133 %s: bus-master DMA support present%s: %s %s to %s mode %s %s: can't allocate memory for command queue: unable to map BA5 register space %s: port %d: device connected, but communication not established %s: port %d: unknown SStatus: 0x%08x %s: port %d: device present, speed: 3.0Gb/s, speed: 1.5Gb/s%s: port %d: PHY offline : can't subregion offset %lu size %luport 0port 1port 2port 3%s %s channel: can't allocate memory for command queue%s: couldn't subregion %s cmd base %s: couldn't subregion %s ctl base %s: couldn't subregion %s channel cmd regs : unexpected PCI function %d , %s %s to native-PCI compatibility : cannot allocate memory for command queue , (unable to map ctl registers)540620630630S633635645645DX651652655658730733735741745746748752755962963: 5597/5598unknown SiS IDE type %d %s:%d: error intr %s:%d: bogus intr %s: unexpected PCI function %d %s: no known timing values %s:%d: bogus intr (reg 0x%x) ppb%s: not configured by system firmware pci at %svr%s: Using force reset command. : failed to enable I/O ports : failed to find i/o space : failed map i/o space %s: can't load dma map %s: can't create dma map %s: can't map dma buffers (%d bytes) %s: can't alloc list : could not establish interrupt%s: rx error (%02x): rx buffer error system bus error received runt packet received giant packet FIFO overflow frame alignment error crc error%s: rx shutdown error! %s: tx shutdown timeout %s: restarting %s: receive error (%04x) packet lost overflow no buffers%s: rx packet lost %s: initialization failed: no memory for tx buffers %s: chip is in D%d power mode -- setting to D0 i82558i82559i82559Si82550, %s%s: Allocation of PCI resources failed %s: Unable to initialize the hardware %s: EEPROM read error while reading mac address %s: Invalid mac address , address: %s %s: Unable to allocate rx_desc memory %s: Unable to allocate tx_desc memory %s: watchdog timeout -- resetting %s: Could not setup transmit structures %s: Could not setup receive structures %s: Unsupported media type em_set_multiFull DuplexHalf Duplex%s: Link is up %d Mbps %s %s: Link is Down %s: Memory Access and/or Bus Master bits were not set! %s: Unknown MAC Type : mmba isn't memory: can't find io space : can't find mem space %s: The EEPROM Checksum Is Not Valid %s: Hardware Initialization Failed%s: EEPROM read error while reading part number %s: em_dma_malloc: bus_dmamap_load failed; error %u %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_create failed; error %u %s: Unable to allocate tx_buffer memory %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u %s: Unable to allocate rx_buffer memory %s: Adapter hardware address = %p %s:CTRL = 0x%x %s:RCTL = 0x%x PS=(0x8402) %s:tx_int_delay = %d, tx_abs_int_delay = %d %s:rx_int_delay = %d, rx_abs_int_delay = %d %s: fifo workaround = %lld, fifo_reset = %lld %s: hw tdh = %d, hw tdt = %d %s: Num Tx descriptors avail = %d %s: Tx Descriptors not avail1 = %ld %s: Tx Descriptors not avail2 = %ld %s: Std mbuf failed = %ld %s: Std mbuf cluster failed = %ld %s: Driver dropped packets = %ld %s: Excessive collisions = %lld %s: Symbol errors = %lld %s: Sequence errors = %lld %s: Defer count = %lld %s: Missed Packets = %lld %s: Receive No Buffers = %lld %s: Receive length errors = %lld %s: Receive errors = %lld %s: Crc errors = %lld %s: Alignment errors = %lld %s: Carrier extension errors = %lld %s: XON Rcvd = %lld %s: XON Xmtd = %lld %s: XOFF Rcvd = %lld %s: XOFF Xmtd = %lld %s: Good Packets Rcvd = %lld %s: Good Packets Xmtd = %lld : can't find I/O space : can't map I/O space : %s,: unknown device: %x:%x dc_pci_attach: can't find I/O base : can't subregion i/o space ne_pci_attach: impossible%s: init failed, error=%d vendor 0x%04x%s: unable to map registers pcscp%s: can't create dma maps %s: unable to allocate memory for the MDL, error = %d %s: unable to map the MDL memory, error = %d %s: unable to map_create for the MDL, error = %d %s: unable to load for the MDL, error = %d dmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d pcscp_dma_intr: empty esp FIFO of %d %s: dma_intr: DMA aborted. %s: error: DMA error detected; Aborting. pcscp dmaintr: DMA wasn't active%s: unable to load dmamap, error = %d pcib%s: %s (rev. 0x%02x) pcibattachisa at %s%s: %s channel interrupting at irq %d pre 1.02.0usb: USB revision %s, not supported usb_attach%s: root device is not a hub %s: root hub problem, error=%d usbtaskunable to create task thread usb_create_event_thread task%s: unable to create event thread for usb_create_event_threadusbevtusbtskusb at %susbreausbreadusbd_add_dev_eventusbd_add_drv_eventusb_add_eventusb_detachusbdet%s: event thread didn't die usbsynusbd_transfer: not doneusbd_start_next: error=%d usb_detach_wait: %s didn't detach HomeConnectBluetooth3C19250 Ethernet3CRSHEW696HomeConnect 3C460U.S.Robotics 56000HomeConnect 3C460BU.S. Robotics3Com OfficeConnect Analog Modem3Com U.S. Robotics Pro ISDN TA3Com HomeConnectAboCom SystemsXX1XX2URE450 EthernetUFE1000 Fast Ethernet1/10/100 ethernetXX4XX5XX6RTL8151XX7XX8XX9XX10BWU613Accton TechnologyUSB320-EC Ethernet2664WT-Sinus 111 WLANSpeedStream EthernetWarplinkAcer PeripheralsAcerscan C310UAcerscan 320UAcerscan 640UAcerscan 620UATA/ATAPIAWL300AWL400Actiontec ElectronicsPrism2.5 WLANPrism2.5 WLAN AROPEX FreeLan 802.11b802UAT1ACTiSYSACT-IR2000U FIRActiveWireI/O BoardI/O Board, rev. 1AWN-8020 WLANAddonics TechnologyAWU-120AN986A EthernetAN986 EthernetAN8511 EthernetAN8513 EthernetAN8515 EthernetADS TechnologiesUBS-10BT EthernetAEIAgate TechnologiesQ-DriveAGFA-GevaertSnapScan 1212USnapScan 1236USnapScan TouchSnapScan e40SnapScan e50SnapScan e20SnapScan e25SnapScan e26SnapScan e52AincommAWU2000BPheenetWM-168bAladdin Knowledge SystemsUSB-HASP 0.06Alcor MicroMacAlly Kbd HubAU9814 HubMicroConnectors/StrongManNEC Kbd HubAllied Telesyn InternationalAT-USB100Altec LansingADA70 SpeakersASC495 SpeakersAmbit MicrosystemsAmerican Power ConversionBack-UPS Pro 500Anchor ChipsEZUSBEZLINKAOXApple ComputerOptical mouseSpeakersAsahi OpticalPENTAX Optio230AsanteAskey ComputerWLL013 (Intersil)WLL013Voyager 1010ASIX ElectronicsUSB 2.0 10/100 ethernet controllerASUSRT2570ASUSTeK ComputerWL-140ATEN International10Mbps EthernetUC-110T EthernetUC210T EthernetDSB-650CUSB Cable 205AtmelUHB124 hubW-Buddie WN210DWL-900AP Wireless access pointAT76C503 (Intersil 3861 Radio)AT76C503 (Intersil 3863 Radio)AT76C503 (RFMD Radio)AT76C505 (RFMD Radio)AT76C505 (RFMD 2958 Radio)AT76C505A (RFMD 2958 Radio)AT76C505AS (RFMD 2958 Radio)Audio-TechnicaATC-HA4USB USB headphoneUSB Audio SpeakerAveratecAvision1200UB&B ElectronicsuLinks RS-422/485F5U002 ParallelF5D6050 802.11b Wireless adapterF5U103 SerialF5U109 SerialF5U409 SerialUSB to LAN ConverterF5U237 USB 2.0 7-Port HubF5U120-PC HubBillionton SystemsUSB100N 10/100 EthernetUSB100LPUSB100ELUSBE100USB2AR EthernetBCM2033BCM2033 (no fw)Brother IndustriesHL-1050 laser printerBehavior Tech. ComputerKeyboard/MouseCANOSCAN N656UCANOSCAN N670UPowerShot S10PowerShot S20PowerShot S100PowerShot G1PowerShot A20Computer Access TechnologyNetmate EthernetNetmate2 EthernetUSB Chief Bus & Protocol AnalyzerAndromeda hubCASIOQVBE-300 PDACASIO Nameland EZ-USBCCYU TechnologyEasyDisk PortableCherry MikroschalterMy3000 keyboardMy3000 hubChic TechnologyCypressChicony ElectronicsKB-8933 keyboardCH ProductsPro ThrottlePro PedalsFighterstickFlight Sim YokeCisco-LinksysiPAQ PocketPCA1500iPAQ WLANW100WLAN MultiPort W200Personal Jukebox PJB100SnapPort EthernetConceptronicC11UWL-210Concord CameraEye Q 3xConnectixQuickCamEther USB-TFEther USB-TXWirelessLAN USB-11FEther USB-TXSWireless LAN Stick-11FEther USB2-TXULUSB-11 KeyWLAN USB Stick 11FEther USB-TXCNomad IINomad II MGNomadVoip BlasterCambridge Silicon RadioBlueCoreChuntexEx1300 hubCypress SemiconductorthermometerKeyboard/HubFM RadioUSB2 HubDaisy TechnologyPhotoClipDallas SemiconductorJ-6502 speakersUSB-FOB/iBUTTONTrueMobile 1180 WLANDiamondRio 500Dick Smith ElectronicsWL-200UCHUSB 611GWL-240UXH1153 802.11bDigi InternationalAccelePort 2AccelePort 4AccelePort 8Digital StreamPS/2 ActiveD-Link10/100 ethernetDWL-120 rev EDWL-122DWL-120 rev F10Mbps ethernetDMIStorage AdapterEasyDiskFlash DiskEicon NetworksDiva 852 ISDN TAEIZOhubmonitorELCON SystemtechnikGoldpfeil P-LANElecom29UOLD-USB/TXLD-USBL/TXUC-SGT SerialUC-SGT0 SerialELSAMicrolink USB2EthernetEntrega1S serial2S serial1S25 serial4S serialE45 EthernetCentronics1S9 serialEZ-USB2U4S serialSeiko EpsonUSB PrinterISD Smart Cable for MacISD Smart CablePerfection 636U / 636PhotoPerfection 610Perfection 1200U / 1200PhotoExpression 1600Perfection 1640SUPerfection 1240U / 1240PhotoPerfection 640UPerfection 1650GT-9700FPerfection 2400Perfection 1260Perfection 1660e-TEK LabsExtended SystemsXTNDAccess IrDAFalcom Wireless Communications GmbHFalcom Twist USBFreecomConnector for DVD driveFuture Technology Devices8U232AM Serial converterPS/2 Keyboard/MouseMatrix Orbital MX200 Series LCDMatrix Orbital LK202-24 LCDMatrix Orbital LK204-24 LCDCrystalfontz CFA-631 LCDCrystalfontz CFA-632 LCDCrystalfontz CFA-633 LCDCrystalfontz CFA-634 LCDSEMC DSS-20 SyncStationFuji Photo FilmMass StorageFujitsuAH-F401U Air H deviceGarmin InternationalIque 3600Genesys LogicGeneLink Host-Host BridgeGL650 HubGL641USB CompactFlashGIGABYTEGN-BR402WGN-WLBM101GigasetGoHubsGoCOM232 Serial converterAdvanced Gravis ComputerGamePad ProGREENHOUSECF-writer/MP3 PlayerGH-USB100B EthernetGH-USB100B Ethernet PNAGriffin TechnologyiMate, ADB adapterGuillemotDA LeaderHagiwara Sys-ComFlashGate SmartMediaFlashGate CompactFlashFlashGateHAL CorporationCrossam2+USB IR commanderHandspringHandspring VisorHandspring TreoHandspring Treo 600WinTV FMHawkingUF200 EthernetHitachiDVD-CAM DZ-MV100A CamcorderHewlett PackardDeskJet 895CScanjet 4100CPhotosmart S20DeskJet 880CScanJet 4200CCD-Writer PlusMultimedia Keyboard HubHN210WScanJet 6200CPhotoSmart S20DeskJet 815CScanJet 3300CCD-Writer Plus 8200eDeskJet 1220CDeskJet 810C/812CScanjet 4300CCD-Writer+ CD-4eOfficeJet G85xiLaserJet 1200Scanjet 5200CDeskJet 830CScanJet 3400cseDeskJet 885CScanjet 6300CDeskJet 840cScanJet 2200CScanjet 5300CDeskJet 816CDeskjet 970CseScanjet 5400CDeskjet 959CDeskJet 930cInkjet P-2000UDeskJet 640cPhotosmart P1100HN210E EthernetPhotoSmart C500OpticalCD-ROMIiyamaImationFlash Go!Inside Out NetworksEdgePort/4 RS232Hubport/7Rapidport/4Edgeport/4 RS232Edgeport/2 RS232Edgeport/4 RS422Edgeport/2 RS422/RS485Hubport/4Hand-built Edgeport/8MultiTech version of RP/4Edgeport/(4)21 ParallelEdgeport/421 Hub+RS232+ParallelEdgeport/21 RS232+Parallel1/2 Edgeport/8Edgeport/2 RS232/DINEdgeport/4 RS232/DIN1/2 Edgeport/16Edgeport CompatibleEdgeport/8 RS422OEM deviceIn-System DesignUSB2 StorageIDE ISD110IDE ISD105Portable USB Harddrive V2USB cableUSB Storage Adapter V2EasyPCAP310 AnyPoint IIWireless 2011B82930 test boardPrism2.x WLANValueCANNeoVI BlueI/O DataUSB-SSMRW SD-cardUSB-SDRW SD-cardUSB ETTUSB ETTXUSB WN-B11USB Airport WN-B11RSAQ1 SerialI-O DataUSB2.0-SCSI Bridge USB2-SCIomegaZip 100Zip 250CDRW 9602iRiveriFP-1xxiFP-3xxiFP-5xxJatonJenoptikJD 350Japan Radio CompanyAirH"PHONE AH-J3001V/J3002VJVCMP-XP7250 Builtin WLANMP-PRX1Kawasaki LSIKawatsu SemiconductorMiniHub 4000PKC-180 IrDAKeisokugikenHKS-0200 USBDAQKensingtonOrbit trackballTurboBallOrbit trackball for MacVideoCAM VGAKeyspanUSA-28 serialUSA-28X serialUSA-19 serialUSA-18 serialUSA-18X serialUSA-19W serialUSA-49W serialUSA-19QI serialUSA-19Q serialUSA-28X/XB serialUSA-28XB serialUSA-28XA serialUSA-18XA serialUSA-19WQ serialUIA-10 remote controlUIA-11 remote controlKingston TechnologyKNU101TX EthernetEastman KodakDigital Science DC220Digital Science DC260Digital Science DC265Digital Science DC290Digital Science DC240Digital Science DC280EasyShare DX4900KonicaKYE SystemsNiche mouseGenius NetScroll mouseFlight 2000 joystickColorPage Vivid-ProKyoceraAH-K3001VLaCieHard DiskCD R/WLexar MediajumpSHOT CompactFlash2662W-ARLexmark InternationalOptra S 2450Camedia MAUSB-2USB10TXUSB10T EthernetUSB100TX EthernetUSB100H1 Ethernet/HPNAUSB10TA EthernetWUSB11 802.11bWUSB11 802.11b v2.5WUSB12 802.11b v1.1WUSB11Network Everywhere NWU11BWUSB11 v2.8WUSB11 v3.0LogitechM2452 keyboardM4848 mousePageScanQuickCam WebQuickCam ProQuickCam ExpressQuickCam Pro 3000QuickCam Notebook ProQuickCam Pro 4000N43N48 mouseM-BA47 mouseWingMan Gaming MouseBD58 mouseiFeel MouseWingMan GamePad ExtremeWingMan RumblePadWingMan Force joystickWingMan Formula Force GP (GT-Force)iTouch KeyboardUSB-PS/2 TrackballTrackMan WheelCordless mouseCordless keyboardCordless Desktop OpticalLCS-8138TXLucentUSS-720 evaluation kitMacallyMCTD-Link DU-H3SP BAY HubRS232 InterfaceSitecom RS232ML-4500MelcoLUA-TX EthernetLUA2-TX EthernetLUA-KTX EthernetWLI-USB-S11MCR-SM2 SmartMediaUSB-IDE Bridge: DUB-PxxGWLI-USB-KS11G wlanLUA-U2-KTX EthernetWLI-USB-KB11 WLANMetricomRicochet GSMicro Star InternationalMicronet CommunicationsSP128AR EtherFastSideWinder Precision ProIntelliMouseNaturalDigital Sound System 80Sidewinder Precision Racing WheelTrackball ExplorerIntelliEye mouseInternet Keyboard ProMN510 WirelessMicrotechSCSI-DB25SCSI-HD50CameraMateFreecom IDEMicrotekPhantom 336CX - C3ScanMaker X6 - X6UPhantom C6ScanMaker V6USLScanMaker V6ULMidimanMidisport 2x2Minds At WorkDigital WalletMinoltaDimage S304Dimage XDimage 7iDimage A1MitsumiCD-R/RW DriveMouseFDDMobilityEasiDock EthernetMC141555 hub controllerT720cSB4100 Cable ModemMultiTechMT5634ZBA modemMustek Systems1200 CU600 CU1200 UB1200 Plus1200 CU PlusBearPaw 1200FMDC-800DV2000M-SystemsDiskOnKeyNational InstrumentsGPIB-USB-ANational SemiconductorBearPaw 1200BearPaw 2400RepeaterPicty760Picty900Picty920Picty800USB2.0 HubNeodio6-in-1 Flash Device ControllerMulti-format Flash ControllerNetChip TechnologyTurbo-ConnectClik! 40BayNETGEARUSB 2.0 Fast EthernetMA101MA101 Rev B802.11bNikonE990E880E885NHJOlympusC-1C-700 Ultra ZoomUSB TO EthernetOmniVisionOV511OV511+OnSpecMDCFE-B CFMemory Stick+CFDatafab-basedPNY/Datafab CF+SMSimple Tech/Datafab CF+SMCF + SM Combo (LC1)Datafab MD1-II PC-Card8In2OQOmodel 01 WiFi interfacemodel 01 Bluetooth interfacemodel 01 Ethernet interfaceOurs Technology Inc.Solid state diskPalm ComputingUSB Serial AdaptorPalm m500Palm m505Palm m515Palm i705Palm Tungsten ZPalm m125Palm m130Palm Tungsten TPalm Zire 31Palm ZirePanasonic (Matsushita)LS-120MultiMediaCardPen Drive6 in 13 in 1Peracom NetworksSerial ConverterAt-Home EthernetWL-503IADSS 350 Digital Speaker SystemDSS XXX Digital Speaker SystemPCA645VCPCA646VCPCVC675K VestaPCVC680K Vesta ProPCVC690K Vesta Pro Scan CameraPCVC730K ToUCam FunPCVC740K ToUCam Pro PCPCVC750K ToUCam Pro ScanDSS 150 Digital Speaker SystemDIVA mp3 playerPhilips SemiconductorsP.I. EngineeringPS2 to MacXkeys Programmable KeyboardPilotechCRW-600 6-in-1Planex CommunicationsGW-US11H WLANGW-US11S WLANPlantronicsPlatronics DSP-400 Headsettest boardPortGearPortsmithExpress EthernetPQITravel Flash DrivePrimax ElectronicsG2-200G2E-300G2-300Colorado 9600Colorado 600uVisioneer 6200Colorado 19200Colorado 1200uG2-600ReadyScan 636iG2E-600ComfortMouse-in-a-BoxSony PCGA-UMS1Prolific TechnologyPL2301 Host-Host interfacePL2302 Host-Host interfacePL2303 SerialParallel printerATAPI-4 Bridge ControllerPL2501 Host-Host interfacePutercomUSB-1284 BRIDGEQtronixScorpion-980NQualcommCDMA MSM modemCDMA MSM phoneQuickshotUSB StrikePadRainbow Technologiesi-Key 2000Ralink TechnologyRATOC SystemsUSB serial REX-USB60RolandUA-100 Audio I/FUM-4 MIDI I/FSC-8850 MIDI SynthU-8 Audio I/FUM-2 MIDI I/FSC-8820 MIDI SynthPC-300 MIDI KeyboardUM-1 MIDI I/FSK-500 MIDI KeyboardSC-D70 MIDI SynthUM-880 MIDI I/FSD-90 MIDI SynthUM-550 MIDI I/FSD-20 MIDI SynthSD-80 MIDI SynthUA-700 Audio I/FRockfiregamepad 203USBSaitekCyborg 3D Gold JoystickSanDiskImageMate SDDR-05aImageMate SDDR-31ImageMate SDDR-05ImageMate SDDR-12ImageMate SDDR-09ImageMate SDDR-75Sanwa SupplyJY-DV9USB gamepadSanyo ElectricSanyo SCP-4900 PhoneSWL-2100UScanLogicSL11R-IDERoot HubSN1 L1 System ControllerSharkPocket AdapterSharpSL5500A300SL5600C700C750Shuttle TechnologyE-USB BridgeeUSCSI BridgeImageMate SDDR09eUSB SmartMedia / CompactFlasheUSB MultiMediaCardSony HifdeUSB ATA/ATAPIeUSB CompactFlashCD-RW DeviceSCM MicroSpeedStreamSpeedStream 1022SigmatelDatum Networks SSF-7X Multi PlayersDigiFilm-ComboMULTICARDREADERSilicomU2EPsion Dacom Gold Port EthernetSilicon PortalsYAP Phone (no firmware)YAP PhoneSirius TechnologiesNetComm Roadster II 56SitecomLN029WL-022CN104SmartBridgesSmartLink EthernetsmartNIC 2 PnPStandard MicrosystemsEZ Connect EthernetEZ Connect 11MbpsEZ Connect 11Mbps v2SOHOwareNUB100 EthernetNUB110 EthernetSolid YearSony DSC CamerasMemorystick NW-MS7Harddrive V2Memorystick MSAC-US1HandycamSony MSC Memorystick SlotClie v3.5PlayStation2 keyboardPlayStation2 keyboard hubPlayStatoin2 mouseClie v4.0Clie v4.0 Memory Stick slotSony Clie s360Clie v4.1 Memory Stick slotClie v4.1Sony Clie nx60Sony Clie tj25SOURCENEXTKeikaiDenwa 8KeikaiDenwa 8 with chargerSTMicroelectronicsCommunicatorSTSNInternet Access DeviceSun Communications, Inc.Mobile AdaptorSUN CorporationU-Cable type D2U-Cable type P1Slipper UIr-TrinityU-Cable type A3U-Cable type A4Sun MicrosystemsType 6 KeyboardType 6 MouseSystem TalksSGC-X2ULDiamond (Supra)Supra Express 56KSupraMax 2890 56KRio 600Rio 800Nike psa[play 120Acer Communications & MultimediaEP-1427X-2 EthernetSusteenEricsson DCU-10/11TangtopUSBPS2Taugagreining HFCameraMate (DPCM_USB)TDKUSB-PDC Adapter UPA9664USB-cdmaOne Adapter UCA1464USB-PHS Adapter UHA6400USB-PHS Adapter UPA6400TEACFD-05PUBTekram TechnologyALLNET 0193 WLANZyXEL ZyAIR B200 WLANU-300CTelex CommunicationsMicrophoneUT-USB41 hubTUSB2046 hubNex II DigitalThrustmasterFusion Digital GamepadTodos Data SystemArgos Mini SmartcardTrek TechnologyThumbDriveThumbDrive 8MBTripp-LiteU209 SerialTrumpion MicroelectronicsUSB/MP3 decoderXXX 1100TsunamiSM-2000Ultima1200 UB PlusUMAX Data SystemsAstra 1236UAstra 1220UAstra 2000UAstra 2100UAstra 2200UAstra 3400Universal AccessPanache Surf ISDNUSR1120 WLANViewSonicG773 Monitor HubP815 Monitor HubG773 Monitor ControlVLSI VisionCPiA CameraVisioneerOneTouch 7600OneTouch 5300Scanport 3000OneTouch 6100OneTouch 6200OneTouch 8100OneTouch 8600VivitarDSC350OptionVodafone Mobile Connect 3GGlobeTrotter 3G FUSIONGlobeTrotter 3G QUADWACOMCT-0405-U TabletGraphireIntuos A5XirlinkImaging DeviceIBM PC CameraY-E DataFlashbuster-UUX256 MIDI I/FUX96 MIDI I/FRP-U200NetVolante RTA54iNetVolante RTW65bNetVolante RTW65iNetVolante RTA55iYanoU640MO-03Z-ComM4Y-750XI-725/726XI-735Zoom Telephonics2986L Fax ModemZyXEL CommunicationOmni 56K PlusADI SystemsAdvanced Micro DevicesNANAOAlps ElectricAMPAmerican MegatrendsMethode Electronics Far EastMaxi SwitchLockheed Martin Energy ResearchToshiba AmericaMicro Macro TechnologiesLite-On TechnologyTatung Co. Of AmericaMyson TechnologyDigiITT CanonAnnabooksAztech SystemsAdvanced Connectek USAALTRAATI TechnologiesAsahi Kasei MicrosystemsBAFO/Quality Computer AccessoriesA-Trend TechnologyAdvanced Input DevicesBrainboxes LimitedAxiohm Transaction SolutionsSymbol TechnologiesFuji ElectricKeithley InstrumentsEIZO NanaoFFCAnko ElectronicAOC InternationalBarco Display SystemsBridge InformationBio-Rad LaboratoriesAct LabsAlarisApexAcer Semiconductor AmericaAiwaACARD TechnologyAlcatel TelecomAsia Microelectronic DevelopmentBizlink InternationalAashima TechnologyAlcatel MicroelectronicsBoston AcousticsAureal SemiconductorBrimaxAxis CommunicationsABL ElectronicsAlfadata ComputerNational Technical SystemsOnntoBeAPG Cash DrawerB.U.G.AVerMedia TechnologiesAptio ProductsArasan Chip SystemsAllied CableBroadLogicAction Star EnterpriseADESSO/Kbtek AmericaAPT TechnologiesBoca ResearchAndrea ElectronicsBurr-Brown Japan2WireAIPTEK InternationalAuthenTecAlation SystemsAmerican Biometric CompanyBlueWater SystemsAgilent TechnologiesAdirondack Wire & CableBeckhoffAltius SolutionsArris InteractiveACTIVCARDA-FOUR TECHAIMEXAddonics TechnologiesAKAI professional M.I.ARESCOMBay AssociatesAlteraBoca SystemsGeocast Network SystemsKurusugawa Electronics, Inc.ABCNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%x.%02x, class %d/%d, rev , addr %dusbd_devinfousbdly0 lengthout of datausbd_fill_iface_data: bad descriptor(s): %s iface descusbd_set_config_index%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port usbd_print%s, %s configuration %d interface %d port %d%s: at %s (addr %d) disconnected multiple%s: %s transaction translator%s %s: hub depth (%d) exceeded, hub ignored uhub_attach%s: %d port%s with %d removable, %s powered %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: port %d power on failed, %s %s: cannot open interrupt pipe %s: no ports, hub ignored uhub%s: port %d reset failed %s: device problem, disabling port %d %s: strange, connected port %d has no power %s: illegal enable change, port %d %s: port error, giving up port %d %s: port error, restarting port %d hid_start_parsedefault bType=%d Local bTag=%d Main bTag=%d Global bTag=%d BAD LENGTH %d uhidev%s: %s, iclass %d/%d %s: could not read endpoint descriptor %s: unexpected endpoint uhidev_attach%s: no report descriptor %s: no memory %s: %d report ids uhid at %s reportid %duhidev_intr: bad repid %d uhidev_set_report_asyncukbd %s: attach failed, %s %s: was console keyboard This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). too many modifier keysbad modifier sizemultiple key code arrays key codes not on byte boundarytoo many key codeskey code size != 8umassumass_attachCBIBulk-OnlyRBC%s: using %s over %s %s: bus attach failed %s: command protocol=0x%x not supported %s: isdata not configured %s: unable to get Max Lun: %s UFIISD-ATACBI with CCI%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: transferred %d bytes instead of %d bytes%s: Unknown state %d%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Get Max Lun failed: %s umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cbaue%s: EEPROM read timed out %s: MII read timed out %s: reset failed %s: setting config no failed auemii%s: getting interface handle failed %s: missing endpoint aue_attach%s: couldn't get endpoint descriptor %d %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open intr pipe failed: %s %s: open tx pipe failed: %s %s: open rx pipe failed: %s %s: close intr pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: abort tx pipe failed: %s %s: close rx pipe failed: %s %s: abort rx pipe failed: %s cue%s: read MAC address failed cue_attach%s: couldn't get ep %d %s: cue_send error=%s kue%s: warm boot, no firmware download %s: cold boot, downloading firmware %s: failed to load trigger segment: %s %s: failed to load fixup segment: %s %s: failed to load code segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer kue_attach%s: kue_send error=%s wsdisplay%s: screen %d-%d added (%s, %s emulation%s: screen %d deleted wsdisplay at %sdmux: console (%s, %s emulation), using %swsdisplay_common_attach: no memorywsdisplaytty() on ctl devicewsdisplay_switch3: giving up wsdisplay_switch3: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch2: giving up wsdisplay_switch2: screen %d disappeared wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwswaitwsmoused_sleepwscons: copybuffer memory malloc failed wsemul_vt100_output_c0c1: ESC in kernel output ignored \[>24;20;0cP0!u%5\wsemul_vt100_handle_csi[?62;6c[%d;%dR[?13n[?21n[?27;1nP2$uwsemul_vt100_handle_dcs: bad type %d[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~OPOQOROSOpOqOrOsOtOuOvOwOxOyOIOMOD[7~OBOCOA[8~[6~[3~[2~[5~[4~[1~OjOkOlOmOnOowsevent_readwskbdwskbd at %s mux %d: console keyboard (mux %d ignored for console)cannot load keymapwskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwsmux_setmax: no memwsmux_setmax: no memorywsmux_attach: error=%d wsmux: attach out of memory wsfont_unlock: font not lockedpckbdprobe: reset response 0x%x pckbd_enable: command error pckbd_disable: command error pckbd Vdd'(r @T\l`hpx|z 4'(/0 %$"!+,.5/)&* -]`^`<  ^`^`  lb`b`<  b` <  b` X  b`  b`  b`   b`b`  @d`Xd`<  De`\e`  e`e`<  f`f`< | f`f`  g`(g`  Pg`hg`  g`g`  |``t  ``  ԇ``  ``  ,`D`  X`p`  ``  ``  `p   !`   !`   !Ѝ``  !`   !``  !P`h`  !|``  !`   !`8   !``  !x`L   !``   !`H   !Ȓ`   !``  !H```  !p`<  &`<  &``  '`  '`  5`  '0`  'H `  ' `  'H`4`  7x`d`  9h``  ? Q A -|'ᅠ" <  !!!!!!!"-"/""")"H"a"d"e"## #!#%% %%%%%$%,%4%<%P%Q%R%S%T%U%V%W%X%Y%Z%[%\%]%^%_%`%a%b%c%d%e%f%g%h%i%j%k%l%%%%%%%%%%%%%%%%% %% :&;&<&@& B& `&c&e&f&j& k&-"*"U<"~# # # #)#<*#>-_ { }xYYvw E--   <<cr39AAAAEEEIIIIDOOOOUUUYaoybuiltin@ `P0pX0\ $( ,h6677l87@ ##############$$@$d$|$ $@$$$@$ %` %4%H%`% p%%%B % % % %% %%% %%0+%@2%P8%`>%pD%l;44d=ooBBBBBBBBBC C)+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuw ! S8]UUc&`H@?@@cf\%THIS is A memory TEST pattern9%Kwx,xii𮭨LjTj(l     $48$|<, `  "<"0|&))-, @ @   )Q0 jboo<D o0>oBoB@AoB8BoTBoBoBphpppxpo j f d1lr d1d1}X z44xt u dl d1p d1d1d1d1d1d1tD d1 d1d1d1d1d1 d1d1d1d1d1O d1d1d1~d1d1d1d1d1d1d1z | d1d1d1d1d1d1dd1d1d1d1d1d1d1a  n E  v  d1^ o p <9$\ m $&d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1d1llTmd1d1d1d1d1md1d1d1d1d1d1d1d1d1 x N li @ Dd1d1d1 lG D  F  P d1U `{ | H d1d1d1d1d1d1d1   ` d1 t|d1d1l` Lma T d1d1d1,xH|ԃ+ + + + ,  ,  0 <2l22, , , , , d@B  H\8`T- <Lp  x@e@)|h pg(ulp(%ȎЎ0gUX]<^b,__tb$ctbc8dhddXfPxhhttyclsttyopnttybgttyinttyoutHi d̢ܼjP7777ܼ77H7777ܼ77H7777ܼ77H7777ܼ77H7777ܼ77H7777ܼ77H 0 0 < ( (X0 0 HRUHRSS4UP,ffs$dext2fscd9660msdosnfs 1 3 Q XR R < = ? . .. 3 @4 l4  4 ( 4 ` 4 h 5 T H5  t5  5 p 5  5 7$6 p! P6 x! 6 ! 7 ! 47 8" l7 h" 7 ) 7 - 7 . 8 . L8 x7 x8 8 T 8 8 7 (9 7 T9 7 : d8 9 8: 4 7 9 : 9 : : \8 : Xc? Y Z 20123456789abcdef^^3333s(  #$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@BC =D$E =F$cde@B@B@KLاO[@T6nQ%l7Jpp@@@@j j j  C C < (  D8 PC C ,2E , H ( T E Ԗ P  @ E ,0 p \ hx j E  E  | E L < E )L E 4 |2 p< X> E  Ԯ$D E dX,F 0F 8F @F 4F }E#(D<8Q @X,F F G G D D D D (G F F F F F F F F F F F F 2(@AAA==(A* dd%(i @@@@@@@@@XH 0H ctcH H PH 4H `H xH |H hH $I I I  @      ?BEFF'' EF''' ?F''F'' F''' F'' EF'' ?EF''' ?EF''' ?EF''' ?EF'''' ?F'' ?BF''' ?BEF''' ?EF''' F'''' F'''''F''FF''FF''F''K K K K L L 0L BL ZL vL L L L L M (M JM ^M tM M M M @3 @4 (*l4 4 04 4 l 5 X H5 ( t5 ( 5 xB5 x 5 7$6 7P6 |6  6 6 7 47 l7 h7 $;7 xi7  8 uL8 Bx8 8 L 8 l 8 (9 T9 : 9 4 9 x9 : 7: cN 3 Ф 4 5 lH5 ( t5 ( 5 5 p6 8 L 8 l 8 (9 9 4 cDO 3 ܕ 4 T5 lH5 ( t5 ( 5 5 6 8 L 8 `8 (9 9 4 : PcO ,,,,H 3 @4 [l4 Hs0: t4 s4 Dt4 t5 uH5 xvt5 x5 pC5 G5 7$6 dP6 l|6 6 6 L7 47 Ll7 7 @7 7  8 L8 x8 8 Y8 xQ8 (9 T9 Q: ؜9 p4 Ȝ9 9 ,: <: |cP 3 Ф 4 5 uH5 xvt5 x5 5 d6 L8 Y8 xQ8 (9 9 p4 ȜxcQ 3 ܕ 4 l5 uH5 xvt5 x5 5 (6 L8 Y8 Q8 (9 9 p4 Ȝ: c`R  ... ...̨@hT U U 3 @4 l4  4 @ 4 4 t5 H5 P t5 5 5 |5 7$6 dP6 l|6 (6 #7 47 `l7 7 7 `7  8 L8 d!x8 8 8 $8 (9 T9 : ؜9 p4 Ȝ9 9 !: hcdS 3 Ф 4 5 H5 P t5 5 5 d6 #8 8 $8 (9 9 p4 ȜlcT 3 ܕ 4 l5 H5 P t5 5 5 (6 #8 8 &8 (9 9 p4 Ȝ: dcU BB|CFJMQRTS\U U PV gdjtjmB <  ">B(L( k/mnt_WW@@<@`bT 08(">B <  ">B(L( @@<@`bTU A>B k<|'@@@@@@@@@'@@@@@@@@@.Ƥ+b͖A #>BA>B"A>B"0J7A#>BV'$>Bs4$>Bs4)ĿQA />BV'/>B/>BPXJA#>Bc'0>B>0>B>+*A#>Bc'#>Bc'#>Bc',0OA#>Bc'#>Bc'#>Bc'-_A#>Bc'#>Bc'#>Bc'.?A#>Bc'#>Bc'#>B(/4A#>B(@>B+@>B+@+C#>B(#>B(#>B(2A#>B(#>B )#>B )3pDA#>B(%>B(%>B(4VUA#>B(#>B(#>B )5tA#>B )#>B )#>B )6!UA#>B )#>B )#>B )7-A#>B )0>B0>B8UJ!A#>B )#>B )#>B )98UsA#>B )#>B')#>B'):ʐ`C#>B')#>B')#>B');A)qQA#>B')#>B')#>B')<VAA#>B')#>B')#>B')=OA#>B')#>B')#>B')>Lo=$>BZb$>B*uA>B" />BC8%>BR 5%>BR 5HB ʜ!*>B*>B*>Bn.!*>B,*>B,*>B,V!*>BJ]*>BJ]*>BJ].uH!*>B*>B*>B?r!*>Bw*>Bw*>Bw'!*>B'*>B'*>B'i\!*>B*>B*>B0jj!*>B;X*>B;X*>B;X^!*>B*>B*>B.ej!*>Bh *>Bh *>Bh !*>B! *>B! *>B! !*>B *>B *>B #k/N!*>B+S *>B+S *>B+S V!*>BX *>BX *>BX &n!*>B *>B *>B }uT!*>B *>B *>B !*>BN*>BN*>BN\ZN!*>B*>B*>B][5!*>BI*>BI*>BI 늼M!*>B*>B*>B b!*>Bv*>Bv*>Bv 2 !*>B I*>B I*>B I x~M!*>B*>B*>B T{xq!*>B9z*>B9z*>B9z oa!*>B*>B*>B ;E!*>BC*>BC*>BC r!*>B*>B*>B ߎI!*>B*u*>B*u*>B*u  !*>B *>B *>B 䰅!*>BW*>BW*>BWQ1!*>B>*>B>*>B>g>!*>B*>B*>BQ!*>Bp*>Bp*>Bp^!*>B*>B*>BY!*>BG*>BG*>BG@*!*>B9*>B9*>B9!*>B k*>B k*>B k!*>B*>B*>B6,:!*>B8*>B8*>B8~ax!*>B4*>B4*>B4!*>Be*>Be*>BeӋ0 !*>Be*>Be*>Be!*>B*>B*>B<^!*>B(*>B(*>B(cE!*>B/ *>B/ *>B/ 0t!*>BU *>BU *>BU a!*>B`!*>B`!*>B`!!*>B"*>B"*>B"[!*>B*#*>B*#*>B*# u/!*>BF#*>BF#*>BF#*ҹ!*>B[$*>B[$*>B[$G!*>Bs$*>Bs$*>Bs$*!*>B %*>B %*>B %5]!*>B%&*>B%&*>B%&CB!*>B6&*>B6&*>B6&L#!*>BV'*>BV'*>BV' +!*>Bc'*>Bc'*>Bc' !*>B(*>B(*>B(L!*>B')*>B')*>B')ڢH!*>BQ**>BQ**>BQ*f[!*>BT**>BT**>BT*+u!*>B+*>B+*>B+!*>B,*>B,*>B,,!*>B,*>B,*>B, !*>BL-*>BL-*>BL- >I!*>BD-*>BD-*>BD- !*>B}.*>B}.*>B}.!!*>Bq/*>Bq/*>Bq/!q憐!*>B/*>B/*>B/"V!*>B50*>B50*>B50"A0!*>Bx1*>Bx1*>Bx1#2[!*>Bb2*>Bb2*>Bb2#!*>B2*>B2*>B2$HH!*>BB3*>BB3*>BB3$y!*>B%3*>B%3*>B%3%~Y]!*>Bs4*>Bs4*>Bs4%f!*>BR 5*>BR 5*>BR 5&t֬!*>B5*>B5*>B5&O@!*>B=6*>B=6*>B=6'!*>B6*>B6*>B6'Y;-!*>BC8*>BC8*>BC8(F\T!*>Bٟ8*>Bٟ8*>Bٟ8()!*>Bp89*>Bp89*>Bp89)uOф!*>B9*>B9*>B9)$!*>Bi:*>Bi:*>Bi:*a!*>B3;*>B3;*>B3;*CPK!+>B+>B+>B+d!+>B+>B+>B+d!+>B-1+>B-1+>B-1,˵!+>B+>B+>B,齃!+>B+>B+>B--\!+>B+>B+>B--!+>B,+>B,+>B,.@YQ!+>B+>B+>B.l4!+>BJ]+>BJ]+>BJ]/V!+>B+>B+>B/mfO!+>Bw+>Bw+>Bw0DRV!+>B'+>B'+>B'0 _=!+>B+>B+>B1 !+>B;X+>B;X+>B;X1q!+>B+>B+>B2_"s!+>B! +>B! +>B! 2vc!+>B +>B +>B 3:kU!+>B+S +>B+S +>B+S 3lv5!+>B +>B +>B 4_!+>BX +>BX +>BX 4S!+>B +>B +>B 5=+i !+>B +>B +>B 57!+>BN+>BN+>BN6b2!+>B+>B+>B6Ľ]!+>B+>B+>B7ƹ!+>Bv+>Bv+>Bv7@!+>B I+>B I+>B I8ɔr!+>B+>B+>B8!+>B9z+>B9z+>B9z9v!+>B+>B+>B9䝴!+>Bf+>Bf+>Bf:Nɵ!+>BC+>BC+>BC:#Ԁ!+>B+>B+>B;E%!+>B*u+>B*u+>B*u;*!+>BW+>BW+>BW<i!+>B>+>B>+>B><K@!+>B+>B+>B=ğ!+>Bp+>Bp+>Bp=o!+>B+>B+>B!+>BG+>BG+>BG B !+>B9+>B9+>B9 {+>!+>Bt+>Bt+>BtuT!+>B+>B+>B$ $!+>B8+>B8+>B8pՋa+>B4+>B4/>Bc'[!+>Be+>Be/>Bc'h/a+>Be+>Be/>Bc'78V!+>B+>B/>Bc' Xa+>B(+>B(/>Bc'ġ!+>B/ +>B/ />Bc'cla+>BU +>BU />Bc' hx!+>B`!+>B`!/>Bc'>%a+>B!+>B!/>Bc' !+>B*#+>B*#/>Bc'֒a+>BF#+>BF#/>Bc'v& !+>B[$+>B[$/>Bc' a+>Bs$+>Bs$/>BQ*8!+>B %+>B %/>BQ*Lja+>B%&+>B%&/>BQ*+6!+>B6&+>B6&/>BQ*\aa+>BV'+>BV'/>BQ*[!+>Bc'+>Bc'/>BQ* [a+>B(+>B(/>BQ*t!+>B )+>B )/>BQ*C Ia+>BQ*+>BQ*/>BQ*!+>BT*+>BT*/>BQ*$a+>B++>B+/>BQ*џ !+>B,+>B,/>BQ*sa+>B,+>B,/>BQ*Jd!+>BL-+>BL-/>BQ*ia+>BD-+>BD-/>BQ*,yj!+>B}.+>B}./>BQ*Ema+>Bq/+>Bq//>BQ*N!+>B/+>B//>BQ*a+>B50+>B50/>BQ* 9!+>Bx1+>Bx1/>BQ* &a+>Bb2+>Bb2/>BQ* m!+>B2+>B2/>BQ* (+a+>BB3+>BB3/>BQ*  Y^!+>B%3+>B%3/>BQ* >[a+>Bs4+>Bs4/>BQ* \!+>BR 5+>BR 5/>BQ* /;a+>B5+>B5/>BQ* !+>B=6+>B=6/>BQ* ya+>B6+>B6/>BQ*(!+>BC8+>BC8/>BQ*MtGa+>Bٟ8+>Bٟ8/>BQ*/!+>Bp89+>Bp89/>BQ*C!a+>B9+>B9/>B+Z" !+>Bi:+>Bi:/>B+CLa+>B3;+>B3;/>B+ö!,>B,>B/>B+~a,>B,>B/>B+/g!,>B-1,>B-1/>B+a,>B,>B/>B+@#!,>BZb,>BZb/>B+a,>B,>B/>B+!,>B,,>B,/>B+A5a,>B,>B/>B+п7!,>BJ],>BJ]/>B+Ɖa,>B,>B/>B+F!,>Bw,>Bw/>B+ua,>B',>B'/>B+J!,>B,>B/>B,ia,>B;X,>B;X/>B+@!,>B,>B/>B,ސ a,>Bh ,>Bh />B+{!,>B ,>B />B,Ua,>B+S ,>B+S />B+Aɮ!,>B ,>B />B,#a,>BX ,>BX />B+]!,>B ,>B />B,FYa,>B ,>B />B+] U!,>BN,>BN/>B,Lfa,>B,>B/>B+VF!,>BI,>BI/>B,Ia,>B,>B/>B+N!,>B I,>B I/>B,Y{*a,>B,>B/>B+!,>B9z,>B9z/>B,qsa,>B,>B/>B, >!,>Bf,>Bf/>BL- `ba,>BC,>BC/>B,!kYx!,>B,>B/>BL-!ϓija,>B*u,>B*u/>BL-"9!,>B ,>B />BL-")a,>BW,>BW/>BL-#l!,>B>,>B>/>BL-#ӫZa,>Bp,>Bp/>BL-$ "!,>B,>B/>BL-$ ^a,>BG,>BG/>BL-%s!,>B9,>B9/>BL-%Nja,>Bt,>Bt/>BL-&!,>B k,>B k/>BL-&"Ta,>B,>B/>BL-'g1!,>B8,>B8/>BL-'&`\a,>B4,>B4/>BL-(,!,>Be,>Be/>BL-('a,>B,>B/>BL-)L%Z!,>B(,>B(/>BL-)]a,>B/ ,>B/ />BL-*Ň!,>BU ,>BU />BL-*a,>B`!,>B`!/>BL-+!Y!,>B!,>B!/>BL-+}a,>B",>B"/>BL-,p`=!,>B*#,>B*#/>BL-,xa,>BF#,>BF#/>BL--QH!,>B[$,>B[$/>BL--)a,>B %,>B %/>BL-.!,>B%&,>B%&/>BL-.'?a,>B6&,>B6&/>BL-/N&!,>BV',>BV'/>BL-/|Wa,>Bc',>Bc'/>B}.0s/!,>B(,>B(/>B}.0a,>B ),>B )/>B}.1:s!,>B'),>B')/>B}.1`a,>BQ*,>BQ*/>B}.2(!,>BT*,>BT*/>B}.2S|a,>B,,>B,/>B}.3϶ !,>B,,>B,/>B}.3#a,>BL-,>BL-/>B}.4@F!,>BD-,>BD-/>B}.4Ya,>B}.,>B}./>B}.5>F4!,>Bq/,>Bq//>B}.5`a,>B/,>B//>B}.6hؤ!,>BG0,>BG0/>B}.6*ka,>B50,>B50/>B}.7 f!,>Bx1,>Bx1/>B}.7%ya,>B2,>B2/>B}.8!,>BB3,>BB3/>B}.8$ a,>B%3,>B%3/>B}.9~،!,>Bs4,>Bs4/>B}.9pa,>BR 5,>BR 5/>B}.: U!,>B5,>B5/>B}.:V.a,>B=6,>B=6/>B}.;c B6,>B6/>B}.;G:a,>Bn7,>Bn7/>B}.<D%,!,>BC8,>BC8/>B}.<I%a,>Bp89,>Bp89/>B}.=x%!,>B9,>B9/>B}.=,ua,>Bi:,>Bi:/>B}.>!,>B3;,>B3;/>B}.>Ba->B->B/>B}.?SB!->B->B/>B}.?[qDa->B-1->B-1/>B/@`O!->B->B/>B/@$,Aa->BZb->BZb/>B/Aڄ'!->B->B/>B/A5a->B->B/>B/B'9!->B,->B,/>B/B\a->BJ]->BJ]/>B/CĽ!->B->B/>B/Ch5La->Bw->Bw/>B/Du!->B'->B'/>B/Dʁ-2a->B->B/>B/E";!->B;X->B;X/>B/E}La->B->B/>B/FRu!->Bh ->Bh />BG0FIa->B! ->B! />B/GAdu!->B ->B />BG0GwEa->B ->B />B/H;0k!->BX ->BX />BG0H R^-a->B ->B />B/Iz)!->B ->B />BG0Ia->BN->BN/>B/JX?L!->B->B/>BG0JbXa->BI->BI/>B/Kӷ!->B->B/>BG0K0a->Bv->Bv/>B/L0!->B I->B I/>BG0Lm9a->B->B/>B/M!->B->B/>BG0MO`{a->Bf->Bf/>B/ND!->BC->BC/>BG0NBa->B->B/>B/OA56W!->B*u->B*u/>BG0OaHa->B ->B />B50I!->BW->BW/>Bx1@a->B>->B>/>B50yS!->B->B/>Bx1DTRa->Bp->Bp/>B50c!->B->B/>Bx1ba->B9->B9/>Bx1b!->Bt->Bt/>Bx19 !a->B k->B k/>Bx12.A!->B->B/>Bx14a->B8->B8/>Bx1h!->B4->B4/>Bx1}Q=a->Be->Be/>Bx1tm!->Be->Be/>Bx1XHr[a->B->B/>Bx1!->B(->B(/>Bx15Xa->B/ ->B/ />Bx1(!->B`!->B`!/>Bx1a->B!->B!/>Bx1 z!->B"->B"/>Bx1 a->B*#->B*#/>Bx1 Z!->BF#->BF#/>Bx1 :a->B[$->B[$/>Bx1 ul!->Bs$->Bs$/>Bx1 Ga->B %->B %/>Bx1  !->B%&->B%&/>Bx1 ua->B6&->B6&/>Bx1 uF!->BV'->BV'/>Bx1 zna->B(->B(/>Bx1f:!->B )->B )/>Bx1*Ta->B')->B')/>Bx1F!->BQ*->BQ*/>Bx1Qia->BT*->BT*/>B2!->B+->B+/>B2n#a->B,->B,/>B2ܕT!->B,->B,/>B2-ka->BL-->BL-/>B2#!->BD-->BD-/>B2b>a->B}.->B}./>B2D!->B/->B//>B2,I,a->BG0->BG0/>B2!->B50->B50/>B2Da->Bx1->Bx1/>B2Z{/!->Bb2->Bb2/>B27MNa->B2->B2/>B2B$L!->BB3->BB3/>B2L/a->B%3->B%3/>B2T!->BR 5->BR 5/>B2y\a->B5->B5/>B2@!->B=6->B=6/>B21a->B6->B6/>B2f/!->Bn7->Bn7/>B2~AӮa->BC8->BC8/>B2&!->Bٟ8->Bٟ8/>B27?a->B9->B9/>B2!->Bi:->Bi:/>B2q.|a->B3;->B3;/>B2Fs!.>B.>B/>B2&a.>B.>B/>B2Ĉ{!.>B-1.>B-1/>B2Yf.a.>B.>B/>B2(!.>BZb.>BZb/>B2pB)a.>B.>B/>B2/0!.>B,.>B,/>B2&a.>B.>B/>B%3 /ff!.>BJ].>BJ]/>B%3 Xwa.>B.>B/>B%3!aXP!.>Bw.>Bw/>B%3! a.>B'.>B'/>B%3"O4!.>B.>B/>B%3"a.>B;X.>B;X/>B%3#I7|!.>B.>B/>Bs4#4aa.>Bh .>Bh />B%3$=fF!.>B .>B />Bs4$sa.>B+S .>B+S />B%3%L˒!.>B .>B />Bs4%Aa.>BX .>BX />B%3&Ve^!.>B .>B />Bs4& :a.>B .>B />B%3'V!.>BN.>BN/>Bs4'*=a.>B.>B/>B%3(8!.>BI.>BI/>Bs4(nV^a.>Bv.>Bv/>B%3)\!.>B I.>B I/>Bs4)a.>B.>B/>B%3*ꔀ!.>B9z.>B9z/>Bs4*cPa.>B.>B/>B%3+!.>Bf.>Bf/>Bs4+Ja.>BC.>BC/>B%3,6!.>B.>B/>Bs4,7oa.>B*u.>B*u/>B%3-=Z!.>BW.>BW/>Bs4-ra.>B>.>B>/>B%3.#!.>B.>B/>Bs4.[aa.>Bp.>Bp/>B%3/YA!.>B.>B/>Bs4/ a.>BG.>BG/>B50%!.>B9.>B9/>B50a.>Bt.>Bt/>B51r>4!.>B k.>B k/>B51mla.>B.>B/>B52zI"!.>B8.>B8/>B52 a.>Be.>Be/>B53H!!.>Be.>Be/>B530oa.>B.>B/>B54o#!.>B(.>B(/>B54$$a.>B/ .>B/ />B55!.>BU .>BU />B55Ja.>B`!.>B`!/>B56EXf!.>B!.>B!/>B56,ca.>B".>B"/>B57<!.>B*#.>B*#/>B57a.>B[$.>B[$/>B58'w!.>Bs$.>Bs$/>B58xcTa.>B %.>B %/>B59)!.>B%&.>B%&/>B59Xsa.>B6&.>B6&/>B5:8a7!.>BV'.>BV'/>B5:F"Wa.>Bc'.>Bc'/>B5; i!.>B(.>B(/>B5;ZZa.>B ).>B )/>B5< !.>B').>B')/>B5<fa.>BQ*.>BQ*/>B5=ӹ_!.>B+.>B+/>B5=z!\a.>B,.>B,/>B5>!!.>B,.>B,/>B5>a.>BL-.>BL-/>B5?B!.>BD-.>BD-/>B5?Oa.>B}..>B}./>B6@\%!.>Bq/.>Bq//>B6@c\ca.>B/.>B//>B6AX!.>BG0.>BG0/>B6A(Ya.>B50.>B50/>B6BX~!.>Bx1.>Bx1/>B6Ba.>B2.>B2/>B6CWܑ8!.>BB3.>BB3/>B6C/lEa.>B%3.>B%3/>B6DRg!.>Bs4.>Bs4/>B6Dbia.>BR 5.>BR 5/>B6Eݕ!.>B5.>B5/>B6Eǡa.>B=6.>B=6/>B6FV!.>B6.>B6/>B6FxSa.>Bn7.>Bn7/>B6G-!.>BC8.>BC8/>B6GWa.>Bp89.>Bp89/>B6Hf!.>B9.>B9/>B6H#ia.>Bi:.>Bi:/>B6I\i1]!.>B3;.>B3;/>B6Ia/>B/>B/>B6J!/>B/>B/>B6Jaya/>B-1/>B-1/>B6K;~!/>B/>B/>B6K(d`a/>BZb/>BZb/>B6L %!!/>B/>B/>B6L a/>B,/>B,/>B6M?=!/>B/>B/>B6Ma/>BJ]/>BJ]/>B6N{c_!/>B/>B/>B6Nra/>Bw/>Bw/>B6Oxh !/>B'/>B'/>B6Ob!/>B/>B/>B ) !/>B;X/>B;X/>B )!/>B/>B/>B )_!/>Bh />Bh />B )]!/>B />B />B )`a/>B+S />B+S />Bc',!/>B />B />Bc'gFa/>BX />BX />Bc'_i!/>B />B />Bc'Za/>B />B />Bc'!/>BN/>BN/>Bc'չEa/>B/>B/>Bc'#!/>BI/>BI/>Bc'RJ6a/>B/>B/>Bc'R!/>Bv/>Bv/>Bc'a/>B/>B/>Bc'x&!/>B9z/>B9z/>Bc'8va/>B/>B/>Bc'?!/>Bf/>Bf/>Bc'/^1a/>BC/>BC/>Bc'y!/>B/>B/>Bc'm!/>B*u/>B*u/>B*uT!/>BW/>BW/>BWrf!/>B>/>B>/>B> !/>B/>B/>B~6/>B9/>Bi:/>Bi:`uh0>B0>BX 0>BX @ H P X ` h p x P7)0>B0>BI0>BI*F,20>B0>B9z0>B9z1=0>Bf0>Bf0>Bf/tmp/disktab.shadow8 0>B0>B0>B/tmp/fstab.shadowhX0>B 0>B 0>B /tmp/resolv.conf.shadowy0 0>B>0>B>0>B>/tmp/hostsU 0>B@>Bc'@>Bc'b}_@>B+@>Bq/A>B`!h8@>Bx1@>BR 5@>BR 5fTv @>Bn7@>Bi:@>Bi:pȅ5jA>BA>BJ]A>B`!x A>BA>BA>B`!{ !/JkA>B9zA>B/ A>B/ 6 YFӯn"y^Ih!)BR  M_l<21UJ|6 [Vfx5.Tǖ)yz|DQReWP"ן0<N`tfQ l/I=$9'q ¥u}1k=l%W \K԰[/ L/nY&!D> u Wך~-%e j9INL+R܆pRB#Sݢ% jDb鄼h}.'l:b-6]#D]HR]ֲ,\UO1!.jqX ۥgV4]  jB3+t% @A/ؗjmfYD|!ʌD5X&?ݨѰZ0M, :W-d:'j 6/gK36cزWjT^2€Rv,vAZPIe%XuSMV}7>ӡ\'0#,$yY"!c+eΙ@iN=qn rjjr!'SCg^~`E;gщi5&{[z\@FyA^G'0|)>iM?g_V=k]\sH~~f,y3gy^s^yLheE|,Oar34 쫀 >;%C #ޤ0X~Dx,m 4 0b6{{_E'gCttypi?ptypi@ttypjAptypjBttypkCptypkDttyplEptyplFttypmGptypmHttypnIptypnJttypoKptypoLttyppMptyppNttypqOptypqPttyprQptyprRttypsSptypsTttyptUptyptVttypuWptypuXttypvYptypvZttypw[ptypw\ttypx]ptypx^ttypy_ptypy`ttypzaptypzbttypAcptypAdttypBeptypBfttypCgptypChttypDiptypDjttypEkptypElttypFmptypFnttypGoptypGpttypHqptypHrttypIsptypItttypJuptypJvttypKwptypKxttypLyptypLzttypM{ptypM|ttypN}ptypN~ttypOptypOttypPptypPttypQptypQttypRptypRttypSptypSttypTptypTttypUptypUttypVptypVttypWptypWttypXptypXttypYptypYttypZptypZttynullzerostdinstdoutstderrrd0arrd0ard0crrd0ccd0arcd0acd0crcd0ccd1arcd1acd1crcd1cwd0arwd0awd0brwd0bwd0crwd0cwd0drwd0dwd0erwd0ewd0frwd0fwd0grwd0gwd0hrwd0hwd0irwd0iwd0jrwd0jwd0krwd0kwd0lrwd0lwd0mrwd0mwd0nrwd0nwd0orwd0owd0prwd0pwd1arwd1awd1brwd1bwd1crwd1cwd1drwd1dwd1erwd1ewd1frwd1fwd1grwd1gwd1hrwd1hwd1irwd1iwd1jrwd1jwd1krwd1kwd1lrwd1lwd1mrwd1mwd1nrwd1nwd1orwd1owd1prwd1pwd2arwd2awd2brwd2bwd2crwd2cwd2drwd2dwd2erwd2ewd2frwd2fwd2grwd2gwd2hrwd2hwd2irwd2iwd2jrwd2jwd2krwd2kwd2lrwd2lwd2mrwd2mwd2nrwd2nwd2orwd2owd2prwd2pwd3a rwd3a wd3b rwd3b wd3c rwd3cwd3drwd3dwd3erwd3ewd3frwd3fwd3grwd3gwd3hrwd3hwd3irwd3iwd3jrwd3jwd3krwd3kwd3lrwd3l wd3m!rwd3m"wd3n#rwd3n$wd3o%rwd3o&wd3p'rwd3p(wd4a)rwd4a*wd4b+rwd4b,wd4c-rwd4c.wd4d/rwd4d0wd4e1rwd4e2wd4f3rwd4f4wd4g5rwd4g6wd4h7rwd4h8wd4i9rwd4i:wd4j;rwd4j<wd4k=rwd4k>wd4l?rwd4l@wd4mArwd4mBwd4nCrwd4nDwd4oErwd4oFwd4pGrwd4pHsd0aIrsd0aJsd0bKrsd0bLsd0cMrsd0cNsd0dOrsd0dPsd0eQrsd0eRsd0fSrsd0fTsd0gUrsd0gVsd0hWrsd0hXsd0iYrsd0iZsd0j[rsd0j\sd0k]rsd0k^sd0l_rsd0l`sd0marsd0mbsd0ncrsd0ndsd0oersd0ofsd0pgrsd0phsd1airsd1ajsd1bkrsd1blsd1cmrsd1cnsd1dorsd1dpsd1eqrsd1ersd1fsrsd1ftsd1gursd1gvsd1hwrsd1hxsd1iyrsd1izsd1j{rsd1j|sd1k}rsd1k~sd1lrsd1lsd1mrsd1msd1nrsd1nsd1orsd1osd1prsd1psd2arsd2asd2brsd2bsd2crsd2csd2drsd2dsd2ersd2esd2frsd2fsd2grsd2gsd2hrsd2hsd2irsd2isd2jrsd2jsd2krsd2ksd2lrsd2lsd2mrsd2msd2nrsd2nsd2orsd2osd2prsd2psd3arsd3asd3brsd3bsd3crsd3csd3drsd3dsd3ersd3esd3frsd3fsd3grsd3gsd3hrsd3hsd3irsd3isd3jrsd3jsd3krsd3ksd3lrsd3lsd3mrsd3msd3nrsd3nsd3orsd3osd3prsd3psd4arsd4asd4brsd4bsd4crsd4csd4drsd4dsd4ersd4esd4frsd4fsd4grsd4gsd4hrsd4hsd4irsd4isd4jrsd4jsd4krsd4ksd4lrsd4lsd4mrsd4msd4nrsd4nsd4orsd4osd4prsd4p memkmemksymsdrumreload st0rst0nst0nrst0est0erst0enst0enrst0 st1rst1nst1nrst1est1erst1enst1enrst1bpf0consoleklogpxf86wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: dialer:*:117: nogroup:*:32766: nobody:*:32767: dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs # emacs-style command line editing rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet alias $alias_ip_address netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } if [ -n "$new_network_number" ]; then echo "New Network Number: $new_network_number" fi if [ -n "$new_broadcast_address" ]; then echo "New Broadcast Address: $new_broadcast_address" fi case $reason in MEDIUM) ifconfig $interface $medium ifconfig $interface inet -alias 0.0.0.0 $medium >/dev/null 2>&1 sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface inet 0.0.0.0 netmask 0.0.0.0 broadcast 255.255.255.255 up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || \ [ "$reason" = REBOOT ] || \ [ -z "$old_ip_address" ] || \ [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet -alias $new_ip_address $medium delete_old_routes exit 1 ;; esac exit 0 MDFSTYPE=msdos MDXAPERTURE=2 ARCH=cats md_set_term() { } md_installboot() { } md_prep_disk() { local _disk=$1 _resp typeset -l _resp cat << __EOT $_disk must be partitioned using an BSD or an MBR partition table. BSD partition table or MBR partition tables can be created by OpenBSD. It is more a question of firmware compatibility disk portability. (Once we can figure out what filesystems ABLE can boot) __EOT while : ; do ask "Use BSD or MBR partition table?" BSD _resp=$resp case $_resp in m|mbr) export disklabeltype=MBR md_prep_MBR $_disk break ;; b|bsd) export disklabeltype=BSD md_prep_BSD $_disk break ;; esac done } md_prep_MBR() { local _disk=$1 if [[ -n $(disklabel -c $_disk 2>/dev/null | grep ' BSD ') ]]; then cat << __EOT WARNING: putting an MBR partition table on $_disk will DESTROY the existing BSD partitions and BSD partition table. __EOT ask_yn "Are you *sure* you want an MBR partition table on $_disk?" [[ $resp == n ]] && exit fi ask_yn "Use *all* of $_disk for OpenBSD?" if [[ $resp == y ]]; then echo -n "Creating Master Boot Record (MBR)..." fdisk -e $_disk >/dev/null 2>&1 << __EOT reinit update write quit __EOT echo "done." echo -n "Formatting 1MB MSDOS boot partition..." gunzip < /usr/mdec/msdos1mb.gz | \ dd of=/dev/r${_disk}c bs=512 seek=1 >/dev/null 2>&1 echo "done." return fi cat << __EOT **** NOTE **** XXX ************** Current partition information is: $(fdisk $_disk) __EOT fdisk -e $_disk cat << __EOT Here is the MBR configuration you chose: $(fdisk $_disk) Please take note of the offsets and sizes of the DOS partition, the OpenBSD partition, and any other partitions you want to access from OpenBSD. You will need this information to fill in the OpenBSD disklabel. __EOT } md_prep_BSD() { local _disk=$1 cat << __EOT No special setup should be required to label using BSD disklabel. however if the disk has previously been partitioned in another manner, it may be necessary to wipe existing partition tables before proceeding. dd if=/dev/zero of=/${_disk} bs=512 count=10 disklabel -c ${_disk} __EOT } md_prep_disklabel() { local _disk=$1 _q md_prep_disk $_disk case $disklabeltype in BSD) ;; MBR) cat << __EOT You *MUST* setup the OpenBSD disklabel to include the MSDOS-formatted boot partition as the 'i' partition. If the 'i' partition is missing or not the MSDOS-formatted boot partition, then the kernel required to boot OpenBSD cannot be installed. __EOT ;; *) echo "Disk label type ('$disklabeltype') is not 'BSD' or 'MBR'." exit ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -c -f /tmp/fstab.$_disk -E $_disk } md_congrats() { cat << __EOT Once the machine has rebooted use OpenFirmware to boot into OpenBSD, as described in the INSTALL.$ARCH document. The command to boot OpenBSD will be something like 'boot (hd0)bsd'. __EOT } #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV > /dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(< /tmp/myname) ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat << __EOT The fstab is configured as follows: $(< /tmp/fstab) For the ${MODE}, filesystems in the fstab will be automatically mounted if the 'noauto' option is absent, and /sbin/mount_ is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up :1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done < /etc/fstab questions echo -n "Saving configuration files..." ( cd /var/db [ -f dhclient.leases ] && mv dhclient.leases /mnt/var/db/. ) ( cd /tmp hostname > myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done < hosts > hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2> /dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up #!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while : ; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat << __EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp ( cd /tmp; rm -f host* my* resolv.* dhclient.* ) cat > /tmp/hosts << __EOT ::1 localhost 127.0.0.1 localhost : (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 ELFa(t44 (ddddhdhdhd(($$t 444OpenBSD -LTP@0! MP@ -0LM 0PS`@p0 x6/ P000`P`0 R ^ *0 0 Q P:00z hdz  0S SX 00-SL@  @1S@DQ@Dt @Dt0鬏 -LM$@0S0Sꤏ -< L04S0 00 hHld@ 0S00pd -LM`pQ 0S5/㳏p@PPPQ P Q088 8Q  tdd| p-PLM@@P` ph 0-@L PP \Xi; 0OSP8  (00SPXtd| -"Ē<LM`00 娂R 堢2 pP=〢xxS UPU 8K`0   ^ 8 @0Ÿ8@ $ Rx  0p0000S0  10S0 0 B W1!0S:  1 R0 1!00 LP P2<P  ,< = =XLP d x=,L%P < \=,<|-<< << ; ;; ; ;;,; ;;,;;,;;,p;l; \; T;vP; ~@;<; w,; $;e#;,k;o; d:h:+]:a: `b0FSQ :M>KQ0C0C pp   InK`F`FN/P@ $`5BY0S 4: S < XBMKHHș@ ( APv9؉9^@h9 9T D PQ R$ U9 P^ T Q R U(0  ܤ0J   H/Z 80380S5 0S  8 R 8 R8 R  % R\8 h8 R`8 R 5 Se  88 Rk i U Up80l% X00R00S7 P 0@ P 10135:3P A@ X7 R 0B$ 70S4 \7 R R0$ 70S4 7 R 7 R\$ 60S4 60S4 6 0 S4 0$ Sa4%S04 RPؔ6Y> A? Д0AP,  ?6X@JP ?dV000TU 3 5#:,P( ?0?V00X@6h1h ? ?6``U 0#5 %* % U UU 4S X0 4  \ P  @?ؔ  YRJ^   ?$X T \% P ؔ PY0 <U U%1 ATE Uc ccn?Xe 00S.K05 \pt \ IC6<0S@#/Q 0SKoP\0@  TS050P5 P  P㬄 X#%*X4dPP<5 4< 05 0@RQx:$ <%!q0`J  0 ~ 5 SP L S3 p0# U Ugg Ug gg >X 0H,଄  <Ja >` 0O %P@V`!X:5 S S V X X42 v \b 2\b`$"#00C4 3@4R 00UV `Pn4S\004 e$ V04 0S03$ 54 5 X4 (4 $ u<Qp ,0 S ,ژ{ 0p605-----5 .5 55.(.55<.5D-5,5H.5 6\.5l.56,556|...00./@/l////080\0\Py+\,4,LTX\dhltx65gfff5P,X,55`,o|l,,,, -8-P-\-NK@ONK4@@4 ) tP  4$S440 $ 5    ^ % Ue0Vf*0U U00R00SU $0R eVU:PU L U0#03RQ $$p ܤ P%0W^  Pd \0#03\030"S3  `Q=P,<"(PK0d1P ^ U * X  PQ ܤ @p 4P  5$ UP2Q 4( Td0 25P%$P ܤ0 0 P B24P%40P$(3R ^3  X4LS \ R 0\J>Kܤ0C@R0 00aAU0!|rP!d0B!U0PBBBB@B`BBpB0BPBBBB|4(KM.KP B4`( Kp$(0K4(K4(K-K0 B$@5 (K 4D% 0K.KH5 4 B#4 `5 4L% $D PT"$`lK``V! ` pK @X K DP,Ġ KHQ. ,KL R$D @5%(PK(`K@d! \!4 $ X! $0@ P \ 5 )0R`06P$(6R0/ D!b0 $v> 0Xp6BNKx6Q%̠%4%(@D@D0 P5&K !0S66TQ$0 N0o00  e T .ܤU0 U 0A AH7(KJ.KP BX7(K`'(0K$"$d% $$PT0!l |! D! `0 @ p lKd`V,Ġ@ `000 q%4$3=]$ 0J/> 40QX=V>d8U U Uʠ 5! V:%V#l=U8'L40S@.cc;T5l ;P0!01S030S345-*Q$H9U! $UT  h9Q eVPR 9U  T 9R UP9R R/5 PBNK@D@D*5f P +p$ e )Pa4: S ܤEnK`F `F @P0 a  % `\d4S: 8j\d4S0 T([44 嬄 D D ~gF -LM@(K]hP`5  Ppp0W0* R00S 0rS`Fv (P@ P@Z`F (00T cP ^P (0vj?(0 R<(0 T0 0\&0 -PL`p@@PDP @T:T @2 m0 -LPgM/, `rPBp  Q q00  R P\ 8Ÿ q00  RP 0`SpSapCP 0S.S  00Y00S ,0S 0S 0S $0S5MK  pI w8pW0SH00Y00S(0 0(0,0S0,00S' 0S $0S ?P $0 ?c02 $00 ,0S ,堔0 {$, u (l oX s`P@ <4j00edA0A 1<.-101@1 -LMp$jQ5Q/jQ& j,Q0S h<4 0jj`8|@|PPihi<Q@iLiDi<i4ix111110111111 Q-0L $ Q*  22 -LM`@p%f $KPf0S0S 0 $0 UR#U(2 p-LM`PU@ T<PP UTUpT42- 0\ \8 0000ӑS^ 0 ^0 Br0 BS 0r0 -ALM3 0\( 0W(8 0R( 0M( 0H( 0tC( 0d>( 0T9( 0D4( 04/( 0$*( 0%( 0 ( 0( 0( 0( 0 ( 0( 0( 0' 0' 0t'0l '֒H2|22223 343D3X3l3|3333334,4@4T4l44 -LM00`Kq@ 00 pfPPS 00@TH 0uS> <S2  0BS^Q 0( 0 0 0 ?R(0  -R   4K P@ 40 R0 0(@9 9P0 0( dP 0L9< 0p PP4<<<<<5 P-L JG=8= 0-LMt@ 0Pd4hQ e@ 80h'h0(0 "h 0S4P=|== -LM0:(0 "P0( 0S(0 0 (K  gPP) 0S& =P`u 00,pK L0cSb iSI lS> oS& A0S 0S 0S(0S P0AS, [0 0S0 VLP,00 0oSP AL,0(0P,0 0 0P,00 0iSP0 T!L,0$0XP,00 00.(0p5=4m====== -LM `P0p-S000P(K 0(P P@  0S 0 Q (8w8r @q<D> D0h0S $ "-,0 0$  -LM@僽00$0 C 0+ 0 -00 $0 0 0+ -0 D0- -L M0KS0@0,0  K 0 0 0`t -LM@Dzd0 00S 0 $: 00 $ 00 $: 0S00  <<  00 0 -LM@3d0 0 -LM0@S  h8 0 << 0 -LM@00$08  0 0(0-K 00 $ 0g@+$ff\> -Lh\f  -LM K00"QP7td> - LCPq7nt p> - L5Pc7ot |> -A0 LR`P pTPJ RDA R pGP3 RA R p:P R@ R p-P 0S 0   0 p  0$  $ 0 p $ 0   0 p  0  0 p 5,784; -LMl \, P`p 0LSDP dlt( eMc@XT 1 eW%X  @zW $8W8zW $8qWh8hW H8_W $(8VW00 NW $7EW@ $7<W  73W  7*/W00SW $ T7W 47W 7 W 6W  6W $ 6@W  6W $l6W@ $L6W ,6W  $ 6W 5W  $5W 5W 5W00 lWP5W $05W $5wW 4n@YW00cW4ZW $4QW@ $l4HW L4?W  ,46W$ 4-W 3$@W 3< S S 3$ W  |3W $\3W  <3W  $3W $2W $ 2W: b0S Q KdeW " @ ^ 0K0 P"x XK 0SXL1 ,0S ,KaKa`K`a0S @K00!dK 0Sn}i S  Selhd`oI 6 @sc4nc( jcBBBA|AAt@@@@A(APA@AAAAC$BC????? @$@D@h@l?|????C4BtBTBBBdBBB C>>> ?8?>H?\?4(CD0C8C>>>>ADC\ClCxCCC 0-0P@0LS 0@05006 6 0-|PL0@S d0db00 0HS@b4b$b00006 6CC -0L0CSQ tM00-  Q^00?  Q^00@  ,00 0 s6< -LTM\ X3XSp`| , xp p <R|0"` |0@0T #|Cpa@ PX`p0| `Kx| $Pxt KxPJ4K|x oP}W p8|0S0t  | l h 0S |`KxPKP& |0 | Ql0Sh0S,0 S ,x 6Pb x!Pl\3[PP|0 |(1  0P 倸@__0l0  yP|0|0X3.t  b~pA|@!Px :p7 P3HCCt@Cht@\gtCCCCC{ D -0L 㭋hdD -rLtM@P`!BpF@; -P4,HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH4H@HHHHH@HHHHP`1`1`00P @a 0T Q $T 1@KpP`  20: SP  0`S0D T 46(6D$6,60d 06Dy -GMLM1q\ P@`E `1`!\1Q0T+K AAP4: S 1 R $cP0P a 0 S 0Q]0S P ANK @D@D0 PK AAPP0 R4: S0%246,6p/P $606DT(6D -0L 0㜊hdE -(LMP` 0 %Ap ?0@8S񟗄""""""!""""""""!"""!"""" """"""""""""4"H"P"l""""""""x""""""""""0S#00, d 0S 3 [ 0S T 0S#00J t#000d#0S < D3<#0C400P 0 R * 0000 t""! n"0S  "0S0Pa0Ua ژ2 R t2t 0 R @prpŸQ @0zP@ S00CS## $$$ %U sP n ḉU fP  0M U [PP 1\   00h*0ESH D@P P P  g 0 0 R, K}P0ESU , Pe/! Pw Yr 0 RmmL0Xtat\x\{ |a|p\Z||\Z\mda p-LM@P`jU0Se/ !0U $000 0 phx1p (a -2LMpP` Aw0t0q0o0100 1 RT 0S? 1 R20S 0 S(  \( KPH !Q$ K@@"P R10P 0@P 0^ P[0S [0Sx H0 R\ PHZ|\bHbbbWEV||Zmdabbbfdcgd0c -LM@Z00CST)t)t)t)t)t)t)t)t)t)t)t)t)d)t)l)t)t)t))0h/$ !_Dcccc -2LM `RpY 1 RJ0 a!QQ*V P1 m/"1lR' /!|a0yM,@0U0x `1R `VD/0S8S, ep/0S8S PL@P 0P]0 R0 R ` P |t`| Ph /`PT|Z\|WEVPdZpddddt\x\ZrdAdedAdsd d -LM( R,@:( 0e/.eT *0 SR:e -LM0pS`B0S0%  R2!( , 0 4 8 |< l4S X("PB4S  <w0B4Sl4ScP0SZT0SRP@\0 S@PFUں(PU@0S PU@ .iPa  0@10p @0 X; 0S S@!18 0. 0S S (   0   @ t@ \@0 M0 lETp`U(7XP@H0 Q B0JP@ S700d1d1d1@1d1d1d1X1d1p1X0 M 8@p T`P0 ?  `Pt l  \ XT ( P@ p`A>P?> -L,MB0 80 0P, 4  ~딠p`0 w0S= / +P80BUa ,P 0lP8 0S 0ڕX څ!,L, D, 00Sv Sj ,$$""4Q 80!R,00CS0, 0  ,0, oy,0 8Q + ,008+P,,00* C R +, 000 08@+$ @,0 08+P,,00* C R , 000R,10R,+ ,x L,T80a ,<g,fsHfPfTfPy\fdfpfxfff -LMZ0, #00 00pӑ Y33`  v Rx3x!tm0d h0P cY ( <], 0Y0 $U8 Q4 M<  m+. P@&PtB Z 0 :Y  0 Y&. P@P[B Z 0x &$h"Y (XP2LL"8@To0, 8@T$$$P T  0@ \0 BS@TZ@TP@\ xPU@ :,T0 D 40( X0 00CS00  ä0P L 00 X00 X0|ffLsfffff g g8gPg`gxgggggXzgg h h@hhhthxhhthhh -LM@0p8(0 cpP P@| 0 0C!0>|PD 奴P@\ o_Ke/$++P P`D e/\ PP3 DAp@ ZX`D(00CS0X0ӤX0 PpP A00CS00Ӥ0 PpNUnU\(0 S ('=T[p+W54[T Z <ZK0C 0C00 )P4V4 P 0S44X0PH`0S440044 PV 0S0S440 0S  440@40@4 )P+VpPh 0Se BNK@D@D 0*04S\  4 44!\0PpPL W00R00SB)B~KpG pG <P 8V`LP `**BP:PBNK@D@D0 044 S;;S(  04O)@40@4 PBNK@D@D0 044 S,  04)@@ PBNK@D@D0 044 S8  0\)@$ @$ LP BNK@D@D0 044 S0P BNK@D@D0 {044 S4P BNK@D@D0 i044 S<P BNK@D@D0 &W044 Sptv8P BNK@D@D0%D044 Spt~P BNK@D@D0p%1044 SptvP BNK@D@D0$%044 Spt=`cP BNK@D@D0 044 SPFQP a0BS0S8a AR:R `0A8BV< B.K B BD$ PD4` 044 SV P D4`044 S<$V<4 `- DPT` *0S ޮP #@T:q30  00S044 i04S44S (044 0< 0<$ @T6 TV* tP `D4<$P V ePD4` u<$4 o&<4V TL"D4f<$P''V ?PD4` O<4P~ V 0D4 B<$4 <&<4P m D454 <$0aC1 0 '@@ ]'@$ @$ k,0 @qS t,n d'@40@4 /8'@40@4 z')$ BNK@D@D0 044 STI440CSpבxʑ`'@ @ (jj-` k`Lsk0X8kDkHkPkhktkkPy\$-kkkkkk kll l4lssTllllll m -LM(0S`d ,0S 00SH 40S Q| 80S0 ,0<08S804 <Ph (u%PaPY (n%PR8SIPU@0a Sp>P7<P-00S$0S0S8PU@U2 \aP 0 &PU&&&< & &8&&x&l&`&T&w&<,me/: jOKe/0e/,Z  . + 0) nOKe/e/VOKe/ e/(8P"OKe/e/Z    0) {Z      .v7 3Z]UH0| @P3 RLZ )9 e/@ P< tCtt#tPP  R0000ӑ yS0 R000ӑnSU P#00ӑyP p2 ,0S ,L|  P@ `#e/~KO COU ]P@  0e=0R $$FPP0S e/PZ q POKe/=e/9e/5V Z 4 |81 RPZ  )9j e/P   kPM "Ke/e/ ,*rr4shApsPyrdAxssssL`TFs:ssst|p dkiVp0( KBNKa@D\0 (K@D . 0<Auuu:: vLvtvvvv p-RLM0@`+ a@ R\0"(\` ph- ^0S  0 SS S0d0T!\ ph (<<fP0, 0 phvvuwHw\ww -SLMp 8Ka`N‡PV(VT` P 0S0Sy  PK 0 SSZ, [RW R08 0R 0 @T0 4J 0 S?0S< 0S L408   P`1 R 0SS 0J(U ` 2V Pv01  0S0S" U <1 Q *(1 Q :0S S R000 00000 0  ((PU2UP 0S S R000(U @@1P000 h v::Pxvxyw -LM&KPpT b[P1^PD1@0!P * U:U: Q:Q"P^^@(1 Q:00Q$^T 0`S 0!@l0Q` PS 0S`u0S@0:: -RLM0`pl a@QgJ(T` iMR 唀R 0&N  0l!00`1 \ p; p0 3 P 0S S" P0bS0c00 Ri7 P i*0 `0T< 0Sh. 80i T (@@AP0vvHyyyy:yzwDz`z p-LMKP@ [PTPT`0 R*0R*0@  [P"up::0 P0:00 -a0L0p@TP  zM P P0 S R @000?S T S 0?S h`+r JX0 ` BR X0  äX0 ˝86hPyz -AML M4 8 , - MK 3(K 8 BnK`Fs< `F M 㜥 RpS3(@K @T 0 0S S@D00(K0?S (K0*S 3(K RTD   0SQ"0000ӑcS &S %S 0@-S+S@84 0D K0C0C4 , p@2(K0PS`V2(K \ @   0@R1(K T1(K `\4s1 ,0S ,uy 0g g0C B#b"Baa  X8 < KLL!LKH 090 03Y sBKJJX@8<$rK;K  ,CP 0(K;K, S QQa B RR24  r4 mL00CS0X0  äX0 ˛zzXzgg { -$LkM0Ke/ ,0 4d#K0!PP (P@ "P' @T`t\ KX 0 @@K T8@ 4T00CS00  ä0 v T`@ UPP  )P,#3P P@t x3x t ,@0\#\3P P}@t 3  t 0@8 # 3P Pg@t 2 t 8@4"2P PQ@t p2pk t 4@<@T44T" L2@ 5p@S pb <PRR0SS T * R 0 dRs0b00S@<@P!1P P @t T1T$ tC Dh!h1P P@t 0 tTD+ 0 ,0S ,_t0   e/ 0 a00`G h0h @ H0 |8{t$1\{ k{{{{{@|yk`|k|||k}:@}k} } ~w~ -8@TLPp60S S 0 (S"H\T& qP`$ 8@T0S S 0R8#H\T@<0 P @lP~ -LXM|`K@X p }PP 0rSPE |0@Sb00C8SFFbIa嘁@\I T@ p1GT0\0CS0<0  0DD PP 0OP* @IP" @T2I 04@)I T@ 0 T00CS0 @00T =Px0K @1SE`|~~t{~~ k{{ -LMp<P@ 0P@ @p <P*`f ax x0P@ @p <0 fP0 0`mg((0 m: :Plw -LM"KP< @0S0 @ 0耟  2[ 8#Rp`#P1 0 QS*10@  P 00!10 pP!H0@ 0R!705@20  0 :8::0 < 0 ::A-p刀0 P0b0`Q0S S ^ @ 0S0T0%0n 0%!Q:: -0LD0C6S[T܃܃܃܃܃܃܃܃\܃܃܃܃܃܃܃܃܃܃d܃܃܃܃܃܃܃܃lt|܃܃܃܃܃܃܃H܃ă܃̃ԃ܃HhCE@<840,($  EEEEEEEEE E E EEEEEDDDDDD|x,Ԋ؏l$0Ē8ܓ(Lp$L ,PtȖT -L`pPAT 1SPUnAq@@oP  oS p-LM`P@PQ@TpP Q kP pQ -LIM MJ~KpGpGP @ , 1JnKS`F1A@TP,0 S ,Kq yP0rSJ /NP@ PrU B>K0C0C4 000 !P@0@@ K LPP 4S JnKⴀ`F10 "\a0@|$ַTʄ1SBKAA  0_ؘ0hKLlu -2LMp`@0P0 $ \0 K~ 0 ~ x 0p ^\ :` 0X ^< :o, kgy::w -LM`pP@0 0 08!0 01QQ p: p 02 X P 0 0S A;P V 0 SS Px0`000< 0S40H. 8 0Xz\yt:Lzw -2LMpP0 0|0`` `@t P0P tT @( C  ` tyw -2LMPQ  0  @ e@t 0& t 0T:`epW; 0 k\l< X0 @ ,叶0 0uԛ yDw -2LM`px \p0@PP@ @| <0< |K DĜȜyw -2LMP 0 Rp`0 0` `@t 0 t 0 @ 0xpx!txP` @ P @T<D 0 0T @ywu`h Q-Lp`( P% P# P! P !@R @PP ֜@T! 0 /\ PP 9lP 4lA4 $0Н؝X wP0S  0 S  -LpMpK`P0sep 1@T X r0S@ 0@0gPc0rdAedAd -LP\p@` 0B0C3SOꬒ44T <0( ,0P<0( ,048  1h W <0( ,0P( 0V ( ,0P<0W<0( ,048 ( (0R, ,0R0 00R4 40R8 80R< <0R@2 44 4:P$ oD`Ldw0 P 0Z<0 0Q1 -L8M0U@p} 55 u  % 5P<T$4@  $Pp 4Q 0SDP PpdP(D0: S  S  S0 0kp{ 00 R000Sg RD?;#003 <0S c#?;0P@ ?LD T@ ;00S  ?+83 0S,3@T c ?2"@@ 0S H2 AR;;S" ":00S 0S 2Ql2l"d2T"H2D2q7?0S0||\ K1Ps1  @ 00 ~?!0!+@ 00 o ?0!@g0*?0d!@T P!P00p 0Q  >0!?0 0T yP>0 ?0P 0<0  H0u`}Dx}uu||ģX}\}T}|ud}u|x}m8@̣(D`l -LMc0Ss0S 3 R S0S3 Rt3 R hCP?P,K B0S 3 R| 0 0R  R B 0 S "000 R2 R0S㼂 00CS00  ä0N00`V xx20 0hP@2`DBHP(@ 0S 0+0 ϲa000+ۼP !1aA0 @@AP|該 @ 0X$1 v@e0APR0: SN8 @TI0C@D0 R㬀 00CS00  ä00 np( ؑ808 $0u}uuDx}u||Hxu`}}Xx|}}p}Ȥ|X} -?MLMt0t` R   0S P \kDp0S?KK@D0P@D?+!dPu@uu p- LMP|Ut`0   p@0T PࠡI= \>uuuL -\0L RL H0 @R0,0, 0>0>ul}d}} 0-QLP) 0S-x0  cP@ڸ0 T ;;S0@0T@|0 t=0<\ 0T =00  cP@0 0uuud}|}u -b0LP@@xr PP PX"000SQ Uڅ;;SNU8U0011 U00R@@T U 1 Q Pn=<!0|!=l1 h_=\[=,l<0S h<0S d<0ES U0P0 0 R0Q/~PUE<0 S A<0S =<0S 9<0S00PX=00 000uuuu|Hx(\u -1LM R*ʔa0S& !00CSYxx0Sp1  0SKPPPȤ0S0 0  0S<<[0ȌlȠ@$ K$ @ qP@0 HP U0S \p0 x@0T@_0 '0@TP 0gQ00000|uDx|u|Lum| -P@LM0 U 5ࠟP.0 R  05p`W 80 S80S*0S@0Qf;@ y<000Puuu| -L M䁟P@P!0SUT!<0000U$ha 0 RQ R 0Q;!,< 1 R  ; T:P0U$`0 a[0 njlȠ( `0P@( Kd$@ |P:$0H ;<Tuuuu4\d}m -?ML M804S?KK (@D, r@Dz r"(K0?[K<(PE0 PE00 ?PAb0 05PV?KK(@D@D?+BaP`G?+;aP;@@ HP+X@  P000 P ,0 S ,=h^:0 p;>;R: e;L: G:p  B:` ?: ?+`P}uum@` -LMdNK@D0 @Dp (0 Z Pw S P30l P4}  }}}8H}}}`}}}Xxh}\ -LM⬡0P,P @1`pD3P P00SP` PUD1 R 43P 1@ 30$P$ 0S U0 R 3P  @0| ,0K8P P.0ST 000 08PHx }DxЮ(`} -!LM0S|@ a1@11 WpQPpA\PX@T PZ\A1 R V3O3@0S`P111P 1 110@1SZX0 R H&3HX,@\ӯ \h @xhv }DxPxHx 0-@0PQ00L ? Q ?;#ʁ P!~ Q ~<Üʘ0 0P 0x 0t0p0 0P02 8PtIt1 R000 QJ0P 0pZ@T_UTQ 0S%  Uڨ 0S 0@  Q  R 0 R u/Tp0 R 0PTp.,  0/ }}}P -a=LM0 a 0 4 {PP,d  P 0S KPrP0S0 aq T@T 0K ڰQR ;PPşU=p1 R `1\ 0.P \ 0S  1 R0 SKP a=p Q 0- 0 .-x 0p .D K  ; -0 0. }uP<d -pL0S@`@PPʀ0 @ xP0@0X0 <,0/$0@u }u}|}}} -\"LM`Qp,` <0S 0SS.@PrB 2 A Q0 `aȁȑȡ!A0PP 7 Pʀ!P 0R00`bP1 (,0/0,0 A1Pe  =0 @00Q P,,0, V ڄ@x0 x0V0`b0X 0H0 (0 0Soh}p}Ȳ }u}}}Hx p-LMhP0 S\` @TT 0S40  p000- uv= p-LMhP0 S\` @T 0S00  p000- u v0 p-LMhP0 S\` @TT 0S40  p000a- vv=d p-LMhP0 S\` @TT 0S40  p000=- vv= -LMdq0`SP P!#3!"c10cAT R$0S9 Q0S/ T P T $`P ժ00T 0$`00  aXPp0(&P$C12dAV@d@000XRPu/>3u Py -LM\q0`SN H!3#c1c0cAT R$0S8 Q0S. T 1P T $`P r00T 0$`00  XPl0(&PC3dAdV@d@]000XRPuu Py -Lp-PP 0S ,0SP!%0aV 0S 4P0S$0 0@0S# V lP00 0$ 0 T %P(@(V`PTP0000v=u -LpPP 0S ,0SP T%0aV 0S ةP0S$0 0@0S# V ⫩P00 0$ 0  %%P(@U`PP0000vu -LM@(啩aMP@ 0S г -1LM 0 bM@ ^0 - ! ^  ^ a0 :#:900 P \0  ^  ^ ^  ^    0-LbM(MPbMK@D$@D0p 0 d0 KX0P  0 @0 0 0S )X0\г Hxܳ 0A0- SPL@ 0]0S8  R0S+ 0+ -a- `L0Q!0p@[ P20P d 0p QL *4 $* PP <Xt0 KS- L0P 0霴 -PL@LPgb=0  |1  d1  Lq0 41  1$  1*  00   0A0a-   am` ;t P0@09P0: S `0  ,h 0S HP (,$0H8 W! -LTMr0 $0 @!P2b- 0LS`P2`  0L`pPKS񟗞<<<a=0A 0 PP2 HD 0L P,2 0D P 2  )$0 S $V1  0. P1 0& P1 0 P1 0 Pp1$ 0 P$1* 0 Pa=0 0 P; 0 PLPP00S S S S  Pd0 )@0l A 0 Pv A0q̴ (,$,0 mS- L0P 0P0 mS- L~0P 0X0 8} -2LM pR@ nPb0   : 2  3 l"0 , T2  % <2.   $262a- u am` & 1>   P F $04 4!N0 P V $04 4`!f0 L1^  P@:0@0P3n000cBP) 0: S `@0 0S@P0 ` `,o 0S P `@0 0S@ Pn#R} (,H8$0 |0 } -H$L|M0 ,0  P $00CS 4   4圐K R 0  P3=6K 0 P7#00CS08lll00a=0p`P@00S@b-P ``06  P03 ($3 0i P3 0a P 2 (2 ,0S ,U2 0J P2 0B Pa=. 0: P`2& 02 PDR>0 0) PF 88# 0 PQN0 0 PV 88# 0 P^ 0 Pp nP/P*Pn000cP@P00S S S S  P<00cPy0 'sq0b= 0P@60 0 PL [b=0P@06\  0 P 0}q` (,$ĵqQ-H0 4S Q 0 S  q} -LMPpPb@03 R 0#400"400"40 0"40  0"40  0"400"40 a͠$ 0 `48 0`  !H8 0Da=$"$2T:0D0P300cPP*!0: S `@0 0S@P1 ` `,o!00 P `@0 0S@ %P0 400 400 40 0 40  0 40  0 400 40 a͠$ 0 `48 0`  !H8 0y} (,$08H P& -%L0M0 (0 H P4H@ AR4  0ASxlxxHPa`%<%8.K-0K.[- [%<$,0KP0K+K(,0[+[pPPČ%H8 0P`KPH0`P@P`b- 0^ H3 %S(0 S (R0LS#H@4B0KAKB [A0[4Pq 80D KC0K 83H@@ 4#H0 4@0K?K@ [?0[4P#H@ 4>0K=K> [=0[4P" 4<0K;K< [;0[4P" 4:0K9K: [90[4P" 480K7K8 [70[4P8"@460K5K6 [50[4Pa=@,@8@4 K30K2K1K4[3 [2[10[ $4(PpPE400K/PK0 [/0[4UDKP2P-000cP@P#D1H`0S S S S\H  ePH<00cPLH0 B%EC0HP H 0 @@,@8. K-0K,K+K, [.[-[+0[ 4H0P@b- P0@/HP b=0+ K. K- K, K#0@L (,$x -0` LK$KP P0]P| P#d 0QpL0L xP0, $ }(,Ķ Q0-L@P%IP/0 R#0U0 R0S 0;0 R0 R0 R 0a  00h0P0 L0L P#0( $}} LxPx8(,ض p-LKtM @`KPP   \L0  Fp]$pp#0 00$0- 0P ) -LpM`@KwPP X0PpWH0P 0R ,0 ^$P}P -LtMpPK@MP1 R* 0R5 0: S, (PEP # 0Q` P X 0x @ $X"0L $P 0R #}} -MLP4M H4p , t * $00C S T p  x      3}P3 RIKII e4S+P) "#0@P \ `3 RT3T P00##3 ,0S ,RP3P 2 Ro 2 uBQ R0P0 R0Sx"0;0 RQQ B0S|2 R p2a  02L P P0SBB0S1 R  IKAAIP!x0S$\1   "4t!#d1_1 . BnKP`F`FU!B4: S>Kp@ Pp! 0"00 ,  %x "B X }}}(,ط}}LxPx80Dx p-LtM`KPP 0@T0: S M'Pp!L 0"pGPVp{! p} -LtM0@/SP @//`@pKT/ `0S0S ĵx0\0Sg0S! = } -@LpMS` Pp0S 0 R K>P0Sl00d0 Rd00HP!00 "  0 "vLxPxԸ -LM@0Sl`0察P 0S 04 !$0 RP} } -LM@0Sl`0冟P 0S 04 !$0 RP} } -LM!@P  0h!D -LMRp, `1 0S00000SPP0e0 peR  V@*0S@T*0S T00- x@ x@@T jP`W,0cI  0 [!pW(KP  U0p\!x/0Q`$  0 }}d| p-RLM`0 Pp@0T<  P 0ph! (vdй 0-0@SLPb 4 0R0a 0h}8 -ML4M!0QP,0 pG`1 KK`(@D@D V k#  kFP p R0 RPa- 0S0S 0  0 ,0S ,vMK(A4A rP a=(K0Q p0| 05QX0P{4 0@  s 0$ `, -0 0R00000L R0000 R0@00x0 Rl1Jh0P PP0 REP$ }}}}0v }}H p-PLM@` 0S pJPP @P0/S00H 0 S8 @`0 0 PPPPp x0v4vd0 R00T0T QH0  \80 R,0 P0M 8v}}(}&B`P0 \*L -$$q0LS`P P: 0-S00 00 0S&0@T0  ᡙ:TP 0 0:S l R1 0 LP0ᐏ?0C0 h,}{ 0}@X p-LM0@P/O&|P00l0僙0SP`ph8<x0Sph00ph} -LTMptp % kp 00@JS񟗈+,,,,,,,,,,,,,,,,,+,T,`,,,,,,,,,,,,,,,--,,4-@-L-,,,,,,+X---,-,,-,--,--.,..///(/0/,/p(4qDTA0S`0@0w, 0S 3wCۘPv  4 u t4Po\j43 Pvd43u,3u$33t 2-Pt29 Ps2s2r2rBp2P: 2p2pH2p 2|2 pt2@p}l2pzd2|w2|qP1@ 0S `Pa0CS"p................1` 0S{1P1P1P1P1 `&t1p1{1PzqT1z-L1y*D1y'xP0a,AH0pK @p 噺<1P@x 2 0P@ PUH@ 05 0'}{ h}}Н}}P}}}}x}$}}X}}}}}Lx}}Px<}}}hv,CTlq\}n9XxwHxu} 0 DxBXL0@0t0 X X0 t0SI0S| |0 0S@1@1111 0S@0P0 0S0w 0S @0P 0$!0S0<1 _P1 RH!d1 pQM Q ! R 1R B Q @A1A0t0 001A0t0 01A0t0 02B0t0 0 - 0PDDLM@, 0 4 8 0(Bp 00@JS񟗾44<6<644<644<6<6<6<6<6<6<6<6<634<6<6<6<645<6<6h5<6<6p5|5<6<6<6<6<6<6<65<65<6<6<6<6<6<6<6l45<655<6h5<6<6<6<65<66 6 6T6(6D6T6`6t6|6<66vfP040 A606666|6T6t&h640Y8  6 86   w4 8CP8  YE6 0 f5b5%5 \0X5 | 0-S 0 , 0S,  5000 Bx5x%=l55P644 0$0,0%000( 55 %, 5R Q@b $4 00CSTY  0S6688YpP. Yi 80I`0< 80 VL h$P\D;P< mPp$P(4 RYPW Ø3 , RPC0S 0S §P 0S,30 ^t#uP@\ LוP R2P 2PpĕP `P x2`0P<0 20H CQ0"Q0v <2PlYPN YY 8 I`0 @0 8 V; @Q P1ᐕP B CP PပP1 RY0  tP@x ~`\P P0 O\PPUHP `P`P@  FP.P \0S X}Tx{ x}$ؽT}} }}`\}DxuPx}}}}}XxMh4}LTlwHx -LpM`@pK@@ 00RPP<P0: SU/00 0D 00SP   -4L$LM4$䄟P4 $4p $p 60@DSp>$?$?$?$?$?$?$?$?$?$?>>>$?>?$?D??$?$??$?$??$?$?$?8=$?$?$?$?$?$? @$?$?$?$?$?$?t>8=,@4@$?@@$?$?H@$?8=P@X@$?`@t@$?|@8=@@@$?$?$?@3x3x#000d3+ X3oH3@c@sP@ P c3 R J Db尒ŸH0pK  p 唶2P@l . 2` @ pp`VH@ L2PH2b 0-S 0!0S "22!0291100!101|1!0&H!1r!!0QS@@,A,AA R PP R860S,1 $\P 0 R   R 0 PP  }}}X}Dx}Px}}hvHxx}{ 4}Tl,C̾q}`\}v}}@w}Xx}uh} p-0LM` |@P1d0 P0R4BDL S00CS00  0p phh}@v@) P00`v -L0L R02 R  `vHp P-L 0S&P1 0PS$ p,˒Pp`=ŒP@ >P  ppP0VPPS0  U  0S( ? |dv`v  p-LM KPp qd R0\4P0 0b0CS#EEEEEEEEETFElFEEEEEEEEEF`P$K4 V U  0xS S *S p`P0E" $ VUp`P%%K5`P*%F:`P!%O1Q0r 0-LMKP+qP @"#  0 S R O>PP   Bz0 0 C 0 0 4} p-ALM- 0aQ 0 0 0 0) 0x 0h, 0X$ 0H 0 0$, 0# 0' 0P 0 0( 0 0% 0 0) 0|}( 0x0`! s[@Ŀ4Dp(Lt 8 -4@LM= 0 R08 M5@\ -p@LM@ 0\>4 0L9E 0<4B 0,/0$= *@T -MLML0P`(0  0S ,[(0 S (F@ @Rpx 0\S@ S  R ?R ;=PP`  PI000S  \R 0R 0S P=P 00@0@0S PS" GS0000S 00P 00PPP)=0 0gS pS00BNK@D@D ;rD 0=z(v  <D3=X0X P#3!"c1 0c!R 0S R(/>3dx p-PLM@3 R0 (a0S= 0#S4 \S. +PP$ 0"C12d1@cP 0S P6P P0! 0px  ` 0#S@ mP,0P  hx/>38=`X0X P#3!"c1 0c!R 0S R,/>3hx -PpL`@ 0Sd /6PPp0 S 00C S0u 0S}6P@j U 0SE00㔊0S1W 0S !0 0P!10@ @@P000 RH 0G }6, @ v6; P 00000 0S MS CS000 0S 0 cS mS00dv,QW0p0@ .QT@}  ( \x`x(Dh@-0\ @a 0S)  S   0R  0R \\  0 S0S 0 S0S  0R \xH -LMPk0pS@ q 20  00S| 0SEvT`q @NP_0 1 !.B=R pGV0G SRlkkHkkkkjkkkj 0!0!>C111v>C 0C0 !0!>CP00 1 !.BR00 R0S P&0B00 1 !.BR00R0S P0 1 !.BR P 0 1 !.B;R typ010!.CDR Pk?C@.PT @} 0-LPL@DT  0o0S0  lx  -LM✁`Pa 1 R 1 Rl1l!11a11acAT pP0 S @T0 0RT 0040h40lx$qv -dpL0S ` AT@0`V01P@Pg4e4Ulx p-LMP@T0 p0Sx`t 0 h0hBΙX0P0 00 + 0 pxG}}0x@ -ML0M (R04 ,0  2 ,0S ,64! +!8 0AT ~KpGR0pG8 @T3P@, Q0 0Q  P D! T34a=  8,1008 A  S0`PS 0S0B/0S  xPT 4a=0 S0ń~8  x$ pxdGxp 0-LPL@DT  00S0 A tx -8L@T`0 !0pAT PP! @T 3P@ (P #P 0! 0A>3<3h T  ކP .3 P tx8d -t@L0`SpPP -0AT ᴆP @T ᑆtx 0-LPL@DT  00S0  xx= -0LP -p`LP% 0Ƃ"S12e1PcAT 0S @T 0ST Q z2P@ 0`0 10 Ajxx/>3 -1L M@\, `p? ̡1 0, @R@\`0 PPI P 0S: Pda00S0@P! 00S00S %2P 00 0 0    0, PhPP 0p p00  ` WPP 0X0@ 1P 00  xxx4 0-LPL@DT  060S0  |x=l p-LML`0S P0AT  0@TPOUp|x -LM䀟pPP, / 0"c12f1`cAT 0S @T1P@ ᔅP pP ,000! 0A1(oo0ST |x/>3 0-LPP 0A"#12b1 cAT 0S @T00 ST 00 00s1q10|x/>3 0-TPL@ T0 04 @00'10S000x8} -LMP0@SȠp  0S P@0BS` x0 (00 徐 L 000oG1`V$ 0`00x8}x -`L0S$ PPUJp0"S@0S 9 0RH Q 0PUZ0000xx}LxPx p-@Q0@LM@C!1`@P  KP*0P0:0 R@U K0P0,*0P0:0@p  -P 0S\ \P00S0 BSL`h~00L\:0000L \*P\:000L\*00L  L 0 00L 0@- 0P@CR,400L\ :1!P@00L \*0\:000L\*00L  L 0 00L P-  *0 R: R$0 R:  Q0-LP0 S\  u0S @T0   0錼P} -LM}P@ 塃Pp圃P \ 00CSP0 @ ($ 0DPDxL}X -LM@, P, (#, 2,3cpp0K0CS d, {R, l0  , p,2  t , g,2|   a,  W,`2a-X2bb0  00 02R(0 ` >0R 2"00<(@ /R m   @<0S@P `1`) (@0/S  00C0L`1 41) 41  5R K0BS` 0@Q KP0  @P00 9p 0 0 :0xx 0, V, 0LP , L, E$ (,H8  }} -|3LCM p3 B, R̈$؈$,3 R 3 ,0S ,~1BP0SPcU :"K(d KC0b S Sx 0CSU Kd 100K/K 0P>KdH2 0P >Kl$20 P  2 D>Kt10 Pa=.K0 PK+K 0PxK7P PBS$  #0 $ 0<2S x(@'(PKdA (KPYoK P0 `A \A XA TA PA LA HA DA @A 媫P\C000 3>K 喫PVPCP_K|#^?K@|A PHx!1RS@$0vP0;CS0,084Q0S|  X\.d+A |%!r 10C1 3At0\ |T0 02&P@T00< KcK0 ! O`VKe/K:1  < K eK R p0S:& 7 @) 0S Rx5  1 刡 < 00Ì bK 0%PʱP 04#~<&r,6,T&=K@ԪPhO\&Y?KP0C PƪP Y?KP0C P帪PwwF]?K 壪0(K0@00 Q O? K \300 0p1  000W ]?K} 7 ]?Ks  P@ 00 -OOK,y@+  0-LP:"0^  x0\*uP0\@ PL0@ Dߖ@P@4G  Dxx -LM@@ -MLMXXb0PpH,0 pp03*0* 201 0 2 1  Q P1@ԡ`0 810 @@Ϡ0P0?P P$JKx!(@D@D0h!`PŒ 0P ,0 Q  ,9( pv`8#8P#$0$ @JK(@D @DAK<:(<2: !<(K0<:(<2:(LL!<  0Ex@xTx(x0@ -L4MD 0K` D 0P@K0 Z L7  N  ,D h0S '0S0 0R0; 6"  L R000 0p 6F 0 B0p0 \Ɵ0 ` DX@0S #S $C0 0c@BHX@000CS00  ä0I MS7 S@PHUp|0 ă ā Ă< 4 <( "4\,<PEU, pH'W 00CS00  ä0MPHpWp!pW T0W6 'W00,P|0 ă ā Ă< 4 <( "4\,<pW0 PH 'U00CS00  ä0@M p/D 0T Phß00p@gU0#DHLM$H 0 \DP0S.W)4S4#0pW@ *0 @S0pW:e0pW@ *0Sp X0W:SPP@K0/鯔PKP@0/0 \> 8K⾾48 < ( 4" <( "4, ! 0,< `Rc@0 , =9 A0 0 0 =,0 2a, 3c#0OPK< LH0`KqPK@ P K`KPKH 0@PK\,!L@0SPK! !H0Sh0L@Sd*PK`T0 A 0010Z1P7   p@@xTxdx~~xxC $,xxxx@MQڲ0AQQ00  8#8LȃLȌ 00Ѝ -ML$4Mx4Q (K @, \ 0 CR 004卽K(IITK(JJT$0 t * l0# * l#0S`V* XͤVP@ǤX0 ϩ - P@ṤV0 8#0 ܉ *al *]lQ 2 R &  ,0 S ,K%2@2@P0 bŸp`0 [6@PK0L X0/0K)K@ B0/㰔0/P@@;0/P@@堔0/+0/P@ @吔K0LP@0/@)K0 BP@0/@~KP@P!<0 @[ *k i W P@M  Df  ? *k3K (JJ0 1 *k 0RJK(II l*kY@ATpL xxxx8 -L0 K M00, 000K 0 ធ p/? 0@ @ _` Q @0 RQ   -LM@㟗T (0PV0P# -LM@Qs|DLx`h6Qػ <DLT\dlt| h0S #!Q 꼼pJ`XPLHDh~840#$(,"(hq0S S0Swusqo0("#<Hd(<L\l(DXh|,Lp,T`p p-L M0@0akP0 !P )) 0 UJPJtVP`F `00CS00  0p phnI(V`F4@T\ -0L M0 K0 P@ J0888 t(J0 k,~d -LM@0 01R4 R(  0 $hl -LxM0`S qP10  0D0SJ 0S TKPKLKHKDK @KT ,@5T3\ 0@S 0 1R0S 0S@ -L0 !0 p-0LM 0PaQ*@PU:F P@ x 0P 0 Q@ 0S @@Tp0S * 0 @0ԅ̅4 -LMСpPe 0Qi$0Sƚ LPo0@0  Po0 5@"%$0& `P; MP P (` 9P 0S 0SZ 0@ ePvH0 0QO$ 0ZB!=܌ -LMp 64 *, p" PP0S40UX0SP `4V ,"0 0S@P1 ,40X+0S*kP8 #! P`S/0 P\ P8 L4,  00X00,00 0S0S,0 2PP0S 4, 0t 00PPPPX,00@0& 0 0 0$0&0PO}t0Sqm  - qPFL` l0 Q00\0S@`.Q,*\ L0S `00S  0 Q0/S0S:0 R P /P R،  -MLMp0P@AnK 0 `FmP`F 0 0U0 U00S0 UL 0S l e *@L0S D 08: S0 3  4،@LTF -L@!x1hFSP/ 0Q0 0 : SFH` d0S T.0S 10g1heh!P  hPP 0hWPxTFXȌh -LMa0P, 0 (@幩tt1L pKR `0 T! 00C SG A?K K0 0Q0 00nS 0 S 0nIK00 K pKA/00, ݷ       0 p-LM(`P,@MP ,aP p  L0S$ `0! 00C S0 0p00000000 -LCM M@$E~KpGpG 0,           `$ \$ ` 3* R@ R  ģd$ 0S P, 0S 댃0Sx3 p3(K h3P\4 4 XT @T40 @T8 0@: S< P,0 S ,2 2@PP 2 Pp2R( K"\$ XD @Aj0 "t@2 R0S (BNK@D@D# P@1 qd4 S00C0 uy !C1@01 000XVy H$0S ,@(pxC0S dP^ 0 LPV 0 PP@ d0SJ OG< @0S? <|>PI TFȌPx$0x8,4d0L -T0L8M<0 0  8 @ 4 0K0 , ( $   @K -CML M␁0P0 P00SP,  d1Q  0P1#\Q:,0 S $,EKJ J0 0`$ ( KX d 8 \ }0`Fp?P ` BNK@D@Dt 0dpP  K@/0،D -LMaPP@e  623 Sp(0S RP, ,0((0,0 0 0 0S1&ᐵ,0S&&兵00,0S0 00 t0 R <@@x|2P0, @( ,@ 0 a0C0 ,`0 (0ϱx Ȍ4@ -0L)M1A1 L0 B0Q 0`!0 `0000L0 S  `0 00 `P(yp@W a 0001V' @ 00CSLw00 0S o1P01XQ0P 000,0 QPUx4, -@LMT F10C1h@-p0\ ` L00n^@` 4K0C4  01FAPo \ $  0 =00S00Y X |6#1@% "X`P$R<1 ,0S 4, 0P@v00h00@6  0yP`Zx 0i&(0CC1lh0`00S  ow 0;SHHPtL -MLM0\C\L#, 4 @(  P@X34#A6T< 4 ` #140\F" $p`B6# AV#1%Y X @0 0 6 X2R^ Qd İ\0 iD80  \0  [ >ȌЌ44TF 0-(0@ LRP 0 ,喰, 00 0-(0P@LT ,5iP  T00T0S 0 T @0، -LM@0T0 T00S0 T@᫸Qpphd0 R T0K0 V 8 (، ЪȌd -0LM@ 0h ;\ 00CS  00 00 r (44 -PLMp 81 Q  @0P*0DS9@T:0T j V- * VĀ0 0bPP( 00p$Kh$ 0 0 h640  H0F  V00 R4،Ќ0 0- L8M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@4 ዯ$0$  00C0044Ќ -LM@Phr0 `0",pM b0@SB 4<x1 b 0`ip1 h \!000`01@ m0U>0(!S 10`00!0`00 0@TQ P 0 R T@D  0;T@DlzX] T0 R Z(Ԍ̌L{ X x|Ȍ8CTCx p-L@M P`KbH0S 0S  0 p -LM`t`ğ QS, @ Dd 0S 0S3 p P0S 3 ,0S ,\9 0ṢģL0S P]먓0S 0SS0\CS Y0S 0S <0S @C 1 D@! T 6`Vh!h1h!X0 d1@L@@0,@ \@ ,0KT@ P@ L@ H@ D@ @@ <@ 8@ 4@ 0@ 6`TP (0@T*0U U@\K (0PT*0U6`V =&ꀠ?>1 L!\  @YP ?>1 A! @TڑRڎ<0Ќ -LMpj0W0 W00S`0 0S 1S4  4p0S@600CS:l$0S X V@ɹP X X X  X P@1(@Q0 T @P@6#Q᭹P@T1X@QtT PY #0001 01S<  XT3  ) X3(&P3 L# p6$ 4$0 R "0S $0`0 P0S22   {P 2p pl P BT~ 0H0 P0Z$ Ы2 R C1 R ;T\0# PX @@T%@DT M1 R #s P @2&6h!0 `<1 RD(K0 ;R@0 $10S U0SM P 00`(< P0S0S p3 P\ ^mtt4@ȌЌ,0 $`0Vą4(8H\l$Py -LM@PpPpe`VWY!?> DR.000 0. $0`F0V$0@X L0 S00*P (@ R00  0R 0S R0R0S~ P ~0 R  P` X0 S00Dō<<!<$ ,Ȍ $Py -La8M0&0Q 0  p 0KL P H D @ < 8 4 0 , ( $ @0(0PU *0T0 T00SP (0@U:6pW<0P 40H@ PK0S  ,(4 -LM`VPڴp崀@PT 0S  0T @T R 0S `FVP 0  0P 00(  -MLX$MT0,0   BRl| P $PC3EKJ 3 Jv0ß q3`R( K#d `$ *B>K0CMKH0C4 HP RP`V:0#`V*0CP\ `V::2 ,0S ,x0S 0 S s S "u P" j  00C0 |"lb Pd  000 00C0  0RBB60C 1 (K KK$ @$ @i0\4  X$  0堑r6 0SF@⭶0 RT P00O0 $`1Fᓶ00 P Pq Pd P 0:90|o4Ld̅ԅ ,px0DȌ$Py$0 -MLM$p\0,0 (`; R 0S L0 S8(K 4  `0 A?(K  A?(K D KKMa0((K0Q 0@^^>KMK ᣨo P$ $\ 0S  R0.S $0'$00Q0Q0 Q00SpG h'dI X (,0 S <,.00 00CS񟗳  4 4   $0S&&L0S6 `03  00C SK$  $  $  $  $  $ ,  0S 00C S'|            00&N P%00C00000000      0S $\NK @D@D0, S^K PE0 0%5 R $\00 PO$0SL0 R$ 4 RO$\ P; ;0: S0   4$009$\R  0.S  00a PbS L0S|3(K4!  `0A?( K A?(K KK `$\0 0 Q0hNK0ᴀ$00$03  0`0C0 е@@Q @T; Q 0S+ 0 SP $00$0P "00C0"_>KMK -PH"OD000.S "C QP00L Rm `0j 0Sg '\@P^>KMK @d$00$0@1  0`0C0 [崀=@}?P_P( s50.SR 00Ph L0S# `0 0S 0<0P$0 Dy،4 0$,4\Ȍht|0x0\ $$0c -!0L1pCW:@`V QЀ Ȁ0 R 0pGW*0 R PQ 0 R x0 UP(`@H000<0 00C000̅ԅ40P, 0-L8M`Q QT!00 @D H0 @0 <0 80 40 00 ,0 (0 $0 0 0 K0DS0@T0@@ 00CS.` 0QP 0S P0  00 dHK HK_l0SHK4 00  B@4,ą -`LVP)P>1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00 T<, -LuM؆0,0 Q  p! L 1PW1 1 1  6 \ᄦP  (` ,6&'Pv !,6"! 0&& ̳&ȳ rKij f?K^4 Z(@1^*P P ?> P  RN+ 0`F<0^:6^  ^<ş 0P<,5% \?>1/1L.QAN 0 40\1嬤 01 0S  1, 0 S  0\` [K_K<$1 q,6 1R rKw P0S#1p& FPh0SR1#p&7P86 P90S 0S % T1 0S 8rK= Pß,0 S ,K C1! 0 000S  ReK P !&m001&P h1T+eK P & L!00! &ȯPu 1{  vi,6KQ01,&K `,6|AQ000P0SH1 SDH0S%1 S!.0\!5 2! 5:? >PN0ׇ? >0N0CS`PdddP101 ,6 0f ,6!_ tX@0 H;<4\|܌(40 -PULp`:4.@$*@TPZ ijU:PX 0 yy0y0y --L ,p  p-PLM@P`l0l R ᩌT D0 Rp80 ㇳ 0   ydyhd` --L  --L  -LM@*Q hd --L   p-LtM/P@TK P0: S p0`rS ⧮ 0-/L@PU+D0 00[/00(+Q+Q00, -LUMpPKPP@lK8y0S-0: S  SU ́P U@P P@0 R000K@UP h1: S@ 2c$^|y P-L lP H -QLM@ P T 7 -L][P ) -kMLM7 6@, @6K0A䆟 A 6 PP6: S &PK ڟ&P0S| |6 Rq 0 S i\0Sa L6L&@HfHv@@ @@@@0 00S P5P(0%<00PC0S0S X5 ,0S , L%e.K B BP \P @0@T H6<4"D0# sP@0@Tşş%5R@0T06 v4 RД3S (0 త4 @@TZ0Q $R |P0S (4 R &6rP, ,4@ &PT6&  S0"",3 0{P@ Uh 6T#00/>10@᫮3PL ⡮x3PTChG T3P= ⎮P03$- 6SR ,@!0@T00 "2 lB00f0"S P nx2jlPP\Hd,(PPO@T J/ $v1  LPP>, &R0S%"0!S$W puYPLF~xO ,>pO 6뚙?A؅(ČЅȌԌ$DP܌܅08X` H\،H<40,0̅ԅȅ(Lp_$,@$Py -L M, Zß ?Ev3吃 ;LP hc+ Q#L3R,D $ pW,$  0bW@ᘭ0EOa.6 0@Ɔ& 6F@V冭3 ( &$6xr 0(& 0Dᅭ00 ိXB 0+00 0S2PU 2 00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55 ` d0 1 R,d0\ &++P 0 R,wAkP@kU*0 Q@tPU:aA ,0 8Ѕ܌STh܅؅x0@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%%  -PLM@ 00 R$hvȌ\d -LMp@W`@v^ Pa0@S pd1P  0PUK T q,10  00S 2W~Cp pG R R0! wc.J`fP%UP)0FOa.U&pn  0 6 & p@b0PV6@  $CPzt` -0LM@H H yP0T k8M, ,edA-L0(&S  d0 P0S\P P1 Pa S\Q 60Q -L: S  S  S H0 R4 S S  S S괌0 -1L `R_VP@@ ;Td1 RLX1 RHL1 RT ,1 R $QXp~ᛝ00CS0X0@ӤX0& T 00CS00 R0 0  yTYT nTNT YT00yTP o PXGk@4F(fȌԌČ̌DhP\h -0 @LM̀@@0 ` @@``PUPTp p k@hP00TQ  p0WD0@@W|$ 0-PL@T 0&"0S @T@T# 0 @TT  d 000X 0000 0 @P@0| p-l0LM@Ɠ0\S` @088 000 0 `PpČЅ p-LM0@S` PU 0 y0U P 0 PPt0T p 6 Ul`P6@ S6& "," Z 6T 8Py ܌Č 0-L0P LR @  (c$P 0ج $Ȍ -LM8pP(2G 2 R b  ? @_{rTo 1 RP a@T T rPUp@ U QW!0Z00 lQ3L1 R% PZD1 R 1徉o黉 1 !@Pȩ0 @C@0PP  ?r@0@ 0P PPUgHČЅ܌؅8Ȍ$|$<܅X -L$M0 !0P@`_ᖄ@K &" $"40 D @K0, 匜Qd4 ,4 P[ 0@0K,0{QM@4 8@ VHW4P8pT54 ,d R0,# @K@_@K0 W 0`Q 00Vs# %@!0P '88 x 4@0pW 㺫8@ 0@80 08px -PLM, 00 ]@_l!@K0/a,@@K,< QG 0 _0PP< ,@`K 0Q.0pZ oi D@ 0R  @@K0 `@0PK_tp ̛ ᤨ,\0 Z<,S00 ,K8Dp@-t@00CP`P``?>!@\1 00CPp010  pH< -L8M 0@K0 ,0  -RSL4M@ Ppl h\\1  BRH eST 0, P \0 , K X T L H D @ < 8 4 0 `HH\KP@ 0 P0 X T0 PP 0p 4 ! 0U0?00f f᠚+`` ᘚ/00f V:TPU L0L X0 0 TP   U \Kz40 -L  - L>0  houx -Lzeuhau -LM0@S C\DTD\D00S lh0 R \P0008[됪Ȍ(0< -L`P똡嘁q@!ָpb@1 P4EXEXE@EXEXEXEXEXEXEXEXEPEXEXEXEXEtE|EEE@@1@@@0 HV00`@0 0QQ0 R|0 R 0 R|0 RP0 R X垌P LkH0JPy\hddD -0`P0@LpP |IRPlP 00Ul0S8x1PP$ 0 hM -sL` P00CS00@Ӥ0tE U T T 3 R^ T0M CR `o000- CR 8^00@t$3 0 0 0S= 0^ CR /000T C@?R 00p P0@0@|2|Mt"0`000R P, '0R'p0 CR 0@0R P0R&p0R&p1 R 0^ CR X000I CR 0000R0R&p1 R 0$ CR 000R&p0 R T 0 R2 0T0Q0S* Dl G0@" eX`@0(D -0p`0P@LP QP@ 000T0S ѕP@ ~0 hM -LpMa 1Rp%  p@ PP  PP p @TæP0Fx0 KƓP L@ P 3P80 塦T{D -PpLM`@>PP`FO ~PP H wPP rPP4:iPP dPPl4 +dZPP`FD4PVP@K 03PP DPP 0-S6 PP `FV@ڸsSp0S $PP`F@p $0Sx3pt3 l3 Y V,300 -X V  E  OV:"0p0t0 OP`VVڠOPPVUtR0S OP 0S0S820S  P 0 BS0SR R0S) 4Q P  `F@1QP Q _`F@X 000`FV@B10S$1Q 10S  TO0 3qP 01S00S00S X ;O0 qPI,048T<@DHl\{4h`{pX{ 0-TPL0@S s<0Ń [ 0P@0000h{ p-1LM0`@PP pP(UP  pPPsp pPx0l pP`P0X^00 DpP< 000p\{!i zi i ~i 4 -L M@,K0 N0P` `T NP`@ ᡤp,P Uy V 0 Sr200000S NP c ?P^0 r1000PT  ]N 00SAA. 2 MN  岕 00S MP2 [ ,Z  MNP% 0 00RSY 0@T 0R @0S 0 0S$0S 00SPU,"1VqX44 C\l -L0 ,M(0( op 騑zi  -4L ,M(0( op 騑yi , p-L M$@K DQ嚣8 op$ $P`  $0 0 ` op㳣 0$ PS 0@UU0  CR 0 R00"h` 0PU@H00CS00  ä0 "p阑xi <X -L0LM@@0@<0^ ,0  锑X{ -0L0 锑 -0L0 锑 -<0<L00, o0Sh阑i  -L 0000 0頑X{ -0LM0@S/ h00S00S P00  X,0T, @00 0 0 0鐑X{ -$$ 0L00  鐑 -L(Mp0@PK` @ 0 R n0S L3[x DT 0 T KnP@㵢 0S, i i  Qd0d0A00d0ἑ -L M Kp0,` $P@\  0FLt0p00dS X:jL0SHD p@h _L$ P0t@l0@B p-0LM0`0S P P!K-P5@T 00S ,LP 0S 00S` @TV80/p锑ܑn0T -PLM`@Kp| `$K1 @`V@0 DP 00 ,(0m0Sni | -PLM`@Kp| `$K1 @`(@0 DP 00 ,(0m0S@i  p-L,M`0@@KP$ 0 jp K ,KKPP HD0\mp4㋡ 0S pi$ p-L,M`0@@KP$ 0 9p TK ,KPKPP HD0+mp4Z 0S dpi$$ -LM@0Pp`P  R0@r1000xSY@Qg W KPY r10000D0S  rt10000D0SX0UYDD5Y 0- qP100000S00B R00000ӑW0C q000000S00B R00000ӑW0C0@00W0\R00S JP@00 `hV f`4Lh p-QLM@P` 00S R00000ӑxS T0S r000000S r000@000STT T00P0SPP  ph>8@;T$@5Tp|,W\ 0-L0MP@0K; K @ h@0S`  @0[<0K1JH0H <0K0lP0 0S I0i  0-L MP0Q 0 @!K  o}0Sp I Ki0@KL I@0@ kp0 0S 0i -LMq q0`H0 D0 @PH` R &P H0D` ZT>OKP[0  CR 0R00X[Q (3Q$ J?KW ,! @KKK P >K4 MK0{V{x0Sxڸ>@I?K2lpK1p`K01@TP ipPh>`tPP@1@SPTUpPl r200000S 0:SP Pl $PPU t@T0, CR 0 R00*p0K10SL=U@ T 0 CR 0R00 8!R0Sy<1S0P [ np00CS00  ä0 H0 ,0Sl,i i8iiiiPy\h 0-0L0MP0@@K( 0 . IG|0| (iP0SXT0 P0 H00<$  0S(T0錑6i(P, 0-t0tP0Lh@h  \0\00 00 G@08 hP$0錑PX5i @ p-LM@`00X`PD 8ɀ@P$NP^Pp錑PPx -Lqd0d0`pT0@#nPp@@Np0  0錑P -LM@KD004 (㄀ 00錑@P -LM@-D004 (f 00錑lPX -L M0p$0  @pp`0h\A$KP`@ʋ$0@@S 1錑P40S 0S0Sd -L0S 00  S\0S t  0-@PL0 Np0 0   0-@PL0 9p0 0l{  -Lp.FPP`@ld0p0`@0 @8l@T( 4  p-LM0@S`P 00  S"Pp@0Sp -QLMPp W@zcX0$q l A0S 0 0 SP @0S@0S$ 00 S0P QWl`||Xt< H8 H00p@0S% 4i+   PyhKl{   -LBM M CNK@D0P @D/㋏KKK,0 PP "E0 gPȠ`$( K 0SU (KP  <Pr(K0 (K 0Q`RKA K P <>r 0D,0 S0,KiPy` 4  -LM줟0@(0 4$4Q4QT00CS00  ä0 'T 0S 0S wXp@K Dd党 D>K( `0 ~fP`0SwP@K( m D hfP0P|šPp |3 ,p RfPtずlK @4 @0R0 0  CR 0R000( CR 0R00 40) CR 0R00\R00CS00  ä0 480< HD20@S& 0Ÿ0S @0 0R2!0S 1^ 80 00 0S1@1S^0X0CS00  ä0 4Pp10S P00@T`10S V8`  0 & K00@T PU,X0@T  @0S 0 0$0Sk (0S(d0X|  4  i $ 6i(8 L \ h PyhK`Tt xlp< -LMX0Tr$0 d0S0+S (偙$B$ dC4PK ? DWC D7eP 1` 01S %A0 x! eP 01S D\4 0(Ca< 14 8#"0! 40K@  DdP T01S | BP 200CS00  ä0 dV $0ST$ ! %i | "i   #i    -(0L00S 0 锑`{0S 00S "48<#80  -DLM08@,0 0S0+S 寘`p㓏Kpp <oP,Bd30: SOK.X sBO_K0d KdP01SD@ <,3 (K @OOK <oP,DB%SOK. 8BOK0 dPu01S hMKP. BO_K0  cPpQ01S <1<1<1<1<1Y 10SB .4 A0L cP01S) (l&81S<1S B@8P Pd2P Pd# "0 ,0S,!Py "i   %i 4 Ii D X d p |   d{Qi  n   \ -0LMaQ00p00P0S@T 0 ˆR~0S K  Ei 00 0{{  p-L MK,` 0 APᬆ0S |{V0000 P00P0S 00p0P@0P0P0 `20p{  p-LMR@!X` 0S  | @Y l<0 CR 0R00W0S7 0CU3* V ,0 CR 0R00?` \0 CR 0 R \ 00) \0 S0 S0SD>0 CR 0R00pph p p-L$M08@K`  Qn4 <0K 0 {P c 0dz<0S  l[zڇ0S 00S Q0S 1#$0$ <p{nC  -LMK,p0 Q`ᾅ 0@S 'zW0000T00TQP   T@D0T0T0 d20{ @-^@ 0S\\  P2  RR P2 R\ 0S\ -LM@  5 -L(M4q0D@K$  a 0 峕 ? ap0S0 0S, 4P%WP0   apŕPU 0@PTPE@TU d@00PEU00S  0S( i$  - @LM0 S騍 DD?D0D?0@-@@@((0P\ P, ,0PRP0@00@-@@@((0P\P, ,0PRP00@0@-@@@ 0P\ P$ $0PRP0@00@-@@@ 0P\P$ $0PRP00@0@-@@@000P\ P4 40PRP0@00@-@@@000P\P4 40PRP00@|@-@@< <0@R8 80R < <0@R8 80R@`@-@@< <0@R8 80R < <0@R8 80R@H -LM`pዅ P8 %00XP5 P@ %Ƥp 10@GS񟗧@htȖЖؖ $DdxȗP4\$P@@P4@L$@,4P44($P@ 4$@@@44333 3#P3#3330ȃ80 ;0t3h#@p3P@@\3\#P@T38#@x3PP 3h3d3`3\#PVT3#00P3#lK2"P2@@@ #0Sq`a2 R2 R 2 R2 Rp"0S0Sh2 R<2 R<"0S0倐ST2 R 80S$Y 0/;40"0S9 !0S3 %S" !0S! 1 R!0S!h1 R!!1V   x1S1 S01 R!1 Rp!p!l! 0S SP!S0 R8!0 R(!(!$!관4Ko 2OP 0T 0000 K#_P"[R0 X`H\|PL|ThltdLh(L8|<Ēl,pȑ|ht@ -1L1\0@p ጦP`h ¨p1 R\0SဧPPK 30CS,D0.S# A0SW ᖨ@C0@T@S@@T  x003S 0 R Dx2D0 SDTݒP0 ݽ0S0㣒됒(T\@ `C< -LM H 0R,0 0 0 0 $5 R5 R 5 R @@ ` 0KV㼐 嬐 娐 夐 堐 尐 崐 帐  @  QQ \  D0.S (0^1Q o @p0 D0S@@@P 80 @T@1Y1Q@ 80S @K 3 R E 3@T PPK0 #\@KO0 #OP @ tPtl QR P   P@ 0 0;0 0 0;0: S S 00R0 d@ `Vw R 0@S |@ p2KL"0 ST2  `V `V2 ,0S ,D@K"0 3Otx !0t p &Ot! 0l Ovt1h R0d0  ` `!0 Octd  000 b;0-S Llm 0R@@@ Gt P [z { ?0 R0 0p Q0 R L1D `t\0 ]>d08@H hPM`TC -LP# \ \ P  \  Ph P 3S40 RP \ 0T<+ 0-@LTP 0S@T0  , 0 0CS00ä04 -L,M , 3S 2 R2 R 2@st勿pQ[ @K 0ST T2@` R42 Rs ,@ 0  $   j1 RY0: S SK 0SC (080c!0V1 R 1 R0(D1 R&t1 R# : S : S L00CS00  ä0 pW ,0S ,i 80(Y "88 #$  X@ 0B ?cW@0 `{  PrdPyT|Ll`lx 0-0P R 0L0x0 R00d0 RX0 R H0 @Tᱎ᭎00頒dl| -LM,K0 P| lR0 0 Q{00P4 U 0S 004!4  R0 P,@4{8 4]P80080 3S 1 R1 R 01@Qi80 R< ;a - 0HH,A^K PEPE0$ `}JT -h0LM$pK\P@`  E0s,  0 埻h p-LM@`0S Pq00  00S|0 R?0X CR 00`0Sp0R P  -0L w,Khd -LMp W@P< ! \o0PdS pğp0<0 0dd` p1@T <PL8ppppppppppppppppppDpPpppppppppppppppppppppppppp0pp\pdpppppp|`< 00$3``#`22 Pb0A QU 0ŸS2  0S "0S}  DAd2Pp PPhd"S000 8 KP8<"H0SXT PCP:G< R P 1 R ,0S L0S RR P 1/2a@#b! 8KUjPڲ3[ ٶ0S ն+,08!z(!uQJP@ 0S0 d@ P P 墋|埋/1P  D00Sb0@\H4}<}@}8}D}0}0<MbT` -LpP`H mPP=XWP@0 X P `HiP0`  (``(0S<0 0P,` P0,,0@| 0S0@^\LL T,0 00  << p-LMT`@T PP T0S00U@0p)'<00P 0 RP< p-LM`hPP@0  0P0\0dh  z00TTPPPPPPP pJrpo(h -LM,K㷚2嘢@ 4pKT ' @,0@PQ h2 R,0Sl 447P0 P, 0,0@40Q9 @T40Q& , Q ៵00 0cP l  1 Rʄxx!=9 B = 0 0R 0S(,! 0R`VV `0 0,00 R = Q $08 0bS$0$00,0^00STd 0,000,0,@ m 0Rd<(}@}4D} @ p-LM, 0@<080RF0|400 S407ڤa08P< 408 8 0R  K0l!8 0Q =9A =C@@  0<1@ Rp<0!p 0R@ 0 cp`8P0800 Vp0 R`8P0t`8PF|X`8P"2n3c1@./A)b2b3c13N<000S `8P0(}?B@}HdD}C -PLM@ l0PdS " H0H w<0@ w' 0 v0  --M L0MpANK0 @D@D\ 0 P0 ` p0  U` 0S L  F4 BwF t4}80}@ -@bLM0 0Cs0$r r@ 0+0 0Cs0Pt@$K@ePl$@T 0)@TAQ 0P |1 p1 R0PQ$0<͈0PU 㗈  0 R0PQ 0S 0 RP㘀P 2 0P 000h喈0d2PP 0UX00L}H}@}HT\ -"L,M0S l0S0]P L2@P@ 8@@ @@@@P*P`"1h: e쁟PYLPKp) 0L` pbPI0) pL` bP6@ H0K: ,@ 8 H@ D@ @@ <@ 4@ 0@ bpP HH00D00!81@P,!0(1 0 10 `@ ` '0 ' 0'x '` 0PDx 00PP dl}p}P}x\@̘ܘ  -1L$M@HK,@ |H0KP0T0@0P 0P @ 0` S@)p p ````   @P ^@ @@@,P 0P20 ~PP0P {02S wD' 0\` 00,000,0 Q 8,@,0 RP}h0@Th@} -LLMTTC`0 $0 KPPp0 SP )Q )Q 000  R0S^ " $0S $V \0P R T K.0ldK@_0@L"0SZ0S T K.0dK@_0!W 0S T K.0dK@m_!000SPP `T K.0 ,0L!(lL0, 0RL0RR000,0T K.0dK@5_ T K.0dK@)_0 x 0>l` g0STR `Q0SK R pGL&< 0tt(P|0 @ -L(Mlq0@PKda @ 0 <H QPD3[1 ,,!0vP"P  0 S  00 0 x 0x 3KQP%8T 0%8 0i  0@Li t -LPM∡0H@Kp|P `(0 HP DP @P $PP 0g4$(, a.$ Ii  <L0@-P@U>01 0 R 000 ^0 0-@0P0LS0S 0' ; :0P.P 0x 00P 00#8H 0 #$ t}8 (d -!LWM0,0  pPUaKJ/ zd -T uOP=WoK0PS @W 0]KS  @P U00R00S6b0 ,0S , \\ K.0 0 S \ ꛮh#D0D @꒮_# 0$ 7tJi(x -LdM☑@q, KⲠP0K0`0 ` p@ 0K K` `0P` 0 R  )000 PPPP0  0S 0 0 .0\ KDl`K@ [0 0p ,P ,0S X, [@ "0  8T -RML 7 M(% 4%  ǟ7 ȟx,  ,  0 8 < @  t' Ēp. H0@/SP`8888888888T888888888h08<|88hx88$8@L0:;;@00S lVA0C2SE <<<<$<<<<0<<<<<<D<<<<<<<<<<<<<<<<<$<<<<0<<<<<<D0<00S|090;0:0;0:080gş80:( 8 07eFKL L4EG.Kx t :  B0p l P 0 ?s5 (09O@ e0:;8 TNKA @ 0S 0 R 4%RQ #NKA D4P|ß0 R 4 R Xh 0@0qP00<0lϬ,0, "NKA o 2\3 R 4 R0 S  "NKALl2`P0S2 4 R.". /VP"\@Y0 ^y/ ^\T 2P00(u10 \pP =!T pPp!NKA  P L0 R 4 Rk (`rQX@@ a080 00 V00NKA 1Pڠ0 R 4 R Pø;d0 0:;7/0<0:;:?.A\D{ 8d'',Hd! 0 P Pl   ~    xpt! !(!~0!L!h!!!'u!!!!"0"P"<~h"T""~ܺ"L<"" 1 bZ bZW0% 1PGFKL@ L@@@@@@laG~K@pGx t : 0p l 4P0 R11 P0Q5  q1郁@P50 ,%R0 KL@ L@@@@@N>K@0C, @:0C D P$0S \0 0 )ZP?"0  NNKL2@D@DP)` 0T `xZPD2) 0`mZPl9o7o*4 0S Q0S22x 0 .0% >5 P$  #0 5@T @@T \DTH$0 00000000@<@TP@0D @E@0 4 R1 @\ O>K)0C* Zps $KNK@D0$% R44:0  4 4: 0 YPPX0 8EP00 0 s0% 0% 05S8%R 454 00) 0l0   ,0S  < 4 (%R  <5P(%`6 0s 400) 0   0Q4 ZQʘ&0) %R @0SX&\KPEd&@0@wYP6&0@lYP&ONK@DP) 0 P^YP6) 0PUYP(@ @叭- 剭' 50C5 ت| @ qKK (0@ ,x00MKBKK DhDKL@AI L@ A 0IH D L @TcPU\0SV(0 NH@0 5 @]P> Hx804 =KL0Cˠ 4 $5 4 HD5 D 4 厎P L%$Ed  R 0S9LPڔ0    n0S Xe0S t P@,wJ:0=KEK0CL0C 0 0XL: Ri g` 哭K0Cɠ@ 0Ch* @wX ~05 *PP:`@ +0V@0 )0 SXPL%d\PhO.K B0 BAgP]\4LJP4  `J@TO^KPEPE 0{ P@540SCJP$zT4[JP~ LnJT`<Phd p04 -|<@O>K0C)0C D WP [KNK@D !}<)O>K0C Wp F-N>K0C 0C( W8 <-00 tT a}$"`=` 埩Pp % 1 PP JIP 0 1J,%0`-PP0  P$ 000P pt -LM8P |0 R 0 l00 2ZL o[]XP 00 @4 @ @ @ .I K W@@$~$<00    0 ᜺~ -3L$M R 0SS@@@@@@@@@pp3  @{\\!00j0Kvg_3 3 .$(," \"(!̠0!0 `.2 p22@80K8P  0 0@ ,@ 4p 剌0P0?@ P`2 X00P 8 },˫@Ko<@@<4 Ġ̌(<"4!Č ̌$[X\, <4$ ,) -MLMp0` 0 ANK @D@D0 I/``PU`PP A.K BT B~=P<qWP V,ʝ 0S P*W@`*p** -ML M⌒0K @.SS@0, @8 P` - KP*000.SS P:0 B00S sP0@8 0S@8S.K B B*0.S.0~KpGpG.SS - KW*00.SS P: tA 0`S EP`0SV.K B0 BU @8.R0@8 `p^KPEPE0 .p_@T_P@.K B B<PD `FR0 |qx P`O WZV <H ,0S8,X~*(*P*W**hd* + -LM`0X"XB00P0H0PPE 0S00(2( rP000ab22 .0S ?,=,;,9,P u@0SPE ),U 0+S-S0S.P.P .U@PE P_U`@PE0SlPfP wPr P ~00S 00SQ1 ,)o<;HPBPcj_D\,hd\`H,,,,D,D^,, p-LM@ SP `p -LMn@T00.0$-0 S S0 S S0@-S@  TAN Ra0NS\ 0RAC\ 0^0 S -d0LMP@@L0 ;<00S 000SE/;h|H -L0MԂԢ 0Pp(0 PTPK 2b`0S @@!JPH nP6 2P- PD2[KP) XP/ P) RP, KP- M P< 1P/ KP) CP, K P- > P3 K P- 8 P0 1P0 21 .1 +|1 (p1 %d1 "X1 L1 @1 41 (1 1 1 1 0 0 0 0 0A[?[0HP @@[0G @0H P 40K9K3K6Kd<@T Kj]App (0S4(h{ xt- p-LMP`0,@KHP 0  G 0Sp-- -LM@P  00R0R  00Sh*锿 -LM@P h00Sh*锿 0-LP@P $00S0h* 0锿 -L M Kb:P@![A[R0 ʐP x0td P00TT0@LP 400 PP00ht@t--- -LM 000000000000 0000 `0`圢0A> 06 pIpq QcPa 4S4S 4?0 [pP@uw*`0A>@t 0 001 0*l(pP|V*?T A.0O0P000B>0,10S 4PU/0K000 u*C040 00S 00S" 00 0000000`0` 0 0 0 0000000 0000 `0`0 $4SY*0霿\.h.d -pLM@ 00s)0@t.@-`@? 0"00\ 0S0S000\蜿 -LMZIp q  Z0Y0:H!O 4  6y†04 S4 S* P%0 4 S4 S0 4 S4 S*p 00 0 4 S4 S:T0O YA. P ` `6& 0I6Y$霿d -x0LM@ 4 BN@Ap@0t hz 00Np霿d 0-LgP" 0P0Q  0R 0R Q(00A> 000 $$0霿(00S00B>0@-(0A> 0$Đ6I 蜿 -LM@$0AR 0  0R0$$R 005:| L0$$R0$4 A  0@0 0$4 霿 0-PL $4S0C! 4S4S 4 A> 0@0P0 A 0@d0 $4T0$0AR 0  0R$$0R* 000hcꜿ5=?0/9P6 0S000 p- LM 4B>0 pQ 0P@00QP`@BN@0 A>0A> 00$d0(@K B>R0  40 40 0DYpqph(p霿. -LMePx 404@0  0000 0 00 0 0 00  0?\00ꜿ -LMX@ 0S 00 0^ @0S0 04hꜿ -LM@0 Xpq @ -LM̀p`P@TC@!`eA>B.A 0 0$D4 dD P  40 40 4stot 0-tP@0L 4@ 4@KE 40 04T0@0h0霿t00 ᜿pD0 00000Sp00000S p0 000  -p000L00 0S0  Pt t#P@ qL0 0000 0S8 0(0$ # d=...(0 $ 00 0  -L 00 0 p-LMP%H$`$@000H000pH꨿ -`Lp00S 0P@Hx 0 0S %H0 0 00(`S@0S0S 0-L@LP 0LR0 0CS00 00 00 -鐠p0 刀0b? |`PUL@0S 2zH0 P0b?U0S( 0f0@m -錀p0 儠0b? x`@TLP U uNH0 @0b?TU,0@ 00c0m^ -PL0`0pS @*H 0 R "H 0 0CR00S 000$H000 p-LM|` x0RR@G`0`P0 0R00C0G00`00S c0Sp 0-p@LPG`0P0GD P:00@P*0P0騿 0-t@tP0LS 0S 0S0800 P0S00 - 0L00S W 0-xPx@0LS 0S S0S0S S 0S 0S S 0S0S S0 -LML@00 S00 S S 00 SS -H0LM0@S ,0@$ 0@]00騿 00 0-L@dPYYdXlXXtXYYLYpYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY0h0hlA00S S y00S S#P` 0s0s   0h(0(P0S @00?@0P 0-1L R 0R:g"0 0R 00S 00S 0 P/ 0 P @T&P@:  h00S 0SCH0(0P<5 ;$0 0@tH$. -0LMK0 ! / - LP x0P0@0P00P "P @00S SS g h,$ 0-H@0PS80L0 ,0,R:`!0P00$$/ 0-LPqC@@T:TT*0 -LMPB@`0p   P0p<0@ Z* P0P0i/   Pp U !W i(8/ - >LM0.0?.00e=@]@0 S=@= +=0S?0SeXC`0SeX@e dM0S P P 0S#0K$`K$K P P 0(K(0 F@(P]T0DcS&$ktjp >00T0$*ZW 0PU*  ]P@E X  @00R00 0R R0@T: 0-QPL@ = P:00S0S P#0Q  0Q A0S0pS P0PS@0PSP p-L MP0$@KS` $0s 0s 0S 40 000 ptTL P-L 0ht -"LM0`PG"0S V HB@,K0 Kp0@ PPP{00S@HdP2@0,0 ? P8  8K8娰X 0 .ᠰ  ᜰᚰ  IP, 0d8K80 X1@0S_P ,P (8K8p 4yPYP ,8 pZ0 00 0 0`< 30`,`0Pg@0SPPo0`0S u?!t0U `00S8K 8p ţ7tMP0xTLPdp|H,+L -LM@0K` P8Kp @PU0P P@ PUk8@0P``t 0  't 0  )t -LP`pWMR`V@ZP PT 00 d 0 t 0 t 0-LP@!P@ iP0h0 -LM@PjtPc p-LM@P`P U P V P ph&p -40LI0S  h^P0M -Lphe -LM@;0 0R`0S! 00R0@S000Sp;0PS UP@000S00 -L 0P00 -LM(@0$SP00X00 -LM@mP -L MP@a; R `p 1 0pR 00R`P Xp PZ V'>;p6Z`@ x p00h P  P d  *@00P001 -PLM`p% 0 S" ;@;@@VPP` 0 Pp#@FPP`6\ 1 -LM@ V 1 -LM0`SP #R %RU0US 0 S %R #R1 1P :``0SPQp@' #R %RU0US 0 S %R #R`0 X0P   d :@Q00xt -LHMp0@ 0 P  0lIpq ``K@ _@TPP@T 0 S  z(1 - L0FIpq0  0  -LMdp'P@00CS00`Ӥ0,?` V e0H v R00  @ိ:P@`00 -LM@uPp% 0S" `V 9@9@@PT 0`|K$n@Ei@C41 -L4M 1@TCT0K X GT0`TD0`BPP 9T0V T0`VpD0`*PU 9@9@ `H 0,T0V00HTKJX \  -1LM0S0 4  1p W OP` |~P 0|S`R9@O9 G@Pp8@ 80S0%S 0sS f080 @39p00@,9T:'@᛬TY P)K P ,)[40D@00PP0S\@1M -,1LMP, UBRjPp; 8@ 80,@8`@Z0 %S0sSZ   , ,8P@00P8U:@*T oł\L1 -LtMK@ᪧP@x0: S@@ p-LtMP0SK` 8@ `ᄧ0S9`d00S0: S m8*@e `n  իp\l -LtMK@BPH0Kj00S 0-d0L0ST00pP@u TU 0000d 0S00> -L M@000 p`P00T,0  300CW 30SW200CW 9B2 R 200CWUV Y0S x20S \1UVP n@ R R F20S pWWJZZ`P#p`Pv0X,0 p@q>P ,PL1AP-00Y000 # 1 00S0uv   00S00S0   00S6 00S 00S-pWZ00S0   ,0S 00p 000 00SYk 0 o tX1hTd -LM@`PpTW 000CT0 @T Jp`PvY ZE@TZXZ!o< t -01L M0pS` 10S P; i>pP@+u)V 0AP 00S PP@$ 0pP@u l0 000 0t -LMp`pP@uV iE 0S<00S,00S 0 0S00Cᘂ'tNh1 P000Pꠂ -P0Q0L00 00 000頂Ȃ - L00 00C0Ȃ p-LMP`(+@0  000p P0-L@P@ 0T傩0h0t0PP᠂0PP᠂ -LM@0S00Ȃ p-DPLM@`T Pp@Tp頂 0-LP@P000P0000000000   -pLMP@u) 10S1!00`Q0 (P*ip@ VP@< P00 P8p0t T >  P 0`V00S;00 P``V%0P@` P@@P%@Ex00S00 S 0 P@ P pDP@Ԃd( -pL MXrPp20S200QPW0 P@P u20S @ T T10: P@ P p1@0`PP` x!0$ P@ p`PP,  0,0 @6Pp@ 0000  %0 P` P l @0Q P 0Px00Sl00 @,@ @0PU`XW,w  Ԃd( p-pLM`Pv dP<p P P@0P`40`/@0P`p P P0`p -L0SH hp0 s 0 0  Bh1t -LMp`pP@u P |00Sh0 tW V P@(0 f K! 11 -L M@Kv O p-LM`pP@uxFpP@uPph UT0 ph11 p-LM`P@P  P ptP@$00S/ ph  -L M`P, , XP,0@cT A dxvP@ Ho6pw0x00XW0A ,0@T)y z  V0 U0 1 ,0c@0;p`Pv ,0@T ,1 ,0@d@ 0@ܠ,@00CT Tp`Pv XW  000S o70@0CTF D0@@^ 0 0@@2t  -hL7` 0S 0 0S<0040   0+0 <2t̂ЂԂ -LM⠀0圐p,댠`'P00V@@TP PV  bbO  b]O`PpԂ̂ЂL0 0DS@0 80 40 00 ,0 00 0 `PTX\hd -L M@@0 S( P@p`p`20S, 2Ÿ  00 r0s 0SR !0S0S1 01 00p 0 00 0S/@@K 02$1P a,1UP0!c0@P P 0 0P00 0 0  0Rph0 00d0 0000 S 0 (0S8(̂PЂTԂ`P2 p-LM0`SQP@0SPE P P@P0SUfp0SQ 0S0ASQ 00S0 0S  -qaQL 0@ l0T@lT@S   0^ࠡ0nP 0 000 h0 00000nP0<0 0n d0 T`P̂Ђ@P ܮ$0 000|@P D<P`X$0 000l p-0LM0@S 0S PpP pp`P R`000SP PT R ,0000SS PpPЂ -@LM80 00 B0 @00`0P̂ЂT -T0LM0@SJ@000S P @TZP̂ -0LPt -QPp1MLP0 0``P!A0P000SPh0S `1@HT1@0@T @1@a0 0CRP  UR1000S S 00@0TS P0ø 0D Rڴ000SP W00P00S U PT P00C0LL0 0p<0 0P000`d0TԂP̂Ђ -0LM00@0T0p` Pcڴ10U 010`@KP`  TJ1U RZT010Pe0 DPPE0 0U00TX`؂\P -p@LP`P 05P  T0P0@` "l@h 0RX0X 0 ?R D0@0 000c hlDT̂P P-L@p`5PU U nU"0 Pa50Sa uꈥ\ |0L 0R 0SPUQL0   RRyxw0 P50000050Sp 0S 0S0STQڨ0   RRPO0 P0 00& 0SI 4Q!0S 40S0ST0   RR(0 `P000 3 0S R0S300PSU T P0 :P000 ßS0 0S_T2QW T g 0 P_T$0S 0S a 000S|2Q00  C\2LB 0 P 0 P000=_S0S 0S  0S  0S 1 T "0  P  T  0 P000 P D10SLSS G >PC <P2 10S ST0 )0P".0 @@0@0@0TP 0 PX 000P 0 yP  000DPX̂Ђ`0T 0-@1@LP T00 P0S1b Q 1 Rb\0 00R 00S 00S00S 0 000 00000 00 p00S d00S *00 00T000hlT0P̂ЂdP00S 00<0< 80Q0(000000\\2LЂ̂0 0 \ p-pLM@0`t nPPEp@ p0.@0t T T000CUP800@(P@0 V000pԂ̂ -@0LMTP/P *@0$0P0PE0* P` p Ulp@ZP\ 0 *0Q0B0Q*0Pd(0PE0`X0000Ԃ̂@-p@T* R  :P0b0D 6@0@@0@0 x< @-P 0S 00Q x -L``P@ T 0S0S*0 S0SB @ T 0S0S:p R000 0  `0St0 @ R0 0S0S@@0 S$0 0 0 x -L^ 0 `2d -LMH@0S dR 00 000P00 -2LM0pS px} XW"Z 0S 0S *Z 0S0S:0S0S0$2Z 2 00`PQ PU`R?Q=PP;1 `XW `1`P0 00pv  0x@0XW4  0 V;U9@04P 0 `VU [0`P0 00pv  09@0VU80   xdd -LMZP,"PU 0 S 0 S *PU 0 S0 S:0 S0 S01U 00 p ` Q `VpR+Q)Pp0P(0`ZGYE $1p0 00px  0@0P`Z,Y)pP ` V U x0p0 00px  0@0P` V U0 xd -LM P@p` P@t0u00X00S T00XtuP@tTU@0t -L M0-S aGECZ,  ,"7&`a6P #"LPp% 0S" 0SEPP` P*@M*@@DP 0`ᲝU0S!P5ᦝ% ! %Y L \40 , o=L<C41ls|2 400S Aa0@S<0 -A @L2$0R202 -'PLM! $P .P ^P@0 00 \P|@000C 0`@`000T@P@ 0s0s(1tt82 -LP 0-LM@ PKT 00000t -L M@K0,sώ0s 00@3t -L M^@K |0^0s 0s\0000 H00 0400 S P 8t -LZP ,0, 0S t2@-, (02 S@04R 0-PLMP0K K@XP# 0S00R0S$ 00  0tM2h P-L0 } hzh 0-PLM@Y P 0P[0=0C:SGlPhPdP`P\PXP@8P{040K 0(10 e0X\`PPP0PPP= -@LMTd ThL0 !@<840,h2| 2 3`333 -LMЁ0P@$0 * TTbA`; 00B S10 0C00B S0hQQ@`(0,SVVE1C B(1`$1 <qK 0S#T`VPK K''@'0@1` 0`V@K'0@' `PK'@'P0@`0P vKHP  $0S4$܂؂X\4 44(4 -PLM! P P( R0 0 0S 0S l|T0T Q0000K (0,0 K0K00K0K0 e04T4 -l0LM@QT T@ hN$0  h `4|0 R004t -PLM$ \ R 00S S  P$K ?0000@0pS $0@ D$0 0RVt                      t   t         $ 0+SppW0$0 q1 +P0 (K$( $ 0+S0(0 1[[X$0z@0C$0 6a0DPS``-P@<0K0P 0(0 000CS4\4\\\ W'P000"W $00Se S$0 $ 0 S 0$ (K8$ $00SR $K 00S($00SHPhpt4 -LMP( `P@p@@P0U 0@ 0$K$0 1U0  0 0S SU(00SPPU`  000CSWUF U IU F 0 0 S008U4 U 7U 4v1 0000vp1 0 00X0ESDU U U (K, K,0S 0 000S U(U 0 W000CStt0010$K0$0 U 0  0  4444 5Q PP -LMF@0 .HD5 -LP0 0S00 -LP  0   0PP -LM0K0 =H5 -0L0hP -`LPp@}`0PSE 0$S T; 7P80 0C$S'(4444444444444444444444(444(44444444(00@f (>\0S R 0 R000000ӑS$0StA0@Sa @0R0-P00 p-LM@P` dX0@0P SP000000STl0Sp -LMK -LMplZ`4$@1$@@( 0P`C -L  M0KA 1@ _P1$a0d [P@00KT0d  U0K LJ0 E -L`P@M\0K0 0鐆P@ !) -0 K4\0d 0\ 0 K00PKF" $0K p-D1LM00@`1 (1 p0S! 0DS  00CS @T U7`KPP0DS  0@pdT p-LMD`DP0@S 00PAP0  Pp鬈T| 0-@ L08PS@00# 0R+0@00PS -LM@P P -Lp`$M姯Z, H0  `vp0.0K.K0 0 P@0@@hYp`0Z-00hH  ,0 S ,&@> -Lp`$M姯Z, H0  `vp0.0K.K0 0 P@0@@h#p`0Z-00hH  ,0 S ,H> p-LMP0ϰ0 0@` 0K K\0/cC!b10@00R0a\-00a  0SȘpgfffT> 0-LM@P0$@K 0 O" 0S 0\> 0-L M@P0@K 0 }7l" 0S 0h> -`LPPp% %P0 `p`0nS dS sS@P pPpP -LMt qP@b T T Tt h -0p L \ `P@ 00S 0@0 S @ \00ShL D000@000T(0 hL|H 0-L@Psj 0 0ĈP p-LM`0PS@ t00SX 0@S  @00ScD(0 0S0 >p|HpT00C p p000C 000C?001t0@-H 0\8001000\0 010t0@-<00 CR,0010 BR0 000t0@-8 0R (0P@0100 R0t p-L MP` 0@R$K0S ]嬔0 +00$0s 0s 0 01$ KptT0@-P 0S0S0X@0^! 00S 0SN00^0t 0AtP<00 r0s  P@-p@0\`0 0r0s 00000\0 t 0P PPB@t -LM\X@TLD@0 840 ,(00+Xd++,l,, p-LM@ @`P8 0S BPl   >0  p   -0LMK0K00K 0-L M8P0@K 0 . 0S 0x> 0-L M8P0@K 0 N 0S j0> 0-LM8P0(@K 0 n 0S T0> -LM@u q0r00T00S 800T@qr t -LMB@6P񟗓\p t1 p1RDT10SD1@18B01$1@0S, qpq' P0mp@q ]QP@@ P0 SPO@@Bp q  (0WP XtMd p-LMB@6PH(4,pP@u2HP@UʰP2 R B@0`PP`VUP@UʒPL2  B?*@0%2z2S P@@r@0`PP`VhUfP@U`P^ph\0P@zt0 u SR?P@09 ap0 s2  0 _0 S*P(Rph=Kp0 s ph| |0S0S S00CS00S S p@,0MP phph-ptt X 0:S S@.S ?S  \SR R 0-0LP0CP@ Sf@XXXXXXXXXXXXXXXXX@X@XXXXXXX@XXX@0B0C2S=0LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL(LLLLLLL8LL LLLLLLP0 00 0 PE000 -<<LM0pSP0:S %S .S) ?S \S / `V $K00!c(PPDP`VPE $K@@!O(P (0S PW00P:g XPy0 -D0L<080`00 ,0b A0 Xd(0$0 0b0c0A} -0LSPp`@7  r000000S R000@00ӑ0 T00R00S@D 0S 0S oP0S000S&10T00S 0T S@D00\00SH00S800SSS00S8D00S r0000000S0S000  $00S00S@ -0LM0@SԀTpW.0000Sp頠`00CVP@tu 0 0S  0`0CVp$pt -$LM0s0s@ !1 P@R00om00SiP`00CV)pP@u XWp q   Q0 P0  }Z$`00CVpt -LU0S, ,h0S000hV$> -PlpL† @:0SX ZL0SD@0SN0P>@ -LM@PD0  p-LMP `@ (0K l0 0"T\]PP (0 00 p@ 0-DPLP @T000  000(@-p`P@Q|0s 0S 0S tu' 0S$\!:00SP00S0Q 0S 0S tu 0S0S*Q$@-0S  0S 0R0S ^ 00S0S:@T 0S 0S 0R 0R@a@ -LP@ M`, K00 zp`PWY Z 0S0 S` M Z  0 S0 Sp`A , 0S? 0 S, @0 P`R @0P`, P,0S, 0S @0P,`00 ,  0S0S , @0 QP`R0QSW -LM\S\p`@0 :< P @0R[@00hï @ 00 0hï @ 0<K%0SP0PS @K 0P<K 0O<\ 0 <0 <\00S0 0 T<8 -LM@K=0s0s n0 c -Lr 0 0S0 h$ -LM@P  pP@uiP@0pX W``0P@,0`(WP@  bpP@u|0`0VpP@u p u `VJpP@u <t -L,M@@K `Pr@K` ph200 <q8 r 08@ T<\  Q R`( 0@0C 0, K `P @0 2 ` P @0puv R@0KD10S D@0dS0c S0 P @,0K4 K0,m@K,#0"0P00S`0P00S Q   H  4  , 00@z00CS0uH00So4, 00  @~@THd -QLM@P` 0S!-P 1,0<R A0S* 0S!0S001 &뀁p0S  PP1Wp 0S  01A 0S 1 0S{  0K(0s$@tm K>0 ` PP` h P00 R00SH0  0K 0P >@>$<8> -L4MP@pß00K @KP  R0S `  D `VD r0s tu h20S R0S0S *tu $200@_0 K0tu 0S0S*100@_10!0S0S00 ?SRp00pWÏ0K D1t u  y0z 0 U T P @t u  U0T0 " 0 @0K@  Pl q0s  ,0S00S0K@0K0 K0@ K 0(0Ԃp@-`^@P  \\ 0S 0\ 0SP@Up^p 000d 000d 000d -@LMTP oDl< gdah] -81LMXH @@ KxC@/`:jP0  @`Pp!0S0S 0 0?00`0  X 0S L0DS$0   idtLd> -LM0$ KK 0 0 P$ - L" P00<h -LML0K Ap@T0[S00KT[h -FML M08GNK, $8$@D @D0`PX $'Cp 20@FS$!$!$!$!$!$!$!$!$!$!$!$!$!$!$!$!$!$!$!$!($!$!$!$!$!@$!$!,@$!$!$!$!$!$!$!$!$!$!$!P$!$!$!$!$!$!$!$!$!$! dp$!$! 6 R6 6 R0&<0tvKA $P00Q0S 8}0@9vKA $P00Q0S g0(8uKA $P00Q0S Q0<:luKA ܽ$P00Q0S <; 5D,5 ?5 ;tKA 徽$?Q0S 08:$000"000;~0@0{08x`4 R$  KJ p pGJ HT$ 0 Ps /P* P P$0004SP0;000@P P3 R3 5P3  080@0 P8  Pl3    P<3    P3 R0"< P P070$H P P060$T 060$P 070$L 0 70T H L 008rKA $P00Q0S (n0$000qKA $P00Q0S U0,0|qKA $P00Q0S t?0 0$qKA ʼ$P00Q0S  )000 1 `bVQ$BnKp`F`FbP  4P $0dP \0-S  1h'(@$(@{ A4ALAdA|A?A AAAA!l&! -L4M0 4 00[ ,0 jZP@K0@XP@P 0H0޶P 44 R 0@ D0  @ D t0H0 0D S ;0 oR04  0S00@ O8#8L0 T3 M 00CS0xS0 00P@7< 000< 0SB0S "0P H\000 ;1ƉL< C444 00 0dBD@0pt0`2 R  4@ 0SY ,K ,0D PPI J=D080 ` 1B< @K0 00!P@# P 1 x0q@ R tld1 RH@4@0Sp $ 1 @bTQ04  0QInK`F`F04 LPDDT0 sT pP, MK@D@D 00Y 0 )NK @t娄pY ,0 S ,姇0  p 3MK@D^@D.,J㖄P XZ W\ p"t0@Y.@P?/@@B@DRPN`,0 @`VP$@Z -@L MX &>opn003X$`pZ p-LM&> @`@[X ~NP PwU$@p` -LĠ[D 0YPp`0 W ,H{ P00 -LĠ[D 0<Pp` W, *0 S  sd -GMLM 0`p,0 ]MK@D@D 0Pr0 )K PUe -LM@|00  00S P11>. \\$ ,gS P^Secc 0-LM PO R|@|K  0S@ pX P@0TD  <=]Qz 0sssLJ Y p-MLM`@0 0 Pp* AK@@+0^P! TAKAA 0r00000S  r\00000S 0S@\᙭0 S)}p(1-Q* rh000000S  r@00000S0S QQ: p-PLMU`x x0gd Xb0@0:PP0P!z0pe4e p-LM 0@Px?0`0X0S 00 0 0@P @y p鐪4 -0 SL0S S h0 hrUe -0LS S h hAe -0LS S hP h.e -0LS S h he -0L ){hd$f -QLM,  10S t1 h1h 0RXA0008,  00S S,1I0S* 10S&,  0PS0 p@`0 0^T@@$UPP T00U,  d e@  @phP\0`@H0 0, .(0 0!0 0 000h|Py f f p-LM`P@P 0 SP UT0  sKᚫP00@  "p -9L M0`0fS eS gS l)h)d)000P@00GS񟗮8a8a8a8a8a8a8a8a8a8adddddddaabdbbbbddddbdddbd cbd,c8cdddddddddddTc\cddccdccddcdccdd c ddddd$dcdddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddd,ddddT u5 0 00 R5 5 5R9ʘ5 ! 0 B 5E ,Kh0, R( P00R0S p AW(5 (EP%00 %6 ,KK0, R P00R0Sp44p44  t4l`4 T4 Bd$`4 X48T$P$000f@@0 0 0# $4X   0  4N4LCI3JE3 3<3   8|3 l33/3)x3 T3$p3"p3 l3h3d3C\P3<P $P 3 2P0@S@" 2 0pp:20`V20Sg "0S`Fj1t0@S "000P2382 42 "0T13 0 `1Q0S000  00BP T1 !P !<tl!0T!0@0T010SLLV00S0  VRP0P p `Fvp @`FvpWxhdT P{ Dht\@\hlx`dxgph%hDHhp -LM@ PpK"  p P0Sʄ0   T p`p  00 0+{#v -LM@ !mhv@- 0@R:T 0 S* 0R S R  :0 0b0000<0c00 00 0@Du -@L0P00   T00 0D S0<PP4 0 0PS0h@DHP8 4R00C0 R0 @HD -LM@T- -LP0H p-0LM0Q 0R0SP  2P`3S S S  08 P3P@pC -PLM`b#PP20StlN AP X20Sw<<"0@S@00K 0` <@ @@ ,0K@  0@@pK0 KG\ , * 1@ <0R0 0S B S@ < lP@t1 Z00R00S H000 810S,10S 10SFq"0S 00S0CM @MP0SXJ@X00 R00SJX 0S0S0SL 0Y0 R00S <00SDM e@PLxe{h -x2LM< P \20S``JH"`0P=020p R8K  01@P10pK0P@ 0 0BP10S 8PK(0S0 00S,0S P` Pq0僐Z410S V``V < 0R0! R00S8A RV3 00S/00S+V# p0SR 0 00R00SR I0 0R00Xh0 : -00C0`h<d@xPLTD^ -@L`]P1T T0q4T0S` }0U  R00000ӑ00Q000 Q0 Q0a !00S  R@000ӑ0!0a00Q -LM@P pt ttt00S$S 0,p 0 0`^S0p0C00t S  LP 0@ BP00C0044 A  0RI r8200000S r2P000PU0_S ,S ^S $S =S -S :S /S 10S  R10000ӑ0.S 0`?QXZ, rP0Q(10S10S p, R X00b0CS0X40h0j`C f0Q0Q a01 h00S  R`000ӑ0!0a0 Q4Shh -LM@0p@R`,@ *$R 4Sf 4S P`PR S Y7Kp20O00O4S  0 0 Sr400000S00S_S   P0S r4400000S0_S 0 S 0R r300000S0_S0 Sr300000S00S_S4SPk P bpW00cO0O4S @0 0 Sr200000S>00S_S:   P0S r200000S(0_S% 0S! 0R rH200000S0_S0 Sr 200000Sl00S_Sh  Us 0b00S10PcUj~pZ0O00O4SL @0 0 SrT100000SA00S_S=   P0S r000000S+0_S( 0S$ 0R  r000000S0_S0 Srh000000S00S_S@,@  0 S 0 b10PU, -L qP  -L]qP T0@-@TP* ^ \00S.^ H0 0S \4000 ӑ^ 0@T:0-\0Q 0\ a p-1LM0`S@P区P10S U t0 CR 0R0 S 0@00ؙ,KIP$10S U 0 CR 0R0 S 0@0廙0-IPU 0 CR 0R0 S 0@0T塙L@0 00CS0 ph钙0  0ph -LM@PlE`p!4*pF@K 0PD4||||||||||||||||||||||||||,||||@|P|||||||||||`|` 1p1' 0`0 R0Y00 @b0Q T00S J0 R 0 R V @PG0P@S@0$v{ hl&<# p-LMKdEP @P`J011QhTZ ɴP@Tj_EZpD]P TP`o -LKM MCNK@D0@D,0 pSJKKPPPM.KAA9kP@4: S  S \uH,0 S <,NrmK`F`F P@ PP  mP@h 2 R_2 R BPO VP4S 0G0@$<@ 8@ ;0K4@ 0@ CK08K KKNN( 0<K @sP`! ^%04 1D MNK !0P a0 0塸xOH{p G@P p @YVD@0 0Pd :P $$  pEV:0P 0 2P T]] (P@T Ph5mK`F`F P8hil&h iDBi0i -LMp(K(DPP3 @T `W@ W Tjo(TCPZ ( D (00(1PZ ( D w (00TG\& 0-x0L0PS0@Q  OP 0S(0 R00 R0 P-L` 0SnS 0@ ,P@ml0PP@p` ,Pp@0oS` d# p-PLM@ PPp勞P .P 00P @Q T`vP. uP 00jP 0Sp -L 0KM#+# -L 0[/pLidii -OML M`3JKpI`@ | , u $0S(#f'pk 90@?Sb갋,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,Ћ܋,,,, ,,,404004 0408 040p4 Q.K B B040< 040hQ 0S B^KPE1PEAGP $@ 0 4 04 $ 0( * D WQKAhp) X5<4 Z584 W5;;44  0UPAPx Pl A堶0$Lg-P@< Ko{ `ji!(*pj$+4+j -LM@P T  Q q0@0  R\ 3랛j -LM@P T  Q q0@0  R\ {j 0-LM0P00CSK @ 0$ ϓ0 R  00@j{ -L0H nj -LM`P6P( @(K,pK 0  (0@SKl -L M0@p00 0Sf DPP 0S nSW =ᴿP0`0@Q ᥜP QIQG  0V0P . 0' Y0  0000V 0`0 ,KႠ, ?R0S@p @@0"Sl 0\Y000 LPH00D 0oSP E<"T"\"l"" -LM<@KpPP@  P40KEP\XXXCXXc -0,0K * K<#S%pd ?0L:S^llllllllllllllllllllllllllllllllllllܓl$llllll$llll@l`ll$0000S /1000,K +K&0Sb @ 00y!0pWQF pGw x PyP`   0upGw P@ `嬾P 姾P 墾P kP@@0S  @`P0\ p0p ^D140K'PMl(l|x{ Tlt0h!,&&dlĖ8<# -LM0@S\ ]PH XP8PMP h!,& -ML M$ß0`@( ,0 @52P`d088 B~KpGpGP"04 0X 048"qP0 T  QPP KA >KA B0Cm048P480   ,2X("@  0B08@Tk YPp@^ P+ U:jX@ 1 ,0S ,lKAA BP<8C4P   XLHC08QNK@D0@D(!`34kA>0S Y .C0S>0S WlY  CCCCU i48tLB08@TGeTn )%lx|)PykkCXk$'k\' 0-`0L@PT  㚮P @T(0 R00 R0p 0-D0L@PT  |P @T 00Py p-LM:`PP 0h 0@T  ]P @T0 ph  Jpl -`LPp@0   0@ -PLM  0SlnS `0 @KTA0S@ @ 0oS0  d#pPy -PLMP` 0S pUXi@@@N 0p` ) -L M0 40 (KP`* ?A2pP@0H U0S -Sl01=P APARP@0P0$`P00`40) -0L ?khdl 0 ጐ0ጐ0ᐐ --L +j p-PLM@P`l0l R T D0 Rp80@  0  @j딐dhd` --L  --L  -LM@)= hd --L j p-LtM/PH@TK cP0: S p0`rS  0-/L@HPU+D0 00圻/00(+廱+㷱00 -LUMpPKPcP@lK8xc0S-0: S  SU P U@P P@0 R000K@TcP h1: S@ 1@c$^{=ꐐ P-L kgP G -QLM@ gP T 6g -L\P ( -LM40 $40  08 nPp  -P@=  PP a`.W X X0SV  0m ְ8  8 0SV  04 P8 W ` ?W X00S($00 0 R 2X0 `,Kpx "@T 0S @TT ,  PB4ppW^^J R0000 0W 8 00$28 8  0"PP00  B 0S00C0V 00R0R`V` 0S 0S4P  0S 4P fff  0(<P,p  0  ?, 8 R" 0PU 0S  0U  0PPU884P0` XMc;LL.'mmmmm-Pym,mLTmdmm -LP@P : q00  R.@P*`p@T  P0 R @Tl@0 0 000< @0@000eP`* 0-T0LPU @d> @T ,^>@T PU0n  -LPp @`T wP @T@96 300 00 @@mn p-LM @`P 0PP ,0 R p 000p阐 -`LMP@4>010*Pp`!30s ?S mS 0Pp, wae0 PbQ VU UW aV  hg 0 pR0`0PEsPyhd,n4n{ 8n -LM0@0cSZ bSZ4 `K ʛ 0pR R  Ἓ 0 P `V | $40"WĂ,(0 ("4S @ P Lnhnnn p-LM@PP`pP$0S`=ꐪ -PLM808 4 $@, H Dghdnnoi -!L$M0` ,0 pp@ PLK.  L@ H@ D@ @@ <@ 8@ 4@ 0@  < p`_90$SPU\=T90S 40 ,0S (,#gf:i t(t! -L(Mp0@PK@`  0 @@ <@ 8@ 4@ 0@ ,@ (@ $@ ڷ 0` 2p@T L 0s  0S f 9i !4t@t-0 R 0R1!\ 0S \\0 0<0@ 0C^!\ 0S \ Pt -LA^K@M PETMPEp` | W k0 S\0 K`00aA>K 0C [ lAXtlt -LB^KMMPE@p`D ' 80τ KBK pG -MLM`p $ANK @D@DP8  ,0 KpA.K B0P0& R0-P@L4 m\ 0 0h|tt0 @0 SA@Qa0@7 @SW @  -LM0P0S  q0XSxS`pW` *0@B@@p갠 -LBnKM`F`FMP@!  ,$0K +. hB>K0C\p % { 0$K0, T00S  P Z ʖd0X $K0\#0$ K0@\0XSxSfPtt u0u -pL`0@TP) 0R q0 0 @ R T^ h&;0@TT ;pW`4;0@T;huu\Pt -LM0S!Ƞ R 0 S  Rl l0 QAQ 0H: 0,:R opuuuu 0-PLH:0@0CT]0hd 0:0@0CT4wth 0S:uu p-LMPp:0@00CT`Pph:D: :00CT@00CT/  4wu\ -00LS  S ~:h{:uuv -AML Mp0  p4 0}8 ß3( KBNK0@D#̠(0K@D5p B^KPE`PV00(K8083( KV0 9$#0(0K0h3V2( K0̠0(0K pi V2 0Sp>g y7"(K00hWXP! 00 x:p: @ 0 TP@:D:<:0 ,c9V] 1SCV& @0 S; S6 7S1 nS, _9960S @ 0 0@00 R  920 S|!74!(K0p0hWP08$44 91 6991910@ A`9 048 % &@@@?81` @ v,v4vPvvvvvw w$b(w8w@wHwPw! -LB>KM0CM0CpT"PB`S (0K BK+I"ᰠD  (0K+ !尀0S$ @P!1 , 1 (K  (900CSꔾ̿ؿ~ @ 0SX) @!0S% $P! <0 (K 80@0CSDhtLR P 0S,(0K 0R000'G @ 0-LANKM@DM@DP ! 1̠ K, 88 888888888888|8xy8pv8hs8`p8Xm80z{,{L{p{{{{{|<|\|||||||}<}`} -MLM!0LPK@ K,0 L@ H@ D@ @@ <@ 8@ 4@ 0@ (HZ尀H X0K<0 P X@ T 0  p\R T 'PKX@1P8!8 8X0pT0 2@P`L L0` 8 r n j (""( 00CS00 ä0X0pW 80 ,0S d,"bf7H p!i \PyTqdqqqqqr r4r@rPr -0L רahd} - 3L MP, 0 8 4 < @0  0-S 2@  4 ", p@g TP r0S `T> TP` 2SiT/ LT8  8  T oT00000  lT<00<0 vTzqP0S 䡟@ w2S P2S 0" 0 4 R㌡@ pTx 2 TT 0@0C0D0q810  00S !P0S @2 PR@-2S8 R$<0S8 R000 R00S <0S 0 R00S 80< 0 `@@<@@}+{  p-L$M`<@K0P  0 <0 80 40 00 ,0 (0 $0 @ p 0[S  ap i P -L(Mp0@PK@`  0 0@ @@ K<@ 8@ 4@ ,@ (@ $@ ı@ p 0S  ` i ` -LMR@!x 0S   ~6@] |Q<0 CR P000S% 0CW3? X 0, CR 1000 \ `0 CR 000 \0S@0> CR 000RiÆ0 Rd \0R0 S0 S0Rᩆ -LM@"0S 0Shd 0SP 0S@ < P0  $p (vth  `| P-L 0=,0, ($9 0_hd0 -Pp@LP'`0"pd@" P|1`11111a Q@b15t1 RN pl10SJP a @(P6 00p8_00$,flt! -3L$M `R@Pl#T+TP0-S ( @P\ 2 @@KDKp  0@ < 8@ 4@ 0p ,@ @@DPXDPnH0S_V V@ *0SR 20S@T:?\1LP0S   RR 1 R001 pP%1 Rd!0S0  L40S0C00  ~4115o4 10 R `4[P` 0  @@PD0t ^ \ Z5 V@B Ă܂< -LMA@K#Q%|@0  Q 0S  0R 0000U`@X@P@H@@@@8@0@ PLXT\hl`d -(6L M PR@`,P 0 {0gS 5@DT%U0-S 50 , K P5 R|P hhh%300@DTP5P%0QS 5 p 5Y ppRp@/00zPP /03S /0S4 R0S ,Q  0S ,0@ 0gS /44` RD4Y@$ 800030SU V V Y 3U7V  3U00T00S 3 R3\30@S ,3 R 0qd2`G0 h0 0, Ka0@+S@`hp$8LTDhp| ( "00 L2 'z%|#@T , KY 0 @T  L@T !00000@T  @T 0-0 0CS%482-41 R 0S Q SQ%-  !Tb0pKP -- 1-  ,0Q S l, \,T`,8LX0| -LM`@`|,pQP Xo!QP LP   R RP Rp0S0C00 UX00U +,X B0P0 ,PW 0{Y  `~,\R\{,P" Z 8p,4)$04 L g,$08 L `,$0<  L Y,@0A}?$ !@ L N,D0$ }? L !D,$0, L t=,$0( L X6,0Q#$0H L -,81 R 0 #,! 00CS00  ä0 o|o7ェ000`00,}R  RS0SP0SL+ `oR TO/Ї 00Mb(Ȉ p-LMHPH`@D+$ S0+  M L@ph Q-L`Pp00CS00  ä0h -|@+ $0p0CS00  ä0@@<+ 0B00RPP |( Q-Lp@P`8 \5 0LW3D 0V C,<R 3000` \ 0 CR 000 \\PV 0> CR 000Rh{0 R \{0R \ {0 S0 S 0-,@LP0S EP@0t 0-LBMQ0 0C @St_N *x 0S dU0+| L x 4F/K<0| $4<L\ -0`PL@ p 00B S0B a0BSWBA0BS7BR@P` `Q:0e0b``` -L@LM "00句P 0;0mtl -LP$M@KDK`@  0@ < 8P 4` 0@ ,P PPPp-DP QPP$ 0  ppPD0ph'U U@ *VL0 0S 0@T:Q} M뀂| -QL$M@DT6 T- T$ T0 T0  @ 0@)0 R0 R000 R"x0 R"ddd@ `D0\@) D @0)꤉ĉ,%Љ 08\d@-@T<0 1  0B0R \ -L@Mq0P 0 L@ 0`S os \ K\@TT9 0S0N 0XS0@  $H k)(AQ   d)$0  B LR 000KJR)00CS00  ä0 0S S dy0R PDyP0 R0080 R0"0`ltM0@S,XXX0XXX8XXXXX@XXXXXXHPXXXXX`HQ@@(<840, ꤊȊ̊Ԋ 0-L\P@ "10Q0S aT0 R 0h(0 0h(0h(Q R R  00S "48<#800000Sx\  p-L,M` 0@@KR0 P !KT*00 R ^:00w( 0S Rp| p-L$MPŸPb0 S @0x Rp 0S$4< <<<<<<<<<<<<<<<<<<<r0 S zRp"R 0tt!d` @T 8PK0  0 80 40 00 ,0 (0 $0 0 S08 K70K o0 [R R/0[0S Q"[-K"48<#8 0 .K/0[0St,`dP0d~P 00|.P ,rdy Xy 0-PLM @ @T T ,|Ԣt0 yd0 RK 7PP .㸢P@  ԢP@Xyy -T0 ML\@4 <@P , yp p-<4(LM<Q"4 L0`,$,!$#\@!P0T0Q00SA1T`U '!P`V ,kpU(UU $Ġ$ $< P$Ƞ$$< @|| P@ P$Ƞ $<X HP۵$<< (PԵhP`Xy 0< -p2LKM@PHK ,@ `Upp 0@CT@#V@PK^I \`D PP@PK00PW @0S <0S80S40Sx V$l1ROK RH[  <P0,(!pk1 ,0S ,P ]0 S- ʀS S `V0 00S SpppS SpS SppppXyDLpX -LM0@0CS                     0 8 hh0 h!h#ly0@-d Q00XB.P@0L#"\ 00  P0S:00A04  -L(M 0K"[["48<0#Q02K4 2[S2[S X Z4 0,,,!奴,@K P qZA <4(<"4(< p@勴*4@8 <#8  倴 Pp p+[*[)@[(P['`[,0[p P@ P`i00S W*00SW:x$2|nVh o` -0LS00S4  0S hIh0 7鸋y -`*@P L m 0@00@ rRpRc hRa P\ Pp0,S :S.SZP{00 00B SU*  RR 01 P0Sp* ,S UP*G1@01 0S1S01 R 1 SRP1 0,S UP*'0@S1S0f0C1rRpR 0hSpS00 rS000 0rSpS hS ,R@hR 0\S 0 /R7R0 0C00BS! 00B!00CS0 BR&, p-PLMP@a@A 8Օ00!S 0 ͕0!S0 ΕP0 录 0 p@0S ̟P 0S0Sx0 夕 R 0S l3`/P 4吟 @0 <0 p3ȌhohKԌvp7،07 -pP0@P@TL`% 00000S 0T 0S0S\hTH 0S 8,P@`'$H7 00VHxg 00NH` 00FH - 0 L0 3 H07 - 0 L0 3l07 - 0 L0 3"07 -PL0M $ 0 0p0 0pS`! K$K{3P 0S@! K$Kr3P 0S$0 1ϔ$0P5P0 $ Q 0S$00aSP 0 0QPPW 00S  $000S $0C $0$0QR  0$0TJ鸍čЍ307< +2 -CML M% P` , \ EK@A@%3P`4 5g5 T`4 |5 t5 d db`50S y R<5 t 050Sp `4 4Pj 50S0 0R r40000S 0S0BKAAS0 0r40000S R0t4000ӑ00S0BKLLH40S  040S 4$4Q T30Sc0 x0S30S S0@03P0@00` 2P@~dA43@\4XT30SD30S `43P 20S`4 `4 20S M 2@`4"2Q\20S@Xb0 0Svh20Sr TR0@P0LK3P0@00eENK@D, Z`4 0BPX4S`4MHTUH 0SE 10S< `4 3P6 p10S d T10S <14!41Q ^@10S@p0 0S00S `0@02P0@00P 0SEK@\4XLdㄿ@0  ,0 Sh,0L307 ,#2 247+2< 24DLD0 \- 0 @ 0^ 0l\L -AML0CMP00 , 04 4 0P004@@S`BK@ A@"U1P 04SBK@ A@"I1P 04S44 2妒442PX2 4TpJ <20S2 0 R r20000S \!BK0LLS0  0 r1000 0S R01000ӑ00S044T d10S 44h 44D10S 44 44V 44BKAA?DV P44!"/K0 P 442p 4SP44  RQ  0|@2h0 XH0 ,0S@,3Kč`30747+2l -L6@00CS00  ä0 Xq0S t00S h@h0hP`0Xp01P@`p`p0$0޽3#2 ,+42 -AML M" P4 , 0 BK@ A@T"C0P 44D @2壑82 44( $2 2 8 坽d R1 _ 10S[ 44K1PU 10S  BK@R@ r100000S0 R0l1000ӑ0 RBKA00A<10S j $10S  Q10 S`0 ppW0S00S @Pp0P0P0004 0P@8㔽<0@ ,0 S\,AJ307 ,#247+2L24̎ 2̎0 Spo ? -LMHCD\ <<3|8#0 , 30S*$0S 2 Ԑِ$2r20 \0彐2 嶐ŸŸ"2子2x2`l2P`2@ L0藐<242@ 0 勐2 儐21@{ 0x10S !1ot10S !1bg1`X1@T10 |Np1pqHh F\1AT1T \|00<90S(<0@T Q *0@TP0 ,3Ԏ #Py 20H 1HPt" p7+< , 47@7<+\7 x23''(,2,1$LL e07 p-PLM@P`0S00P xvP00 \vP L0 DpV 0 嶏ppo ?3Xp -0L 0x+07 - 0L0 0 071 -0L 0阑07 0-PLM@ !0S000)P0 dvP _vP0 K ^zP00S0 |0 V |0 0T0 HPH@IX G0S40 8@0F '3po ?2̑07Њ -0L D 007 -0L 8 0(,07 -0L , 0@(,07 -0L 0P07 0-PLM@P\1 T NP@!0S000!P uP  uP0 T0P @,̘0@0 @0S 00S 0Sh000`0@0 P\04@夎0 00 03dH po ?d1HP07 -0L 0̒07 -0L 0ؒ 07 0-PLM1@ "`uP0   XuP K YyP00S 0 S0 00 0S000hPt 0@S000008,0 D040( S00003po' ?07+8 -PL M   KK,P 0S0 0 0 0P|@0}S t00S\0h0\P H0R@0 P,0  Th307&2 -MLMp0P 0 00P0P 0 Ǎ`-P0 PZ ANK @D@DuP X0 \姍PG 80 V D 0S( F307ܓ -PLMd   KK,P 0@S 8080 u(0 0č3 07 -PL M0 , ,K0K0!+P 00  1T1 00 1 0 幹4 N$ R0  0S 00,0S 0S0@0S 0P0,P0P000 +P0`@4ㅹ@餎307 ,#224$ -PLM   KKʏ+P 0| SKKʆ+P 0\S T0T0 D0 0u0S$0o ,8@3H07h -P0LM0P01@0P1 希ϖp 0\``ŖP ,P0 PᷖP 00|S ,P W,Pp0  X0,0PBU hBM3p07L -PL$M0 , ,K0K!*P ,0S ,K0K!*P00 1P, 001 4  4@ ^P 400|S 4Kr,P 4\+PP1 00@ <1 41 嚸< $/1p0S. ,00CW*Ww0a050K00`!50K4&0pS0@0S 0P000+P0P00h00S ,00CW<`4@0 P,0 TB餎Ȕ3M07 ,#224 -ML Mq0$0 =`9P@P@P@@T+(|嘧PP 0S`Q/"P@Lq@BnK-0 K@`F4!0✕ 岕P+0 K0 10S A啋 X00  0  FDBK@Pڷ׷`Pt00P@ $0S<$DCjls'3,j07 -L`M|q Px t `tKxK\!)t0x 0CSD1 <.81@0P+t0Sx0t00t0 x0Pt0SPp@K Ovr`@x0 @t00t0 x0 `P \0| Vt0Sx0T  P0 0S<  D307<DPXhdl,Lg 0-L@0LDP0eP 0000}S$0ʊYP0|073 0-LMMlPANK@D0@D0 pP DD @0塊C 0S$0 C0ȕ307Е -PLM   KK)P 0S |0|0 wl0 0 PH00}S <0<0S 0l0$ؕ307 8 -PLM   KK(P 0S |0|0 >l0 0PH00}S <0<0S 030$ؕ@307Ht -PLMX   KK ʩ(P<800 (0  '|307Py -PLMX   KK ʇ(P<800 (0  鬖307Ȗ -LMM0BNK@D0@D`+,0 ɓV+pPP00U00S BNKB.K@D BQ@D BQ 00Q+a 秓PP00U00SBKA0A@-0K-PP ,0S,BЖ -PLM   KK(P 0d SKK(P 0DS <0<0 a,0 0 ؖ307 0-0@0P 0 0RLP0 0-0@0P 0 0RLP0$0 0-0@0P 0 0RLP0@H -LM4@0S [0SA, 0-T@L0LPSH P@40,0P 00,?P 2` P- L<80 ܈,0  :hkX307pd -Ly-800S (0( 0S00ϴ 2,h7 -PL M0 , ,K0K!?'P00 1埈=00!p4 tAt坈d14  40SDAL 4  0S$A0剈冴P`4  0S 0PU @piӴ0 PP@L d H,040@ L0 P0R  㯴|307DD,#jh7 -0L A 0ؗ4707 -0L 5 0@707 -`VLt Pl@lph000000H000V ,00h+0737 @-p0@S @ T00R00S0S `P0S  0SQ0ѷ  Q00R00SU000S 00 d7 0-PLM  1A00嫇 P KK2&P 0S 0 0叇 0 00 P0 z0@0S 0 S  @n@00D0HD 0 S , ,032 (07, 23' p-LPlM@ `K01 R R; 0S8 0$S \S0S@+0^ 0R 1N 10 1<0K  R 0S`0K  0R@T 0S0 SR 0S0S0K Ac000S 0[S@ $S \S0S0$\( r$300000S 00S 0 S 000S1C0K 1SQ <0K`K ! 1R 00 1R@D0 S,S : ]S8 0\S- $S' rP200000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R0S 0 0S,S ]S0SU @@T0 0 RK ]R \S0S0 R ]R0S2:0,Sq ]S@n) r000000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R000S1000S(0(5pp3d'3D -$0L \0020`07 -0L % 0p< 07 -0L  0逘,07 -TL P D00}S8080S00( P 0  鐘073Ę2 0-0LMS0 lKP@tPu @0 \ ,0ą0巅000̘3lG P -L MTr0$ S( D P8"$K(K3$P $0S (0 2吅 2 10S1(0a ~0S1 0 1|1@0 P00E0X1 `1!!00 00T11 PU @!00CS00@Ӥ0Q@t0 S@  1 0U UP 00PUP00CS00@Ӥ01@ T tt 00CS0" P0 R0@0X307L "h  0-PLM   KKʏ#P 0S t0t0 d0 00J%pP@0<u   Pք0@03807L -PLM   KKZ#P 0Sp0p0 嶄 0[%0sK0  {( 0   壄 0 38X07 0R- `h -LM00 @P  0 0h逄Lp3 -PLM0 ,  !,K0K#P ,0S00 0e0 8 $P0 =P  0S 4Kp3 `0 p吀@ 00 h04dP_N4:00080S:8307s\l'\ -MML M<ğ P,   % OKAOKA$@"P4  S0X C4 SP@ 0X30X 4 33 NKI I tt#܍1Tß5 01 PU  r@300000SP0QcL 0$S \S0? = r200000S@ 0 r2000!0S00@C4PE0CS 4At"0 fᖍ4@iQ4 Z% P 4("  fᄍ4 x`000SP0S0q000p`1p1`CP 0S 10SX1_P1 1h10S ,A0S 0pH90V L@K 4)P0 08>P t  `GA0Tp1 B SK <mP," 90S9 up p1sp  p ȿP V 0S @p ǿ0p1  0L@K@<P`@TDfp1S]pd| X 80S 8"2ր 7рF70S7l"Ȁ:㽊P# P@<. %㲊PV ͊P Ɵ 0@誀Ɵ 0墀7V 崊P Ɵ 0@葀xƟ 0剀pp ~K `6P  !R B00S S S R B0! 0!R0 0S S S 50S$6"\ QP@ @ {P  {P    {Pl6|5 45 ~K坚P  !Rd 00S S S B B0! 0!R0V 0S S S 1SO T40S4"  gPRK@ j$0Sr0So10Sk P 4 fP@40 @S04 "R !p1sp|1S|?6=6"2  SSSx܉P20t1  x"t t1SxP(01 幫P 1S$  x2P@ 3 0! Po 6 5P Gu2B  t!p@ P 10`S1 10S, 10S(T"0S!0S:@2# 0C\0\00^H10 PoR0S*1K*2P 00Sz 00SvlPq0Sn00/PY0SV*01#0 CR 0RJ00G`؜(P|M7n2'(,Н'"C !!(,D\t0Ğ8P`dhlm̟+, 3 @<^,0 00CS00ä01^X01S- p0s 1S 0S 0R 00S 0~00S0~P R  0x(,0P p1sp?Q4|1S|44!,0 S,7 -LM$@#g~`q3Ƞ7 -LM$@#U~N_37 -ML M60H ,0 0L P$ D4 @P@ |60S%D4\㙪T 㖪LPX  0SX (P\  0 S \$ D4H`D SeD4L$:P^ D4LT D P `   eP  dP\ t dP@_X$R P$p'#@/ˇ:PLJ@pÇPW3 W1*P0#03U0S* TD @@ᰇ`@ ᫇PVV*4 T4S 0S Y 0SD4L$PlT%T "T :㇇P` U  R0305`1:`:vPT 0S U ppU 0S /IPpP|30S p3pT$ 0PP Z}30SM<3 0V@4 10S 1U!  0|V BNK@D@D0!ut1 @4 < 8  XACKT1APA@4 PP4CKSAA4$ 84 1!0?2cS D40`4 3D4`$0RD4 D4HSD0`$0Sr` ,0 S,50,؜\8'3Hhdt@-2PyHTĠ̎07Q\ P-L`7 c2P@} 0pSP' +Q 00 %Q r00000D0S  r\00000D0S PP0pS@00g頡p000000S00@ p0 00000S70@W0@ 20rP000000S00@r$000000S70@W0@ -LMl @c0SX  b0S<  b0S$ w0P 0؜ȡ -$LYM0@,0 4p@` [Kt `4Kl  0h d `A 8pP$" L@KƅP P#LK 0᷅P#LK P03L0[S LK 08PU u  Ứ x3 p1Q,,TLspA@#@3T J p10S S_K <夲P,Y2 S{P`Ȣ& PP0S U 0S S_K <yPP,.D 8`@TV  1 p q`cQ }0pt1 @f`]/KpA P J0S x ^?K 嚵P rxA00pl0dQS PP* H10S 08 0zPPP | _?K,eP00S` p0\0 x0 ,0S,31:`p̡ԡܡC07d #3! !8!9L?,<'`P -LMd@3 0 0CS00ä0Yx((0 0 S 3dh8 --p1pq0LS00`& TAT^zH uP8 4 uPLz G00CS00  ä0 Y6P@Ts0  !㗦 @'%z0 |.P0PSTy'd3X`ht|?07T}4D P -LAM M8B>K0C0C0 +,  %@$ R p< 8 4 BK J4`J U0@S񟗾\\DP 0tDPp 0Pyu04S440S (D(y$ U; #0SS5V4X24UV 4V00V00S30S#30S X X0Sp3|3 qyX30 CR 0R0 S 0P0XXu3 00000S "01000C0W2 0BSpRdppW00X00S u2 00000SpW)0U0 U00S@$p0 @<2QP4@ 5dW(UpX-U848S1  8 V-0K`ZP4A PP210SS5V4Vڐ10StA0 CR 0R0 S 0P0TX4$RB>K 0C c R+#$ق8Q 00 S Y44044 1V 0  <6 0 YR 00S <$`0RR0F<,0 S x,1< 0  T}07?3h7e #9;D d -LM700 (@(0 x~古d3#9 -JML M͟@͟KK` ͟VSp=͟N_N<,p 0P@004 <P@0< 0 $ 4  Q 0-S<$BxTU< ;x|<@T $_ \< X<RHK0C 0C)00P 4S 4 S9T t9Pt 僣P`I 0SA 凁P 傁P7,90S 0CS  7b4,90PP  4S8P@80<HP 4TSd8P- 84 $R P& 㖣㓣4DS7@$P ㅣィ4TS7P z4S 4  4S \ gd7 0S k0CSh6ppS7/4 APp``@VH70S> 60S 60S6&4S.ʸ4S 4S'4x6# 0C\0\00VK.K 6 B B Ɵ0O4Sʸ4S 4S5BNK4@D@D+(P`60S7 50S |50S/hşP*0S'450/P0S*,5#0 CR 0R00U4 00CS00ä0U4PVW0 S|4 VOh4#0 CR 0R00U(4*K.K3 B B0Od40S 30S 30S #4Sʸ4S4 S440@3 0 CR 0R00`U<3P@ 0 CR 0R0 S 0`0GU2P@ p` 30S2 20S 20S*x"4Sʸ4S4 S4P2#0 CR 0R00U2 00CS00ä0U140@ 340@ 0 S*1 4$St1 4弹}4S2  ڡ.֡ӡ4DS0@ ˡ10S$1 "@P004SM4 S0  4S4T 0S0Sf ,0 S,O.2+8,+(,3@L 2L9D `H,MhxX07lp\'| -LM00 (@(0 td3#: -LMϟ@`0 _X0K, 0` 4` <` 0>Ο0Οp0 >Ο0p0 P` ~PH H0S > 0RS ,0S X,00-S \>, TtQ@>D t8>0S H0S ,  .0 80 R@0  D0 H0 S  L 厠P! =0S =0SNP600@0S@ޠ<0S<٠,= p ,=p.LϠD0@0 ʠ< X, j~PS ,00|SO ,-P@/, @0S 0 S , @㦠<㣠= T00,0T|  T,p T/0p0WP<0S a0 S,gP<0S T0 S ;0S ,p , ,0S HQ;0S v ; ;RnL@;PL PH0S \ 0S H lP 0S  ( c _P@ 4 40S pW%,}P:00 l:p) ,00|S D ,70 00S,|  *0S:d: ,\0 00SD:, +O80 00KP0S;0 Z0 SiP))P0@0 @.0: S )0S009 H9@T 0DS0 0S 000DQppY90  p@0 S pWPdUQLȟ80OP< 80S 80S4(T0S,T0S X0S%X07# 0C\0\00jR|7XK |ǟ0OT0ST0S X0ST74077 $P`PpÙʈ70S7 60S 60S/ƟP*0S'60/P0S*6#0 CR 0R00R`6 00CS00ä0R46V0 S:5 W W,`V 0S 0 `]PPU 0p P@0S@0 M]P, 80pS,5p05 080 VP00P0  V[5#0 CR 0R00Q4E4XK 0O 50S l40S p40S X$T0ST0SX0 SX0$ğ@04 / P`L0S 000@20 0 CR 0R00nQV v V 00 CR 0R0 S 0`0VQ<3P@ 4p`P0S CP q|qd30S2 20S 20S*"T0ST0SX0 SX02#0 CR 0R00QP2 00CS00ä0 Q$2400@ 0 Sp41 000@ ,)80 S1p 1p080@<D0SD ߝ4屵r@ RH0S R0S10S 8 d1Rp {00 0,K0 p{K'hil 0$, 7qD0S`0d0D 㛝l00S70 @ 呝<㎝2(,ȣ+, +3@L 2@7:D x,MDy,lpLxdh'ԣܣ L`07,P4 0@P@@80S 00S08040S4l 0S0S@:<7 -LM0 S 01 `0, 1 a 0 S00SS  |0S$ `͟lP HP < 5>R00= =0 >K P 0S S0 L<0S$ L0S la < XyP(:$:a?B1cSQ8 PUQ  U@ 'jKiKKgK qK mKo/K=KnOK@ PW1S_1S\1SY 8 t!1 (,10$10 < ȟ4<K^ 4"<  0jKiKKgK fKeKKcKbK aK$K(_K,^K0]K4K8[KK ğpL0DS  p1 P1S00 0Sd >KP@0S S >K  P >K ) ٨PLC P030 >K ¨PxXC0r/K1 帷P@S㔩PQ ZOK3(`K0S S 220S3 20S/H3(KKoK\0P1 \ S_K <@@P"P 0nP R `2 0S82  <2Dm QA Q^ ^ 8 0@X@G)0@0 0  $         $ ( , 04<8@@D  ! 1S0s`0a 0 \^$1  0S >K  P X@0P00  ,0 S,r&8x:`!+107gfff3Ĥ'"$< dxĥH}~T:!,d<!ȦЦ< -0L,MP؀0p0U$0 D @KD K `喩@T彫00巫?[\H0K @H 刧P<` $0S $&8`HP -LM4 0S@0S @, -Lj 000d -|@0Lp0T\" 0S0LbLr0 0S 0b(r@(2(R  Q ,vBΆDQAφA@E0<1 <10@! @10D!D1t00lH1 H1`0L! L1P0P! P1@0T! T10X! X10\!\10 @v (0 T0907 -/L`dPPU1 1U_U/0p0W 0tj@+etZ.0PW0PdZ 9X0l0005Pp 0X0U.S100E 00EPEW Dy3̧| -LBMAq0 S P q10S1  RAnK `F`F0X!P贇0 0YP0, j 10U B>K 0C0$  0 K(4 0BK @@ 尨Pʰ00S0  FU 0K0 +PP@00S 0S8 "?907h]9'$ -BMLM(7$'$70 '7 H , 厅 'P  0 S606+ 6PP6@P6vP6fP6Ȇ@6@@PP6 6@6@bP@ 0S sPP lsP TsPP @{sPPP,(6(qsP5  6 &P 0S50U0S 50@T@PP@ 0S KsP FsP AsPPtEl5P5  X5X P UI P c40NBS񟗓\dp(|  3I#00#0F3;0 0 0 ;4303 3 <3033 rP#h3% '2 2\3 2L30 rH300000S 3M 3 g3  l2 0"Hp_2202 2l0 2H H gP ZƷP BNK@D@D+IrT2@ D崔04SBH4>P 10H P48P@ 㘔 㕔H@1 0@$ D4 < 8 4D 0CKdAA A0QS R  1h1 h冢0S 1 (P@@T d a@p87ԡ"Ԩ̡2 "H (,D71xL l!hd 1Py4-xh23,,+'{ M 2@7,D 0,Ĩ -LV 幓0 p-LMP0`H 0S @0S ѫ00@PD00000S T@0S 嵫00$0 $ 00`p,?`h7, p-PLM 200CS00  ä0 F10S AIgBAQ NP +P^ @0 SP00U1P`1t*g0X!0CS00Ӥ0 PB p?0a0S Q00Np@ P 0S 00S0f0  00S 0S d00 CR 0R00EF \0R TBL ph>32#h4$,D7,++Pp@-& @`QP 0R0S  0R 0S 0`S`PQ^ppp p-d d0LM\` X0X PPP0@T000p#+D7 0,$,?p@-AaP0$S!S0S S001  00 h!h1!Qp0 S S8  S0S00 S0000 S S S "S \S0S 0 0S "S P00P p4 0S00 S000p+ ?, = -PLMp(M1@ 1QQ! ae0p2V*Q 0S 0S H0`2V: iYP@U@p`0` l P \<e0< ePEU 23TX\ĩ -,0ML  0e^hdЩ -MLM , % 5 \P@ " 0S f P:?e |B^KPEPE0d%TNP5P0S4<RNK@D@DJP,KR5( K·.6oP褟 P P  QC Pd LP TLP .oP@ LP  `&LP00c0S .oP@ KP@i  LP0S0@S񟗻tP %P.o5"nP P tnP L3YK0AAP5?P %0S o52YK0AAP5?P{ 0Swnr20S} P Plpp00 P  RqXr0So Lb11@P@U pP ` 2000 pX 0 P0 1pO PpK 0S1 0 0D!!00!!00 00da11 @`QT $1bp+ 0 S0TS 00@T1T|GP PP6@Po0j0"d][<0X0 ,0St,2 1 |Py # 2L "ԪPXp3ԫ p-LM a00` p 0@ PS,P ppP"P@@\P0 p "P\P0 p P P P,P00Ppp8@0S mP 0S p| -LM @TP 0000P 0-0 L0C@R PP 0 Q000 P0-L@ 0S Q 0PU*00PU:0h0 -L MS( 0$ S 33 P$K(K"$ 0BS (0 2,c2 B0S22R(00S(0 2P 0Sp7P 0S (0PP@20S 202 b@ @l2 @l2 @l1 @l1 l1P0S1@1P(0 z1d0S0`0_PV  lP@pl lP@ 0T.S@DpP0@4!bTp,, ^P 10S11  V  `0 b R00 V   ]P0b `,3 #|bĬ07H 871 @"L ,"2dH7 ,p7xg'P;T;p 2<7@ ، -LM(pQ" ,  r  /K?KKP2  2S 2S&20S" NK"*^K ,2P ޻Px202 G2X"L2WB 2  @22 2S&P`x»P`V   0a1a|@KP!O|PKZIP@|0[S@TB zP@2S= |nP@ 2SX0 Pa@TXQ $WP W00S&p0P  k0 0` 0@P0 PkP@P 0T,0 St,07,,!p3h<Ppd  2#D7$,,L x$ -`LMpPU0@T0^a0 Oa 00@dP HP :@T0P S00@@0 800P00#03Lh$,D7 -AML83M4ß@0T,0 p0 3 0S 3@ SP R@0S 0S 00@T@0S|P@ 0SB00SP/S  0 S R?`D"iBnK`F`F+j00S/S/00P+ej|PfPꄟ1X0Q  \ 00 1P0S 00pSh1h!0?2cS XL100$R 1PBNK0@D@DI000SX000y` |P GP@嫤@ VjP0@0x0 ,0Sh,{# (Tx' 2L 607Q;3Ԯ -MLMpp0 S( P`L Tq0SHHA0 @ `"BK@@$!GP9 1$K R01000ӑa0CS'0t0_ 0 \0__(0 S4(+3h <Tx 0-0L0M0@PKS@,  0 ㅰ0S\@0S 00iP  0L -LMp0 SԀ0@0#P`P ziP (KQ(0`P R rp000000S`P T 0S8@,k_ Ŀ';3 -LTMa0qS!0PPPA[ 0r10000S@ Pr1000PU@p ZP \1\)_000 00200`KdKhK\0KX K T@KlK , l0X T0 h0\P0 d0v.BL0 `0A BH0 0D @ 40 qYpP X0S 0h ^00P X 0SH@8^ =u0'07;3ԯ 0-LMH@0Psא0 K㝊p 0SPP0,wt@ -LM@P00s@(, -LMH H0q,0 F6&6K60S |&Qp6\Ɵ  d@ ( A@ _P$ 詅@T@dTd@K0 %{50PCUڔ5 ra@@ =ş@ş`g0%{p `P`Pp%5VF%T5UWPT  @ 5@` \ B0%@P{0 04bQ c<" =9 B =<" $8 82 0 S0S*<#NK\<8" 0 T< 4020bS aD"  BD" @2 =9 =D@2 GP@@C/ {0 6%KHP;%.K]3/C0ur ᷠ@ ᴠ@`0#S{ ᫠@ ᨠ@`t#H{%K>T3OK0ua2g 2crB0@ #? 2cc#aw0S0S%NK/ ^PڄŸ0 S 0S* m@ j@" <2S b@ _@d"`zN !PJ1P@E%K 0 %K Śߘ1Po0uv 8@ 5@`0!z ,@ )@`x!zd1OK0uf2g2crE0@8!?` 2cc,! GzOKQ 0mH~vHP 00CS00  ä0 _<(,0 S,.A  l (,+,l7QPy$0ų@(KHXhx3 -x3LMp 0@@,0 KH3H0b0P a  B=9 = 0 P@ / E0 K腃 KP@/ wP @K .ᵃQP0吠KS0SLŸ HŸH2@K00 YY~/ ~/ "ŸP@Y00 d!py\P 0SL0SI@K]/ PBڜ R>1 P@@PR50S1:PP@ K ͚0 @Kǚ 陙볗 1@o0ef2f2c BD P 0Ϡ#PE0l 2lADd`0 @y@K0 S00X<@,0 Sh,.A>P? ,Py\+TV+lųб3 -LM0`V *0羞0`YV@: H1 ᓺPUP@{`VA0S,0 :p0AT0[ 0S :000CS00  ä0# : ᅞ P@| 0 @0 C\0\00: T,0p0S,0 `Vl73 -L MD00 K4@@p( P0 1[SP00@3ht@l7 -0L M@K 0 K   -$4LW@ "42p, " $呯PP#劯PP" ,K⥄p" (,,ؕ(1" p@" zHAǕ 0H0Q   Sp1p0``!kBT刑pL" Hp@" 0P 大P  -PP5P ~"⁒0H 00E 0 hd{ NܩtN|NNOȴشtĩ <xOTp\Nx\De -,0LM$@ VVShdԵ p-LMH P0S 000` ph`H@s,H0LH0000 H04 H 0 &080H0<`phȩN -LMH0@H XD0,0H00H 00(0 H04 H0 &080hȩN -PL}H0`@T Vp,vl 0S`0 ^W@H 0V0H 00h1HS@`H 0 = 00H0 00}=0H0  00'<0 0H 00h|00H 00 H04 HD0 &080H D0,0hZNȩ 0-LM(PH0 ,0@S 0R⋲PzH00SS S Sq$0#!+P 0h!H0 H0@Pl100 $H0 0S10H0 0;S<00H0@2S0?00 w$H0@ 2S o$ 0/"/0B1 0H0 000H0 0S10H0 000H0 0S10H0 00 0H0  0S1 00h0 "N -LMH0@<0 ,H0HP  P !1P0,aH0Q 0SH0H0Qi H0PCH0 H00H0 0H00 0 _"H0 H0 0@ c H 00h 8@HPX`\Nh 0-H0LPH D0,0H00AT 00 H0@80H 040H$0 &080H 000h4ȩN -LM0p0S"(0H0 &|0PU  `$@0@!P 00!$h| PUhF, -LM0pS S S 鬀嬠ꨀ娠꤀夠(0H0 &0PU  `$@0@!P 00! @ m> PU Ķ,̶ -LM(`PH"2PppQ, 0R 0RP@$0! 4 H 6;0S &0;0100 S+h0SH0@T 0S ⼰Ph @TfP@lh1S00000H0L<0,08,H,1 &P 40PP^p _  ኰPH000H0@H00S 000SP00H 0S@  0S 0S@h0 0bSpWhI@ |8h (N -L PP<!-1`0 pR y P@8O 40 奤0 804 0 $ P@D Z0 0吤1S 100,0S AP P@$) @ ,z$ 0@0$6 P@$`1S 100l0S + P@(P H @ lN( 0040X 0-LM(@H0 ,0PS/0 S (P $H00SS S S$@ XH0P0S0hH 00(H 000hQ0" -LMHD @24 0bXP@m0S 20S H <0S0@<0H<0S 6!@0 <0H0<0H0<PTH@ 80S 6!0 oH0 880080H`Tq 68 0RڣOoH0  6@@8@80S 6!080H0 &804 0 S0l080X8#8#$H@0$ ࣸ$H0`$p#Y2 !4H88<#8h&H\0%0@@ H0804 mN8PNXO p-LMH0@PH 0S 0SDH0a 0S6 0 eH00,6H0H0QFPH0  S00H0 0XbH0 0@000n<H Q0 0H0 H 0S 0S R0 0H 00H 00 0H00S UPS|H0QTnH 00H0P & 0D00 zph-ꈸN`\ĸL  -L M00PH$c(0 04 SSpb  6#0WH 0040S<0S 0,Q PH0 , < H@0S 0 0RpH0dH0QP DwH0Q,H 00u80S 6"0 wnH0 8ᴯ80080H`! 680QڣOfnH0 8夯@@8@H0S d1 80 0S0`0808K 㶰H0SS 1 0R0040 070K080KC<3K0S0``0S3 W08#8#$0$$43[4#DHL0$H 0H0%@H 40880  (0S8( N"P8X\p@` p-L MX`0P#DHL0$H 0,H$0%0@@bpNpO -L{KM$pGBKpGMJP`@*J%@K,+ (H!@#H5.7%0KT# @ @P3L 6,  `3 #1SH  60<S  60<0 6!0<0H0! 60<0!0 0QH@`@ 0 ``` ``/H 5KSK?5H 0@0H 0A0H 0B0H0C`H@OmDH0dH0dH0L`H0P`H0T`H0X`H \/ -LMBKMH0P+p!0KKK╯H @D@Dd"@⎯`H5.7!0KP#  `P3H 6,L3 `# ` R00R0S5 _ 2>  \3 ` #1SH  60<S  60<0 6!0<0H0! 60<0!0 0QH@`0 @``` ``H 5KSK?5H 0@0H 0A0H 0B0H0C`H ,0D0H0dH00CSL` LH0dH 0P0H T0H X0H \ -LEM= K MBK@P+Hp!@C>KH`L3 F.KE>KH3 p=K @0$ P H X3 @D 8 ,t (t $ L D < 4 6=S F>K,3 6=`4 6=\4 6=T X4 @@0 @@@ @@ H 5KSK?5H0@pH 0A0H 0B0H0C@H ,0D0H0DH0DH0L@H0P@H0T@H0X@H \ p-LMP$P(P@`40S8`V@Zph p-LMPP @7P-{8`0H0 @T  @TX0H0Q c塉0 ג0ph雯NLN -RLM`P`B0S00ڳ`008r0S,B,7P 4N00A.N !N 0 N( RN$ RN,0S N`@4 Q 0 8l!0"`M`V@E 0 @ v> 0M E 0 v>  0MD 0 v>  0`MTMi鱞?NLйh$8` -0LMQ`(0 p P ( 0$0 (000 0 - PP1 $K >  @(K9 ( @R 2 @b,K0 ,0 ) 0, @# t$ 0/ p 鴺ĺOк -0LP`Up0 H0d &H@6SsH06S {WH0 6p H060S H0ƐHH H<V004 H6H$ 0h0NPy8@ -ML M 3 P, #0H< 0BS:@<KY<0@pK@0 @G 00T`K0T0 S$ Dd0"H1 S@KHK0hPK0h0 S XH0"H(0SHx"$0SHd"`` Pg H@ &PN 40S0@L 18SG45@5\558@4@H0 &0@冑9 40!1YsNK@D0 @DH08 64  64 1h1YdT1`"PsNK@D @D8ǝH0 &40!ྜྷ0 04 R8@Y ZK'P  0  0HR7`0V7 P {NK@D @D0h i0X H;,0 S@,BN,8H\hhx -LM( 0Rp80 00 40  0 $P 4 Z 8 0 K 08 ,@K0!=0 , (0  P40PU0 Z2V@!00P`(  @ !0K0 @(00 @4K0 @y$04 @s8K0 @m 08 @g@P4 `804 @ZPU@ZT,B(0bp; O4ĺOк -LMU 0P00$0 P P@$pK   -Pxt`9pd 0 0 $0 ]$Q< 0 S0(K Q(OĺOкػ -<1L(M44PK0(  "(` U1V H0 &v0@0 @P @08` <0 @pKH@ D 啌PPL  LK0P00P@@TP pL@ HK )PVH( 0L[R0(NO  O 0 -L M`ҍ6p0@S 6  +FP610=S 6p1S&P ,0AW2PHP@FF`FV6 1 V囍@ ᘍ0@@@61SF @0@$S `S<~0T\ : w@ t0@p6@@ 0  h@hļ 0-6P0LS@ 6&016P1S060-00S ^0 0-S_0 000S0 0 p-0LM0 S@PTl`d0P@ܻpT 0s 廻帻ڈ00pNĩ̼ -LMAP4 8 04 8`{@UCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCR@TdpW 08 0 Լܩ@- .0R) .R@" .SABaB00B\Q T00.T\ABaB 00B^Q S ^Q00B-R S T0  0-LM@P P00B.R S 00B.R S0S0 S0 S K .P 0 -PLMpQi@'0T1* Rr000000S  0RQ 0 eP`F0'S"S $S `S \S`F\000`F0@0T:V00$?<H#\t p-L M`P᥉p P ,0@؃幹嶹峹Նӆ PK0  ` 1Kņp@O0<ST 0 'p|Nĩ -LMRBy "ŧ" 0< 1<  ̌001P  001` P \001K/ p!1`p 0l|0 00P10!D1  81  00P@ ,PKr0s  h8Ջ`P@H0S bH0H0S4 0Hb.]0H0 6S LPPt$ ,, ֘0H0 VT0P鸩 O0 e  $Nhe -LMp@+d0P@ K r 40R ,#w鼩ܽ -LMP pK`@ @@IP񟗹LMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM0LM M MDMPMdMMMMMMMMMMM@LLMMpMM|MMMMM\LLLMMMP 0 Pl 0 1(P 0 P 0 1W \V ,,+U<K,r  k0VMb@;P  <\t -LM@$`KpA?@0CSP ABAQ 0($yUP# :R :P $p l0Ph  $ RPD$y̾ -LMPp`$K 0PP ڼ0p  PP@ 0$,P @T T @` V y ,P ;P @Y,($P h$<X -LM@ `KpV 0P ,H0PS[ H0 6Sh C {P h%OX e r }R H0 &X( p p-LM@POPpp|`@T ~OP @T\P@@  \ 6 QO00@pNH0S W$ H0PH0` @T 0 S  PV$0 H0  @TW$  H0 00H0 PH0P 0 S  0R ⒡P$0H0 H($0H0 0 $0H 0 0$0H0P阿48NP -LMP `K@p$  @@:PlVV F0S 0 0 B 0S 1S 0 l 10@  ,h@ -L M`V Q0, `*V 0X  Xxp000 0 STAT1 D1D<1 0R,0$ 000o08,0Q4Z㔛P@0  W4@0p0P@x0 40 D0 ?00 000 4<4@00`V S:0,  0 hH\p -EMLM`PR P, *Kp\1@ P 1S  Ƞ\E_LPE 0S@PtR UZ#VK500600300V800 Q AUK0KSJOX 0KSJO ܍A Ս0 Z@E⩐0 yKP:K(H\!0HV?K c0EPx1`0  ᲍@T @0전0µBz0P40 00 0 ᝍZP @dTl ᒍT @0Tl0  @0Tl0 きP0 V00S @e, u?T  @0?Tl0 @0?Tl0,0 S,*dhcSc8 -AML MP, BK0 @+44 8T U\4$84p!RP BKL1SK`\ 01200tS< ` < V@T 7  V00U@0S0e 0U 0 S 0e@00S@T,$<4Sp@ T 1 F ,0 01 `VP8 Q8 h -L4Mlǟp, XP T Xp @gY@8Z,\   G \ "00 S T0S 0 X 0LKX 0 0A0C3SgH{||||||||||||||||||||||d{||||||||||||0|||||||||||||||{X 0 BT0 X 02 QP0 0R r50000S  Q QT  x0: p 0\ T 0T0 t0 0 K0K p pp0  "0 0Sx W4  0T|00 W00S4 gTP ሙT TQڗ Q@4 aLT R ZT Xp WL K0B0C6SLLLLLLLLdLLLLLLLLLLLLLLLLLLLLLLLLLLLLXLLLLLL~LLLPP"00 0PET1* Rr200000SP 0RQ 0"W`PE0'S"S $S `S \SPE\000PE0P@ 0T:Q"00PE00P2 8 #" J  DPb 1  0!WpPTP`@/? 08C8+ 08#8l!WpPP`@<0D!0K0C 0C1 BS 1S@T0 ,0S,\Lt p-LMP`×P@  `pP0-H0@0 80840400,0 \e@he@@TeW@`eXe -0 0CS00LӤ0 ^00# P 0 000t0 00p PQQ8 00C 0000@@`e@TeW@@ p-LM@l1Pd1` PP10S Q q041 0000S#Q"Q0P0`pQ q0 00000S-Q0P0`pQqx0 00000S X0PP0`p80< P00`,0 00p@@LedePe@@ 0-PL0@S| p0 h0R`0 X0 T000y40 ,0 T(0 000@de@@TeXePe@ -LM℠0SxpxxPx`0 0 S@^L0 D0 @Y(000@Pede@@`eXe@ -LM@p P p-LM@`Pppn UP\PP "P H0D0@T80T0Z@D0   0p@@ -pL`P@xP000PP px0000D0SX0 L0@T<0T4 @D0  0@@@ -pLPBo@xP -P_P p0 00000S0 pt0 000D\0Q`T0@TH0T@@D0  , 0h@@ @ p-LM @R`pRx90000ӑa0CST<\ЌlĎ,,Xt\,ԐH,,@PpPpPpPpPpP|pPtP p\PLpHP8p4P$p@P pPpPpPpPPpPNp P 0S|ptPFp` P 0S@p @8mPp fPp@^PpWPCpPPMp@HPpAPp:Pqp@2Plph+PXpT$P[Dp@<P p$PpPERp@PpP6pP/pPPp P@PxptPOp@XPHpDP4p0P pP p@PApPp@PpPp@PpPp|PKpdPTpP|P@p<uP,p(nPpgPp@_PQpXPpQPEpJPpCPGp<Pxpt5Pdp`.PPpL'P<p8 Pp PPp@Pp PpP:IpP P@PpPJpPSphPXpTPDp<P0ppPppO8mF69= ?,M<7L9T"hpx*IC:d!0K,%'y8Z A010*<L 6;<PB\d#BNp&Gd +.23>8J> /L) E  L-,(B8LX l5| --LM 0 /0@l !0S X)wP 㑕L ㍕@!0S 00)4("JFNLX --Lt r0\ \/X0XH !H080S v$ Z  VJFNL --Lt I0\ \`/X0XH l!H080S v$ 1  -JFNL --Lt  0\ \7/X0XH C!H080S v$   JFNL -L`@Pݾ pR %R0mS 30@ QPD"`@`PT@D ń R00鐪 --LM@a 4A010$!$Q$`P0 !. p  0PS00  c 00S 3v 㛔 㗔)v 㑔t ㍔X0d  B⇔P ეH0 Fde\eNJXePeeLhe Mp-L@M`P@ 0K e DKa0 D0RX QX 0 00T K0QXK000 S p Mp-L@M`@P 0K /DK +D00P0X0 XKQ  0 0 T0K Q00XKX0 000 S p M-L,M|@  (K  <K(<0 \$K8KoP 0 S  M-LM@  (K σ(0`S X$ 0S880 T< 0SuN@-\@ * "48<#P @"@"\:\* 0P @"@"00#  p-SLM@P` (K 0S  z0 "KS  m 0(K 1Kc000p -LM<[ @qq/P@ ,q, 888 0`0U8Q" ?P ?0> `qB8 8 0@8?>qG388@ 08@T $Ph -LM`-Q@TpP00S xR@ Rr100000S@0w @ `RW B @R7 B/R0 BhhR0&&SX0 E0220CVT T !X  X X BX U U U 0f0fifii(U U U `!ii$ MPyDp -L0MPTpK@PbT`080 P@VTT2< Pv>@ 0C<0 Ş/P@XGP@`<?T=0@@0 /P@4 P@-T+0D0 yP@"T 0H0 n:P@hP@T0L0 ^:P@ hVP@ L7;T`T`0P0 0` 4` B;P@ #M<@E0L!!!?!C!c,B^ B^DHL@PP 010000012c12c1 C @00012c12c1 C @ @lX,th p-LM`@T0 |PUP0`0p 0-L@0SP ~0000 p-LM`@ 0 cp 0P0 0U_0PuY0#S U0S R5;mk0pH -LMpP` P@X t`Pd00S ,0#S t  V15 1;p -MLM%0KA ,0 `hQR Q *Q 'd8 SiKAA ld8 S:qZlPP <PPXO l(KA Al K+B 0d(0Rp8:s8pP@ P@- p({">K0C0C#8 Gd8! Sl5;h#cKA A]t(d8!M@S:rtP P t( DKA ?xd(0@R:qxP ŊP| x( &KA A |(d8@S:r,|Pp 㧊Pp |(PゎKd8H@ HS( ;KA A01(81(Rd8@S|:r{0P1P (PUڈ< 8 9 75P(1S>K0C…-PU+d8PSjr 0 ( hX d8 ZP@^ KA jPVKA A aP\MnpDF<C0 ,0S(,p4ĺк 1 P-L@' 1a 0Qc 1 EPVP Qxh!0 'PTP ?3@ 0O  q0 Q@L00P 0@0CS0@0 03 00CS0p@0 02< 0Rkkkkм̼ $ -LMP)PpC 0@ S 0 S`ev 0S쀟쐟0 xPP 2i :`0$0O` P4f@002(2 C <kkkL$ 0-DP@L,000 @@0 0 0 0 nld0 S- L 0S S 0SP S  kd p-xQxALM00P06T1 P!QP3VU00GUX $ 0nS` lS0 P 0 R0 ,000gPc `0pS`0  qX QX} 0qD=0  00Sn _Pph L= R|QP=- PT 0nS` ElS0? P 0 R03N0S!\  \0S \>TTTWU 0d HP0P > R > RqXG ?;`0pS`0+? `|? R$! 0nS` lS0 P 0 R0u|?`0pS`0? ? NPD010CS0 0nS` !lS0 P 0 R000  Q0 P|`0pS`0< pP0000  tll4lT -`0` LRTLL0<SS,0 0Qڄ0llhlldl -LMܠPp@* W* 0 0S@@T0TbW`CPP l0 R   0埙P 0#T 0EE@ nl|l -LLM0 R8Ÿ" 0 q00  R 0  R1 A0 Sd KP& 0!S] 0SWʬaQQڌ 0  Q @0 0 0 S 0  {P,q$Q0L00P 0@0CS0@0 $0 00CS0@0 0`00P @@0@EtlLHpl -6LM PR,P l,K6\@Pp P,0 Q@i0! ( P0 S 0 !R %R  Qd 00P0\ST 0 R Rʤ5 $e5 P %Q00!Q`uTş0 R`l004P 0 0CS`0e0 |80x"00CS0D0e!0 0 Pdt Q`l000P 0$0C`$S0d0 =|00S? h@ P4 000 S/ S- @PP pP `0S P@` @@ -oP|0p p0PL@oT,@P0$ tl0' -LMq@P0S S  [Rb \RZ 0S  S0匡Pc Q| ^ `1 @ RD1 0o(0 Q`l00P 0`0CS0`0 000CS0@000 SH@P@(tl|l  ^R ]R 0]S S [S  0]S S]R.Q =Q:Q R]R 0 S 0R]S -PLMPP0`@p T/ 7P* 0 S0 S00 10BS gR  00 p00 PP 0P0 P tln -SLM p 0%S 0 R ࢟ Qx0  P0 pg \PG 0 R Q0"plR Q@L000P 0,"0C@$"S0B0 000CS0A000 R0 pt1 RlA8P X1 0R S 0`00P 0S0BpG0` Q@L000lP 0 B0R@ q@0k ho0lY00CS0@8h0SL(@00Pi0Ftln$nnxlhdl -2L M0r0l^L@4 , 0 000 00,qP`0 0bZ4 @R  P8(PnP!0@00`T@T# U T00CS0@0 4 @ 4 0 zPP00CS0D@0 0hll nn -LM " P2 P@" " q ğ0S   ?KُPW"R 20R2 84bPU$0S4 >\"0S \ 2 1    ?K媏P 3 `d 0Q,V,K 0S 2Pß0SH#  \030 \\ 0 0%rŸ0 QP\00P 0"0CP"S0R0 W0SP00CS00B0 B0 0o࡟0 Up|00P 0!0Cp!S0Uq0O L0X00CS0$b"P U" 0S  v[0 K9P0x 0uꬠ0 Up|000P 0d 0Cp\ S0Xp0 0" 0M|l nnL( -L MH0 @\, P40 p( 0&S \S~ 4@TM0 P0p 0cS3 Q 00c Q@L000'P 0t#0C@d#S0\C0 n*0j(00CS0C0W0Ȃ T`l000P 0"0C`"S0xb0 30/<00CS0 00S|9Sz400CSv02 @`1 d Q Tq, 0@TPgꔡ Q000塿P 0\!0CL!S0D0 000CS0x0 `@0 dQ T2, 0@TP(꘠ Q000bP 0` 0CP S0H0 e0 n$nn n -LMؐԀdP`01 ^, p@P+P@ @q0@0 A0@0,A0 00j(@@LPH -LM"0 s8 < 0s BВ0S2  @0T00@D ڄ0r 0StFH0H0H00 00 0 T0@D0#0 N @0?T@Dڄ0qa4PK0 d 1 0C 0 d 1 0C @D /\ `Fʀ1 R!PX D0 80!0C,!,<S0(A0000 00 0@D0 00 00 00  00 00 N0GT nlXP`lHxlD -`L0 0Cs0 p001 R 0p 0Cs0d0d 00T T00@PT P0@޽TPH nlTX -LM@`.먃0#sP 1 0#{wpP H0@*SHJpKpKpKKpKpKpKKpK,KpKpKpKpKpKpKpKpKpKpKpKpKpKpKpKpKpKpKpK8KpKpKHKpKpKpKpKpKpKdKpKxK  0 1 "P00Pp2W00X2PH2D2 @bTaz("0S "0S n ! 0 g!0S ZY OV1 Wt1@DStQq+ PP*I0S0E= 0 0!K⻸pp-0S?T%w  r냿!0S 0S  BK➸1: S 0S 0S BKVp0: S.  0 0 `eJ^ H_J <fPy ( S  S QP00x2 R QP Q02 R Q S  S S- egQ\1 R1 R 0S 0: SQ Ȑ00t\!ePAPDLe *{v 0S e@ 00 0: S, {'0: S#0 R0S @0f@PM3S0@0g tzeA S00 w0S<W6 1 R,0  !0S SCQCPH4*pKQP  0R1 !\P p P(C&Cp|CCTLQLx@R0Sa  (D,$p 0T0 PxphP@BV;   wP Ď0S @0<0V$ RP @㮎0V0 LᾏP 0-S xl@pL0S LD>4d IL ߒ@(nMb -L 89@Ps0 R  Ē 0-,@,PL $ hd\ -BMLM;;BK@(L; L , @0gS0*K`t[K⼐帐 p00\0PH P40 00(;  0uS0nS0 0 0BMK(@D @D P  P[K@ @Z 0(K 0BMK(@D @DP B}K0(pG(KpGp 0v3P@ ?hB]KBK0T(PE(L4 PEL # %-*01`3P@0C0B-K( B BS1`@ 10DES񟗾^^^^^^^^^````````````````````_````_`````````````^^_(_`0_8_````\_`__`_p``H``h`K@@ - 0DqobnBMKxX(@D @D 00Sa DE8 /'P,(NK@@ Mȟ0 0 0 @ 77BK@@+  P#%* K ,7 (dWKBMKL(@DL @D0.S 0.  0 l b 007   ''000 &6PPqp@060Xap6(K0&SBmK(`F6`FK00Q0 6   U@!0-S 0<S46 10005 @T*K R 50XS5% 0X0KQ000 0SڨJE0%0s 500 tP0ia3P0C SItbtctcPctcfPctctcb40Sa  v0S'. B=K(0C 0CP KAA> P NK@DK@DLL$0 P *@P@00: SP X  0Ha@00* R 30S R30S3#3P PC0S 30SP a0S BK@|+@ $*K R 0BK@S@ +P20S`rNK@D"@D0@I P! !%*Ÿ0S#BNK@DK@DAA♲T2Ppp0SP8: SNPI KW  8: S:Kq0S 10S10S p p1BNK@1@DQ@DL! 0 P P $0S3H!0S/@H10S(RP$ 0SdX:K0S @P 0S 0S 00S ˏ ;` tP``00S Whdrrxr`|ho{ rprr trr8rXdhKCPy8D`tphg| - L)` -LMK ӱP @0S  [0R 0[S 0S -ML4M4ğ p0, )KP0 `N P@30 SJ30S |PP 30S P 30S_M>xß0 PR  0\0P Pp 30S2>3@T KL" SN)KPL20SKL| `P t20Sl IK(@D@D))KPL Uʥ?Z00S 20S v0S  q> f_j0SYK(PE PEP Z10SxP_|1 R1(K0|AS KPP1(0,  0$   0S H P00KLq =P Z00SZ#00S (K0S KP(K(00  h00S )K( B0 0C00(K B0  ,0 SL,׷trr0rrPCxr8pr\ -LM<0`Sp (10S$,0!(PϠ ?BlD3c0K0 , (P $0 ]9P0S k0@_k00 0lGP 0Sl0;0_PDLQ 9P rrMb  0-@LPOP!  PD|000CS00Ӥ0,F Pp@ 0@ 0CS00Ӥ0F PpyT0h -pLQ  P@ XP0@S P`PD1SQ@ -Lp@`PU 0 0f0@L0Sr00a000 Pr0000D0x| -L$MB0, S`20SŔŶː0, P i t\2P, 0 , S 0 S0 00000 r 0< 00  P0K m$n/ ;0 W$P^$ @0 ?@S$0 :0 <,P@0K0<0 p50( 0@<0@ 0@00S(R&SŤ:˰0000P$T :P@ $0 ;0P@ D0pY@lntr8Tn\ndn( M-LM01, 0p`S  o00S P# n:P@ #0 |;,0 txp `0pS  0S P@P@0 ,0oY@rPrTrt - 0LM@ xhd -`QLMW0rSwS ?RPPU Xχ00E[P@> 1,PP00PP4PPPPPPDP s0p000wS  @0P` IJH0090囇`0wS  0  P  @X@H@L@P@T@ -PLM@P`(0S 00wS` rS`U l0 0 0\000T0000 V:`:kT@H@P@L@ -LM 0K# Q]P p-LMD0@S PH`U 'P)ѭP0 D0 ` 0C00  p 0-LP@@0D0HL0 -RLMP` @10@P]T@TSQT1Tq 00 @0D00@Dt p000 V@O@0P00 V4|p V00 0P00 lpX  ec8 000DP  O0 0H@L@ -L Mp@  T,KPt $+K*K < ^' K)K&K%0K(K  ^  $ K` 0# KT, K< 080  4@ >0000 T  <K, 0 pS #L@ -LMD0PSp NRL @T 0@H@)٬P0D0@ P`.  gp0P  00P  00$ 000 P@D`  `VD0S0S$@  g0 cP@L@ȠQ0@-,Ƞ@P 0RO @!@1UQPa30 0  0  0  0   0   0  0  A Q @Q 0Q <0U'7cb2" cb0q 0S 000  b0 QŒ00 , P080!Q,000S\pnX -0L0SXpn p-QLMP@`p00SV@+00$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$01`FV$D#V 0 0$01`V$D#pXpnP@-P $ R΂R@ p`0P80 D  $04dH p-RLM@` @0S01RPPU pPp(0 PS00P(0,0S00,0| (PpVF20`f$00FPS0,0$0p0,0`phԝ0 0P00D0 0L00H0 -$@L,0pS` P0 (P, Q 02 0$(0 `cV:,bwJ 0$00(0(0,PcUP!f hJ`V ,f aJ 0(` (0 0S(0$0(`S*0$0 -PL,M4 8 S $`VP 0SM 0S0SG0S00440@  < 04pD H L0 0S1Ԅ ,@,P<tԍp@(4@H0S0  WZ 0JpW0(=à c0#22cPQ0S(0 0SpG  4p008WZ 0JpW(4<(<,4<04p8000 0S  40808 R 0S0pc80WZ 0JpW ⨀0 pGS꠆0  00$<4 000(pGc0pcW8Z 0JpW;((8#"(R p08 08PU~ @ U P!UP!Uy  <iI80@ <0e e e@ < 801 WZe 0Jp W⨂⨂;  QT X\(pGP0`000`0TS*WZ@ 0JpW`: 0 Q6`威pG:`Q L*00 0R` R. 0D L0d hd0L PP 0L 0L` 94 094 000X0  `0S*L0 #D B ,K H+[0SZ0Jp[PW*Z 0JpW:+0[` pc8 VP0W*Z  0JpW:` +0[Rpc8 00P(pG*P0W*Z  0JpW:+0[8pc0P⨁pG0W*Z  0JpW:+0[8pc0 P⨃pG`X 0S|PEu  PE0u ` X `0Sw:0S6 R 0d@DL0dX L_h0PPL Gd0XH00P0\ 0PhPP 0L 0 64  03L 02D0C0,@K -H+0[SZ0Jp/,0[S ,000 /[0 [0 20C"[0D3  H/ [+0[0SZ0Jppb82[+ [80,0[pbS80  0@54 00@0 00@Q W*Z 0JpW:018 0C0 8 pa8 00P 02H0C0,@K G+0[SZ0Jp,0[,000 /[0 [0 20C"[0H3  G/ [+0[0SZ0Jppb8,0[+ [@pb8&2[ <0,0[ 0@0@Q W*Z 0JpW:01< 0C0 < pa8H$0@< 00lR0034 0f@Qt H <0PaS<8P c ( PeU 08Pb,0e0eU P@80UP!0ee80@ 0<PU0< 80S@ RK 80< B0< @ 030S4 WZ< 0JpW4H@ l0@H 0Q00 < H0c 48(4<,(<4 <@SH  14 000p00 L 0L0 <4@ 00S4p0S0H R 4H>P 0040<@4p04 HpPp`De0@ Hp D 0 0RW0 4 H g408 DpHQS@004 p8p  W 043R40 LPL LBT| -PLM@ $ R ,\ ,0S0 0$,0$0 P-LPp` $@T 0S  a ^0P P 00 ,VbAF 0$0f 9F$`0 0@-0@SP*S\\0 ^0c0SP:0 -PLM $X0S40S0S 4 00 cR0004 0 ,0K 4 00 B#4R004 0``0,K `0@ `  `0S  @`p0P000P0 $ P 0S40S  0 -Q00PppLMW@$PU (\ ,0S0  P` ,0S  0(Pp0,d tED0H d0e ee0 WD0H d 0 ,#`E,p$` -L|Mp t x0 0LK X R *t0  0 Z00: | |LK00SP| |Y!Q@x ,@K0P00@0,0K|0 2K+PKEx0 00E|P00S@TY100cQ^XQp RW 4[ 0cSS06KlK 0 Xj0K Z*t00S 0 000峠 Z:p\ \   #3̠ 0 ll  90 L3p\00x Q00 S0p `0    00lQ0 +0K0,0KK `0,0KպKځ 0,0K0 "K0VA Pd7 ,K zDU H0B @T0DLK p0p0Cp0| XB 00t 0ᲀ X0^ \  0&`l|0 R0 *00cQ`|0 R:L1p Q00R00S Cx0 a 00 0bC10}@0 W,0K+K"K# \ 0S x  +K07  ,K D H0B @T0DpppWx010 P 0` -LѨ -L4MP`)' 0oS000 0gR   L0 0mS000 0fR  p\ X T0 H0 &[bp@H0@ 0SBꔟܟܟܟܟܟܟܟܟܟܟܟܟܟܟܟܟܟܟܟܟܟܟܟܟܟğПܟܟܟܟܟܟܟܟܟpp pH  L 0T0 0SD Lş1 -R5 0PcUa.H QP T0S4WppZPp P @T 0 000CS}00,K 0@|0S0 ,0 R0 l @ 4@ `P 1ePP `5fP@ 30C SpH RK 0S 0S @ R4 @4 L00L0@8 L00L0@ L,P X`0S @0SD RP LQ 0S0ST R X\ P.P L0SX\ C:@0<2 fF x`mQ0S: H`aQ0S}T 0!R0[|0Sv "Q4K8 K0KG-P0 #80@ 080 WPU+ P000CS>|,K@ P@5|0S ,0 R0D@ @0 ; \ 4L P"|"002P< @@ )0S :@PpP b\ 5X .P@ *pX pL\ o0S0S0@0e0@~4iPyhdrrrrl|C<j 0-LM0@SP HP 0K p 0 R U 00U zP F4됪 -LM0@S :0SK  dp 0 R  TP  4됪 -t0LPd0 R X0XP PP00L!@0( 4P000(rrhd 0X r8H p-LM` `P0@0@\  0S 0S 0S py -LM"00Qp,0 w$Ps_`0@0 P`O 4d[$K4!04  PN \P4 T勏K` A0S0 0 (P  !0S0 R0 0  0@ f@ 000'P0S d0 ,0S \,囨0S 0QOhyy(y -l2LM 40pF ;;S0SQR0SJ R, 0,0  0++PR- 0\ )0S(dP! ?;?00clcQ/\ 0 8&,0 X0000000S0S0.P@0S0 & 0 X@0@@@080   0 0S}zhy 0@-@ 0!?;?0c\<`?* Q< R:8\0P0S000 0SP P Q!0/S0S*U 00SS 0 S /S R0S00dyy  -MLMp0P@AnK 0 `F`F O 0%U0 U 0S l c@!0S D 08: S0   4dy@LTF -L@!x^0hFSP7 !0Q0 0 : SWFH` d|Q0 R TQ 0S 00g0hxR!P hz _OXP 4hyTFX0yhx -LCM0`,$0 (@0A/ K0 0R00P00 P0eS&0eJ/K0P 0 0p 0S0  0A? K   , >U 0SD0 R0 0  $0 S $垦yx(y 0-(P, L@ TJP  $0 0 S0 000yx -LCM Ml$E~KpGpG 0,           `$ \$ ` 4* R@ R  d$ 0S3 R 0 P, 0S Qy뤃0SZ3 (K 3P\4 4 XT @T40 @TP C0@: S< 0,_ P,0 S ,3 2@.PP 2 P2R( K"\$ XD @A08"X2 R0S @fBNK@D@D~ P@6 qd4 S00C0 {y !0@00e 000p9y `X{ 0000S M0,xs !0SPY 0 PQ 0 QP@ d0SE ~xB< @0S: M7PD TF0yxyp$08y( yd0L -T0L8M<0 0  8 @ 4 0K0 , ( $   H@K鸱 -CML M☡0PP,0  1Q  0P1#\Q:,0 S @,EKI I0 0`$ @( K@X d 8 \ `0@0 BNK@D@D 0"P  @00@$;D+tdyp -0#LM0$,0 P`P 0 2 Pp@(0S  0 2 ,0S ,劤8!P4 42((0,00h0O0 82 008"Č Rh  0P1OP5~:\z:00/0SIOK,<040#0PS<,< 00L0TO:0082 S0,  0P1OP57:\3:000PS e<01 R -w@@ZP0, P( ,P0h0QO 400Lh08 "i 85@0 L0P 1<0 0L T: 85@0 L0~hy  0y4@ 0)-Lg1!1Q@@ px`0(40PS ; 04L0T;:0000eW+ A 00CS00 0S 0`00D`0` 000`0 ``< ;0 4L T:y<$hyyy  -@LMT x00C0h@-p0\ ` L00n^@` 4K0CB4  0D0 04 01@DpPÏPoD \ 0 ?00S00X W 0t/1E $$pWR`P1 ,0S ,凢 0 P  `0S@uP1)O  0x Ppz@0 `( B0B!O]u0pt00 S 0l X 08  [D@ 0(@_R:0S:P h0ShyHPty -MLM0lC\\#, 4 @(  P@[,4(0 B04(  3<  400T` t00\F" $p`"0t/AV#1%Y X @0 0  \2R_ Q01 D@!T  `,0V04 @@U@T Q?>1 D@!T 0 T0 0̀0P( X (0KP L H D @ < 8 4 0 , pF뜠0 0P,0`U0@T UP@XKP 0 T `,0V00rhyy| yXyrTp -LM0 0,0 0p:40  6 6< 00`<0 @0R)0S&6 RtF p 0d 0dP 46 ,0S <,0 /  L2 o4 0S R1 < 8 0 B ? `PP@404 S S` Q V@1(@Q0 T `FV@ 0%0tP?P`@T1X@QzTP $0000 00SW4 Q4  A 4 4" 4  R 0s 0 p00t 00pSd4d$00l4 00$4040$0h Rf   #0S l 0p$0h0fPR <0 00x3t3   jP 3 l hP3 R! Ho2 R4 3 R <0 R 0SR;Sh0S)|0<(œ R:0S:\4h0S1<  0@#? S`& @CT`0t0@DT `4"80d a( Ÿ.bP^1 R  p ('1h0<0 0<  0 0Pn,1 R 0tnlP  0p4< <0/410u($0 {<P X u<P0S 0S 1 hP P0  } D 0N [ hyyyy`xl0yXyyx(yrr`0Vpxy|x|(xxlPy -LM@P1Ppe`VWY!?> DR.000 0. $0`F0V$0@\ P0 S00*<P ,@ R0 0  0R 0S R0R0S OP  0 R kPd `\0 S00Hō<<< y yryx0yrPy -,0LM ,0  @9hyr -1L8M1q1!00( T (0KX P L H D @ < 8 4 0 , ,0@Q 0PU `TP@  @0U ,0X00P @0P@ XK0S Y xrhyTXry -LM`VPڴp崀4@PT 0S  0T @T R 0S `FVP 0  0P 00ry -LM @0 @rr -LM @0 @rr -MLME0,0   BR0DL HCP  8%PD0 %0S 0%000$EKI4 I q0ğğ q`$aA4( Kxx$x4xğV`$ 0d *MKJ J0P000Ss`V:ğ($`0V0 * D0P00\'`V:ß0 q`S00*PP V:RP,0 S ,|0S 0 P00S 0 S s S ,#P# 7  00C0 "P  000 00C0  SV;;S <\"9(K00MKA@AKK@ $@a.0 \4  X$ iBNK @D@D0%1 R" 0̠  A0S0?0?00 R<P0 @hh0̠ T@z @N((/ 0 _ PPQ PP 0:0 ) l yLdyxxzHrrHTypx0Dx(0yPPy$0 -ML8M 8Rp, (`  Q h8 Q`853 575$\E0S 4SP $ ȟ0 41 R8 8 (K(K  (K0AO0KK,!0S7(K (K(K ( K(K0 00RP^^>KMK j-XmP$ $\0S,  R0.S $0&$00\ &+0S \ 0S F 00CS񟗜D,,$0SX T6 ,0S h,00 H& Q@"0S E0 S &? 00 P%00C0 80S$ $\NK @D@D0|S^K PE0`0X%T4P5 R DgP $\00$0S0 R$ 4 R4 R$ P 0: S0   p$00^p$0 0 Pc0SM$\6R$ 0.S/000 41 R33 (K(K  AO0(K0KK,L0S@3(K (K(K ( K(K0$00\P000 Q0hNK0ᴀ$00$02  0`0C0 :@@\+0SP $00$0P l"00C0|"O>KMK ,P<"?8Y00@P \ P !(A0l!00S 0S 0D0 P}>KMK Pe+$00$0 1  0`0C0 A:崀\(^@oPG T0S 0x0 P\0 RD 0SA <0050 (ydyxDyyy $y4\0yxtx|0x0\ $$0c -LM @0 @zr -`!LMX0P!1pCH1W0:<000@`V Q 0 R 0pGW* 000 R PQ 0 R 0 UPd`@`Pl000`0  00C0K0 0@0  zxT`ry,zyy -LM @0 @#yr -L4Mtq lPhh!0$0 @P T0 L0 H0 D0 @0 <0 80 40 00 ,0 (0 $K# a Q @L@ 00CS6`      0QP 0S P0@T000  00奏xTK TKw 0STK@ <0 ,yT0 ( ryypx -`LVP)P>1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00ETyx y -LM @0 @crr -MLM0Oϟ ,0 KK(A@ 8KA@K  8K$? toR@X\$UU.K! U5U3N8KAK^, P0@@?|\ ``N A$e @M7?AV@0p`A7/110SoK $ULqK Q8K1PTPK XP5\@@?NA`@ 0|0l(K07?K!d $5dKS@B@h@$5A@l@0` | 6?8K1Ad@HKAK\ d0T@b@aK0=KKP 08K(0CCHK  7<K(@0@ SHKAX4 ZK(NN 0K 0  $08 00C bpX L?>1 H!X ,;+ ,0(KPK4K KTKKK K `HK @0 0 ! 0l  K`0S 3S 8K EHK@K0 $K0P ,00C\P(K;!1a HK@Ke$5S8C6KpHKAK  $  K,(0S0@0^ TK (0, (K!0000@8K1J K0RP04080<0@0D0H0L0(K!KT0K !7L5(KsK pX19Ϡ 0.0CS D 0 0 0 D HKA000KK 0IQ0C  0K@\00> 00c# XpK^K(0SK.!0\00> 00c# K 0X0C 08K0UB8p WG?>1 AR!?> p W ^' ^"KG$0KQ0$0K`0.!008 > b0Q0cKP! 08K Z $5S,Kl p@h0PX`P ^ $%^ࠡ1(K01!p@0SX^ $%^ࠡ101f(0K( KHKAv0(K(K$P@K1ܥ(0KHKA 0 (K(K(K(K 0(KK!P3P B 3P5 R9 8KHK 'PşK,0PK_PPL5@s(K 8KP% 2P,0 S ,K P K0PP0K(K8K 2PHKA`ğ0(K SK T0@D0KSKTT08K 2P HKAh P3 R KXK8K1 SQKHK\0A00RHK@pK\000?000S @@T8K1HK@XKX(RRKHK`0@00QHKApK`000?000S @C@T8K1HK@XLHQHKAK\0RHK@(K \0K -2P' (K!4& P HK@0(K SK!\0A0SK\0|A8K 2RKK0?\04000S4K0K RKK0?\0000S4dK0K YKK ]KK yx@(yyrr0 Txx4T4yxhyU hy0y\yy0KK8K &HK@X0(K SK!T0T@0SKKT08K @%K{ PcK@000| U3K!0pSK0T0T 0 000| '3@P=30 30` 3PE/3K!0SKX02000000$%R83(K!?l>1 @  KK 0d2RK`00 ?> 00c# 8bW 2K0HKA"0#P>1KKT K 0 A ͠HKK,0 P54C0SPXP 0S (KpP0@@?|`N A@2?$%ARP `A2?AP=L0P4@ P $4o UTM$5SDT0S Pf0S`P Kt4$@@X\: 0 0 T\0T0X --L }I p-PLM@P`l0l R  T D0 Rp800S 4](0SbP 0(<Q  <0(5<(0S ]$0SKP{  hH080@_Qn d H0S.0O 0S \'0SV+PR  gL0@0@_QE p L0-0O@'0S \(0S. P* 7 W0S0,%R0S0L%r 0S 6 R @/P `P3S x 0pVPT085"d@00PgS0$PP Ve 00 pWD&00/>10@.\6PPF 6E.46P(@ .6P6 .P5& 0%@U5 @.E00.0%S P 4|5    d^ L``P` `$h R!(4Lwa(0S? $0 00L 0P5?T5 V>X5pP0@@?|PN A@.?$%AR㰠 `A.?A=`L 0D#D3 P 0S U0 00,%0S><0(5 H0S.0O "L00O\P p"000D5SL000<5S,2  2 }000a45 SJ]H0S0O L0-0O021  1 *1  1 |000h1@@4P  0<0|P 00t!0S0][ 0t0P]=Z  d]5Z H] <<`x,yy|x0y`y$yy zhy0yy$yX` H\yydy<dp4Xyx|yyxyz,zzxtxxL\y(P(yp_$,@Py -LM PUŸ ?P1q :P@V:` 0P\%1R x,Qaڴ RєڒS0ARph0 S\8Ad04!-00-@T 1 , 0 B0 0!Ph 0SP 0 R,TZ@Ph00`T*0 QPd@T:aA\<$yy|xhyTTx zy,T -PLM@ 00 R$hZ\0y\d -L`pP@u Pa0@S p$2@  0@T{ q10  00S2WnC` `F R R1!![!-@4@ P8P00 $ 0``,008 (V,|0 @N,@J, V0 0`V00 |p0B000@B,8@@=,P`06,$01,@-,0W`,d0`V0d0( 80 ,Prh`dy -0LM@H HP0T oX< vedA 0R  0R 0R 0R 0R 0R, ,0R0 00R4 40R8 80RH H0RL L0RP P0RT T0R` `0Rd d0Rh h0Rt t0Rx x0R 0R 0R 0R 0R\5\%R -L: S  S  S H0 R4[ S S  S Sy0 -1L `RdP@@ .Tx1 ROl1 RK`1 RT @1 R 8N[,QXp$G[d00CS0X0@ӤX0) T 00CS00 R0 0  0 yTYT nTNT -YT00yT  R 5 PXG1@@ [40@,0y`y,yTyDhPxx\h -LM0 @@@0?P1 P00@@PP0 *`V`Tp p %0@0!P00TQ  p0W$0@@WShyyy4yy 0-PL@T 0 d!0S @T@T 0 @TT  T 0000 0 @P@0 yhy0z p-p0LMd0@SP` @088 000 0  `Pphy,y4z|x -LM0@S` PU 0 6*0U  Pp 0PPnT 0` Up806"d@00PeS0$V0`0 PUpyPy hy,y 0-L0P LR @  ($P 0, 0y -LM(pP2M 2 R a  ? @_8Tk 1 RU AavO@T T lPDBUp@ U QM\!\0Z00 0 $1 R$ ({Z1 R0u or 0 @P)0 Y0  +PP  ?0P@ @0UgD,y|xhyxy0y4yyyyy4z0z$X -L$M0 !0P@`_ᖄ@K &" $"40 D @K0, NQd4 ,D|4 P[ 0@0K,0=QM@4 8@ *HY4P8pT54 ,&| R0,# @K@_@K0  0`Q 00Vs# (@(0P X88 x 4@0pW |+8@(0@X80 0ypxy -PLM, 00 ]@_l!@K0/a,@@K,< QG 0 !+0PP< ,@`K 0Q.X0pZ o++ +@ 0R  @@K0 `@0PK_tp  f(,\mX0 Z<,X00 ,Pyy -`2LMPpH08 P0R@00bT 800g\ `"?>1 1FR#  800g\0 8 a@T^ 0/.!1CQT^@P'0 0 ! 0!S 3S 0'^P @ ?>1 A!  ?Q>`0 0 ?> 00c#^ \0008 W0$00C0g0$0^4yhyyyU x y -L8M0@K00 ,  -RSL4MP @`t pq\d1  BRP  T 00c0Q3@T TX0X  0S  R1 018Ġ\ -80L0CS%dJ J J J J J J PJ 0S0 #Q00 L0 R0S -80L0CS!$K @K K \K K K K K 000 10B0  2 R0  00 -80L0CS!K K 8L L 8L 8L 8L K 000 10B0  2 R0  00 -80L0CS!L L L L L L L L 0S1 S20#B1  0S 00w( -L U@>U @b 00cSkNK@DEP m0SXi PP>]0S  /tUKP  = R K| t]0S 8NP r KPxx:KKAx Pi?: S ]0S[ cKP  P`PK`0P p<  0P *Kx ZK:KPtqt<0  00SKtjK2t`W~Cp pG0S 0 S 0S00 S0S P-0SZKtP4S0>0Lm0SKt00S00SKt,0S00 0SKt(0S0`,0sZKtP40L,0SjKt`4S000[0S0S0ڴk0S 0 QڄK0S@P+0S010; RʴK0S ; rq + 0sKt[4K00 q *Kt 400t`80P )0 8 )唽*\ 0S0^K#10iPE \  [ʟ@<0S*<00L$Y00Flj00@,@*7ɟ0 S0RS80X0S AK(AIoP X8(`K 8(K0 K|(0(K K .:*K0KZKjK|0x K$hP P0 S 0 G0S *KWx0Sz p@{ PG ~KpGpG'0nK`Fg$ A]K0(PESPE, 0STZ H0SD  Kp P)A4 u PjK`V) XNK@D@D0|&W{yw`T0 t $8 0(8 (( 0 ,H  >K0C0C G ZPG| KA xP0SkK|EgKK t | SZ<SRP0OK \\ƟLV0  4Ɵl5, @P`0 4( 2  B0001 S90^Kt(0 S;30Ml/`!T:K0 < 0K  xc JWG$  OG  ~AjKPt Ktp  *KP|:A}K(pGpGGP`) H  7P `VIJP @,0Sr0@00S P  T Y0`Vj?0Z(Gͻ  LFŻ  dDh"X2d<KTAmp @84"2.$ PNK@D@De/f K>K| jK0C^!t@P(`K1( K,@0) 9 !1 ɠ$ (PKp , +^KPEPEd!0BNKK@D@DP@!@1KI!1*KI t Phd|({@{ $ @ |l   {j X '{  8 \ x     < C100d x |hK8a  && |{ $   {{ $ |(  X ,p 0  |  {  ({L<p,h@|{%|{ {4D>K0C0C``1L0 K00``41P@F0P!`h1Pt`1P`1Pڰ!000,aџ1PPaȟ1Pta忟2Pչa嶟,2P8հa孟H2PTէa够d2Pp՞b囟2P(b咟2PըՌLb剟2PcPo|b}2Pw0S 2#CYb.P#000M<#PD3D#D PA(cRd3Ppet34TcG3PՐAxc>3Pլ83PP c,3P&c#3P d4P(,Wҹ 0D P 00- L@PpP`0 `R\ 000>P@< 0-1I(DzedA$|011D p-d0LM0`S@P p84 S0S Iph|gd\l -0-LPP@'r$0  hd 0-PL0@S00  5 xl0 R 0TST 0S S 0S q{|hde -LMPp`p@? P. uq$PK` Gp $0 P  30$0 ZW$C40S$0 l!d U PDFP$ CX$\' -LtMK@jPx0  P P P  ,< -LMБ 1, ! 1 ! 1!p1 !  p `PP6 KZ C/KjU@! WT ,0S H,q ,P 0M HoP GP GꈀKZ2@Kl p'0 ` P@ W  P 0\I DG;P (G\`Dyd p% -LkMl0`d$0 PP@ 0S@AsK*P $A1" P 6^K P@ P1*$0 S $q  P*0 S/R ` d P*P< , ' -LMp0PK 0 Bt0t `h ,@0X @1 B` 0S  pȀ,H -LM T` , p 4 P  ?Py>P >P NK0S l_.0AU0ʤ> >p  h> d>R`.`p  $0 ,50(5P ( > @) M^00 00 Rڨ R= =$ $RӠռڰ$RӐշڌ000 0400 Bd40AP LL0Q 4 R(:R8ëR0H0400cL0 H0S.0O L00O PP00Z4\ʠ ZP00P0 0T 4Zʠ ZT00T0˟ T00S1800`0 8Zڠʠ Z`00`0ʀ P80Sm; P%00#1t0 003x0@P+4G|0d0 |Z;ʠ Zd00d0JX;\` 4@,8@帊@&ԛ0P4@8@@00" 8 000P|0@ 8@@000 夠Zɟʠ Z000 0B00000S010CO 00pǏ| tSΌ/1`G P$p`Z`Z 00 0` |02X3 X3嬠S  ʠX30X38 X3S H܈P0`x@ @ⴐ 00)1 @@ ` TBP 0|00  0  X@ @z 0 H 0S S0$5P㸀 0P @@ ?|`N A @W?$%ARp0O`AI?A@T0 S< R4`P0@@?|pN A@(00$/>AQ@0P`?P?T0 0 00S000ʠ $FP 剐X3 0X3@ 0 腟 80080`00`0 80Sڴş4 00RR 80080 `00C`040040 |00|0l0 0 E0 PKOP?0 UpxP开 0Eo0 $50 0ЄH5P0`x@!@@^Y l 80 Si  Vg  \Tb0$C<4@ ɐ00 000@80080 `00C`0y0 PP0@ @?|`N A @e?$%ARp0N` AW?A@TLßPp @ PK0?PxP0Eo0 500 0000000 x@83!R@@$ऀX ʸP B0#C CP帀PP2 @B 0 P @3 RRR0S C聟 @ @0 R0hŸ  Hp@ PK0?PKxxP0Eo0 B5P0P10`x@!@@@Tڴ00i 0p@PK 0?PP0 @?|pN A @?$%AR㰀D` A?A@Ti0 Se` Raڣ?/0 0 |(Ā{{{|P|{h,0 Hx(4|VUUU0Pt |{{$Dl{{$0Th{$| |Ȁ@{{T{8$,Ȉ <kd(`P0@@?|pN A@00$/>AQ@0P`?P0@ @ 0P0i0p圁PK0 P?UxP0Eo0 M50D@ 0|0@ `|P06 T DHR0S T0T p" 0@TA0A0S0p P0@@?|PN A@?$%AR㰀 `A?A=`L0`d 0S2$0@$ |0hP| $ Q0°0Pè Ű RA3 3  3 0L5 @5LV>00h0Ph0 S:h0PŤ0S0X36 Xc0PE`0|p+TV V> T5T50X5 ^ @`=LP0OOT0p$$0 $ A4 0X3@,@P,00,0@`0xQ0000, B` PZ0 "@p0`S$0bZ/0A P+U 8@P  @0|  @ ,00C,0`@@`@P 0|$ d$0t&10XFP0SPPU p0Sg `00 ,@5L20000# jl 0Zp0ڴʠ Zp00p00V3&P> 7P'\50\'@0h'<l7P0X0'\@/0"b7D 0 0 0 0 0000@0S 0S 8P )0, Z`(\H80pKS(d d ,0X0Sy 8 R P  0 Pf(0X 0 8\łI  (9\5 0Z8( P,0X \00@ d0|  ,0X) I9 P0 0 ,400 80 0 + 0Q  ,i 0 T@0d jZ Q  00 Zl 6Z00@`T#d0>A RP  ? _ pPC :< <9+$0| 0 _?@$P4G>. 0,0p`P4{6/  0 9?x긓pß0 d|P  B H0lc&?80|00$!8P@ @d ?0" ?h S|0` 2Q@500h0 X3X#B P5PBL%00r/ P5T%  lŸPP0P%PH X3X0 I80Jp|0P @P0 0` PEL5` sT5Z20P000s, `A\ L5sX500VL5sP5T%2 0 / 00n0L5sP5T%2 0  80ZZi0 L5sX500V. 00V3?T5 V>X56TWX>{<p  |4PPpgD0 0Q 0\\8>0d40 S$||-> (>%>0S nWP T?/0 0 W0 0 ,5<0 0_:0 004 Ϡ΃` -LM, ,P@, 0p0Q"0$ `,0 V` e0e\0 40 40@ 44 ; :,0Œ8 ʟ0p:0 , ,00CPʟ+0! * 0`e<` ;pʟ1 <0P0 `$5S@8 p 0T0T0 1X0 PX00\0 0\0/>`$5SYڴ 0|a /`010Ch0 h000h0h0$%10l0 @0`|D /l01d0 )d 0R<ʸ 0,0\ 0,p8.!Q0σ\00>00c 8p W 00C 0pd(@`0xQ W%00PUDh% *l 1 D, '&0000| 66 ƟRT000T000@|0嬠  ~ P` 0 t 0p p Pe <@6Pp Ri  | 00050 80 Y0 (00(0%540( 0l ( 048@? Pp- | `!40040\%4800` \@4 45.!Q0σ`004>00c 4  P $00$044 80<0 SlP 8 @4 R`0 \0$%R L$?>l 1 D, 4$0000| ß3 RT000T000@|0嬠   P` 0  0p Pe PT3Pp R   000 3< 800 S<Y#0i14  4 "2.!Q0σ`00>0 0c x2 <$0 Y0$0L0$%R0<0 plp h@\P@" \ !0$%\ 10 10S1p p0W\ 0$%\ 10 1tt!0 00T1T0$ <08!00 001 0008,0 0 0@ dP0oU  X@@@V  X@@@ 0| /`01d0@ ]%봀U ( -LA^ p t00 000 R6Pp04WP㌠(p`͇L|0P` 0O;h0d4 ND400`p[t{,|4ĀA -0`A VLP|`A@00000 0`VpcPBO ` p     Ā -L M0 d@Π , ` t3 R 7@T 0X3 _R`0@P08J  P0 8XP43 03`R`0XA  $5S ?l >1 D,  00C0 00C0"00C0 000000|2 0000|  D2<2 RT000T00C0@|0 4 40 P` 0  0p Pe P1 pRU 04 00C0@, 00R> 4@ P180 0` @80 0` 80$ 0` $ 800`4  4 08 P ?Q>`0 0?>0 0c0@8 T0 d 04u X@@@ 6鴀U $P -LMpQl0A d  al1 RO 00C 0@0S\0000 10 d0 l 00C000C0P`,0W** 0 0 0$@x `0d C0XKB$PE 0x 00 6)   봀U x -0LM`pQ  X0X07!hm<0@ L 0PgP " {{{ -0LM`\0p l0 P X0XN0P P ,0007 h2 $ {{{{ -8L0@S% 8  8 8 8 0S0 #Q00 L0 R0S  勩 -8L0@S!     000 10B0  2 R0  00 X  -8L0@S!p d 000 10B0  2 R0  00 &< -L M@H K0s4 A[TP d@TP@ht@ -LMP@8p1匑匡`p!pP@6 "P/X ` L h t 0`00``p0 PbUAY0Sl0a\0W 0 RPỳ؀XЀ܀Ԁ -Lbp0LS82 R,2 pRp 2W R PPw 졟 P@i #0B SV$ < < ` <  < < h t 0=0S@ P  0S P X  0S R R 0 R P -9P 0S7f30S%RP0S@ >P #WK30S$̀؀Ԁ܀C< -LtMP@T ttpKVPK 0SP H1 R 30S (r70S@: S( `0S : S  P : S  S 0 R )P 8P 0SX0 RH0S 㨧 $܀̀ЀDC -LM쁟0Q@(0 Pp`i 0: S (0 S (` 0S  Ip` Kp 1 S!3 ]PpE 8@ IP P 60  ]0 * ,P hP0  P VPw] MK{P  `p -LM@`P  Vp@0V U@0 @=PPU`VUU -1L$M℁PUp$ `Sd1 R 0: S P$0 S $$_4KG@w+[ Q003 Kp另@`D00CS00Ӥ0 PpP @00CS00Ӥ0 PpYU00yUol ,b؀ԀPyhoh p-LMP`P @B@P0/S+ /=P0.S P0S@p0S .S0S`V d 00 Q P0S0P,`  @@P0/S  -0L ^hd -LLM0`@/<,#P000P 0p0R" p fPp "0Sa@a T@DpTW :Py0SRb 0x"S00QS 3P@?0S. 6[8c8Pd0 0`0 dK0S [iPm0So^6 xhK ㊐` 0dKPh0 R k0S .gXPKp ]PH00S0S\, 5\0K ߻0Qh0 S@0 Sh  h孠PP@:p@0p0Pxpl0DSipPp,`pI0 PDHA8{ l|mpm8@LؽC 0-LM0@P R/ AR@ 3 0 ,00CS00  ä0 $@ 0d@34@0( ,0D@30 $J$A0h3c , -RLM@p 0S   3Tc W@` 0S] |Q<0 CR P00 R%  B02? X 0, CR 100  \ `0 CR 00  \ R@0> CR 000Ri߃0 Rd \׃0R҃ R R0RŃ -40L R(0$0$   B]Ld 0-LP.@jZ8P P-  00  - LbN -L -LMhq0S \\PPL s@!PD 4a@P!@0P P00FP@ @3 0 0@@Pp@K;0$!  P 0mP 0;C 0 0d@d @aˠ$0K $ @Y8\' -0LS \|0H0  00S_\-\0S  p-LCM``GOK0PL  80 Y 0S \p   -LM$@0 S A00  0-D0L R 4410P@@7T00p<  0-LBMdP0FOK\0 P 04 0S A\0  (  p-LM`@,0 jPUph p-BMLM`0<@KP0 B<0[ES FS AS  R0r S00x$;K/0 S X[pCNK@D@D 0<0[FS 0  4 h C -$0LM K TP [ p-QLMP`@00H@ph0PE S U@00pt   -LM`PS2ဋᨋh!pXq mP pP 7P@(@ X!0AT3 T`7 O@P0/S Z  1P0S@!`MP X:p`1  @@P0/S Q@   ZPy { j -LpM`@pKs.@I- 00RPPSP0: S/0U0   X57-0S U P ,-0S  ~1C -0L ΡZhd  -\@LM80(0( 0鴗ؗЗܗԗ -LM` 2P( S l  Q Qq00  R( \ 0S#S 0P00 `  (0npPpp(Ȉ0S 0H00S (S 0S(0 t0W0 S񟗮 d ` T h P (0\(   Q Qq00  R( 0000((0\(   Q Qq00  R( 0;S`( \ oSf  ,da(0\(   Q Qq00  R( 0\S  G(\(   Q Qq00  R( 0S: * D((0\(   Q Qq00  R( (0`S0Z00 0Px(0\( h  Q Qq00  R( 0S 0(0;Sp  ( Kw (0\(   Q Qq00  R(  ( K\ 0S (0\( D  Q Qq00  R( , 8k(0\(   Q( Qq00  R( 0S  3 @T00u#(pn\+)( 0phe`d(( ( 0\SS. (~P(  L( ( 2P(   Q Qq00  R( 0;S /.(|)(0 ( P(   Q Qq00  R( 0;S S ( pIQD>(*(YP( p4  Q Qq00  R( 0,S00\(   Q Qq00  R( w(%P( pd  Q Qq00  R( Z l,!(!@!l!!!!$!!!ȗ C""<"|"""" 0-LM P@U W \UXQ UM  0S 0[S: \S1 0\S \R 0S 0 0 0S000 00\S  0S  0\S0nS 00  0[S KP@ ($0# <#@-@000^S00]S00 R ]R0 0[S \S 0 R ]R00]S 0nS 00.^ =^:^00 ]P P 0]S0PP -LMMpNK @D0@D` 0 BPU 0 K0S0 t U P T0S5 0S 0 qW ܗl#x# -L M@X, 02 ,0 p1 100 ,0 0;P0S4P  \S  RE ZQ@D0S4 0bp00 g R AP\0 00 P \00, 0 S0`B 0V, 0S`:\Q&Q\00 S SP+ 4  0bp@, 0꼗-#### -LMr ` 0 ( P0 (PpŸ  Q Qq00  R( 0gS} 09S,1SUK A A pP@P@(S S (0(8 0 S  V;SpSF wSP( <  Q Qq00  R( 0NK @D@DS  S ( 0(0S0R0 w0PU ( p m(: 0tydu00U0P0h( $4$d$$ȗ C$ -MLMh P( 0\SSN ~KpGpGPP(A jK$`FP@ `FPP5 0Q Qq0  00SP@T 000S0S   0S(0 S H(U8,$$$%8% -ML MD!D0 ,0 낮KJp`J  P@Q ' Q Qq00  R ^ \R 0 R0hQ` 0f Sʉ kp00w@0 ,0S <,oU 0S Sx% 0-LM0@9SP$0S$S /S  0P@  00Dt 000 K) \S@%% R-`L@ ( 0pS S ;S p0 0 0 S S ;SR 0gPV@ @ڥ \20pS S 8p0 0 0 S S00% p-PLM@P& `0a0CS, H 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 , 8 H 8 8 8 8 8 8 000@Tp 0S0 C0S40 Q ؗ% - P LR` 2P R 01@pT 0S @Tm0@00` 00 eP 0% p-LM PR` 2P RT0 AT 0S @Tp0 <P0 0p0 -\pL`AT 0S<P yQU@`V0 `0& - rLMP@`! p?@H /P< 1`1`^ 0}S00 0AQ0S 0S|0jpP%垚P n@{ X&ȗė`&̗& -錂LpP0xSM @:S=d0SX20 #R. @U<ŸPE$ R R 0 0  00 0 0 0 0Q00 00 00 00nS1  paP X1 0S7 S Ha |P@  00M@ 0Q 0#S0nS0@0 ㋷P0 @0  | 6d0P@ 0X 00h%0 0%4\̗08{&C -LMb0S!lRhPdr 0SX2X0{ 00CS0r2  p0 40S 00,K⇂0@ @C,  02!刁000 00CS0 0Ӥ0,pXqHQ$0:0CCS             l                          T x       D d 4 P   l t  x   pepU 0RdE !0 0 !0@0 A000E0 004&y0DSx R  B 0P 0iL Z00bhDQ  40tV D0n$PF#0S yP0S30S5 R3}Y@00* B P 0 0c0@ 0p0 0S D3 R 400 30"0S0S B2P00290Sh21X"0S 0S02#(R(Ÿ0 SB !0 0 !0@0 A0000A0<0A000!0S 00@Tp ^0P B" 0<N ,,!p2" 0>Ԁ0S P R" 0pW ` 0@ ,0 S0 ,%NF 0S P; E~PJK(@DP@D *0/\ 40 0ꤗЗ|'& -LMr0@s `PR |R0VQPq`20  00SG \PD 0, CR 600`0S0$ CR "0000CS00  ä00@0S  \s0Rs0R P(s0\ CR #00KP 0 C0 b\ 00`0\ Ps#`0Rsti `vdP {yfL$ KP2[S<00Z&'''0ht@ -PLM؀`pP@) T 0 S R@D @00U00  0 P P #D <0S1갗ԗܗx#' -LMP, Up & &U0 \Ud 0SDb p9  0r1 P`0@0S*,0   000PU@0S*00K@ 0@ @K @ 00s0s\U @0S*P000K@ 0@ 0&S\SPq(00  00S00@ԗ -LM@P P`p W00 ' 0 0  N P0-L@P 0wS! sS @T0 p P 0 0P0 d[{Sp P007 0CCa00 0-PLP @CIT000 0-LPIP@0 0R0 @@0G4 0-SL@p  P`;IP@4 U@@V@G h4P @\0000Q00H -L,MS @D ||#kp LP ?PPP4#0SA $G儈H 偈L Q 0S 0S"0S P0 "PPe<92p D 12`b`" @ 82@ $2$ ; 00 , G00 080 4 3E`W00S!0(R00S k>Xd R $@K`P $0ASA2 A$ R20S`!?1S2 R hBxR` R PdBd`VZX ??0D,0  P5?BQc U`, (` ,pKPB0 R,0 PPV`U ,@0!@dWpp@R 0%S# $K0`P $p`P`AT剉 >>CP  0p00  00S& @ wPp6 P`7dVP`2 <T8X8h8< D$dhKgfff  > C8DD^ 0-@0PTL 0Qjb@@0$ -XRLMP"@eb?P 0A`V PU / 0S ۃ0S =1 LPl 0S0@  $0 S  1SqQ0S 10Sly= @P@"b?0P0P00S` 0+0 0K@KKV0?0 0K00K?V00~0@ ;0 QP~ K40P@@ RV  0!  @, 00a=(<89$$9H9P9d9 -PL@p` ap lP ?PmPp`t 0P0 PPP =:0P0 B0PPS<90fP p-0LM` P@}a?P 0AT K02\0 S0 1 !0l p$<p<<:(: -LM0@P,0 #Hap ?P SPP,0 S ,A3 AT #0 P 00LS!00LS0B \L =i<7p5\ p]  Qf` ᠑XIP@PR  Q8 唑P3 0X0C SI H H H H H H H H H H H H H H I H H H H H H H I H H I H H I H I I PI PQP'SP0-V +V ,Q@ NP \ \ =V1h0l;P 0a0CSJ K K K K K J K K K K K K K J K K K K K K Ispmk@hpU @@K`Pp 0 0=00 b200P B\,0000D<:<3<-8:D,:@:D:P:\:d:l:p:$ p-(QLM !@9`?P< 0aV< 0 0K.P( 0Q0 R 00 0 S   0S  0XPpĆ PT;P< (J;p鳆p<CP 0-PLM @_?P 0PPKPKX@P 0Q@0 SR R 0< -PL4M0p @P0 TP XP $ _p, rP' ?P pPLK<PX L:sP uP`PX  L K"<PX L <:0T0 0P0 0!R40*Xy;$Xc?@ P` 00XPT0Sc 0 00 , 0 00R080 4 x 4`u U 0S C0 P0ŵU u 0  $0S tP0;0 T0S H00c RHKpZpP800c R8KfZ`Y U u P2 P$ R X P oOX2 IRP0\U00Su US 0"0  40VG 0S 00{0`71 R,4 }P# 0S~@T 38_)P<:|: -LM\` PW  u`ONFd`@>ePX OD%BddW_N( FVe $P @'e:hPy: -LPM@lPK`ᄀdK 0hp 0 0 0 hoL -LM`SK@P [lKK0S@ #3````0SS?KS?K0C0C0`"S?K0C`VK@9KgQKdm 0h  l0R=9B\! =C ` \1 `! 0` d 0Rd! =9B@Kh ZK KP T1XbL1Pc=9 A =X T X! T1 PVK0 A0@.U A 0@#U A 0@lQahX 0 P< 0  40  =Ch! d1 h0  cl0Rc=9 =\! \1  A0` `! \10`! S \1 =9C`! =C `! \1 Ũ `0 cd0Rcd! =9 Ah =h! < d1 d1h!0 SKZKh! d1 w=9C lx?BL:<::; ;; -LM>0 -L2LM@"<2<4"42@,@ 2"2pb p2",K@@00@-C,P1 `!1eNp1!aP@C^ 1!T10n 0cCP@00pQ2 P7`1 R p|@!0@ 4@,01 06S 1 !pp 0`1` P P P0@P L <0cL6d=I 8<$D H, (@|L+04 0-PLM P@0 K Br0K  PKH00Cs00 0 -LD0S 00 P P P -|p|0L@ R``P* `  0 0 0    -`嬠L@Pp嘸P0 @ @ 0 pS030#00W 00P0Uu0U  8 -L -T0T LM0 Q<@ P` >@ 0 -D0D L0\0 P (  0 P-L`N \ RT LR0S0f0QE$@F0t0f0Pp F@Dtp 䀟 ` 00H0 0 c@BTT@@DtP @Dtu@ @Dt00X0 0PPu0UD $(8 -L -L -LZ 00  -LNy - 1 LP@8 `00Cs0䠟p- P P r0 0  R0_S $S@@PP P  q00 0  R_S $S@@00Cs0SW 0 -1L @\7 `00Cs0ࠟp- \  r0 0  R0_S $S@P\ q00 0 R_S $S@00Cs0  0 p-0LM@P: 00P:p0@ph`P0`P* 0B0R0T:pp00U0T,  -LM@@t @Dt 0-@PPL 0PS0 P0 p(0  0 P00 -hP@L`f P Lp0T*0V  0S 0T*0V  - PLM@ pH 0 0  R ^wT@?hrh -D0D 0L0Q0 P`0TY 0 -D0D 0L0S0 P0<A 0 -p0 @L `P00Cs0 U0 T 4} @R 00Cs0(0$}P@ 0 0-0PL@00Cs0 tϠ Qd0AQ 00S 0S0@0Cs00 0 - L 0    -$0L; 鸻 -0L?| -0L6 - 0L0@*0< - 0L00< -D0L R80000 ,00@4|0 -0P LU:0` pUhh0P0@  `v| l0 h\ \0 0Rh?h"|<8 -000 0 0 bL1C 00Oꬽ<@000 0Q 0 R M4 -LCM`0JK $0 @ PTJ P/,1 P0' )S S1 S (0KU*0T0`pP@ g0^S@ (@T$0 S `$+U 00eU@  LA A -pQL@@0 @dT` :%PP 0@DT*d0 XD0@坴@0@^S@D~ <| 0- L^RP@ lP00d0} lP0 -p0xP @L@b\`00=D0 <0 40,0 ! 8D -0L- -0L$ -L -p0LMqP 0  0Ra a1 0@0b!0C01R0 RሑF PU"x 0@S0P0cPcT<0 0CR& 0R 0R>P*Pt @DtP@0T 00t0T 0R P

R0@D?R0 00p\0 T 00 0S< ^00,P@0 ?00 00 P0-L@P T h$|0 0h S`0 ! XT0hV$H0<P$40 I$XAL+P$`A -LM∢pQ, S d,@01Q 0H 0@:T$Pj a ,dP00S SYT 0S@ WG@01 R;0@:T;T 01  lV#00 RPq 00@ ,0T1 ?> 1 @  ?>1 @ p 0P xP B@, < ,Pd00@TTPUX~WT$ "L+$hAPTA p-LM<_8!00( k$A 0 PP Ġ00 PPUP` 0P4GU  D@PĠ 0PPUP@ DxP80  p,xP@LL.PA@-?>,1@LQ 00TL -LM@Q  Q Q Q Q$ h0  D p-LMP` R @0@0R@PcPbsS@ptD  -L0Qh0 YD  - LM0 0 p` P0@@cP0 PPSt 00p 0>L0L H0@ @0@p`E= T T <4 -Ls -Lk -Lc -L[ -LS -LK -LC p-0L$M` 0K K$K a0a(@K @@PP 0@ 0K @T$0ͯ$0P 0S@@TPph   -h1L M`` 0(K n0n4@K0K,K @P@P? X04 ^00,0KpCfP00T0S`T XU U 04 fP00  0R/S \P(0K+00( e PF  -\0\X0X T0L0 L08\000 5 h($ , 80 -T L0LS00P0 S  0S0 p- P PP0PLM`0 0@R 0 R R00CRphp0DS X з X з з X 00C000($ p-LM@,`PP 0S 0U p  0-L@Pp0p0  0!0S 00@C_ 0 00000t0 @P40 -LMPp0` ` K"`8@T 0 0@0@ ET چ`  p-1LM `Vr 1 RPC0S S S "S 'SP0S0C00 R R R "R 'RP0S S S "S 'S00S0C0`@0S S S "S 'SP00@y@pP@U0Օ 0  R R "R 'RPEU  R R "R 'R0u0 S S "S 'S OP40ULC -,2,B L^P r00Cs0e b^  q00 0  R_S $S0^ LUT  r0 0  R Qp!B00X0^2  r0 0  R0_S $S#UU r0 0  R Q 00000 r0 0  R Q 00Cs0R000 r0 0  R Q D 0 -LMtQlh0h @ PT *Tp0Q`iTP*0U@008, -tt`0@0LpM2@@PP{+ P4pz0mMA -LM0@S`p) P$ ( +*(0  (0 P (PK x0S( 0Q *00 $0 `(0 $ @`DA A@ @ $ ( ` $ (  p-L Ml`0P0@0 $K 0 $0 9$ K 0B #1P Pp p-L M`0@0P 0$K0 $ $ K 0B C1<@ S@  @ p -PL`M@ ` `   /0S 0S0S @0  00 , |00p(0p 80 4 P@ Lp p p p  `K 800c R8K=PW񟗩 l h D l ` V񟗜 \ l T | | t `X 00 "" " V  R X V X 08.0004, `8@[0T. @0T* @(0V0 0 0  00 , 004 080 PL=@` DA A0@0@0@0T * 00 ᤫ  < @`DA A0@0@+ 40 0c0 0C Vm Q 0 R00S 0S,0[W 剐Q   l!0F]Sh` 4 ` ` ` 4 4 d   0   0 00S 0  0 0 0 `0S0000 > S<   0 0  00 @ {V @ 0000W(  0 8K KP ^P 0 UPuX p=40UqP  @0T*  0@8@` DA A0@0@hp0`0  `   $00(   0 S 8  b R8K<P00 0S )00 HKPp Jq  000  $00(   0S 8  b R8K;P00 0S )006 0 | dK@K 0q000 G^0@S 8  b R8Kڦ;0P00S00  00@0 p KHK 0KPp~ WX  PJ ([ 3[0cഠ00@ 0 R00#0C S- ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (  ( 4 00 ?00A `@0  (CXUl4p8Z C0  0A 0  00#0CSOD  D                         $ 00)  000p 40Pu]  H R000 0p 40P#"@U 0 ]P]0p00 0 40@U  e  X 0 ` t0|`0 r)` np H0`VH0 f R 3[SD0 RD0 H p00C0 1`VQ 3[S ` RD 3[S0p0 >QA ` :D  0SC' D 0`0V V    0Svv  D C3[SpJ0DZF `A 4F`pN 40 U B GH0`VH0 `Pク ,[ ꄽDPy4AC@AAA@D@ Y@P08 @WPL -L MPpQs 0#S  `P@@:T 0ş00 `@ 0`S VPT`0@@T*TQ%XJ K#XG (5  0S8  @T000@ ğ0 @" 0 R +X 4 R 4R 00 @T+X lg@-X=X ?X @4R44@T0@@Z0=X[nP 0@S*S0]S =X Z[@00  #0HS$ 4 $ 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 $ 4 $ 2 0,0 0 4 BbZP 0/Z40 0`CA 2020@S@@^,0\ *000 4  @0@S000MŸ  10,0 0 4 4,0\* @ 4 z[0 @` DA A@,@ 4 0 0 T`V T0S@`@@T 0`SFP[nP 0@S*S0]S( @T*T0 @ T00Q00S V 00 U80i80Z![l0`P`ަ@aZL0 0`S`Z Z DA -d1LM`p+DQ``@NP`@ 0S $K $A@AP P  ' e2T000@0 R0PU 0S 00S 00`@P@P,0 U B(B,B -L@PYm@%Tp? #T U@` ':P`T`T TU@ :P@T0e  m7P@:p`p 9P`DT*P@: 9P@DT* p-LM 0CP`CA)P @0T *00 TpX0 @`DA 3A0@@0@`Adph;  -0LMpH`C 8 @1Sx;,8KwK/Y&] Pؽ X   X`LB@hB<hKC -L,MH, \00 p4 L H  0S 0@S \ |<kV iT,0`S ,0 R V 0S ,0S ,0   D 8@ RD00D0  1S4 `0 7# RP Tq 0ǟ0 ^7 0m>0 0 R^ D 0`!VL@Q D0@ 0J 0!RPU7 ,0S 6 R /bfP0H, , 00CS  P ( ( ( ,4 0044 |6 ,/, 0@3,0 R,0 R @ ,0S\00 ~040 0,0 0-PLH P 0, , 0 @@ ,0  00x5 p0S 0@SLUD0 ,0  ağ#080 , ,0#20#0 ,< ,0<0 00LJP@> @48|$,,#0< <00, 0< S 0DS 44 4 c. 0\.a,0 , 00, 000,,0 1P,00 3@  00 0@(_[, 0T F,0  ,0 R  : ,0[.B\ 00 2,  0 p00 0S B @JJ <$T,0 R X0T9NQ`R$ <PV ,0S ,0 R ], 00D L0 W ,0 0H0 1RB ,0! Q5 ,0! Q7@P4||!U4pP@ p*TH  0 R H 01` Q H0, ,0S ,0 R 0` l0S00p000 PU  , ,0S,P |4넽F<hBhK@@lBBBĽB$BL C8C` _ X, <;HC`C p-LMP`PQP@ 0ST 0S`@0 0@壟Z0 $ 0 0@|CjC 0-L@F 0FPP$ 0h 8C -0LMp@`T P FP L 0V0R00S@R F 0 0  -LPp`CF  @0;` 000W DM0  0S;0FV0 0N p-LM@`P0=S\ *SZ +SZ@F F 0 ` p -LM`pE2/cPP` @0T00SK 0 H PTF 0S 0 U @' TL2L2@ 0P ,2U( .0 00 OP2P 0 PQ000Y @ @ Q0000 F0P9U&10T00S 0 PU10T00SPPU00S U EPP 0  P 00000 0 PP 0`BOTPX0P 0 c0 E@Rꄽ88x= p-L M PK`pEEP@  V 0 /R 0(00 0Kpx -LpMPK`@ PpᴜP@U WV 0Sp : S  S pp@Ip -SLM0@< /0bP < P  ᏛH1  000 , 00PT080 4 4 :4@zbpW7 `eW 80 0c S8K-@ @֩/0080  cR8KP-@  Ʃ<4 zP 0SPU4,4`, =p -x0tp00lL @`0PP50D01 @60000, ܽ< -LM0X pP `ᐣ $ Q jP 40S 44$5 CDD8D 0-0LSP@ @1SQLM0S9LMt lh(PHLM R ;P00P00S100TD$$/ 0-LMP@ 0"80XD -LMpPP`@ (0V`SP U@P0?Bc P@,, (0K(p $` @ 0gfff<8 -LM@ 07鐪 -LMp`PP@ 0UPS` 0X0<D p-L M8a0@0 PR Q0 S p0S 2 0AR  SR $K0S 0 0PU000PKP*00 R^:QP RP 00_PP R `D3 -LM0\ R@A 0 T  MЍs0O lD 0-L MP  04K@4 0@ (000 -L$M@L H 80KD , <@ 0@ a(1+P@ 0 R050k( T+,0S&HK@0(S HKpHK@0(SL 0  8 [LML(JL, LL'0@0 4  'HK  -LM0@00Q3 @ L X d p  &0BS    $ 0 0} 'x0  L`0K 0 K0K < 4 , $  D4/DDDD EC -QL MP L@!0DTS.T, #T T&0DS``Q 0`T P 0`G 0`$S$ ; *!T 0`0 "T T 00c 0 0S00 A0 @`pDWX$01 RT,`  `0D S40 TT T 00DTST W!  , 8 , @ P `   p      ( @ X p  8 , @ P ` p    , 0 4  R,  0   ,L`@0DSp`"01 R Y, KT  0R 0R 0 0R 0R 0R 0R 0Rô 0S 00 00n 0 S 0 S 00C 0 0S 00 00V R 0 S R i J 0x 0ct 0p 0"l 0h 0pSpW 0 0 0W 0`0C 00%S %W 00 0 W`\  C 0S 0S0 0( ,  4E4/@ELE -LMPXp@ t00  RPTP(0 00+  @0 [T 0S 040&00PA ` '`&IgPPl!7 P 4 _T 00#T0S @_T0 000#T0SA PE `f'`{0<000 ` cKP ,'0 0`V T  0`V )00 ,0 NP,0VPD<4/ -LM`p@FT 0 0@ 00C 0 00P@   KX @ pJ -0LS  0 0!   0! Z4/ -LM4@ ⁿ?0000  -0LS@ P0 R  pJ0S0e@050]I0 050`  -8LM$ `Rᬀ `ᰀ pᴀ 帀 开 r ا'^+p{ 00ACS h h h h h 4! h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h 0,K 㨣 P_X`A00 R  0S AQNP ,K ㆣE X < E 0,1!O0  ,Kf$D0 h 0 } 70< 1}9K,K Clc,K <T00 !HXIhK IIJh,JPJXJ1C 0-0@ LR# P0\$ 0S 0S0Q RT p0phTd  0X00\ 0S@ 0S@| PyGH HH 0-LMPK@ ٢80@0S 0@S ̢0X| -L M,K`PD p㻢V`pUF 0KP@3 X XT ,40#00 V  @  00CS0<0U@T@T 0 t@T   w000!(@X| pJ1C -LM pK` \@T P0S 0@  00CS0<0@T@T 0 H@T0k" 5|X<xJ -LM@K 8"00 \000 0X -LMQ@P 0= S< 06 @`쀟40 0Qp@Q Q 0  T  0R@QT t3 0R0   0S 8)@,i$$ꄙ|JJJ%00 000S  0S$4 0S000ꔙ  -LMP00좟000 SQr`宓0 SV Q  Q  00. 00 R} `2 Ry 0Sv QDbj @B)PY 0SN P 0S? "9 0S0;004 S 0S# ( 1 1`@ 0S Q !|f! Q 0S V PP 412  00S0  凓 0  <B0 `E}P0h;0l`0P@j 0`00@0000@00Za Q_MꄽԽ hxl<DJ -LM0` V 2 0S{ `VpK᫯뼠K  PPhڸpK៯`V 0@T 0S @T`VH yV (0\Q=9A =C 0(l0c (( Q=9 =p 0( 0b @(( Q  =9A =C0d0  ch  Q=9b @ =  0H 700 0S0 0SS0000000 | ?B p-LM P 00S QT 0PS4 0S 0 S0000 00CS A0Sa 8 R 0RS  @ a 0S0 * 0SD 0S$ 00S D1 R 0S 0S RA & C 0 0S 00S p 0S 0 U  ,00 000ppphP00CS000$ph`xJJJ -L`\MD0V ,0 x 0 #@003# Q Yt +0 0Y 0-0p0 0PU5 0@Sc e f @f lK@ JV 00Ul t "Va VR tŸTp"p Q0l KPx "U 0S UxQ1 ,0S ,"0 SVt  V  PU 0S0 S t\h10i"x 0P@LDT^"l0[S (!T100l Kx` Q" L" p0F"V 0SlK~ lK@ C"{0l0Kx @VT0 SS 02f 0lK2a R4P x X"|K$K,K,4KDKTK\KpKxKKKKKD  -8#0L` %^0?Sa$h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h $h h h h h h $h h Lh h h lh lh lh lh lh lh lh lh lh lh h h h h h $i 2P Z0010S P %1 @T 0S @Tᨂp1@PT 0 ;PX@TX Z 001@T 0PU p:P XPU@TZ 00Q00$p @T 40S 0S @T@T 0S S @TZ0D| -p LP00 X R 0S R 0SRlbꤙ|x -L,,0@ S00 P ꨙx0SS 0SSS  000Q  0Q0 0  ` 0ST 00C0H0H < P000P00|K - RR  RRR00Q00Q <R 0S  R 0S | p-LM0@`TP 0S@Tp2PP -/LM0尟,0  ?@ 0@ t2 |" 0K/KH" 2 x pB 崫|20 2 ϟ? @p@嚯K`!200`d"  `` P\P ,ϟ 0S  X X #X  0 0 0.0S 2   hb  P\P Ο0S00 X V V0D.020c RKp V4o q y @   $ \ l = R 010!X00Sx P\P ͟0S0P0 PUf U00 UPM!UH u ,00 P -U u ,00 PF u,00 @KQ PK P\P ̟ 0PS  U PU U U  U  P-0KT:"0R0 KIP; AT 0 !R 0$000 8 H [X @X*X~ ?X+X{ !Xy 'Xe P"X? \X \X$X   - P\P D˟0S00  (X {XJ [000@* 00X  " b RKp P\P ʟ 0S  00   00X    20c RKp00X  @00 00$0000K p P\P ɟ0S00 :X %X#Xf 2 Z 0`0 K W 2 Z 0 K    P\P ȟ0S00 i  P\P ȟ0S00 Y (X & 2 Z 0 00 0`d K 2 Z  0 2`0c 0{ Kv `X2 Z 00p7 ` R< R 0S BR RB B+R ' KK  P\P ǟ0S00 $X "X 20c RKpX  \0000\X `X00" Z@ `@ K \X P\P (Ɵ0S00 X 005 2ş Z  0 K  P\P ş0S0P0 P(U 00 ` n2 Z 0 K "`X 00 7Pc)KP 0@S " b RKdp  00 R<4q0$20 00 8  K0  @ )X (X0000S0C P\P ß0S0P0  P)U0020c RKp/KZ V`>X<XBVPW U V00W00SZ x)X O&X+  X"t2 ,0S x,k(XT2 R P\P lŸ0S0P0 P(U  P\P Ÿ0S0P0 PU |X&UF ;X |X 1&XK;X |X0x"`A|q0FSGLAb@T *Xl (Q dȚX0A0EA0US2 " / AE'2`A2&  ]'P@ 0 0S 0S 80S 0$ @ 0, 80 `|C DK(AE 'P@  P0R }R\  300T*X 0S0 0 0☧U0`00C >X000 P\P 0S0P0 PX< <X>U&P 000 0x婧l1E` P\P 0S0P0 P-U0 0 0&U >X00  |U00S @0<X00>X'X2 JZ H ` 00C0 K"X|2 JZ `00 K}X`2 JZ `0 K0S $ ܀  (X( "X 'X @TV2 JZ `@ K p 00000)X \X  00C000"X \X0 0C'X0000C`X  " \X P\P H0S00 $X "X X\0520S\X `X2 JZ `# KZ(X000 )X00CS0 P\P (0S0P0 P)U b@P a6000( `p 2 JZ `  K\X 'X "X 0 0m2 Z   &`000 K"X \X P\P x0S00 $X "X X  \00\X `X 00` )X |X (XO 00  2 Z 00` K 0 00T}X |X (X3 00  '000 P\P  0S  CX X'00C0D p-LM0P0`0@V:`p0T: -LM 0, !B0001 < 40 0 圥408 0<0 @ 80,` pcP\P 1 R0P0 PUR W U p0U <00c R<K @P`S UU( P\P 0P 0R0 P U<K U$ <  b Rڼ @P<00c Rڳ @P8 0 08 @@0 `M0 00C00,밙K --hLM 00CS08 00CS0$@@ T묽< p-LM@<`0DSl0P B    8 $`4 ( , 0 p<004`00,( p-LM,`,T- X 1 R$ R 00S  RXij  0S 00S 0S 00 (1  BqX0001( dP  0R@ S ,0@(0c aR( (@@D0S #   $0S R;T 00S $<0 0 qaꄽ0Dؽ -0@L MTP@ T R,d-0M,_- 0, 000 < b0SH0@ , G 0 00KL -!MLM ʟ` ,  PT( X8 \ d @ 0 S\ @0S - !KLLl Yh O \ SL p\P` !P@0 XH XQ ` R$ 0 B 0d(  h8S`` 0S XQ T(8R ,0`S ,f@!P@ 8!mK `F0`F(0 wxXPXQd( h8S` ((XePh` @Q 7 R!0AVS񟗆p p ̓ ̓ ̓ ̓ ̓ ̓ ̓ ̓ < p d ĕ  ( , P t Ȗ , d ԗ < B^KPEpPE0K K,0L+ Aw`XP@p06B^K PE0PE0&Rp6B^K PER$0#0pPE00AS00@SB^KPEPE%0 0 B^K1PEaPE0%mRpl&?l+B^KPEPE`%0D$l?l+B^KPEPE0%`}> P00{RPPU B^KPEPE0$@R~KpGpG+>}>PPl>l{+B^KPEPE0  $}>@p{B^KPEPEl>lb+B^KPEPE$$B^KPEPE+n>u*+LoB^KPEPEB^KPE0KpPEd8 ,LPB^KPEpPE\0EB^K PE;KpPEd( ,C@l>l.+B^KPEPE`#yB^KPEpPE0,B^KPEPE.)>P0p0#4B^KPEPE0*tP oP@ B^KPEPEB^KPEpPE B^KPE pPE 0` K,0A+K0+0BB^KPE` pPE 0H2B^KPElN>l*B^KPEPE"&B^KPEPE w =P  =P B^KPE@PE+= =Pp)+@)*v`=P h)*=P B^KPE~0K+KpPE,0A+B )* /P0/S)*B^KPE0PE 0B^KPEPE0 -Q0 S Sh`  p S \S0p)h8 d8S`00`8 <L\Ld=L(BL84|$LĽ U 10L 0X 0T -LM䡟䁟p@`P\P 1 R0P0 PV(ꐚ  #U` 00``` 00c R@P000  V[U(K8P/ P(0PS  b Rڠ0@00S(x0]P\P L0 R0P0 P0 `묽D8L -1LM  0((0 $ (0p000 , P`P\P 0 R0@0 Q@000c R0KKP[T@` ]T`FTV T00,$ `ߟV00 p- LM0`S0C0Px0U  Q@@T0 AQ 0p$ P@ 080꬙ p-0LM R 0 0P 00pphP0S`  0 0R@0 \T 0 0R0 P 00p@(0  0P 00p鰙 0-8 P0@0L A @=00 -LM0@=C0 0 c] -LtMJ< 0S00cS0P@$ T P0 0@TKPx0: SH K 0S 0X S `0S X ,'P 0@@ș̙DL0̙ 0-LpMP0@S|0lS`0 TK  P|0: S\0 0 00긙x -LMp@:``PP :b;`PP%[;P@ 0T\S T 00U0L0 R T??;@&   @ 0@S P@1PSlg@0S P@1PS4g47 0_yP& -(000s0@:Pv&00  6 ! P PP @0 @*0SwmpƟp@P0PP T@)H*Dy&`'0@/SP< P 60S,6T  ' @`&7(\& '0US kUe%5Q00H&0@ 0S 0PP P5P` `PP"0S"P@T $@@)4p0S d ̀PK}P2: St 0`@S@` 00DSg#02 e0L0  媦$P0``P 0SK 0S8@T 0/%& R$P PUY00 0SH3   6p/00`%&zP  00 0@TL 0갲 0S DPw @$@  0 00 k1p00 } P P0c 0X1o1pSP00S 1SPGꐐ@jTe&#%9P  &0S 0S0S H!0SmKPdK P!$2R! 2R,9Pu 9Pptn@\ P wPPd0`.. [Ľx(Ƚ'8\VjNz   (101|xL84\N TKNNNP1C0N@NPNDylsL|NC -TL$  @0 <0R4S0 h8%0wN\ -L$M< @ D0  00, 8 PH s @ R1@000  000  040 1VZP@. ,P,0 00S X00 4 0 0DSH ` H ` T ` 1D R&0 R  "@0S 0 @000 <00PU, ,0H 8 ,@,%,0@ L00S 00 40N -,0LM@(@@h -LM, 0 ,0#  0S 04 80  00S2 < @ <0S2  2YP@) 0@S񟗙x x l x l l <0S@ \2 P 82 R ,0 R40S, 00,0", a2 Rh,08 R0S, ,  0 000 0<0SR,XP@. 0S40S* 0S' 800C80 8 R!d, 00T 0S ,0  g$1T 0S <0S 0S00$40S P0SP ,0  00Sy0@ h0 aC,Lgy@  0 ` ,ꄽؽNN P0-L@ 0S PP0 R @P 0Sꜳ XT 000%0S TT ꄽDD -P`LpG P@pP P00 Q @ -haLPp0S  0RO" \ @0 R@BT0S80S W p0  h`V#0 R!0 P0@CTT WU_ ^h0 P\  0P$ : ' D< p-LMl`PU \ @0 @Rk T ᷙ0 0PU 00p -(0LM@T @T -,@LM0 01hG P0-L@ (P 0R @T0  -LM/@P@r5P0 A'0P0ls - LrN- X 00Q0000Q0  QD -La 00zQ0A 00ZQ0ھ;\0;LD<4 ,@$hD|OO$O(O0O4O -H`0DpL0f@PM00fXP@HO p-PLM`0P un@ᩘ@P u50p 0Q0-@PL0 00h|0 p-LM0`S0 00@ 0PᔘPf0P00p p-LM<`P@1S@$TpN5Pph1 0-LM@4P,,P$ 0 0鄽po ?`P -PLNMP! Rp0PH1 `AT P$UHR?K kmQ?K-KAQH1`PH T0P@<`0S 1<SP$U(" hPh1  HP 0-L0M|P0@@Ktt0  R 0S $Q@000* 0S 0h1P - qLMPP0` 5 PP* P( 0S0P00S R 0V0U00S00 U 0HSx0x 0Q$`y`@s׋ʋ8{ȋöV 0000`QR ꄽ \ -L,MS0L0 0H S pP T W㸓 DK   pPO 40AU00#`B $?U sU00WP0P0 <#@0U @$T %T  0  koU<PP@ 2 V 21   R<V<0  L0 T 4D1S +R-R0S-RG D H R T0 SD1S  H0 T R L 0S $0S LP0S D1@S @1S``!T RDD L!Tr'D1 S 1 SD  0S0#0@0-S /dP 0-S 0唐 @6@( y3nll@0* Pp3elLT@0@S 00$T000 h1PP9 aP 0-LM@P KB0 S  P00 Q0 Sp 0 0-L@PP 0(: -LDM耟0QP`@$0 P$0 S $:l0plUP!P0dP@UdpK  X3P40p 0eP -PpLM`@*0S @T:X00 S WP*U> ?U< [U) ]U" |U )UX IyWpGY00X00S |2P X pX Y X R0!S@ R0]S@DB -RPL MP@p`R *0U5#SP QT:U0S d?S^ *S 0TQ T PE0 P0PS:< S P, 1 0TPES% ,0 S Z0@00  00\ , 0Z,0XP , 0P,Q vP@QSSڿ0CS P, 0TPES,   U0@00  00U\ , 0Z,0XQE\  D0x U ;P r, 03Pk sP, PEU0  g 0@ P ,0X , 0PGZp@-@^P`D R6 R0 ^ R 00 Q00S @^0]STp0-S0S \ Rp0 \0]S[Qp0  R   R( !^` P-L@Pp`*0S @T: `)\ 0W0|\00S V  1P``FvDB1 -LM, ,0 i?B10Q , ` P@BpU<:T P @DU 00 00 P  00 U 00 6HpG@ , 0hC1 iBS, ,`   P 060  P0 0 0     -LM@`Q 1 PU$ 0Q-P0 Q -P 000#0+P0SPU00 -P  0  0 0:U?U0r ,U00;UppWj#Uh P0Pc :P. ;P, ,P# #P 1\ !000p01S 0!0 00! 001 p 10 R 00%1S00! ;Pp :P 0 00 P 0?00P000:S00P 0T HD0L0-SX^U0 00 DPyNN 0-LP0 S@5 0  0S0h0S 0\@ 'Se U 0S C  0  00SU0<0hPP0DP  -LMh4 4  , 00 @妒4q8 KPPP@DTX` U`V`P40c4p0S0W<0 ^ ~,@\8   00@T pNWP8o顒, 4 0, T < 0PP -QLM@ uvPp `PP*PU e*0S dv0S0@e PUp:0h0 -L`p PPZ /0#S+0@P$@ -LM @iP 00 iP00 p-@LMTP` wTP pU gP0  P000[đ` -`<LVM`0 0 /Q40 8 , P80 0D .Qq 00pW8p  8 R 0 S:S0 0S:S0S0g0 080YS 0/S , R 0S38 0RY 0c0 0 @ cRP @ u 0 SP/R/00040 *g @0 bRP u8 R00 4g0 cR@P ,wu,  P0 S/R/000.S0S/S  8 0@-S`G /SppW @/P/R7 ^/ .^ QP R/R0 00S/S /^^  .^0/SSQ000 QP@ Q AQ0/SQ.00 /R P-Lp@` fP0 Ulp uT X0T L0hPϐ0P@@4x -LM@mf|0     囐00 K 0  P 0P/0000 ` -MLM0ܑ0c0SpP, @ PT? 0/Sb S: /.-P`dU VO V> 0/ c 0 0c RPBNK ` P@Dt@D` ]P0`(K P/R P PP X@,0 S ,@0S 0.S0.S U0u/S U0.Se`0/S P -LM@p|0`00 0,0< (p0P qP@20 P00S 0`` S`` og gp[aW@, -PLM`lp@82 T& V`0 0,0$ (` p ` P gꘀ[≏x0\⁏00@0P3 ngP PP PPPPP -pPLM`l@*$ T P (0S0W< 00$  `  ,g\ #gP P PPpPPP Q,Q -L^M\pP`@)T0㠀 0WB , 0 E 00p(Ppp PPP $0BRU@Pkplݎ@LQ 0- 0PSL@]P _`PP0 , 0, 0- 0PSL@ BP D` 0P 0 P0 0-0L@P  0S0 0  00 0,Îf 0- 0PSL@ P0 , 0,媎 0- L @ 0  0 0S[ :Q0a0 /"s0 P0    0h c$0 0 dQ -@L P 0 Sw p   0:0@ #  = S , *@0  d0d@0 0 90   0p``V  "Pp``V@ 90 000S@ ;0 0W$ 0  }000@٫$00o@xQ -LM @   0S9 / &:0  uP 0S0 0S0:00;0埫0 00$ 0:p  鋫$00" Q -L @\`PpK C :  W  0 0 :0  0rQ^0 ;0$ V ?SR0 e00  0Bu ? S Rp 0$00+0 -LMP `p* V# @T T@ /q0 `d d0V0 pX f0;-p @T QQ -P Lp7 WpG2 @T p) @T!  pP @0a@T@` ppW00 V dP  X@DQ -LM @T 0S  0C 0 P 0S $Q 0-L@P8 50u  0 Q)  Q000  0QS 0*A0 0 00: A0 PA 00 00p  0S Q p-LM @`A v" + 0`KS" PK  <P P0S   ;00 $0p  $0 0\  R 0 B `0p    R R P0-L@P a 0h0 -LMP `pZ XS@T 0PI T@ o0 0 d0 `dpV&]p" VQ@ !}@`T`d  Pp@`TV  o 0 0f0 鐩0S 0 ;0凩 00$ 0X 8RPR --LM 2 -p-PQ LP@4MH`KH 0 0  @pdR --L4M@@K0B  u -L`M0VPD ,0 < @  @T %T  R 0 B @0D  D @T0D |8 ,0S l,@T 0DLS h h h h h h h h  @ h 8 H h T h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h ` h h h @TYT A0DS 0@%0DSSk 0 <0<00 <0 d0D,pK< S/ ( X 8 X Q a@ @ 1!10A00R0guT @P-0+0 0(K0gC Y @Ѫ30#0 P0S X i @ = ShC @ @0@X+YD D I0S C  0  0YpIXDD 0S C0 @0 HXʨ}D00hD0 h0S C0 @0 Xj-P+P/ P- 0P 0@0S# 0C0 00 DIYpD 0xS0S 0C0 00 D p ID 960S 0C0 00 DpID $0gX0000gQ 00SN 00!10 ! g@ \pGX0x00<0倠 8pK0<0 8 K:<0p (1Wp< ^08@K8pK,}<00@0 <0@0<0 t@Xqhnlꀠi@fd0 b 0@D@@ @0  @10@00C @0 0@`FQ@ @E CR̔RHORD 0-0@ LP0 SlPl0  R0S RR 010000 묽D8H -L!PP@`p 0S 0|R0P 0 T  0e@aP00|PDH -LPP`p 0S0@0 p0T d0T 0P <T2Pr@XDH -LMp, PP0@07 T`( U FT&T &T 0PX W  0pV000 ;T`,0S U(0P @DH p-LM@0S( 0 ER p`0P0 Q@@Q$T00 0h 00`S000 L0RP4 5*p000EPDH,R -LML0@S 80  Q 0PDH -LM$`Kp@H P 0b -(L  P 0}0DS - L. l. t. . . T \ 0  0  0i 0S|  @t t ` X X T L L 30#0P  r r ! -PLM@ 0T0   R0 0Q [R P@D-0S00 0\00 Q\0[S 0S0 [S ]SQD -LM@P0 0S00 -LM@P  0S 0=S   -1L M q< ,0 0 4 Y ap`VJPU 0 0 S" `VZLY4,0Q *00010 0 `40 q0@` DA qA@,@ 0 4  L@T   P000L@T0 4,0Q* 004 0X0@` DA qA@,@ 0 4 s0<0  0 Ri? -LM@R $P 0 鬚 -LM@> P h 鬚 -LM@@P:W W dX dX dX X LX dX dX dX dX dX dX dX hX 0<00<0?0 b0 <00 <00S ?C!0T <00< <040 0<0긚$ p-LtMPy@P (Y lY Y Y Y Y Z $Z LZ hZ xZ Z Z Z Z Z |[ BPt00リpXpp@ 42 p0<0 @ "@`@0<0p0<0Azpp0<00<0>!0<0w)psƇp<\0 ! P 0Ӫ0p p0  0 S0`PO0@/SFPK P0: S`}pLjp000<0D0 b< @0<0kꄼxDV -LM@@P-T\ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ @P0800h鷩t"pld0 hh,<@P  p00hꄼ8x$O -LM` pE0W:00pPU 0SPU 0SU 0S  o@  k 0 A?U0@0 pP0@ 0 P]P [P P]P Ra -LM[@2 0Sd 0  h -LMpPH0`KW1S~ @1S勶W -LM Q#p`a0S  @T 0 S 빅@t 1 R Q 0T2 0T/ 0T! :Pą ą …뾅t @ XQ ^ 0  0 0  R X0 Q\@X뙅 T|x -|XL0@ S@a d d e \e |a |a |a e e hi 8h0Sr P0^@0[P\ XpR 0ǟS7 S 00BS7 0GSWW0 iPLb b \b a p7 R cQsQ CQ  P  700BPLb b \b db 6 R6  00P0S P 6  B P00 P``V10@<&SL00@``0  6p@p P 0 Sx @ @0 @C   5/T ` `  P{ p%0 0  R8% 01000C0E0 %0@00};10@S0 D0 0$0@0T0 $00v 0rp$0 0  R$LQl4h4   PY 0 $000 w($0  #0 00 B3  7 P00 PppWP  0P``V @T 3 DTS @ 0 0b 0  00 m@0P 0PV 3'QP  2H 2 RD 0 0S: 0M  0 0-0 @0 TT 0 0S 0^  0(" 0@$ 0 0 0 00  0R 0 @ꠡ괁1`V P q0@0  R`Fp1XV P q0@0  R`F PPEU q@L 0PE0`U 0 ` 0 0` 0? 0@T 0 R`@0 p0 l( 0 00_xd48$<4X4(Ú< p-|0LM@`@Pᬰ\\0P P0D D0< <0@#phx$l tphdP0 0 .PP X4 p-xLM P00PPPU@C H4 R < P ,ğ0S0C00@0 00C 00  c [ 3 ppß0 Q #0S0C000C0  0P0 0 ӷ0C 0 p0P 0P 4#0SP(3PT-l m m m m l l m m m l m m l m m m m m m m m m m m m m m pp2 S p2! RHR0 0CR0$b 82Q@  0 @00 R 1 0 S0 00  cf[ 00 0 0St1 `P`1   \\!0a00cSsS CS41@ ph`0 RA 0@  l +[0 0d c 00dR0c00P@$h@0S\0PpH0P0  c[0  A P긻d$ 48 -LMPP`0  @P0 04? R 0LyS{@s Lr q q @h0 Ru M00 pW-00Ĵp k  0pWur꘳ p-LM`@PT# 0dR 0@P0@pv0S0C0 vt 0S00v0S00<0 P bPv0S00ꈳ -PLMpA0S_ PWa$K@0 (K,K @zPPB H1($01 $0T00 (0@cT  R 0000 0 0@@,0o5,0 t{0S @TYP p300(Q 0pppdh8t4  -PL$M@`P㼒 r0S㨒 T0S PV0 ,K0K4K8@K @yyPs Ve `FVV80S940q 5`@M,03,0!0{P00SP 1T0 S/R  P4y|1|!x1l1l!@@4@Py1UpU 4@y0P PU48 v4y540P``pyx0 @ x00qQk D0@@ P[  004 pdht8 -L$MK0 K @KK @xP@ Yvay6 0 RPPᄽ -T0LM @R 8 TT^h1u0u@@$ D9 P@91( K ! Q@10 `P00CS00Ӥ0 Pp @00CS00Ӥ0 PpyZYZe_773PQL 8WWWWWMPyhoh -0L$M@  H0 < x>H0PPD0 <W@-n>Pp cPdbY0SP| H b@T PP @~@bP..@~Y.D0S>-P5z00L{P!( 08K@8 0 40 ,0 *P-P @@~<-P$<~@~cz0-S @~L0S @~SzH00 0 R@~@~0;0<`H0P0!Pz~0z0H D0 i@~ XX(X8XHX\X -LM0 4 "{P; ,K }p# ,0.C4 {P ,K }p ,0 C4 NNlx=~l@ll 00{\2~8,$@4,4 00{XXXXXPXX 0-,@,PL $m i=hdY Y -LM@㒤P 0lN 0-@LㄤPU 0SYN000 -LM0@S h頤垤p@-0PS00p-\@@T \ P`r00 P 0 R0ATap -LM0@SK P b 00 0-0@SL PP  0{ 0(0M 0-0PSL@0S00 RP0P 0S 0- L0@T  0P0Q 0S =S Qh0 `0 00S<Q  !Q >Q  PP eHY -Li1XY 0-XPL0S S 0@ S0 00 -LOM\0X,0 0P S ,0 S ,,wOKKK`VT NP W?K+!rPW?K \!QH1SD1 L1@X0P S Tb818S <+ 0hYPy -Lp`@T TT#6P0S! P T0  0S T K@T TT K0pYY -Lp`PU U @0S P U0 0 00b0bPU U 0Y -L MP`p@T T T TT T$KPKP@ (KFP; 0D S 8 P d | $ (0Rpp`$ (0Rpp$ (0Rpp$ (0pRp$ (0Rpp$ (0RppGE0D S $ 8 P l &Pppý&Ppp&&pPp&PppӤ&p p-LM^`P0S p.T@0S 0S uP0S  p-LM``@0S pP0S {@0S t -LM@`y{X0@@D0@ R0S$|zjwPy  -@L8Mp` M\l2` N\X2@ L"[p5&LKTpK`H P K0T L` ;P@P00P0 厡PP;/ P 1K0H P0 T @@;P |XK<K <P800 pS080 80W@:0T@Z >\)<\00S#\! D`K 0  \C0[SD[0 CR 0R P 00xmly0 pW@X D00CS00  ä0 V{ YYYY -L 㬣Z p-0LAM @P` Zp sP` /0 @bTQ!P -'PpっGOKPP Vv.PPJ\(Z4Z -0L [hd@Z -LM0p (0 g9P@/UoKK/gPKU  S?K\ 0SKK,L1 H1 D1 @1 <1 81 41 01 3J,KL0I< K)(0 S (dZZ -LaMb>K0C 0Cp( @%Pv$6: Sg  S-PW(0 S (8TJBnK`F`F|!|1,0S,@aD8PP$[NK@D@D  P(2W>C R0 RW W(ryu0S ,@8PPW d^yBnK`F`F+J0)0KW ZZx 0edAZZ -LM@X {0s 0[-[*[T0G(at -SL Mp@Pt00!1/dP`!  V8Vx t0S@ 0P P* ?8W@t?00 \@a` X0P P* %8W@{t?00Py10P[ -LM@ K K 0K @@h9P -LM8 < @ aP`pm 4KP@h 4 0R SB *P`Z 4 W:40@#P0PS ,KL PP 0 1P@ U10 ` PP 00S0 K6\P 0 R ;;S PP 8P xPP 0< @0T lPP,V [$O0[[[HE -ML M0$ , pp+ P`:s?000!1 ,0S ,厡AzP@ IP 0 ^1P s0S08s0S !0BKHH F90@C/{PP- ~0@S" C0S =0S+ 00L? \ 0$ 0:]s?000, 0z$[[[[[\Dy0\ -L,MQP, p0K0 `ß Q Qq00  Rp0+S-S-S +S 0+S-S QN QLq\30  00S.^A0.S7 Z0PC Z48 "O1@K 00K @0KH@L P P K 00K`V 10(O @/r "00Z r 000S 8OSl,4`( &"0K`PP, P0 Q!000ӑP PUr"00 P pl1  0PX1@@K1`M% <0 ,,< {p4@0 KX0 8 Wm0K J80K5 B"4@Z$$ `JPU *0 K0 VP00KU:@ K00K ,@ {0@T0 {'0 0R00 00cPE: UcU pP/]{ { \-gfffQ p-PLM@`PC ph10  00S H100PC r0 0  R1.\P' *\\ 0SU 0B8 S('08C?PxAPPڌ@PEUp pT00  0<0S000PC r0 0  R{ { -LMp`#0P@ r %\P @\0 P@  -"P@2L MR0@K0 p` UsLz\Ō\pG   a 0a>Ìp4G6pGƃ??p`F R bЮ?Ф@A P 00Q00S Q b`.^L2a?@ C_`0 Px 0 P0x0Ńƌz(p , 0 KV10U0 30 P@,0 S 0 70 ? -L Mp`@P@2<K4K0H0S񟗦t  ( H 8 `  \  8 ( \ H L d ( < t  H 0 t  ( H 8 `  \  8 ( \ H L d ( < t  H 0 8D3#cX Q0@ 0 KD0  DK5P0S 5l!000PKp DB*l!00CP3L#cX Q0@ 0 KD0  DKP0S l!00 !Bl!002cX" 00D0 ?0PKQ@  DKP0S k!00h Ak!00ŸH2D"cX 0QD0 @ 0 KH0S DKPk"00k"0020K00!1cX! 0QD0 @ >0PKA0S DKPpk"00lk"00ht10 KdQ814!cX 0QD0 @ 0 K(0S DK|PLk"00H{k"00D00K000 0cX @ 0Q@D0 00K DK\P,_k"00([k"00$G]]]]]^^^$^<^D^L^T^Tg\^d^h^l^^^^^H ^^@@0D cX 0QD0 @ <O0 KX@0S DKPx0 R k!00 ,Ak!000"00KP0 cX 0QD0 @ O0 KA0S DKP01 R j!00l @j!00x1!00KQ1!cX 0QD0 @ kO0 KA0S DKP1 R j!00 @j!0002!00KDR\2`"cX 0QD0 @ O0 KB0S DKPb2 R j!00Z @j!00Q2z!00KR2#cX 0QD0 @ O0 K8C0S DKdP4X3 R cj!00, t@Zj!00#3L!00KS3#cX 0QD0 @ 0 K`C0S DK6P@3 R 5j!00 F@,j!002!00KR2"cX 0QD0 @ 0 K0S DKP j"00j"00d20K00T"2cX" 0QD0 @ ?0PKB0S DKP1 R i!00 ?i!0010 KQt1p!cX 0QD0 @ 0 KdA0S DKPD1 R i!00 ?i"00v0 00KP0 cX 0QD0 @ 0 K@0S DKPY0 R i!00QL ?i!00HD0q 00K^^^^^^^^_$_,_4_L_H d_l_?G?h!00,(24"cX 0QD0 @ .OO00K0/O %.O P@[PB0S DKPh"00h"00~0 IP O0 K00K0/O /O P@,P0 *P 3#3cX QO0@ 0 KD0  DKqPAth"00=ph"0093#3cX 0QD0 @ O00K0C0S DKRP"3 R Qh!00H b>Hh!003:0 KS3 #cX 0QD0 @ 0 KDß0S DK$P$3 R #h!00 4>h!00?0PKh2d"cX 0QD0 @ / Pځ?0KtB0S DKPg"00g"00o?Ÿg/ 0jP0 K0P@Q1!cX 0QD0 @ K0 K0S DKP1 R g!00 =g!00{S?0PK,0 cX 0QD0 @ 0KP0S DKPa0 R g!00Yp =g!00P 0@K Gp_l_d__________ ``$`@`H`P`h````H````` d^h^$@h0l cX Q4O0@ 0 KD0  DK?P0S ?g!00 P=6g!00@0 cX QO0@ 0 KD0  DKP0S g!00H -=g!00 0&L2@-O@d4xB 02d @-M0Ѝ@4=> 0'2 /5b -L MQ@0K00#  0 p0T0P00S00#0 -LM K K!12P -LM K K!%2P -L 0KM#<$ -L@0\M0 0 L0  <0 ,00S00 K$ K+P$| { -LM`Rp @t%  P`F @pT`P0AS Q)0 0  00    p-LM @0`SPR0 S    0100p 0S Q0 S  0S0 .R@- P@0@ .\Q00Q0S@@ 0S0 .R𠁢Q00á? P              plhd`\XTPLHD@<8bbbb@bcZ P" 8PP 0SB P 哵P 0S $481!`)! X0`X0 `0ᕯKS/K ڜ1S9 ? @T  0(KQ QMK0SMKPO L "3@(K0SS SQ u -o -iOK @D- b~P-?(K R!  W~0S -?(K R2S "R K * K*姂WO0 4.  MK0iPMKs P+ 1MKi P\W)  b RW0S NW L* 41`?W LD O- h3W0#S /W  R@\K 0@,"|@@"2@@埳P 0S"2Pe'0eee'eeef0f\fPye0e( -L,Mp`@ KD0K< 8 @ 4 0 , ( $ zPDP@  0`4PP @TDưD°n -LMp@P `p08K8 (P , 4` p7K0 8K (0S (mf -MLM Z,   4 `a V $ 0P@Q iX1X1 - #Pp' B^KPEPE0$!@ }b`}V INK@D@DrP 4: S  R 0 50 ,0S , Pt $R 0R\ 4 L 8&`fff{ fffg0g -LMh@pP` 04K4 $@ ( 0P `3K, 4pK $0S $ǃDg -LEM@pKK, 4! K081 ጳP@  #R 00T-* R+ R) R' r0 0  R r0 0  R0 Qh#0000ӑ000\*0 S S S0\*0 S S 3000 \ *0 S S\*0 S S  \* 0 S S S R r0 0  R> \*00 S S SP\P 0S `` Pz0+Sd -S D 4zP0+S0 -S  PPUb ?? UP[|,0 S t,0S @S P K?K)`0S @S K?Ks)0SP @S  4.P`8~ 81S  K?K[) 4t8 0SP @S 8~ 81S  K?KC) 4\8 Tg -LM8KKPp <, PP `P@ ,0 S ,卂P/K%>KH D LB @B KH L @B 0S bt?I"0 0V:`|tP@ `<$0=80` 0Dt 8 a0AS"p p p p p p p p p p p p p p p p p p p p t 80>080 8 C. 8 800p+WP -W=W80@ =W  0 S RA(  # P0e(0 ( rP@} (  (0PPPP@ P0 S S0 S S AP0P0,K M,0S ?R0Sp0PB U 0@S  R00 RZ@ T 0S 000 ! BX @P@ qPP 000  bRF0@NMF0@001qP0LP 0Vjq{ 0{ -L>0S{ T\k*;h* -LM,4C8̓ <.K #h, ?KKK@D3 0# p @ { -p`LFPP ^P @P VP 0S0S { 0-@P@0LS00$ 0000ҡr{ -LM(@0S0 u00{ -LM0St (K "Q@`Tg ( 0 S RL0L(  S *u (0#` @Rq PU`@0S0T`ÅܢPP `0 S S0 S S ͢P@00TP@ 0U ` 0S  R00 R@@TP U 0S |00x0V:\堢PP 00PP@Ņ,,Pjr@-Mp` @0\@X\x\@ Q $Qq0 0  R#0C'  Q .Q0V42:ЍQ q00  00S 0gC R17 1RTq00 D R q0 0   Ra0LA0L** -PLM`p |B000@,K0K 0 , ( @@rp0 WV0000JmPP0  0 @@\p  mmIB0@gmDB0@* 0-! L0TT!P@1BT @@ T 0&B0 0 -PLMU㤀0` @pT ;0S0h0 @ǥ\00VD @:,0"0A0@ -LM@(@T0 @@   B00! RA R0000000000000000Z * ?0-1pQ LR@` 0S P @@ =Z0@< 09000S@0 ?0-1pQ LR@` 0S P @@  Z0@< 0 000S@0 0-LM 0x r.0l@hPTX0 RP 0 PP@ 0$  p-LM@hP`\ 0 @4Tp`0@ R4 0-@LP 00,@r.0  0h$ -rSLM"0@P` :@p 0P @0p@ p-LM@hP`M \0 @4~Tp`0@ Rm4 0-@LP 00g,@r.0 a 0h$ -rSLM"0@P` :r@p 0P g@0pb@ p-LM\@0PSP`PP ᘞ@0PPPpkkVPp <r8 0-LP(P0@P @04 p-LMDP0@S8`p$0P@@@6k <8 -@LMh -LTMF\` \ , d h g l 2%0S U@T %0S :Sd P0@T @T@KZC\d QR d埾PPMCDICPP XK 㓡X0S p00R0Sd@\T00Q00S ` PT0PS l  R T@0,S SS S UP0T0 UP004D,0 S 0,`mUT@PPh@T #P@K0h LK@jPhj Uh  LjpLP L~jyh00fs`V tCDK0\HK P@KLK @徰PejULD0LP 0H3LK2 P@K@nP`P: h0S@- ?jh@ )R 7P  T 弽P@ 00CS0 0Ӥ0 P p 0+S:P P P ˚P TKjB\ d0@RSA00ٽh ᨽP㲚P \QP!00 DQ0SG d0S7 p,0d LKP@K@巯PPP LLiP0T@KPT ,B(B$BPP d@T XKkX 0SpR`@@K` `02H0 uP8@Ĩrr<D 0s]*H P-T P,/C!bL0 Rn$ ? A1c10L000Kgfff p-LM@PT` h0 d1矻 ჻p< 㔻  sssl*$i* -LMğ !  \ ,    !p4@R@  pP4@K K 0 f Kb K^,K Z KV KR KN KJ KFW0 \0 x X0 T0 P0 H0 D0 @0 <0 80 40 00 L 0 0 |0 t0 p0 l0 h0 d0 `0 \  !@0PCⅠK  adP`.0[  R) R' T*00K[p20  00S  Q"0000ӑ0K[ Qt"0000ӑ0K[PP}=L0@R XKK, PGK K K K K K K K K Wt0S `!>T0S3 0CS/<=v@1 ,0S , k KI  : 3]KP=KXKL00L0 60[S0X K60K#@<00Hpp< 0 vL< 0T0 -L0Mp0P 0 `@ LKL@KD00D0 Q Q <00 0 S 8 j, HQCt,t,t, -LM^8K- 7<K@ K0 <0 =p` P" PDK@ @ `@KvD@K  @K0 8K?Fvz j*: Sb0 d Sc0 ] Sp0?0 0r0-00w0-00!=@SL CS-0> d! r0-0 0w0-0R00 &R-0! (!r0-0 0w0-0R0 R-0 00 0 R 0Rt0T0x00 R 0Rs0S0x00 S ! Ss0S0x0 Sd0 Sl0  S-0 Ss0  Sw0d'*K$*!*%* M-L(MPP@0P HK;0D0 ; Up` T LKP:L0P p`R 0S  0SH K1 0;D0K!X p`PW UTv W Vw;0"S{;0"S w -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K 0KP@@K 9<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S N:"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`Io * *R0S 0S0S0  R00 *' * -MLM00ANK@D@D+_P Dyw -LMM|pANK @D0@D`P+ 0 HP 0@ $ 0S  Rdw -LMM|pANK @D0@D`P+ 0 P 0@ ( 0S  *d\w0PP0 Br 0 B\0 r 0-0@SL 0 aPU ,0 S00P03a  0-@0L@PT ѴP @T00 p-LM0`PU aaTP00p p-LM4R0b0BP`(` 0St 00P 0S\ 000 0  0 1P0 0S8 00P 0S  00 P 0S  0 0$0D!$0<1p0`E  0 ` <0`8  0`/`0`)  0` `0`  0``0`  0``~<Py$8 -L M0`S$ p  :S0 $0 0pS PK%t8l8\8P@ (K (0S p00R0S 8P@  (0S p00R  R W1 $ 0 0 z8|v8lr8d Q T1 R 0S0<00  00  0 R 0 R0 0 0S 0I8E8P@  m(0S p00R0SP X.8P@  V(0S p00R0SP$|ĨPy8 -4L  0PP `H@T T 0T,S 0S P cW_W  0PU  0PP  0PPPXy p-LMP0 S0 `@0 P P0S&W0X S0L@0Sp00W W W<  -L MpȀ@0`SP(@ &\0  巭P 10$ KtP(K⼇ῪP  (*D0  $V|< `y.xL@-0S@ @ 0 0 0  -LM`Q ^( @`p$ 4 0cPB ( K10 P; (P6V00T00S(0V0T00SW WP P0 $%@4$ 02P $ 03[V$K,< `y. --LM -L@`p#+`0 XXPПT  8ҽ8 $0ޟ  忟Xhdd$ --L 0-<0@ PL,,妟T 婽 0hhdd 0-0L@P 0SP0 CR 0P0 00R P~* 0 0 -PL4MPL p` 0 SU@P X 0 S L@P L0@KវP\!H0KQ, < 8 4 0 p4@HP D `` @0)Sn6 0  ./ }+0U# >E0CS <0pCaH0S  j H N a 0H0 L0U 0R*0 0\){} 0-@PL0\*ql0  0!0S T000@CT00^00S 0 u -LP0SPp:qP`\&*0^S00p\*0]S -S \0* ]R S*-R P0]S-Rx \*0]S :0SS 0 0@SJ0  t0`2  00SH@TZ 0S?W"  0SJ 0 @@000l 0\0Z 0  00 0 B 0SP  h hb  P  000  00 -00-0 -  Pz00 -00-0 -  h00 ]00]0 ] h ᤔP & P0S1*8  㗔P+ 8000 -@PP050#-SL [S0 :Sa =S1  pR*0-S `WW  0 00 \  X\*0]S -P0`0 `0S0%*00-S]S P*0S*0=S .0]S00$P*0S0"*00-S]S 'P *0S*0:S 0]SP*0S05l:o h -LM @$Ap\ *P q00  R@ `ePi ΐP0S PP PP  000   PP0S 50PS -LM@=>0 00  0- LR@%*0S*0[S 0 0.Q00PQ*0S*0.S [00]S00Q R* -PL@  R)* P*0PS 0]Sp`ePV , $P0 R 0Spx0   0 R PX 00p , 00  RP  p-LM0K KP` 0 ]0@K0K KhP`p -0L `@8pP Put00  00S P h ]0S04  4  p-LM0K KP` 0 ^00K K]0 @0K K$P`p -LMP`@p0SGT1 T00W0 W00SiP X X X        |         ` f 00   f  f5"  A,  i f0   f  f"  A    @`pG f 0  f  @D @D`q0 S @  -LM P p0 0@W` 1R VL@0S P0 L0S 0S @`P  R Ϡ>1*!">00c # Ϡ j ,@ LP@ 0^?>1  ^0L0@LP@ 0@0Lp@-0`@  ^R *0 00  n^ :0E\  00C 0p -L M, p0 0 S@"* 00T0R00S P*`P0 00 R0#S P: P @ T:`@ T*,,0p-0 R*0 R:@-0@P*0  \: -LM@`p0 00R0KPU@  P g i速 0S  PiKL- 00/>\ 0S0\ 0@- 00>Q\@ 0R0\00 -0LS8p`0S PU`P 40PU040@0 S @TP -`RL@PpR 0!j000 p-LM0@S`P 0\ 0  !p/ p-LM`\P p@  A 0S0 0H0SHP Z  e! B 0A0S 1>3 01 0-0@SLP0 :K0S @ 00h 0-0P0@L &K0S 0 0 00 0- LR@00>#R0 (R" R @0Q@PR@P0JP< @Q >3SAQ 00@0QLR RRL>31>#R R "RR R(00(000S0 0>3S S S\(00(0 P L -LM 0R  @T p0R000PP P<PhkJjJhJfJdJeE -LuMp0 (, 1 JP`` JPPR 0@x1 0$P}K@{K 0 oK. ́ ȑ q 婗uK "P? 1 pIP@ oK 0 ,0S ,L0 10SII H0 @pI 0g| ( -LbM⸠0JK(0 xp @)@KpZ_K`P TjKjK11 P 0S(0 S (iLH -$0L!00  -LMp|# 0 0  R4 УP n@j T#1PU%0\ \|t3  00SXH3 /\00\0SP.\ \|3  00S0 0/\P- \ W u0i U ډ>i1!X H U r(00 0S PSPSPPP0i!UPQQ20  00S W䡟`P @j T! 1\P \|1  0 R\ Uڶ][i0XSxSNQKq(10  0D0SB X0P` 0\7 \5|00  0D0S, |  0 0  R \ 00ӑ@ ᙘ@dT0P0U0 XHm 00P02 p( UHÊ( -LM0  ux -L M@ 0@e뤃R*Z* -QLM  0K  0  , 0-LP@p P'p U T 0\ $pP U)St -LPpPpp,> -LM$0HPPp`=P@ 0 $ 0I00D @0(`0 -PLM@ @=T 0-00L@ :0S00?0 00=0>PP 0S P= R D0P00c00 R3 SD0Q00c000S0 3S 0-@PPL0.0UP1S -LpM$`@P R KHPp 0 0R, 0R ]p00YV@U@p  PP -LLM` d d@` @d@ h0 \`K$ h0 PpW:` <Q U@ * 0dR @T`05<5:T 0 00` 0 0Pp$0(0,0 0LPP d0S`@H0SW 0 P0P00 d\ Q D0^ "0D0^`H0S0 t `0L R0Sf R0S]  0_P@ E U 0 CPU 0; HP@ d\ 0hc/0cOdP^*hP@pD0^ 0  d0^p@P:PP<<TPP\< F<`@L  0%0D6<Pc`H0S[b<`<`@0\ PPp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0| -LM0Q, `Q0 AϠ lp 0 4 00XP40`l ^0p U40 @  U V  Vs T e42W  U' u "0 0Q_U  V v 00QF_VD  U u!0 0Q%_U# A?G0CS >2,0X  R 00  @P4  0  @0W  V v 00Q_V pp0  @@DTʎ0 00\@\ d0Wpp~ 0w0r ,@pn 0g -LM, 0 0Q0 `Q0AϠ l040 0PX`lp U@  U V  Vr T d02W  U' uŸ 00Q_U  V v!0 0QE_VC  U u 00Q$_U" A?G0CS4 ><,00  X^4 00  @P40  @E0W  V v 0 0Q_V pp0  @(@DTʏ0 00\@\ d0Wpp 0x0s ,@po 0hG-Q0`A $ P !>3Sy < S7 S S S Q@3"Zp0   S S0ZS S S0>#0S S S S "S>0!># R0p !>3 S >3 !>3 S&S S\0X0>0400 S2 aB0L~ -LTMd h h@d @h@ l0 ``K$ l0 PpW:d <Q U@ * 0dR @Td05<5:T d @@Pp=7P$ 0 0( 0 0, 00 000  4  0SPP h0Sd@H0SX 0 +P0P00 h\ Q D0^ "0D0^dH0S0 y d0L R0Sk R0S`  0fP@ E U 0 FPU 0> NP@ h\ 0lc/0cOhP^*lP@pD0^ 0  h0^p@P:PP$666TPPY6$6 t6d@L  0'0Dd6P^dH0SV66$6d@0\ PPp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P'` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0| -LMp, 00 Q,(P4 0 8 0 Y_0000AϠ0 P0P 4 < 0Y04 `O<0P 0 V<0 @  V X  X T sp2Z  V' v\ 00Q_V  X x$"0 0QT_XR  V v 00Q3_V1 A?J0CS$0, Y00R0S0 8y0 4t0 80P1P<  0P00 P P0Z  X x 0 0Q_X 긠00 P@DTP0y 00\@\ d0Zo 0h0c ,@_ 0X -LMp, 00 Q4(P4 0 8 0 Yw00 000AϠ PP< 0`Y V @  V X  X T 00 P@DTP82Z  V' v$"0 0Q_V  X x 00QU_XS  V v!0 0Q4_V2 A?J0CS$  0<S 4< P ,Y 0 80 40 80PDP< 00 P8P0Z  X x 00Q_X |0wX0X `0Z@n0h0c,@`0YG-QM@p(,P >3 S C S> #S S S P@Ѝ3"Y0   S S0 YS S S0>#00 000S S S +S "S 0>00 1>3 S 0   0S0 `>3 S >3` >3 S 0&S Sy`0\00 >00`0 S00h0S0`@Cca@-M ^@ P`pX\ Ѝ(@ \@Ѝ@@Ѝ@eE1* -<5L|MHK0 @K0PuAe/@ L L R *0S0L  L 0|S :S 00$@$@@L KPڄL̄PX00 LP`: @PX0L0P K@X0pP0<T K(@(0T0X K@00X0\ K@,0\0@L K40PL d K@p00, d0h K@80yp408 h0l K@<0op6[>lp K@4gp7[0Pt K@4_p7[04x K@4Wp7[0| K@4Op|00 K@P0Gp00 K@T0?p0: K@07p0,K: 0' 0K# 4K     ̄ -Lp= P@ d ,P`$ d0:SS ^S \S $ @^ 0:SS00f^@A`E,P`V,Pfd9,P `d P00:P\00BS1P0C@ 0 0/S7SB0@@2S?DPxX`xxxxxxxhxxxpxxxxxxxxxxxxxxDPxX`xxxxxxxhxxxpx00:00 0 0 00T 00S:S00ov -Lp= P@/ d^+PP! 0d:SS 0`e\d@ 0:SS00e\@AP+PPUp++Pd P  0-LP# P 0R @ 00B SaBQABW0B\70BS>. 0 XRxR @@00 :S0-LP 0:S0@0~@0- 0 Sn@S| -LM K"占vtO;*$8* -LM0`=S`pPጷ,K;P@; U逷 P:0P00@S=S 0S=Sg! P,@*P 0 ,0RA 0=S 0S0 0=S=000P0 @0S 0S` `00cC Q*P@ 0 0S 0 @0@, 0z   p-L@`M@PKΏP 0! 0S0 pz -LM(a0Sp=QQ 00 !1Q耟@P"0 !11j?0**P  01!0P0S00F*@ P P    0-L M@ᶶH0P (0 $ 00K K(0@  0  ,P P 0L=* B9*A`4*#1*@-@0S  S 0Sd@*(*Q0 fA 0bA$h *$%* -LM< 08 rSwS@T 00  ), ,0SZ 4K٠PTpPH P < 0rS <0@4,0@, P,00,  4@00@T 0@T< 0rS 04P 80ME4б0@4̱T 4ñ0,i),e) jlsj -LM☀@`T 0S `@TT #$pK pP0S V00007)u$  -0-LMP0 S@   R1 00 cQ  R!,0 ŷ 0S +0z  -0-LMP0 S@   R1 00 cQ  R! ᐷ 0S +0 -0-LMP0 S@   R1 00 cQ  R! 0S S+0 -0L Mz -BMLMh#0P,0 0L4  0S X00,3 ,0S ,*+/{PL$H$ K܍2P@@00 cBK J JH {MK@DPpP 0Srϴ`0CK0A S A P2D4 H2@ K0C0C0  A  Զ00C=S񟗗ܟLLLLLLLLL<LLLLLLܟܟLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLܟܟ0 S  1S!00 c0 p{C0L4 dBPnL$R 060S3/\VHEDyz lsj@-@^  0 S SS00N0 --L  0-LM@P|0S 0}0S {0S  {\ 0 @@Pp -LM@`P{P pWW0S `U @YT :0S ''000@0PTP:@T TW&PP  w 0{鄆 -PLUp`@: PP@ U:` `       --L p-LM@P\0X T`EpT < G000 &Sp ph3phdd$ -LpP4B,BP 0S20ZdWBbPq  PzU0S(Z @PP zU @Z @P PP@UT mY m|  yZ /yP@ P& 0/S! `g0 S 300 R @pP /P 0S/SPU U @P yPU @ZZ $0 偋Pz v (l$ < p-LMxx yp@P`\yPP @U8p @`@P 0F$ P @P`  H -0LAM p@P0` 0 uy0S 0 S v(ey0S _y0AK @S@l  :yLL0Ό0FS l$ \Ah P p-LM`PP@ 0S@T 0S@@T 0S$@p/xP Pt * -GMLMⴒ0pP@,0 ֽP.00ŵpŵA0.S +x P?@#2*/P P@8 @P0/S 00ɪP0S- IKAA-P`%4: Sp Wʼ!\P`ŧ0@Uc@,0 S l,'>00 SA BnK`F`F+x P0*IP 0/S+ p1(K R m@jР@@ TW +n P+n P *P@?00Sp RP4@@ 0R@cDyPy -PLM Q    0@+ @CZ$PAp .0@0K +P@ `00  X @ K|P@  Q00RPPU<0S :   $Pn 0g`0p00 .000PP_ KPZ/000Sx BPUh 0.S\   .K7P Z 000S0 S0 @c0Q00TQ4  2$0P a 0 0@b 0 @ Q /00b  00b0 M00 0rQ#XA #"00 0S 040. S0SZ 00PP 0 S/00a0 a A# 0 0;0 q#P    p-LMP ζ`V p 0@ H##ܫ`ỶJ 0-P@L"wPe0 -#LM0,0 H pp KP@<2: S ᮫500(3 ,0S ,& p! #P ;#;SP "P@ P 00p"#vuKlPDK hPP 1  0L2 PP2 ` UP L" P L" &#L2Pe@P `k  0sP@P``POP2 0Pb@V*0f0  R R0S Y@V:Y0s"P 0L"0c 0 0 8 !0@ST"  PT2S [vP TR 0@S 1SP "  HppP""9P"Rf "cȇ!, -L4Mp, &$W, Q< , R0, & BX 0BX0 嗃#(R@40 T P?4 P0`Y 00  Y 0AQ0 X`P&TP @0P UR PUJ P"0Y<0 00  Y 0L\0 `g@g' 0L\0 Y 00  Y 0L\0 P@g< ' 0L\0 < RV 0 b0hP,0P㗃#40 Y0`; 0@P0 4@d0fgP!P Y0` 0L\0 ^ T 4 , d/  0  0L\0  0@P0 ʿ,0T`P0 0V*@T%Pg PY 00  Y 0AQ0 @' 0AQ0 P`0V: 0Y<0 00 0 0  0 P Y0 0L\0 0' 0L\0 ' 0AQ0 4 4P4 P4 40P01@80  8P@ Ph PZ 800cD0 @ 8PP? P10@4 ` aH 84 HPa P4 P4 k4H H 4P4 PH4 40H P D D0P0 PD D0P0 P   P P  `0VL *@T%Pg PY 00  Y 0AQ0 @' 0AQ0 L`0V: p-LM@ ^<0  00S 0S0q>  0 0S 0 0C`0P %T 0S 0S0 0C` 8t= ,0S h ,!ҰP 8\ @pxT54,|j| 100Cw+@@# 0<3 0S_@0q:  0 0S 0`0CS0 P LT<tZ @ T *000P d X1 `0 j 0 0 43 0P4C8@4C `8 Z KK @0S 0 0CZ @ S0 RT `ʯP T4#0KKQ 4# @ 0Z0C0   0S 0 R@X 0083083 ꠯P XZ@&43@4C @0q48  00S 0Z0C0   0SyP 80d`08 0[0q7  0 0S0Z0C @0 SXP d7JZ!3Kg @+0DMSahLhLLxxxxxxxLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL<#R0<3  @00CS0000CZ 8@XXTxT/  3K0l`<#3K@C 43 4  43 43 8C@8C 43@ 4C  43 043  43 4 H3>KXXᡮP 【<x$00<3 <`$00S<3 ʦ<3 S  3K0X <#  4JZ!3KL @+0D:SFP8P`888888888888l8888888888888888888888888888888l@00CS0000BZ   2@xeTET)8 3NK0d>3K⑑ MK 43 @04 8# 8#  43 MK 43@ȡ44 @x3.KXx3>KX P 【  <  S<խP P!@0@# KKN@p@@@@@@C @< ylP 43 43 `4343  @4C 4 `|@"@C @UX@ t40  0PD B$ @0L̦ .L @-^R  \R n-\ @\00]\0S  R\ A]\ -LMP pR0 0V@ ံ000,P`dp@V p 0 f0 0  f -LM`0@0P 4p净PP @ O4@0P PP _;040Pp0@  pWZP p0-LP@= @1 RK 0 90000PS  40R 0B0PB0000P 00 0R0 \0\S  0B@00< 8040BP00 L0 0ᔵP0000<| 0-P@LT a DA0DSR0D@TP0 \(PnP.T.Q0̈ -EMLM@H$ 0,, e'H4 YL h Pl4 Y t7 ,0S p,Q!4 $Tǟ8(<,"(S\$ D ` 0 l APpDP 6 0YY`  \4`$ P T  S\4`$0Cd$ \4 V:l6 D 0 l APpXD(PR `V)*C` VX !* C`V H*C`V x*X4S TJ `\4CS\ d$R00V0#02S`4S T PY? L ""`$00R00S Y! 0S L0  CKA A$HsD4p cWHtmD4 0D$ YYX^ X$ YR X Q ?;@ 7;p X4;p0% H$P Y\ YY d^`` D/JPD3 WX^/ `P" D4 0b3 RD :dd nl3TP:hQh ecT4  T4 妥`D40D4 D40D40D4 <K h<0S80S40s?2 D4%P8YDlIP%D4|H$D 0 l @PpDcPdd ``QD4!0 2P^D45p#04P 5wy D嵥pCNK@D@D 0h@Pp:Pd40d4 ᜥD4` cpWwlD0l D4 D1PP*CNK@D0@D 0?@PpPd$ d$ D4P0P mD4`p0D4 fD4p cWdd ŲdlD$H0D4 DSD$p0D4 0H$ VY( | Ј<| =܈8 0-0L@,|_0P   0S 0 0}C0s0( | - L M0P,40` X X0s. 0kP  q30   00S 0@T td3  00S.Q q0 ,3  0D0S}:\D ,pKn a,0[S6 `S@ 0fS+ "bS @TV0S P Ƞ 0B(P 0R` ySX`  k,0[0@T t1  0 D0S:R .R 0P.S a GP, ikt!tt1T @0 @`@D1  :JkPz0P.Sl  ^GP܀,@k < 00 @@0 0@v+t0K r(PP'h0 k/00c0rBp X( | `<@| -BMLM38 0,, < 08t XZ80S XZ8$0S R80s R S  0S S 8$ p 8$ X X0 SB>K0C0CX@4 .K Xt BnK<`F `Fn J2(K Rb 0pS@ 0fSU LbS @TW0SH2 ,0S @,P Ƞ@ 0&PP&@$ 0/Pp Q  8!0X0P 1 <$0  0 0 ySX8 p8  p$ Jj@dP f0 ,  }P@`PUZ f5ju~00 0 @0@ P@}bk/00Q00SS (lAp 8 -k( | @| `(08r 0-8P@0LS((LI0@0}I< 0-,PLP 0@T 0 @ -L M0,똂4 0S ,K HP@ ,0 S R@0@,  S*H  ,0`` @#R #iP` JPP q` EPU, 0S ,0Q1 p 00 S S0 S S 1hP0``JPP 00U 0S  R00 R@@TP U 0S @@4 0 0@+0K 0 0VP4/JPP @ WEPv4 0 0,0  f H0 DDHP _( | <j@| 8< -LLM0@<,60 hP ( | -pL`"P@ 0SEP PP EP 0Sh0 -pL `PP@  0S0P -鬁L0M 0嘡0 0` px1Z>*pIP@P7 P %D0 S S0 S S yIP`@ 0 SP P`+U`T 0S  R00 RPPU@ T 0S PX000 R X0W@4EIP@ PqhP $0W`4tj$O8 -L(Mp젟0 S( PcEP 0@`8PK P@{P00XΞ    t@@0p!lL0\S@0 !$ 0^A(( (   4HG-@M`@<T8 40 ğ0,`0#0c0, `0cC 7?04 #/(00 ( ~- 0 ~ " #~5 ~ !~7   ~9 / 00, ,: "#:0:"&!*  1 !00H,x P `@p` Ph%%),%\P0!ē @ 1 )Wh _)| 0* 0 ` 0+p0 `08000 @`@1p0lPz0p[0ˌ0 00400@ЍHhȈ8XȨ -LM`0(K\p@P.  0($ 8 ( #"., K00K, `0@,<4 Ġ̌(<"4!Č <.̌ (0 $ t -LM0`$S@ 3 R (PK0000e@SP0m _Rl zP `P;@ ZP@P5@9P-P.@0zS `S;0C ZS@S50C9S-S.0C0p 0@SX, K00KUPP2,pŸ * =? 0 7?0  ?0 4 [,  9?0 &?  3?0 ? 000  6?0 #? ?00P 0zS `S;0C ZS@S50C9S-S.0C0 Rp 0zS `S;0C ZS@S50C9S-S.0C0 Rq0S  0P0S 0 e0#R0L@0SP0SH@ b᪛@a 01S P @-!P.*@0 S0ԧ S ԧ RQ 00C210P*0SԧQ <0 C120P *0 S ԧ R 030P:] p-@L$MaP2 ` 0( uX%X@ ph -LMp0@P 0 0`K 08#HT UPUP#08  0 S  SuP)  -BMLMr0D`K@P ,0 02S0$S aS@ t,0 S d,,@0$SQ= KR K0Y@ P TKBܚAK`Z0(H K:K4H  K@TK 0i TN:B]KAKx1 (PE(I(K @PE6I @T@ @?T@BKCK!"41"",!1AK1@TPZ$ @20@0  @*K0 'uTK { rK @TK  T:kP( (0@-"Q*|@P0#!0\ "0'*0#" \ ! *0##? 0 \0:00000E-0``&&&C&̠O 1t@X 00#0P 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 0$0#0 0#P%%%C%̠O 1@x 0(0#0 0#`&&&C&̠O 1@x 0,0#0 0#P%%%C%̠O 1@x 000#0 0#`&&&C&̠O 1@x 040#0 0#P%%%C%̠O 1@x 080#0 0#`&&&C&̠O 1@x 0<0#0 0#P%%%C%̠O 1t@ ̐0@@0#D 00#P%`&P`E-D0``&&&C&̠O 1t@X 0@0#0P 0#P%%%C%̠O 1@x 0<0#0 0#`&&&C&̠O 1@x 080#0 0#P%%%C%̠O 1@x 040#0 0#`&&&C&̠O 1@x 000#0 0#P%%%C%̠O 1@x 0,0#0 0#`&&&C&̠O 1@x 0(0#0 0#P%%%C%̠O 1@x 0$0#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1t@ ̐0@0# 00#P%`&P` 0H0@-@P!0\#0 0(S"Ƞ0 -L0M($@KP"h0dp 0 8#x "W 0@2K,0 00 p,K0K  H,0 0("x00W0p@d  608 0#H,0T108#xW -L M((KⴠPp@"hh   0 8# "Y 02K00 40  z000# 00 s40 0#0K4 K40 00 0("04 Y @  X000# 00 Q40 0#0K4 K40 08 4#H00T108#Y p-LMH`P*$H ph? (-"xPUL`@: 08#XU@: (-"xPUL`@: 08#XU@: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 a,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 d,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`5*0K0 0#0P0 8 Ƞ<̌ Č40 ,K ,0 0 ,00 ,@[0P[p##Ġ"" #8"(W0@ P`: -`CL0V Mp@CPC,K0K6,K0K08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0Q`FVPE@D08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0QR-D?0 \ !Z -LM@t@ğ0 8`, y MP 00 0S$S 00R5:0PK c \ V K I  ? 'D\@ @'(`@ ?0(LX\ @c@@ '<@<@ (H<@ [H@ @D@ - K(DH [P@ @L@ . K8DP [X@ \/ KX [@@30K`0T@ 0 KP@ L40K, 1K2PK 84K ,0(S(h ,  0-PL@U !", 1#80!"$ 11PX 0h鞰0 -LDM@@ hK p0(h0 0'00 * 霠 d0  (  ly 0)pgz p`00* 00H '臠\  )  $0( jX 0 0'00 * 霠 T0  (  x 0)pgz pP00* 00จ '臠LP  )  0( jH0 0'00p * 霠 D0  (  Lx 0)pgz p@`00*00)COH臠 0'<00) 00 ( j8  '  ܗ0* 霠 40 0(00w )pgz p0  *  0'臠,00)00pd  j0*00(00LP 靠 0)00*00(w< p{ p 0'0 0)00hh0(0 0'00টT  j0*00(00༖X 靠 0)00*00vD p{ p 0'0 0)00th0(0 0'00T\ j0*00(000H  靠 0)00*00 vp{ p 0'0 0)00셟4h0(0 0'00ȥ`  j0*00(00कT 靠 0)00*00uH p{ p 0'0 0)00\h0(0 0' 00< j0*0#00 < i 0)0#00ud pz p 0' 0#00Xh0( 0#00 ꤠ0*0#00औ4  i 0)0#00thpz p 0' 0#00dh0( 0#00H ꤠ0*0#00,\  i 0)0#00 tPpz p 0' 0#00샟D h0( 0#00̣` ꤠ0*0#00ଓ i 0)0# 00spz p 0' 0#00t h0( 0#00T ꤠh0  (  0 0 i *s pg{ p00)00舠T0  '  ̢0 ꥠ( ଒\ i 00* 00r pg{ p  )  l 舠d 'H0 ꥠH00( 00$ i   *  r pg{ pP ) 0舠400' 00༡ ꥠX0  (   i <* tq 0pg{ p`00)00P 舠D  '  (  0ꥠ    xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ*#** -LM0p@ LP ϭ00 00B S0`Ba0B\W`BA0B0S7`B R Q\S P Q'|000000000000|00U0P:0`d00c0CV0`ąrppp0d0C0pp -LM 0@Q`pPT*.X0 R0""00 0PT:400  0 SP:00) \ 0-0L M P4 Zx00 p@, S0(0 $@ N0 0 P I4K0 0 ?$$0  B 嚫hd* Gx* X* 0-0L M @RP0 R|0 4 #l00 , 0(0 $P 0 0 @ 4K0 0 0\* hd* -@L^PF0T$p`0@έp  0St0t 0$&bRB`0` @* P  % 0 04* @* |* 8* - ML` Vp0 q郝pD@0 !%10@ 0@* <* -#LTM0,0 3 p RpW W Wp3PUP 0SM X`<0C>S񟗰7,8d6,8,87,8,8,8,8777,87,8,8,87,8,8,87,8,8,8,8,87,87,8,8,8,8,8,87,8,8,8,8778,8 8,8,8,88,8,8,88,8,8,8,8,8$8,8D8000P 0SpWB0S2  1 P@01p& 1  @1^+ 00t1& <1UpP@1P ,0S \,(P0041,A:0 1011 10`0`000000@`@d `DPgP2l`K? pPPp){ꛬ| p* t* <* 4* 0* @* * ȞԞd* h* \* `* l* $ p-!LM>t0> `0\@P 0S?*\0S@c$1 R U  㨫U$F% 0 %b0P 1* 0P:0 R V 0S`pH&3@PP PR0 `00 P0d 0 D* d* 4* <* t* * 0@S P-L @ <0!RF 0q PRQ @`@` 0 R0!0  B8# 010 g!0`BQc R0̪`hᠩP`VP@@`@PP<* t* 0-0L @R& 0P$ t* TP|0 RU l0 RU0 ㎪@<P 000* X* p* 8 -1L@PT`r1 RO 1 b Qf1 QE!1PC P? 020Cp5:#:32"!01H*0@!0!HVSV00T0S 1 R f.yPp TV T 1 !ᨛ.:#:S0JS `0 VR:DV0JS 8rX* 0* L4* 8* l<* `* t* ȟPh0 R` \0 RP0 b QD @0 Q40 !RJL0* LX* 4* 8* <* l -LMT@0PS HH0  B0Q0  00鲪,* $x*  p-LM`0PS@$00 S00 0CR@0` T00PQ00Sp2ꀪpzx* 4* l*  p-LMl`0hPS@0X0T S0 phm0 0CR0pphUSx* D* -pL0@S`+P0 0S0T 0 0CR@0l T00Q00S@!kQx* P* l*  -L` PpO :36021V 0RP!*FPPe VY0`0@0@0001300p .P?@\ " @0d!ST 21 @!T 0U 0'6cQ 10 QX@ڤ21 Ln!@X @*02&60 ` p4* <* -RLMP@ R oY:#:S#0 `1dßS \3 RL3 R@#0S $301 3 RcP P0 0Q=0 0@0pW R 0Rb 0R Y o;.0S0 00 0DŸ0@2  FbT` !0 `V0D0 0@S *P p 0@S*pW R @0  0@00 0S R Q0 @00@00p00P0pW  0Z0 P0 0p@pyc e Z 7E ᤧ< 0`$0 1S +8`ȟ<* t* h* d* * D* |* 8* 4* x p-LM0<@0C*"*2dR!0`36\|1 RV \Q \0&H  04 R% 0R p R 0S 0 0 a01 R PUphIG  R \ 0S * R 0S  0S: @pphꔟt* <* 4*  -LM\t0p Rd0`V @@TJQ 0PES@TZ`mV9t @ - LM0S!P0,0 % 0( 00 ,K0pK` @ 0``p@ PUU00 0`0` p-0LTMP`XK <@KhK0 0h0 H0XK< Kc4@0 dK`0 \0 d0 f뼃;s̠ p-@LMP` 0P@0@T0PJX @TXPZp* -0LM R% @00SJ R 0SXZP @ P000H      00 4 D  | p -LM#L@0cP0S @0cP0SPږpxԫ -L$ 0 N|  -L0M0 @00 R/|OOOOP PXPdPpP|PPPPPPPPPPPQQ Q,Q8QDQPQ\QdQpQQQ0 (0 $ (K, K00KGp, 90 0KPd 0 K0 (0 $ (K, K00K"p ,0S  0 0 0 0 0 0 0 0 0$0 (0 0 0(0 0 0 0 0 0 0 0 0 0 0 00! 0(0 $ 0= (0 $ z M-L@M@ 0p`P{ 0 p`dPPk 0`0`KX0塵0S   0nJ R 4 40  1@ 0 (@\`$@TpPb`8@ X0pX L H T` Pp IXKHP* <0 0PS` 00G0 @d@ h PI 0d Kp@@ 00E00UbX_0 D0D֒ ,0$@(ϒ 00,00~f|  M0-LM00 0 PS0`" -LM,ş `,  (q 0  0  5 $0 K0 0 0 8K 匠K┐K80P800X0K00 P  0P   P 00 0 X 0vP0S0S 3`0K KP L 娴 32a/@#b! P pj `@? B7c011N0 d 0!T 0 L0L " 4 \/u4 4 4 4 4 Eن4 4 ^00P 0-0PL,84@0, ,ڕB@0S0( | | h| H -0PL4,ŕ0`Sp- S  0@W0 0 R@ 0T0\ 0S 0S0S0S ^Pp 0@W0 0 R@ 0TP 0P( | -AMLM,48 <#h0V,0 4  P`F&B~KpGpG 00PSPq@n ZH00$H T00S4P 0S`F00 ,0S $,5P -AMLM,$p(. , "h  V, 4  P 0 ,0S , P`F%BKHH 040PSP@H $H( 0"(lP0P`F Ṣ -LMH L p ,0, ɔ H` Z 0!d2 L2  S <\t" h l | p 0Px xD R" P  P |2x.X0S @㒟KoK%KK  0@P񟗢(00)TQ t"R$ 0Tȟp2 0 S@0 S 4XD"0S 0@S D2 咕P|00D"rPOK?K@DuH2L42  70 K0C  0C P`  Rh 0H|T 0B|< 0;|$ 04|  0-|0 '|00 |00 |00R  yp( | 4@LXdpȨ5(,048 V -ML MȀB^Kp PE@0 $ P`0 K R0. CR 00$0 S <$0R5 -<0, -LMP ` @`d pW0pP0 0S.S Q `070Dy -LAMlpANK @Dd@DP0 P` - 0 S  H -ML,M?`0p,, 刍0P@p? UKH|ϟH  0P` P- `08# `08#H `K { `!` 8KKR0`    :K #-`!R    -  -0JeSiԴ$Լ\@X\@Լ@h0hLHHT( T& *K `00CS00  ä0:K0K c R  0l,`D< ,0S H ,  MK(@D@D oK\ KQ `P@ Ƞ,Ƞ 0`],  `U,0  CR T00  P` 0  CR >00  P` 0 zy ` (,r @f`0 ,h @\`0 ,^ @R`0  ,T @H 0``,]0Ri 0Rc KQMMK(@D@D }n" *K0` @l 0+@ V*P X 0 * +0  CR 00H@P V:0) CR 00 0R 0 R y0  CR 00  P`0R 0  CR t00KV*"0 CR _00@T 00V0#02SP"0" CR 00V*0  CR 00V:0R 0R `75P 0\ CR 000 CR 00V0#03PEU00S0R P 0R 0R"| 0Rv 0  CR 00  cP`i 0 V0R]  0xK @T 00V0#02SP0" 4P 0\ CR 000 CR 00V0#03PEU00S0R P 0R 0 x:K0@T 00V0#02SPX0" CR L00V*@T  Z0 llx# 0\gxH 0axTVP*f4P 0\ CR 000 CR 00V0#03PEU00Su0R P 0R 0R H14P 0\ CR 000 CR 00V0#03PEU00S0R P 0R} R ("(`*m:K   )K `T;  ` $) X)@JT 0 )' K  P )` S` ) K` ) ("(l`)  K K(HH `D1 OPU@? 0% 0 CR 00PU 0{wTz ` 0pw0 R \ew( | | T\ĩܩ $08<@DhlC̪Ԫܪ0  CR A00 (`"(t?) ;):KK0 (HH0) f0 PU@? 0 0 CR 00PU0 R \{v0RsH ("(p`(\ K.0D  (K`JWK  (>(`P$`@ XH%X$H Ƞ,Ƞ0 `(4`@ H0$H8 `#8h(@t 0`(@ 0`(@0 `( 0  CR 00(:K0`0RK\< (` p-LM0@S`PU00paP @0SU00p -LM@\ 0Q 0S04 0ET$00T00  5 -LM0@S 0Q 0S00 ,ET 00T00 5  4  @P-L@ P P P 0( EP P P P  P P| Ppl P  PTPHD@<45 x ,4<DP$Xd -PLMw a0(⢢ 0 "j@0ࢂ"h0@!#RU0pQ@ 1W!(03E(PHPF`U W 00 V>*D1DU @f 00 0@   @5 د -QL MP`@3ȁ0,0K ,[+K!1* K00K+ [*[0p[ 3""" 1??W/ K.0K-KPEW/ [?RT.[?QQ-[?PN ZJ0 0@ @U@@U4 0S *0K+0K,0K*,K00 R:,[+[ 100K* [0[0"#!!?\/K. K/ [?R.[?P0 SXU 0 0@0 =0@0@=00@ T*002د -@PL`P p20  00S6 P=P UUP p0 0  R P=PP Pp00 Q PV 0S=P q,P U񟗽t V X*0g10PV  \*0 gB2"0 PV  \*0 gB1#0 PV X*0 g00PدG-@ 0SPPRp 0 SZ0h0? 4@ 3 #T #R p0`W RZh0 0 ^ ^*.000S*0 RpJ\`0.\0 \\ T* RZS*` -SL M, p`   Z 0 S 0S@TP) Z 0E  0 pP020S 0CX03`505 `.T$ \T V*@@T0bST 0@>S TV*00, bZ00`F@T@Q*@$?#<-"-0 0c`0, bP *0S  P*0SPlR Pp4 0 0  RP 00ӑ -RL M00 , *,p `PU 0 S0? 4` PU0S 00X: iPUJ0.S \S@TpPUZPU0S .U 0@- .R .R .^ABa0B" Q00.Q^APBa@BABa0B UT00B SQ 00\S0@B-R T0\S0B ^0*S 0.S S0S !0B]S.R000Q\R R.R0S !0C]S0S0 0   < 00 , 0 ( Ġ P 0000ӑ 0-0 L@ P  RoP $0bPP00C0P0P 00 U00S jqP 0 aqP꤫ 0 000@ S7@00 -PLp\` V * +\00.\P \ V:/\ \|0 0 P \ 00ӑ|0 0 DP @\ \` 00ӑ|0 0 DP B0`p R@-@@ P^0#2 S007000 0 S00700 \.00´\ 005 P 0000ӑ 0-LM0P [[@[0[ P@P=08 H -PLM@  Th7/00h -L M⠠p@P8`K0 (P Pp"=P030#P0S  {) (0S $(黪00дܴ -LdM0p ,  |0 x0 t0 p0 l0 h0 d0 `0 @`P|K 0D0c!1@#T!pP@1SuP``@Tu w Vpw Xp.K\0K S\`K@*wB T@0T=T4 V0#03@T00Sw 0S 0 S*\ K0b@S@\K (L1 ,0S 8,>00 R*:00` R:0305`1:T  R*:00`T Pf1 k<PP`WX Xh h0R f P a`uw w VpPot -MLM 0, , ~0, ~ 0S    000S0005 =0004  0oY/0`000 `n`8 g(P Pe  Z(< (K K AVPPJ ; @REnK`F`F o4@@# ;P@(K R  P&l+(K0 S S Q0P S S \ \ \00\``V`@,(P`d  `P1*(K0 S S+Pn/Y 0 SS S S ,S PPP 0bSyS fS P 0bSyS fS|z (PW)(K0 S SQPk0P S S \ \ \00\@@TY`p,' 'P@`0DpSPH` \ V!* \00 \PYP\ V: P P P 0S S S 0 0 Pyt((K0 S SsPp 0 P S S \ \ PP P 0  r0 0  R0SFKL LL@K '50t | x :G.K B0 B0C P0S  R4 |n4 R 2 P X4dn,| JP&(K0 S SP ^ʌ1114  \ \ \ \ 0 SSz ;S`w 0 S &P ;Q Qq5  0P G~KpG pG  4PF 414 @4 h1&PH`4  Q;Q Qq00  RP  P4 l1 $004h1 0l!$  $  ^@hl\@K wP00ώO`  Q;Q Qq00  RP &Y  ! /P P PP0`30E R@$4 $0$$ 4 p .P( kP#(K0 S SY?Q    " >``0S= ^`0` D HSDH`P 0.\@SPpVP *T.@D%PPV:00LP0:0 000 ,0S ,7PP vENK@D@DP.%PP ,`%7PP: `@,%`0d SD@PH`☔ \V!* R R00 R0SY $ P\ V: P P P P 0S S S S000( | | h| _` $O 0,A08DPT -0LMP0,\{0pSD Y@ S S@0TP S S  ~P`3$K P$Q |H1  00P0S0 ^00 0 0 00T R R R @0TP R R R0S CP  =P0:0t 3P0; X +P0; < #P01( | `$XDP<4<("4 <1QS0  0-L@PP@ T0 0-LM@ P K 0K  P @@jp0 -LMKPA-M `p |20  00S3 0\ Pt A\ |0  0  R#0CU\|0  0 D R |0  0   Ra NA N.\ 0V54:Ѝ\ \| 10  00S 0hC10S $ P^*0S쎑W <4<("4.<0^* R0S8<^P0S R8<4X\x\PP P-L \hB&/00h -LMP@`T,`K,pK #P 010jP VX`@TX ,K k0V0.T00S` X ꤵ -"L$M0K 0CPcT RL K0 A ,P@)t W~ { 0  `P`K> @>K 0C1Kc@@2AlA H D< L @L }CKPќ07S  K A 0P@07S  0\KclA18 A 4< 0 < NCmQ T00%Q00S  `@Dvr `W!X< .PPD@`PeX R 0AN 0 .P PJ `81 K@@  0| P PJ ` 1 K@@k#@  ظhdP4L  -LM0@s O0000 -LtMp0|@ $0 " 0jP`KS  $0S $pth KPK叀K OpPOPrp U|4D -PLM@R  ?  000 -LM@UO 0 0 0P0 -LMB -LMp@`P0T@$K P,0 P00g Z@d= -LLMd`\, Pp 0%S U 000S ,0 S ,bpzW(P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&(P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&P&(()0)&L)*T)\)P&P&P&)P&&P&P&))))*)**4*P&P&P&P&P&P&`*,x***P&*,P&,,,,,P&,P&--X-`-t-|---.`Fmşp 0RPg0S1| 0 Sş105v `p 0p`p 0H 85Ϡ l0BP  @ N 0C` R   00b0 B`xv  0L(P 0S \4 0S$1`$p0 p 0PR v  l Rg#>/2b11^3b11^ZCl| ` !$0/C!b?@1c!bb1cA0c0cs00\?\N0S 22a11^3a11^[ό[ό 0a Ba4P P 0VS? gS}\2T`p 0N000 S50S ,B P៕  1Ϡ%0 Sň!ըŤ dK8@KdK !0 &,tlP`P 0h hK hP\ph 0\!p00 v 0?2c11@ 0S$@T @dfPϠ0Bl4? 2cc1D1PQD*8$InmLmwM.Ȼ -LMTp,@KP` 0  + & 0S 0л -LMTp,@KP` 0  +  0S ػQ *0S0 Q*0S00 S0 R@-` 0R00 m̀   0P1PP0Pmͅ@p@  011 P!8  -#ML M$0PP,0 `  P 0:S /S .P PU 0:S0/S tW pP@mP@@ T*BNK@D@D+k+ + .WPP ?QPE\p@ #\K(PE PE`#F LPkhe 0a$0](0Y 2R,p\ \^2^P2P ZZ0Y0 YQ001001 0 e b 0R|Q @)Xp@X 0 0 QcX X`@pL0SP7T0T7 @SN XX 0X0 `1QuM@p0Xp@ X ZX 0SX7 X X  Y\ 0S\70X l0 ,0S t, XPU/xP8P0LrL`h00S0 C,S R-S+SP@-@  00L S 100C^00L S^ 0-LMPK@ 0P 02c2c20 :R 0 ;0P 0 2c! 0:S<0 P0 00 0-0P-SL@P +SP  U0 0c00 -LM0@JS: MS 00C S00 0P 0/S00    00  0qP 0.S 0fP 0.S 0 0 00 m E-P@p "22a11\3a11\p0Sl S  W02c2cZ@]E ;RPS J^P WXa  102c2c^S,! 1?0c0AZ1`L ` !Ϡl  B 111F/N!b  !@!A! B 0C`aR0B S B^ W 00T` 010S^ 02c2cS002c2cSQ*gfff$I -RLDMP\ `  Nd4\@ R !`0@d T0 DmP00 `R&T00c  L7PTdY 00 0 0 SmM @ \d Y0@ ``@ m` @bY0S,S ;S XKP@ 0V0R00SC ;Q,QM Q@Q` 0011P'RL7`c \\%0011P'R\\tr01u.00\'RT0 0f  P'L7R`c\T0X d0c bL7`'0 Td7 Phu@<KkP@ 0,SPKbP@ ^|d0TX]~0ph al0 0`p LP7`Tdh 0 < KhX0@ hP KT0@000@000 0`"`!!Z1Z0 !h0 "b"b3h0 x0ZTT0>CX0 A\@aQd %0S" TKP@xQD -@LM$N0S h -@ 0LS0 008Phw 8 -@LMihiw 0-L%P@8 P0SP. LPP!\ 0m ,TǃPǃLǃ 0hhP 0:S H gP 0 ,00hꔼw v 8  -@LMihiw -LM`\p  0P"P7 S@ u RA @0S@ALx 0 K] P` T70m= 01(0 R0P R0  A8  p-8@LM`PEi] ?ipw -LM(@, 03iP hw 8 p-LM`\@P iP P0S 8i0, 3U$0$0(0p00w w W s -LM@  -LM(@, 0hP hw 8 -@LM w G-p^@EJ1삟@Pu 0`T^PE@Z2 l Bha02c2cSDPzJ2UZE]EU`p2O Ed2d2cREP2Ϡ%H">?lA1c "l1c0c!E S@rB000 D21!/2aB1ca?@4cVP/2b13b1T1T1 !VVPEE0d!"a1@!ba 100h`c@v.D\(0 B0 0`0V0  1`aV 0$ 0Z]U`F~p^p\0up^Nb 0 0R]0 0R@pA T0\QHE.Qų$IQD -Lh -L,M@<K0 Q 0 Q  -@p0T`LPf0c0hf -@p0T`LP|f0c0hsf 0R 0R 0R 0R 0R 0c -LtM0 00TK0SPPK L@K< PhHK Pb@P儀KDK P PYD}PTH^DńP 4^$4\  “Ϡ2l1Q`3l1R1R`3!bH XP/H3^DńPDP#O2d1ap3d1U1UpW 004# 0A0d^ \D H0 0D0 )PH !PT0;Q@0 v>" 0ST Ŝ p00 @ K K  TK@P T@DT00CP0ň0  4C4Ј0 4\;`0 S8 "Y 0@S1P1P}R pRJ0 S @TpG4UZ 0`S1PQPJP7 SK `VPE4UZLǕ0 00n0  TKP` 40R00 ? \0#S K    00:TKPT;0 T0  pPkDP0\  “2a1H`3a1R1R@0!^H PPKTK< xP FlnQDA8 W -LMp@P`\ 0  -MLM 04( S0 0ł>K0C0Cp0 D8 ,(RJ 00S1 P1!88 8( 80QBKL !80Q8(0@ SJBKL@8( 1SA0@(K@1 @( QZ@0S<8 <8.K B8(  0 P1H P'R <(@8 R<( @8XH8( 0>K0C!88!aPǖ\04(D8@X PLLGdUPP P`,8SL'L 0 `bS00 0AW 8  0-4PL@e  Z@e0w A0 0 LdC 0 0FdC@0  R J1u  0Q R@Z8 -LM@K$0c -L M@K$0@K 0 `RA 0 `RS  0 `RS A -LMPpP 0娐 R0⌠0@` QPvΌt   0@D P`"00P@@T +00ꗼt* -LM0H @0$dPH  hw x -P`LV@Gp0S  SP@D RCA 0\R#R! B`0 -L"ɠ2l3c13@"c1MP 1K0  d C -QL\`M 0LK KϠhKT0 `0 X Kh l"h0  -LMp`WRQ,K@T , 0SZ@TzP@6 0 0     0S01@P< P5`P [PP %  p`U  UP +P0 ,000tKPEP fPb0 0^00Tx  -LM@`pPP$K3@T 0S @T P `P $0S 00 0 x -PLpٍ0#S LA xş,0 S l,娻@A?TP0s S <`V `0S@@׸`T%00l4PSl00h$R 0S`V i P `Vh$l~P` l "b0 \0h p hPU 0S1@$`0Q?p$@\@\PH0 IP`h@\ @Gp pP#00l4`S` 0BKßN N8 pß@(K< CK @E>KTP(K@0CP@ 0C4 d 3 P@o 3( K!$(,"( R`*R^ 2Kp2 0 IF>K0C"P pt0,^0S 0t t h wdh$`0 K@P@ @ S$"(0K!48<#8 S*S 0H T H0L P J I@R  LRh@hA  Hp\ 0p4Slap PBNK@D@DhL!L1NPp@) c=pP0#SEKEKALK 0 LAIP4 \ X T maX4P$0P ?hP??p$RhPV0 8< DT|d -LM` @0 0\ `0V -pp`@LTP  P `@T` 0V0000hN< -LM$@0 S  0x -LMPp`P@\ 0,K,jX!0Sp\@T`B,0S ,e,e,eee,eele,ee,e,e,e,e,e,e,e,e( 0/00,(0 $ | p@T` (pP0P (0L 0 (0 CtL$x̿ -Lh\P0Ⱦ -L  hB$ -LM`ZPpP 0 S S 0d  0 0 @0$ @,| e -LhP0 --LM  -LM@$ B$0K K 0   M -@LM 8 x 0-LBP|@ 0S L| 0SPeT 0S \00LS `000B0 -LDM@ d ݵP dصP`} 0Sh 0S0J0@ @@`KoLpP dP00 H XP L T@ fXKP0SVߵXܵ ->P0P0H0STTA 0@81H  `P =P0@ 00儊00p0d  N X%4 40ᒵᐵ  `0X@\M 00c00 00(@,L 00W00oqH|  -LTM` `\ h0 0Qd 0p KLP0|0 pK0 0Rx0  x 00$0L< 4 00hJ   0-LP@P0  P 0S SP 0h0 0-L@PP 0S S 00h0S 0h 0-LM@P0S0P  \02 0| 0-0 0 0LS@P 00S 0S 0S  0S 0hPvuvv v(v000 0 0 0 0 0 0P0 P 0 0 00 0-0LS@P S 00  0S S 000  0 S 000 000 P0-  @ @-0@SC @<4(<"4!<0  -0S C   <4(<"4!<0   0-LM@0 SKCP0 2M<4(<"4!<0  -LM0@SK C < 4 P` K 0S\0SP  R ,3 50S( 0  2" 0 2 2!0 201P  0B00 1P0 5A1@O`DOw_@0S 0 y;P 2 p 0  29 2  29 20S 28 2\\" 0;K 㪢PwPO02 R 20 2D 20 2 0 0 0[ 0 0[ [[[[[@[P[`[p[ۀ[0 0 K0KKKKK@KPK`KpK妀K0 0 0 K 0 0[ [0 [[[[@[P[`[p[[ K0[ K KKKK@KPK`KpK嚀K0K 0R {O0!0S 0[@[)[*[ 0  1K+[, [0C7P #XZ P \*T@KXK 0K/[80[#Ƞ T 0 0 00T [ 0X0  00  X0[0,  0\0 Y [ Z0[0[ [ \0[0 ` ]0[0^ [ _0[0` [  0d0 a [ b0[0c [ d0[0 h e0[0f [ g0[0h [ \:\*D@KHK 12K-[0.[8#Ƞ D 0 0 00D [ 0H0  00  H0[0  0L0 I [ J0[0K [ L0[0 P M0[0N [ O0[0P [ \: -LTM 2E Q !t 0B 7R#h R9 0 \0 Y0[h x0 e0[` l0 f0[d Z [[[\[][^[bp[c[d[p0 _@[x0`P[a`[0 @P` p l  p0 0t h["K1g [3K-[.[/[00[ 0P*DPKH@K 0! 0D0 00 0 D[8 #H 00  00H [ ,  0L0 I [ J0[0K [ L0[0 P M0[0N [ O0[0P [  0T0 Q [ R0[0S [ T0[0 X U0[0V [ W0[0X [ 1P2K+ [ ,0[0:!t hPe*4PK8@K1 4   0 04 [ 080  00  80[0  0<0 9 [ :0[0; [ <0[0 @ =0[0> [ ?0[0@ [ 1P2K)0[0* [ :p@-0 M0  0@P`0 @P`0 0 0   000 0 0 00 0 000 0 0Ѝp -LLMP, \\0 + 2$\Q :Q Bx004 ,0S |,w?0 R d Pw? R\^ 1SX@K P` \` Q`崐 X0S 2   0p@z  00 0p l0Rc:0L7#(Y@!S: g0!1 @ @dI0 @I(0 0S. 1S 0S10C00CY{?   88\ Q 20 2{` 0 6!010SY{?㳐  0R1 S0"1!@ i EId 0RP H 7BX0S{  797X@K 0YP` VN W7P`ḑY@@K  5p 4K 0 T P0 I0LK 0KL0 HPw? dRTKd @@K 5p <0K D H0 H08KLK L0 Hd0D0HKd0 (00S#w0  700 -LMPp@  6P`E {000   ` Q:1S 0S @T P@A W7@P0000S0@0 0CR P0 0  0  p-LMP`@QR 2KTD T=`09    p6P  10C0S! 0H@10C0  P  R PT 20 2 T  6K Pov 00@ev 0 600 -LM0 @`4 400 80 68, KPr @4 0R] Yk  6p,1P CSP! U 6 P@R 10C00CPp6 0 8!#ᴠ101pGw 0!0P0P01 01s6 5PpG@ w d6  5P@ 4 0R T64  500PR  A68, KaP 40@ 0S Y  .6p,1P CSP! U 5P@ 0 Sp6 0C 8!#ᴠ101pGw 0!0P 6 u5PpG@ 1!0C0P0C8!#ᴠ1w01 5  Z5P@ 4 0R -0L MP00 , KP@n , R`c 0 0S S 2 0 ?0N\* P 0N\ L\ 10C0FP  5Y  Z 0pp 0 CS  v510C3<P f5 a5]500#0\ -, L M`, 0 10 S0C@@1T,  4PP ሐq@0g10C0S10S yPj3P 01v?0 1  5,0 R ,^P@ @,K3P 50 0p a0F0H!8#8 S! 0C8 R#8 1S!0B0h88C#8 0C R80#8!0B1 2p 4  -L(p \`W 0!@0I  2p6 0 0P aE88C!# 0 Q! 0A8R# 1 Q!0B0h88C# 0AR80#! B!(0 0S  0S1S0C1ǁ t2p 0 ^\P  -LM@ ` pP X Uq10C00CU^:UQ@10C00CU Y0p RK 000 0K0PQ 3P 00 K0 2K{P 000  400 2[0  3 h3P 0 10C00C0 K2KTP00  300 K2K0p DP0000E0 K2K0p 7P000K 00p RK P p 0-0 S@LP0 S003P0 003 3P 0 003 -LMP`Q@>0DS5pppp(0#(pK0 .P@  (0 g=rυ @I 2@ (00 ( I3(pK mr0 0 :300 p-LM0C`PS1000S 0Sr0 0p 0K @ 2P 10C  10@200 2 @ e2P 10C 0  10@210C00C -LM@0P0`  $0KO :2P+ V+ V p0 00@@pW0G 8#x@ 2T 2P10C00C0`p!08#x BW@ 2T  1Pp -L M0  @, P`` @TS 2  0@ p0 Q%8 8P  O20 RQ 0R  ?2 1Pp 10C00 0B0 ,P   R  !20 0 0S  2 10CR 0 pP 2U r1Pp@ p-LM0@S`P( ` ( (0Q0(0p錜00 0 -,0L Mp1@, 0  F1Pb 10C7#H P00 8,#h+0 DP8(C X#8#H 0Z0J8#h `00!`101 @1 2 Z0S10CZ 0 00张0S , 00P , 008P 0 0 0 0 -LMP@` p00S$ K$0  02KP  G1 K 0 $;1 -LMP@` p00S$ K$0  10C00C2KP  1 K 0 $ 1 -LMR`Pp @  ]Y 2   0 0Q PM[P/ 00 B0 0 Z: 0*Y 2   0Q P:P 000  A0 邛  00 000 4.P0 j  '.P00 p-L M@\P 70S4 0p 00   0 0 `K p `KQ r?sτ -P1 0  p0 0  0 0 `K 0@-@T010!0Cs 0C\sd b0@-P@U1!L| 0LR|T!200P@-@p `0S0S=S 0S=S PdP U 0S  0R^ 0S ^0=S P00cC10z -LMK -LM0K *P - LMK0P -LM 0@P@ -LM 0@P@ -QRLtMp` 0@S 0S@b@DT*o00 0P0XR00S @(@D  0IZS&lH\\\\\\\\\Td<px.(K0S 0(K0((  00A SPڅ 10 A0 R0PC$^ 2PSP1$2 $20P 02 02$"S 0c$" 02 i(( e Pb\ PR \$ $2002 Pb K T/K!>K  + >(K *Y 00I SP100PC0 I R$Y 0U@@2 2PR SK T/K!>K   00A SPڅ 10 A0 R0PC$^ 2PSP1$2 $2PP  0U@@$" PB\ PR \$ $2PPB K T/K!>K E (20(2 P100PC0 I R$Y0R (( ( s $2` $" VfT(DB ( D 00\0S,K% Q: &:Q 8O#`>(K DVRH H ("H20H2 (@"0HPaUU&0 !1 0RPEK1 ! pUʀ6(!1 0R1 ! p>(K R b?K 0C0 10Q1  pʀTo DPfUUgE00@!1 0RPEK1 ! pRU0!1 0R1 ! p?(" n`!1 0R1 ! p\(" 0"H2PcUUş00!1 0RPEK1 ! p=U!!1 0R1 ! +,02H"R1, S0~K1 K]P P ?KP @0 2 ,0@,0 S ,峘K?P ;P~K K4P~KeYT K- $PQ3@!1 0R1 ! p>"2R( @4!1 0R1 ! p$2PCUoUC00@!1 0RPEK1 ! pU0!1 0PP~K BKP~KKP{~K"R2RS20!1 0R1 ! p>2P`UU6A00@!1 0RPEK1 ! p!U0!1 0R1 ! p(2 l1 0 1Q01  KP0~KP~K )AKP"~K20!1 0R1 ! p!ʰ0 0 10Q1  p K 0C0K@!1 0KPP~KKIP~KRDyn$EHO 0@!1 0R1 ! pL@4" !1 0R1 ! p92PcUU1ڔ@00@!1 0RPEK1 ! pU0!1 0R1 ! p 201"0Q`KP~KP~K \AKP~KKP~K2Sgڤ1. (K yK0 !1 0R1 ! pN Kz/O P 20C01"00CQ1  p e?K0@!1 R0 KPC~K2PCUUڤB00@!1 0RPEK1 ! p U0!1 0R1 ! {P~K $CKrP~K(00! 1R0K_P~KZP~K C0H P`UU'C00@!1 0RPEK1 ! pU0!1 0R1 ! plK.P~Ke)P~K lDK P~KU(R yK00$0(0K0 !1 0R1 ! @KP~K(P~K %L >&B`Ph( K0h`C1!`P0h(" 00S00 0hV0 0h0 Q`PV P00 U- >(K Pu`(2(" ("  2PSP 1$2 $2 PoP $ w("@ 2PSP 1P $2 $2Po 2SP"1$2 $2$ P20P2 Po$ W((( ("  $2`0$2  >(K F( 2PSP1$2 $2 P P` $" (2 ("  2PSP 1$2 $2 P`P $ ("@ 2PSP 1P $2 $2P` 2SP"1$2 $2$ P20P2 P`$ (( (  $2` $" (2(" ("  2PSP 1$2 $2 P`P $ ("@ 2PSP 1P $2 $2P` 2SP"1$2 $2$ P20P2 P`$ p L ("  $2`0$2 (000S(" (" [( 2PSP1$2 $2 P P` $" (2 ("  2PSP 1$2 $2 P`P $ ("@ 2PSP 1P $2 $2P` 2SP"1$2 $2$ P20P2 P`$ 2PSPbK 1$2 $2` P $"  >(K ct@ GYgYT@(y 2SP"1 -K$2 $2$P20P2 $ -K6P K/ yăP- >(K `7 -K4P㘃(2bKL -K<KK (2 GYgY|\ggYEeeY"fY \ ( ``2(K R- >(K \0l``\`T `( 0`L eK  2@ S``(2 2 KSP1P$2 $2P $ (@l\("  (20(" s(  2PSP"1$2 $2,2P /$20$2 3( 2PSP,1$2 $2 P $2 "(@ 2 KSPP1$2 $2$ P20P2 $ ( (  2SP"1 $2$ P2,0P2 $ $2 2S P1 2tSP(1x$2 $2 L P`P" 0P" $2 ( ( [R 2PSP1$2 $2$"80X TP $"  +P `hV`w`(BL NY bK >(K`1S01 KP ("+CKP~K0Sw  $"e 00 -LI,M4PK, < `@0 @8P 4K3K2K1K0K/K.K-KQ %Q Q %QQ p @ 0AZS((((((((x(@(((((((((((4(((((`((l(((((l((((((((((((8h8((t(p(p(((` 00B SPԅ100C0 A R$Q <0Z80 X 8K<K<0D P80 @ X  Dp8K<K*Q 00A Sh00A Sc 00B SPԅ100C0 A R$Q<0H P80 @ X  HB8K<K` <100C0 A R$Q 2/p  <0Z 80 X 8K<K@ .  <0Z 8K<K3 <0Z 8K<K(@ <0Z80 X 8K<K<0Z 8K<K<0Z 8K<K pp  <0Z 8K<K@ <0Z 8K<K<0Z 8K<K<0Z 8K<K <0Z 8K<K<0Z }8K<K @p lR p p  <0Z h8K<K <0Z ]8K<K@ <0Z R8K<K  <0Z G8K<K  <0Z <8K<K<0Z 38K<Kz<0Z *8K<Kq <0Z 8K<Kf |A  O \ <0Z 8K<KTQ"X:P8 0a80S`P^ 4PK^ @ 9080 l0 ,0S \,@`@ 40 P@0( { -LM`PQp0 @ 0 ( @4@9@  b7p( _ -LM @`PfT40 p ETeTpG/  P090 ,K0K0RtgTGTp400  fT@ I P0@ 0 R*00SC 00 0:0 g 00S 0@8 a P0h0-0`P -LNMp0Q 0 P-0 +0a0ŵ0ť \00 K0 ` l@,/C!bL0 Rn000n^*0^0: 0eR  _gfff 0-L@!0RP0L1 0 000U 0Hz P 10Hz -`Lp@P8#8S"!"81 ("((^ XU 0V1`P` !@ O(p -Lp B/ bR@P`0ڃ0Rʙ V0P0 P @@ 0 BPU@UPe 0 BPU98 88S00000P0   0"108#8S2 "$"""!    -LM@;00@ -LMp`PW, `pP 00 R"0 0!@0 < 0@ , R40 @*004 T:aPX8` 4P @9*0h&hV 4@ p(8#8"(2, !#, T x:p0#h 4@ pP %82! 8"(#8P2! T, x:80X:0 @0R<  0>S000CS00 0>S 00, 0, -LMPp&EQ @T` P 0`S @c0`\0p0J@`0 1pz q8 -LM0b 0PUp@ڂ Ul R0  R00@ d 040 Q2 :RP 0E0e0Q0: P!0 <01R\3# -L@PP`9 @P``!p0@P `a(8#8"(0b! aL8U0CȠ: T * 8#8 "(L8 T0CȠ:0>S0>pGS p00`@-@0!"** B\0l Cʠ\7SL l0\20 -0pQ`5L@B 0` P0U 5 \ lU2><``6> U ` 6> 2.0 -L MP@4Q6%z00 600 T`,@ ' ,KP0 ,0 `100 ,02 0 000S  @0 W 0C>C5 `0C0 C>@0C!0B@`@0K00 0 @ -L MP$K`@0(Kp{ 0$KP N0bŒ\0 :C -L\M8 4 04ޏxCPLP PP T T0  q0 0  RT  T 0-S +ST T 0 S/ 0Sw T0`/RX0 p9R 10W0C10W0`CT@p /RT@ 9RRHp  @EReR@@ 8L04T  T @04  +RT0  -R 00B S4T #0R 10BST0B0 /RT0 9R T@10 0C/RT@ 9RT@!0aPS^@ ` @ W @@ @lH@@ \W  H D > ZD0 SD@00 HLR+ VP@ 0 Wl aD@@0dPU 0 1PV MU-^"00p0lP dwhupslqto8QT  P0 SNH||@??ER$ U@ L`@P 0 U`ʄ5I1 0 a&j0jV0Vἐ5XH 0`l l l0h  ! $ , K00K^d @@p T@,`l0L! 0P`PCP`P`^CN@6@lpP`U࠱ࠡ^ࠡ^pn`nPnQpdp @dd@ VdGd Zh h Uh;h Wp5p hdt 0< 0pcP tpM/O P@P).O ZP@<p`Pp`zP/O p`*3 Z] Z/O pP3.O 6 <p`\p` x0  0 a&jjZ dhhfpdtb< 0 P@<PX46S / FP/ 0P - 7P`K5I /0  0 1#:x":S5h2\ R `@t<\ O0p`qX46S X N0ndYc]l"0y\0zi/ P . P@CF[O0<0S, 4`!6S \ <@T 0 aJ/ P@PH  0 =>x1#::646SX1#::C (< R%X#46Stpt 4P5?55?5???|AMPe ,  3P@ ERUlU@ p`@P 0 U`ʨ 1 K 0 `K O P`` K@K0 0 .O P@P5 P@P Pg@0QtA 0 @ n@ 0 @A 0 @qt@  L }/O P@[/O {BL  40T0 T 0RT T@ T@ TW T 20R) 10BS0BT PX QP U EW !p₠1W`^W 1p⃠W1Ѓ`PT0 T0 00B STP 0RT 0B Q@L@ T0 0ST S}0T@P T@ q -LM, 0 0 S0 J 1P,  4 pf/P8P - ` 8#8!"(!82$8!#80a("(40 (bA(U $Bh0SpG W 0SpG WJ0S , 0,P1`8P 8#8!( 8 H!#80a("(40,(bA(U $Bh 1 pRpG W 0SpG WJ0S ,  -LlM4 \80 p`@W00qdz01#:H":S !. P  002Q0 0000K, K0':ც᪪Zp T K J%00ƂJ0 KZ/ l c . t W/ I P@ JR/ j 0 = i P PP QX 0 PP00CP0 X 0j@SP0S@dB C`@ U< U<@ E` ES`@ d0 ` 4 ^ࠃ^4 N4 40P\ PS%))48\8<8d8?aCoc?`(?yPD?nDz @z  PR b-  \ 1<20 0 \ ?\"00 0QS@-@0c  \1<0   \ ?\0 @0 @\ PT0 0 -RLM@8"x8S,0 `x)hȠ,Ƞ*H&$!PQ # 3(!( '#P020cY ! C2R `0 !8,0S&hhT)` 0 Q 2RhF0P13P1 <2 @-(0(   8*T\P ;;( ;S0 0P0 -LM`PP0@ KpD0 K04 4K00M00Ѝ -LM@Pp`EUW 00-_u@T0-`P\9p T0 R @  S$0 -LM`PpP%J6 K`P`,K0 0K00CM-00!OO$P`0"&pЍ -LM`Pp, H0P`pY ,0 p-LM`P@@@`@p -1LM0S``V$ P@pSS PpR SN $8?S @ U=|:JUT!0000à@T  RP;?$ $  u00Q0SpJe\0 \03  0<$0 00P@ $0P0?45WCpSppX\P p-LM`P@l@P@` ph -LMPP@`pW P `034 `RE0E0BUPU0H @0`043P 0 00` -LMdß@TXp, 00 ` T W 0^0T3("S*2V ,P0;,P02S|5P3 T T00W00ST00W\ /O0`PP#>`P`P`0O/ <`PP`V%^!000P 0\P2 000 ,P 00 0O/O0`*0`@0@ P` 0``!v00Q0 S  P (1U:  |0#03  ,K0f0K "Y` ^X,P0W T ,P0^,P0T^,P0{0^0TDX\P -RL@M@p $0 0 $ ` `AG P@U0e $ e0(0 21%$ `e( $0 K(K$K$P0 P O4  b p-PL Mp_@@` P0Q S0 U UJA>`o0OoPJ0P` P 0 `p0`S  0 S43"?S04# 0 0 p-;PLMDUEoJP V 0T0U00S pp~UPD 000p5 D" 0a4000V`p\ -;L,M\< 8 * \PoO 0^8K< K`P80C8 <=PoOoPJ  0P` P`PD @ `Po4KO0^`P,0P`$+`P -;L`p45gSM 3^@$P 0 )V! W2 0 KN0^0 ^0n03  1>0$0 2 A$0 AB B0Q0UzW V2$0 n$Q0 Q03  01$0 0P0S;V V ?"0!P -;LˠP` 45fMà3^@p $0 $U V1$0 N$^0 ^0n03  1>$0 0$0 cAH0Q0\U UP` S:\: 0S00 lp'V U Kn<Q0 Q 03  010$0 1$0 0P0S ";XϠ\  Ϡ\  y -;@T;LM/UT`ᠯ", (@ 4P 0 H X9 T^(K, KV0X4P 0K4 KM0,4sL'h$H X!1"4 R0#038"8(!,6.(0\ ! 2\ 0C QCR ,p 5U`; i^0U0X00S; -;PD;LM0/EU"4 0P ,@ (0 h Sb ST P ?45(K, K0PU4P0K4 K0P,0454( S b4 ࠑ}~ ,0 4 p?0S`,Ƞ,Ƞ(XB[ 4!Q0#038!8 5"40P 20bP  CR`P`  0P0!02S `FT ^S ;T -;0LMS@ ;0S P  00 45S P{P c45S;0 S-L# ;0S ?S S 00 P *S S 45S 345S;0 S-L# ;0S ?S S0 0000P *S S 45S 45S -!:**@LAB14LM\?@(0R\0l0&03  T`PT P TQx 000T`0R@L0R000 000 l>"0  \ -p`':@ナ7DL⨊ MXO<0KP  @KX@0H1@0 A@ 0?48@K5 0 ( -LP@K4MH)JJp,jP@ 冪 #T # 3(l0 $(h0.%pH(N.l # R2^P2t 3#S#3t@p#8$0 (, PP@2`3`#\ # 3(t0,( Ƞ##!@ Q020S ! 24`h@^ ! 2ldxY00RKAH D L0 *L`H0DK HKLK0D @T0 0` 0O/ l0T Y 00` 0O` -LP@KlM`K PP<,JXJ@ ,Jᄪ@|40 X%X "| t #[,Hs[2,.\0#03^#38,8 Ƞ&.x 8 "# V2R02 3#h00c bVQ0C2Y0C2S`h0 fh  00|00|0 H0 DK|D 0HKLK>L`dD H0h`Pxt@030# 3# h \|L| h|H ph0l@ 3 #030#0SPLh P DP t ` 0/O PP@Z ` 0O/A?O`PP` -p(  LMP`P' &:::S@ W @0 O00X64460 PP 20460@ -p(  LMP`P3 &:::S@$ ?S@ S@0 O00W VUS S X64460 0460@ -p(  LMP`P3 &:::S@$ ?S@ S @0 O00W VUS S X64460 0460@Q0 0aQ03000100P0R b0@- @P 1<\0 0 ?\4 00-b1R"  @-Sc@#0 401  00S20@-  3#@3@# 0  0bQ@2c0 0@-Pc0 @R#3 e d \@2 n0Q@20p@-X h%X ! $ T#3 Ƞ$ȌH.@!Q2pG-(!X  "(!& ' V#3W#3 Ƞ&Ȍh$a*'x%p,Z@2\P2 3 #P$ PG-ȠM!h,Ƞ !#8() X#3 Ƞ"( X(ȌPA*% ᑌ,Z@#@3H*H F' ᙡ&,QP2 Vp2` P@3@#\#3P, Ƞ%".p RP2 3#^#3@ .,$<0\@2@PTP28 40@0 PЍQPP  :Q00SP  :Q0#02SQP@-0 !-0S! 0  00 000 0$0(0)0*0+ 0,0!-"0.0#00/D80S40 00 00 z 8  -LMK 0K! !cM0( 1S Ѝ0SM0D #2::S Ѝ046S0S P  0S Q  Q0 R0 P0000S0P00R 0S0  R R 0S0  R 0S  0Sb p-LM@PQ"%p 2`  @ -P`ppP`8P 2 2` 00 -L$MP@`Q{ Tu "; S  p+  0%0D K$<0 @ 2@K 3 LpK 0P p$ 0 q  P 2: 2r L@ T 0P /0LpK0 ,0  0P8K L04 80  L@ T 0P ? 00} 0-@LPQ*-p p PPP ArrP0r011r011r00 0 00 0-@PLQU "0S 0 p P 20 23G00 00 -LM `Pp4K 0 –H0AR 40 000 , (@ $P  }0b1 0-0L8@+ #80P$ 0S00P @0Pr000DP0000 0r0D0qPP PF 0 0 -LMP@ `\0 p 0Op  -LMP`pQ@5T0@TF0 02T 2  P`@D jP@  0p( 2` 00   00 -L M1"pS *PDFqP4 "! X0 , 0K!*`P!00CS0!0@Ӥ0&t `V@@V 0Pt X"55: X* 2< 2? @]q -L M?Z@8*Qa!00CS0!0pӤ08w W V 1PP`l pP Pp`F+q1w c00 ,  0 K 0OPw  Z: Z* 2< 2R |p -LM1"PS *P:pP"!' b1( ,0 V,KB r*T#*•\ \ 00T0#02S \ 0P`V:B?  2< 2p -LMR?UpB b*T*,@ 0S @T*0S,l, K0( PP U@:B 2< 2 -LM@pPQ` 2    R 1S *PpP` 21 "? l !,K, 2(0 V_,(0$PP "U 2 B 0U 2<00 40 4K-0U 2 E 0]P  2 V: 2$P  04o 0DP0UoP4 "?0 4KOp "D000PU"P` 0PU0PU "Uoi0( ,0 ,Kz 00M -L$M<"w/, p\`t"V00X0SjV g LP0 VP@Y V 2XG:00` a0R1:0A7#(Uᅀ!!: f!0!0  02 "0 "2 1 ,0S , r酀 e  0 `P>P202 zp` 08#X 8 K Kp 40K@0 80 < 40  @K0 z( p-LMP`@Q-T T C0 0p(0 2S  $AP$00C$0 P 2:0 20Q 2Q A *00 p-LM `Q0 @  PP 0p -pLM0!P@0  p< 00` a+0e7#88!8C#8 S! 0C8R#8 1 S!0B000`07#888C#8 0CR80#8! B!20C2 -LM@P0 0C0 0 0 S 0-d1L @RR 0 P0#<2 %000S 0 $0P:0000 0@0 00 0P0P00PB 0@0000P @0Pn<00PS0 8000Qq| ̇ -LM@QPk0ESC̊ 0PU6 P U 2 % P U  EP`  (0$P0(0 0? 2p 00  Pp}B0 0P 2  Rp (0$0P(0 $0PS 00 -LMSP @`p 1S PJ,mP4 01  K1 0 W7 00!P0# 2  00  0!Q PmP001 0! Nmr?sτ  P10 =m -L M@` p$KP(K (0S *P'lP(00 1`C$ PU (@X@1 s 6(0`0dS(0 0$0 l -L M10C`p0 40 ,K k@T" 4P,0UP! 0岁ᰁ?Z 00  0 0040`Vp  0-LM@P K@ K UP 0 1@C00 0 S BP00d0 00 -00 2 0 2  0-1 SPL@ 0hP 10 "0 "10 -LM,`pἑP P< 0410C7#0 8#P@ 0QP1@!Z101 :Z  X0 0 0C00 0 00e0@ZP 1@ C S@! T P Z0000   B   @P -LpMPK`pzP@ 0: S|P@  0Q 00 ZT0K 0 t{dT v@0 0($4 $ p-LM4@s`P( P$ U4404  04  0 00   0S0@0 0 R0p% 0? -LA0 001R0000 00 R 0 00 0 0 S   5k -LMp6P`2 0 001R00000 S    0S0``` R 0 00 0 0 S  p0 0 R0```0 00P`  $P0P$P p  P ?0 0J000 0 0   0S0```p0 0 R0``4`S $ A0 00000 -LM@P  R 0 0 00 R0000jPj 0-@LTP 0@TKP0Np p-LM$ 4PR:@T 0` @TjP@ $ 0 0 404pp00010Q000 00R 0 00 0 0 S 0 0ppp -LM 4`Sp$0P0P4 P4S0 00$ $ 00 R 0S R0  -LDM@PKP@ 4,T QP 0P KSR0S0PK0 P@[[TK$P@KK ,PT@,83K#[$8KK[[R3KL K0KKK4pK@KX d0 d@@DTd@ 0S 0d@S@d`@ p0`SL` `` \JX0@\@ZXp3QPX h h P Uh R `0d@Dh \ l l偀 0 RPh H  `\ 8R \0`FP(*SdP\l 00 L cPe%88cP\X%X@ʷ0Pe%8P d`F\P l@00 L P\P%X@ʷ000l`X\l ` R" h0S d@\ c0 Sh0`@.L0#\ ʌ0#[[[2[P T PK $[[[4[P T P KP@&8#0H8#0H8#0H\ h   P T P0K p@-^`@ Pb 0 2%$^ 040p p-LM@ P$K, ,0K $0 (` ` P `p -LM`V (  0SP@ p`@ V`pV@  V 1+#,PP 0p0`S0`` 0 @00, eV`pV@ B<B S=  P UP! 0 0e P0 0p0eS0`e0PVPV: ,PP 0 P0f  000yP P*0P` 0PU:gP 0 0c  0P0 V,` `pV@ ,0S? 0Y 1! P Q00P00S$ Q ,PPkY 0p0eS0`e^(P], P 0 0e 0  |000P E  eP0g0,0 J< 0 03 0-0L @R3 P+  0P @0P Pg 0P$00 0 00 QB< S  0  0 0c0 00000j| p-L M0K K@C 00p!`fPUhC 0 SP P000ppP` 0 0 pN p-LtM@PP`KP0@  P  Q 0 L P  p( 40R p; 0p0+ 0 p -LM ap@PP;T 0 0S.@0S$0 p@ 0S 0000 0E#10 @0!0 p0 OPRff00 BP @  -L Mp@=PPT 0S @S 0ST  P pox`0Sd0 p@  0E #1 0 f9f@@  0-LTPM@KT 0K  0  @@pz -LM@\Pp` h^\QU0SD R 0S=W00  00CS̩̩̩ة0 0:00 1 0 0 ;00 0 0 R 0;S< W  4? : 00: 0,  -LM`@ 0pP`  0-L0MpP0 @0 0SDK@ 0S ,3h00@@L t,@ P-L 0 h<: 00h*ԫ p-LM`0p@T 0Pd@00U0  ,PP`@Up0@00pp -dpLMW` P@PUJ0SX@PUZpW`pR @0S R@-  Mp-LM0`0 @`ep p-0LM`KPP $ P@  R 00RgP P0 0<0@0@ $0, 808 `(0  p90 0ll -LM@6`PP/0:0 p-LMP `@0 : 0ph -LM@pP  0:0q0:0 -LMp` \0 P@ P@ -0LrS aS "90 0 Ϡ0+S bS 00 0+S wS ̠  -pLpMW@` wD PPN 0X1A  p  KP`N\ K 0SIWG  P`P5 Z Q X0a0 100410$1$cP@ 1!01 ! 01 !01  P0 80`8`8`Uc8Z 0S 1$1 !A/-_@{t AT O` 0R00CS  @0P0( @AP !D010CS1!N1  }H8`E800ȳPܹxa P0-PL @Mc0 -PLM0 0At 0800 -X1LtM@0 00 8p̠ 40$18p` DP @ V K^P H U P0S400S 10SQ l `0QQP700 00S 0 p-LMP@4? P @0 H$0D @0`D 6R@D0C ,0P0320<00@(@ 0  03S0php -L4!`PpGP/eP W& 1PU@8PP@UPP pubW0M70pkbibgb1B7p`b10Cs1 1!0C1Ub10Cs1Nb*7p -QLMP @4P  kP P0 70 0 -LBM`4P0 0  NKQ@pN0A/p p AP@18!0R@T,P 6O0060,1a -LM@S0 h;600,1 -LMSS@0  \h!600,160 -LMR@ 0 h600,1~60 -LM4  4< 0 @ 80  0 PpZ 0@00P`V R0b<0lP @`V0PȻȻ 4 80 P00000@ < P 0Q[Ȼ@ 0S 800 0 c 000  80P   P 4 80 P  R   R< @0P`p(Kp! C  ,  0Pp @ P`~,p~ -LMSS`p@ S$!S00/ 0(1 !$! \W (0 RP0 0P E (Q0S R$1 !0$1^ 0S J?P0S% 1 P 0X 00b0 !0000  c 0 S(%*$1 0(! $1   0P $Q( UU0$Q $1ŝ 0P 0S( P0U(1( 650 0,1 -LM(0 p7b00VP(pVAv %P! @AdP 1!0 1!( 0P1D!D, W00  ,0i  -L`p@_PP   dx `P -0LM@ ,0( P00 0-@LPP P \ 031 1! \!0040@'40@p@-0P0 @ 0`0  00  00  00 0 0 0 0 00  00  00  00  00  00  00  00  00  #0 0" ! !0"0 # '0$0& % %0&0$ ' +0(0* ) )0*0( + /0,0. - -0.0, / 30002 1 10200 3 70406 5 50604 7 ;080: 9 90:08 ; ?0<0> = =0>0< ? C0@0B A A0B0@ C 1 G0DFEEFDG ` 0V0pG-M0 咀 0P0呀 @P`pL吠叀 @P`p0P0 0 L0 0 0 兀H儀0D僀@@傀P`p0 <偀8 0 @P`pH0$0D @00<8000tw|04vx 0u0 ~}|{@zPy`xp,t( 0 @!P"`#p40$00%,0&0((0'p00 ,04h jl0r s0pon@mPl`kpdq$i hgf) *(0+,-@.P/`0p$0< 10 @2030405080\ \`0be0a`@Xd c_P^`]p[ ZYX9:;@607 8p0T@?0 @0A0B0C0D0^T0 0TD E0FG崌⾉0 0 ZЍ -LM@p4 00 , 08 40L0 Ƞ< S,ȠL 0X0C8#Ƞ3 X0 08\<#X5 0<0e8#h < X0` 0n0C 00,`0 0X00 00C8#Ƞ Pp@00 0E8X#X4  R 0("X0e8#h 8H0`0l0C0 , ` 8040 ePp80 4 4P㌠!\/ X0 08#X\< " 0<0e8#h< `Ie00e0 `0@040\ 00C8#ȠQ00X @ -LMP @p`0B8S`RE 00Q 00lU@g PT3 V  0S 0Q S0ò000 B0 00C0C0 0 00T00 = UU800C802 0 R -LMP`  a("H T p 0 ʲ0S T0 fP  `ZQ0 Ppd`P 0 0b8#H Tʲ0S  0- LP@0S 0\P 0Q 0S 0S 0S00 -LM@ PQpl 0 RX 00 P) @Y 00d0 0S 0S 0P  0(1 P$1 0$1  $1 0(! @0 d Ƞ Q`ἠ,kP   04p  0 S 1 0 10 00 0S0GP 张@`0 0S07P 0S @ -LMP`  Q@ n, $ 0 0S0P  0Pp 0, S 0 i 00 0  pP![P Y 0(10S$1 0 ! 0S 0P  0P$1 0$1[ 0-LMP @p 1 00 -L M`@ A nQP, p'P"I[P 0 P 0, S 0  C00 0 ^[0 0S0|P  0Pp -LMP<0 80K0 Kp `P@Q0, 30 <KRp8#80CY 0@00PP08#X ("X 0 P L 00< 0@00Q<Y0A  P00<PP< 0P -RL M`Pp 0 @T 0S @RT ͅ0! A0@ &P@ V00 P V, 0 10 731 B,0  1@01S -L MQ 1pU, 0 1S{@`x 1Uu 0  \0D 0S0SZ 0 0<3Q B K  1F 0 10S% @ ` 0 Y \ಐ\% 0 Q10  @0 @00, S00 0 P 01-0Q0 P0P 00 `P@ YPP  l YP@ c1S0C1Y00! Q0PQX 0 AQ=Q10 -LMPpPmP@ R0 X 0W@ P  0YAT Y0CP @-0@0 @0!00  RCA 0\R! B@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  RQ'  0R!<xl`TH 2 2 2 2 2 2 2 2Q 0S !0S: 0-LMPK 00%0 @( 0ST 0S @S 0ST 0S.   .00 @ 10*2 | 0-P@TUL !P :WP@ / 0, 0 0@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -LM@0h,-R0 0c BSR48 R p-@P`x BRpR0 BRRR Mp-LM0`0 @`p2u*r*k*xh*Je*b* -LM, ,`\0 4 P u00  R-UP8  +U8 P4 RR0Uv 4@T0U 4 4@0K/0 @K @@K< pu 00Q0PEu P!0 0Q4 u,A 00Q7 EW EP4U%\ X  W W0 < U00S *p"00PD@ <B"D@p$$ŏ X008Q\pw0 R \,00F0XSxS0P40 `$P1 *  DH* 0*H -p@L00l8#hP 08#x `0 0c8#h08#x 0b0C`p`0 -LM@P 0S p7U0R G0`8U#h 0  b Rʂ0 S00@0@@0@Rڰ 0000G000A8  B8 000o -L4M@ 0< 开@ PD p <0Px D0@ 00  0 ZH P L *P0<S`R0000 l , @0g\0KH8 K8' 0080 0 c4 CP08#8P0 0ZpPP0n0 a B 00ഀD   000#8ᲀL  L 08# aL0 00`0ᲀPD  0<@ D   000 -LLMT X PpP 0L8#hL \\P ` h [00C8S 0@TL s \d `E0S@@KHKd0@ @ b 00H0 0L c@d@ 5P P3 0S 0 00S L Pp   00008#h\0 0S\`0S L'\0S 0 00S\  TLPT \ \  hT 000 0a0C0 h 0b0C 0X L0PX L` X0@QPh  L X` eX 8K TP X0LPbP4PT 8pW\ 0 RL0X P X -LM@p0Qs P`0 R=V0e S0 0RS 00P U*V0 00Q *^ 0P@  0Y008 8(40Po P0 00S"P@ 0S 0 00S 0P  Q p-LM40@SP`$ 000`!H 0 #Pp0000000 0 B@ 0p00S40040 -L M`pxQ  0 0C0ppSa <0R@W  P@0Pp  P P>Y 0S00C0pp  ,1R Y 0C\0K 1 00  0 !0  00[\002K)0[* [0 0\ʌ0 0"K+ [,[ \K'O0 0F@0@0<  JPPBJ@ 6@00@ -L MPx`p@ `  1R TI 0CP0K100  0!0  00[P0Z" <0W@  P@0Pp  P &O0 0@0@0< J PpBJ@ @00@0Tʀ0 0"K) [*[ Pڸ5P  -LM` Q0H20APP p0 1017  d2 020 0  崜8Q0 00P -L M  !4 0pD $0@SQ!P40 BU00 ,P 18aV U 0, 1 CU@  T pb @ TPU00ZD0 $0@0@@c TD ZF !4 0@  A@ D@ 010CY ?=2!I !U08#X&ʊU0 aP`40@ D0 T0D0Z 1@@ AU@ D 1 %001 %d@?=2D  $0!E!P@T$ U D0T P U D0TU1@ \0@bT5У 0$10C@/-"@dP`S -0p8#(=1@0@A0C$0^^ 18a!$ BVLP ?=2!E.!h}` -LAMp0P 0 &ANK0AnK @D `FS@D `F) \0 0 AK A0A $4 0s1 + 8  0 pS $ *SG -L MⰀ0ሐ` 0cV8#Ƞ, F0@p P0 00 0c8#Ƞ 0 밀,000 0Pc PEP00@ -LM1@QPap O0 Rp8! ,5P8q8PpR0-P@ 0bR03 B0 -L 000CS?h(((((H(((((((2[!0 h!!2[ 0H@00TQ/ 0S   2 0 40 p   0 4 "0 40  }0 y4 u2[!0 h!!P2[\L01 @ @ L 0 00L0P  L0 p2[ S000!! B  @@  2[!0 h!!2[0A0@v2[S000!! B  @@10C00  2[!0 h!!2[!0 B  0@T*K0 K40K"0@7[#(Q:0 1T  a )A 0 0TL $ 00X0 0S2[S1L 0C0 0 !<K0 80 < 0D @0 DK 00SX0%1P P0 %P  2 0 40 p0 40  @ 000@t*K0 K40K@qX) -LMP,K00 P`N ,0 1v?0 1 0 0\ 01 0CRC MPp8 !000 v?0 1 0\ 1  P@ 00 J0 !@wT@MP00`M -01P00` -LM@,Kpl`V0K% fPU0  , @0vϠ@ @ @@@`P -LMv` Lp1P0C@ 00!  B!1@1!0C 00 01  } -vL LP@@ ` R+ R:! p 0  0 n!!1 @ @ 0   0 !0 0 0w 'p!0 0 n!1!@ 00 -L$MP, ,@vAL! Ƞ< ^D 00 8 ,Ƞᰠ`4 @ pS*Z@  000CS DDDDDDDDDDDD 0 0 @0H0 Z@400S*<0AW Z 10d1 1 Ƞ  ,x:@ 0088@#8S@0 :HDP^ D <08W#h:1, 001  ,0 0R` Z00с,0g0< `W6*0Z8#h 000CSy8DDDDD\DDDDDDDp0  @001 0d10@1 Ƞ ,x<08W#h:0<1Z0110100 0 0@ 1@0  R0"0! !R0%,%0%05,@5 g 050% !0F8#h|0!0 0 0@ H ?0!@080!@H@ 00@0 -LM @P0  0 0 090-10C7#\ 0* 08 #8S:  -Lᴃ%s: %s not compiled in instbinUsage: %s ..., where is one of: mount_cd9660dfmountmount_ext2fssyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigrtsolping6kbdlessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfsckmknodwicontrolreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shmvexprdmesghostnameB̈4|D@@$d(,0 @@4` hp x |       [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxcbsconvfilesibsifobsofskipno value specified for %srecord operations require cbsbuffer sizes cannot be zeroseek offsets cannot be larger than %qdcbs cannot be zerocbs meaningless if not doing record operationsbs supersedes ibs and obs%s: illegal argument combination or already setunknown operand %sasciiblockebcdicibmlcasenoerrornotruncoldasciioldebcdicoldibmosyncswabucaseunblockunknown conversion %s%s: illegal conversion combination%s: illegal numeric value%s: short input recordstdoutinput bufferoutput bufferfiles is not supported for non-tape devices%s: short write on tape device%s: short write on character device%s: end of device%u+%u records in %u+%u records out blocks%u odd length swab %s %u truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryskip reached end of inputP!\!h!l!t!!!!!!! !userquotagroupquotarwautoaccesstimeatimedevexecsuidrdonlyunionupdateegjo:Rcd9660%s: Filesystem not supported by kernelrealpath %s%s on %susage: mount_cd9660 [-egjR] [-o options] special node %s: illegal value '%s'needsdoes not need-o %s: option %s a value-o %s: option not supportedhiklnPt:retrieving information on mounted file systems%s mounted as a %s file system%s is not a local file system-i is incompatible with -Ponly one -t option may be specified.empty type list %lld %7s%-*.*s %*u %9u %9d %5.0f%% %7u %7u %5.0f%% %s 1K-blocks%-*.*s %s Used Avail CapacityFilesystem Mounted on iused ifree %%iused Size%-*.*s %s Used Avail Capacity1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fskerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdepasynchronousasyncexported to the worldAadfo:rwt:uvforcerqnoauto/var/run/mountd.pidsignal mountdgetmntinfo:@nfsunknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./usr/sbinexec: mount_%smountfsstatfs %s%s/mount_%sexec %s for %sno mount helper program found for %sforkalready mounted%s on %s type %.*s: %s %s on %s type %.*s (%sunknown flag%s %#xv2v3udptcpsoftintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregminacregmax, %s=%dacdirminacdirmaxprmounthardmfs%s%s=%lu %sadosfs%s%s=%u, %s=%u%s%s=0%omsdosshortnowin95gemdirexecnorripgensextattprocfslinuxversion %d, ctime=%s%s,%s-o[-Aadfruvw] [-t ffs | external_type][-dfruvw] special | nodeusage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special nodeufs%s: fstab type %s != disklabel type %s%s: fstab uses outdated type 'ufs' -- fix pleaseP!\!h!l!t!!!!!!! !mount table fullspecified device does not match mounted device%s on %s: %sfilesystem not supported by kernelusage: mount_ext2fs [-o options] special node $FreeBSD: src/sbin/newfs_msdos/newfs_msdos.c,v 1.9 1999/08/28 00:13:52 peter Exp $%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) %s: can't read sector %u%s: can't write sector %uNO NAMEFAT%uBSD 4.4%u clusters too few clusters for FAT%u, need %uwarning: sectors/FAT limits file system to %u clusterstoo few reserved sectorsno room for backup sectorbackup sector would overwrite info sectorno room for info sector/boot/%s%s: inappropriate file type or format160180320360720120014402880%s: bad FAT typevolume ID%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorswarning: %s is not a character devicebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: FAT type limits file system to %u sectors/dev/%s is mounted on %s%s: unknown standard format%s: can't figure out partition info%s: partition is unavailablegetdiskinfo%s: unknown disk typeioctl (GDINFO)%s: can't read disk label; disk type must be specifiedbps=%u spc=%u res=%u nft=%u mid=%#x spt=%u hds=%u hid=%u bspf=%u rdcl=%u infs=%#x bkbs= bsec=%u spf=%u sec=%u rde=%u%s: no default %s%s: illegal %s%s: bad %s"*+,./:;<=>?[\]|usage: newfs_msdos [ -options ] special [disktype] where the options are: -N don't create file system: just print out parameters -B get bootstrap from file -F FAT type (12, 16, or 32) -I volume ID -L volume label -O OEM string -S bytes/sector -a sectors/FAT -b block size -c sectors/cluster -e root directory entries -f standard format -h drive heads -i file system info sector -k backup boot sector -m media descriptor -n number of FATs -o hidden sectors -r reserved sectors -s file system size (sectors) -u sectors/track 0<8< @< ?D<@'@L<T<X< `<h< p<x< < @p?<<:>>>>>>>>>>> > >#>3>#>3>2?3?3?#?@ ?@@(?@0?8?@?H?T?\?d?l?t?|???????? ? ?@?@??????@ @0/@@$@,@4@<@D@L@T@`@ h@ @At@|@@@@@@@@@@@@@@AAAA A@(A@4A@undefoption requires an argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:ispeed=%d:ospeed=%d %s=%x:%lxoflagospeedlflagiflagispeedcflagcbreakcolscolumnscookeddecekeverythingextprocnewoldostartostoprawrowssanespeedttyillegal option -- -%s%d %d TIOCSETDTIOCSTARTTIOCSTOPcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeottablet disc; ispeed %d baud; ospeed %d baud;lflags-extprociflagsoflagscflags%-8scchars%s = %s; %d rows; %d columns;speed %d baud;#%d disc; slip disc; ppp disc; strip disc; -aefgaef:gTIOCGETDTIOCSWINSZtcsetattrgfmt1illegal option -- %sTIOCGWINSZnot a terminalusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.11 2004/12/17 00:36:07 jaredy Exp $Ffhnslinkit%s: is a directoryusage: %s [-fhns] file1 file2 %s [-fs] file ... directory @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.94 2005/01/07 21:58:14 otto Exp $lsjp~`t~`̕ kQx~~` `~`a~a~~~\{sƑOJNH\u]iSwv\>i ȉ@ʇ~ Yɚ"1=3=ݿ~//_}$^n^^W{;mZ5jcFUGOGdo^d/^g_e2+Mflfo:UVJgyUwt^{wkUvo@2>.4;-"GoA~g=gz.7]x5יƯ#6,MЌ1:_gu:+xVqh~,m|_eUNٖS|5|O6{릀f诳l>>oLJQ^f/; @fgq-跗[XctztԜeg$w;xXRyяiLm}^&_|̇67T]/s}˼m[j@VLP0o\14(b ̋Uo`pa>>ZlTAš_aaz( *:jT^L >f`ECn,os[i;Jun٘n0[34o ,LyCaM!Q8Usevg(O8em;Z)&a]mx+B;>ҥŝNaO(/3RY9^NW[:lU_c]"7gbF`Bfl'v)$Z2;j1iy[Ȣ"Ʈ#4CRI{4.0 iP>6 ӊ^-i&WdA? 4{PI `sH &gi1ߴ$j&$,FoA2'S+< dk{Z Lb|ۭ=XlP̯ή.)WK:WW)/{^*XP8P@>r]@%-,I׷M=*xH-zB%Ӡ< [ A^TyÝ/]usg"ܩ IIn*`Y)cM:ݏ, VK'9c7ѣ=|m;F1o@DVZ7.<&Z;&QS|c?$5("$5 {V%B i ؊qaBh0S"P׀}^s^[ Eyجn3pk{Wz ƾk1Nt=Z0h-o[UVpr0j[[')FQ6~%-bMS]]7ۅ^+# Y/[ؽtB@POT~z37v/FAnͿ_U'׶UQnH]Hz8ϑvGN*{SZu'6 Py@d*E (ڭvP#BÑ Â<-^ߎGZ剀+J**7xޗt[70ʎ+-}Yޢ O#w3SOі!qfU?a3ZDН5YoP$nޥ9꒣4ᓢ{NΦ a= S+C_<=;3 kc7RvMD0ZAoٰDޚAKFBÔ*KB)0)Ǟk0|8cjz 0*CΊ "u#B%N<;Wpkr#\5! ]CQֆM)V3튠I74=ix\  xӅoc9^-Ni(nI "2vgsΙ%|Ξ:'C@O]gr}eCܑ3$E QaiJ#d"T{jZgPI0Z5' rV}1|blNP(_(D2)=b.ȃ8Fys)n}@Z'>ňo2J`'>IG@/=dۂ7ԈL@}Skk .y!2,ף1- .?jIJmtؐ@QY-f].j[<ʫvER,,ϝ25PCfuL42)%D㐛u|ˏn]7kxr#0_F (#<G~7Z'4_kUB 2 a&1cx  Ϛ|ϛ;?g}[W]DxF yC$!_FܖʹtneW*/;51/`!pOٟW)ʚcܴ nF,ZKdKS9;H{FZ6hIh8pb]H-8~BXV7 ԍ֩^e*b{iX}f ȷ}CwɚGvN;1(}qꔖ.B6>3 耑*CйBRMv1躶Ufg T:nRY2m:ߌ|;ZL1&$T{E tF Θh=더]:G[*YBgsrp (77W^k??:e 0#G_-s { nV82Fu15.u@ڈ4 f'Fη]as3gd|h˛Q:a_3\ Qqe</ ktk` nq׶UPWenM1A1 s @nNIQEʱ<;OTN\ŪX'V\ ^<}:ktإ'9 ,Lq.k3}Kyr|󒇫$ɒLYF0b/N Fp8EP#t,~%uGVOۅSp}[` >u~ŧ'>?#vT^rymهC 9uFQX,;MmU߹s$u:.ekHi/ ,z=c`d2o@U{'iJMAM>:{=(lrg~{xmj[W? +OʇM2pȤDt{.Iٖ*Żo懾t?pT[ *%( hh^1杯!8$*cI:R :]]lNXLR`2GHa.25P20գzi8cӄ?ɮ"Gn}*j7:qz tB~ 2NF\S@N~Q{ ,.0|9v`N%̉u#U{(T]Ɉh7X;־9d$1R` ⏵b/u3rnso@uYk \ZS:$x3g":%1US3lO`3uٸt1+P($:C.Cl *cA(|8Kmݴ3frQE0on"?>Y_ s_q>d;><"܉icZG>|k A5ޟHŅ% +~~ WԁÓ|SN4nqD~\ơJUT.A*kT@!,A \KWIM(c׸ޞͽU1)Xkʱu{TށGEy!Jv'inW+ޙA[y v&ѩNi3&#OadR,8y ES߱tIHzl:q!42*@WwT[C"M,i\[I C fQ[.5F]X3N/Mg4+=lAP۴ aV G1:p0=e&$[ OƄ4Tж IڤA\e]SEV~PD3-] {ή6B,-Ȳ=G+ܦEp=ߺ¥qhQM honVώpz~|CYoB o!8)BqDE=\.Z0./nEgn!媃UM{m|]B \{`9Չ9&^[-}A!r!|Kh7br51?-*>4(ڄ(2xʦ RG8ǸA$)Z9dA}}RN1IN"Saв VJt+/%#{$O!NPAvhk T1_kRL+eMQSzl%zdo* i|{%;M}SP%-Hve!nOErUܓZƽ|J#d+n U+*'*92r.mߎ`H-{Ʌĸ(6j/rhwDwû^KŎδ{@)S,8.f#XӪ;\Y,j0r*NȻf\k'߻58''i>Dx$2ؘu$(4ELNst'rjh2}lzR0h7if^deMPTSe6ΩcRI _;G6hR`rA™h6~Ha>jn!d΄"Q#C O]a4Y U*В8R|>S/onlg?;>t2Md5-+)Xa)!sEQ!.tJ]&#QÌ{4MwܞfrbSF{?L(h1#sqM~MA~b-8%{p32%(|nQwfR# W˅m?a\wQ]-&ˮ]]:8m.趰݌UU9c"7RQ;zkc$Az_*y@L<[c-W?_ԶEI7۳qYA| rf⹄%d| WRbsg_-W/ɌPbadosunknownSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSBEf:NRWb:cdenp:rs:tvwbckmgioctl DIOCWLABELunknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.writelseekwriting label to block %lld (0x%qx) ioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)no disklabel found. scanning.no disk labeldisk label corruptedfound at 0x%lxreading label from block %lld, offset %lld ioctl DIOCGPDINFOioctl DIOCGDINFOioctl DIOCRLDINFOBootstrap doesn't leave room for disk label\ :Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%hu:%sil#%hu:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:%sts#%u:%shs#%u:%scs#%hu:%ssk#%hu:%.*s| %c: %12.*f%c %12.*f%c %7.7s%7d%19.19s# %s# Cyl %5u-%6u %5u %5u %4hu %5u %5u %4.4s %c: %13u %13u device: %s # %s: type: %s type: %d disk: %.*s label: %.*s bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total bytes: %.*f%c free bytes: %.*f%c rpm: %hu %hu partitions: offset# %13.13s %13.13s fstype [fsize bsize cpg] interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d free sectors: %u total sectors: %u badsect ecc removable # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) re-edit the label? [y]: editNo changes.-cEDITOR/usr/bin/vifailed to start editor/bin/sh # line %d: syntax errorIDEline %d: warning, unknown disk type: %sremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: warning, unknown filesystem type: %sline %d: too few fieldsline %d: bad partition offset: %sgetasciilabelline %d: bad partition size: %sline %d: unknown field: %sline %d: bad # of partitionssector size %dtracks/cylinder %dwarning, unused partition %c: size %d offset %dpartition %c: block size < fragment sizepartition %c: partition extends past end of unitpartition %c: offset past end of unitwarning, partition %c: size 0, but offset %dwarning, number of partitions (%d) > MAXPARTITIONS (%d)warning, super block size %% sector-size != 0super block size %dwarning, boot block size %% sector-size != 0boot block size %dwarning, revolutions/minute %dcylinders/unit %dsectors/track %dcmplabel usage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) disklabel -B [-nv]%s disk [disktype] (boot) disklabel -Bw [-nv]%s disk disktype [packid] (write) disklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)You need to specify a type for this disk.No 'c' partition found, adding one that spans the disk. Initial label editor (enter '?' for help at any prompt) unable to get default partition tablePAGER/usr/bin/lessgunzip -qc|%sunable to execute %sEnteringExiting%s expert mode This option is not valid when run without the -f flag. Write the modified label to disk?Write new label?unable to write labelNo label changes.In no change mode, not writing label.Recalculated free space.cannot open %sFilenameName of the file to save label into.Nothing to undo!Last change undone.Unknown option: %c ('?' for help) can't run when there is partition overlap.Partition must be between 'a' and '%c' (excluding 'c'). editor_add Please re-enter an offset and size for partition %c. Partition '%c' exists. Delete it first. The letter of the new partition, a - p.partitionPartition '%c' already exists. Partition must be between 'a' and '%c'. No space left, you need to shrink a partition Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to nameThe letter of the partition to name, a - p.Command aborted Please re-enter an offset and sizeWarning, need %u sectors but there are only %u free. Setting size to %u. partition to modifyThe letter of the partition to modify, a - p.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk partition to change sizeThe letter of the partition to change size, a - p.%s: [%s] %s: [%u] Rounding to nearest cylinder: %u getuinthas_overlap Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE)."%s" is not a valid disk type. Valid types are: "%s"label name15 char string that describes this label, usually the disk name.The Numer of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.Not enough free space to shrink by %u sectors (only %u sectors left) The rotational speed of the disk in revolutions per minute.The physical sector interleave, set when formatting. Almost always 1.edit_parmsYou may want to increase the size of the 'c' partition.failed to sort partition tablesdrzFLOPPYxdhdCCDVNDsvndPossible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. Available commands: ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [b|d|u] - use [b]ios, [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. p [unit] - print label. q - quit and save changes. r - recalculate free space. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. mpsave%s%c %s %s rw 1 %d Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors Size of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. Error: block size must be at least as big as page size (%d). cpgNumber of filesystem cylinders per group. Usually 16 or 8.FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' noneWhere to mount this filesystem (ie: / /var /usr)Mount points must start with '/' Can't stat deviceBIOS geometry not defined. You must enter either 'd', 'b', or 'u'. Note: user geometry is the same as disk geometry. Enter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.[d]isk, [b]ios, or [u]ser geometry$OpenBSD: ar_io.c,v 1.36 2004/06/20 16:22:08 niklas Exp $$OpenBSD: ar_subs.c,v 1.28 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: buf_subs.c,v 1.20 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $$OpenBSD: cpio.c,v 1.17 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: file_subs.c,v 1.28 2004/11/29 16:23:22 otto Exp $$OpenBSD: ftree.c,v 1.25 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: gen_subs.c,v 1.17 2003/06/13 17:51:14 millert Exp $$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: options.c,v 1.61 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: pat_rep.c,v 1.28 2004/06/11 03:10:43 millert Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.27 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: tables.c,v 1.22 2004/11/29 16:23:22 otto Exp $$OpenBSD: tar.c,v 1.34 2004/10/23 19:34:14 otto Exp $$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $Cannot write an archive on top of a directory %sFailed stat on %sFailed chdir to %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %s%s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. done. %s: Waiting for tape drive close to complete...ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specEnd of archive volume %d reachedFailed read on archive volume %dWARNING: partial archive write. Archive IS FLAWEDWARNING: partial archive write. Archive MAY BE FLAWEDFailed write to archive volume: %dUnable to append, trailer re-write failed. Quitting.Write failed, archive is write protected.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Cannot allow updates to an archive with flaws.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to seek archive backwardsReverse position on previous volume.Unable to obtain current archive byte offsetUnable to backspace tape %d blocks.Tape drive unable to backspace requested amountget_physUnable to backspace tape over %d pad blocksUnable to backspace over tape filemark.Unable to locate tape filemark.Cannot determine archive tape blocksize.Unable to backspace over last tape block.ar_next ATTENTION! %s archive volume change required. %s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot open %s, try again Cannot save archive name.Quitting %s! %s ready for archive tape volume: %d Load the NEXT TAPE on the tape driveReady for archive volume: %d Unable to restore signal maskUnable to set signal maskcould not pipecould not forkcould not exec-dcCan't fchdir to starting directoryCannot chdir to %sextractUnable to open %s to readCannot mix current archive format %s with %sappend%s: Reading archive to position at the end...directory name is too long %scopyDestination is not a directory %sDestination pathname too long %sCannot access destination directory %sArchive I/O error. Trying to recover.Archive I/O error, cannot continuePremature end of file on archive readInvalid header, starting valid header search.Unable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleUnable to rewrite archive trailer, cannot append.Cannot append to an archive that may have flaws.Archive read error limit (%d) reachedUnable to append when there are archive read errors.File changed size during read %sFile %s was modified during copy to archiveRead fault on %sActual crc does not match expected crc %sUnable to obtain block size for file %sFile %s changed size during copy to %sFile %s was modified during copy to %sFailed stat of %sFailed write during copy of %s to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache tableTRAILER!!!cpio_endwrCpio file name in header is corruptedCpio file name length %d is out of rangeCpio link name is corruptCpio link name read errorCpio link name length is invalid: %qu070707File is too large for cpio format %sCpio header field is too small to store file %scpio_wrUnable to write cpio link name for %sUnable to write cpio header for %s070701070702File is too large for sv4cpio format %sSv4cpio header field is too small for file %svcpio_wrCould not write sv4cpio link name for %sCould not write sv4cpio header for %sFile is too large for bcpio format %sbcpio_wrBcpio header field is too small for file %sCould not write bcpio link name for %sCould not write bcpio header for %sUnable to create %sUnable to close file descriptor on %sA hard link to the directory %s is not allowedUnable to link to %s from %sUnable to copy %s, file would overwrite itselfCould not link to %s from %sUnable to remove %sUnable to link file %s to itselfCould not create: %snode_creatCould not access %s (stat)cannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not unlink %sUnable to remove directory %sAccess/modification time set failed on: %sUnable to obtain file stats %sUnable to set file uid/gid of %sCould not set permissions on %sFailed write to file %sOut of memoryFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Failed seek on file %sFile changed size %sset_crcFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:Can't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sIgnoring too-long pathname: %sIgnoring unterminated pathname at EOFls_list%b %e %H:%M%b %e %Y%s%2u %-*.*s %-*.*s %4lu,%4lu == => %9qu %s%s %s ls_tty%s: unknown option %c %s: %c argument missing bcpiosv4cpiosv4crcustarab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZ0Write limit is not a %d byte multipleInvalid write limit %sError count value must be positiveInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Destination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8Unable to allocate space for option listTAPEProblem with file '%s'Unable to open file '%s' for read-C-Iwrite_opt=nodirabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options format [-G group] ... usage: pax [-cdnvzO] [-E limit] [-f archive] [-T [from_date][,to_date]] ... [-s replstr] ... [-U user] ...[pattern ...] pax -r [-cdiknuvzDOYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvzHLOPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-T [from_date][,to_date][/[c][m]]] ... [-o options] ... [-U user] ... pax -r -w [-diklntuvDHLOPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory usage: tar [-]{crtux}[-befhmopqsvwzHLOPXZ014578] [blocksize] [archive] [replstr] [-C directory] [-I file] [file ...] usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list Empty replacement stringrep_addInvalid replacement string %sInvalid replacement string option %s%s while compiling regular expression %sUnable to allocate memory for replacement stringEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern list inconsistentPattern select out of memoryRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Processing continues, name changed to: %s tty_renameProcessing continues, name unchanged. Skipping file. File name %s/%s, too longrep_name%s >> %s >> %s Replacement name too long %s >> %sReplacement name error %sTMPDIR/tmp/Cannot allocate memory for temp file name.Can't open current working directory.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerUser selection table out of memoryUnable to find uid for user: %sUnable to allocate memory for user selection tableGroup selection table out of memoryCannot determine gid for group name: %sUnable to allocate memory fo group selection tableEmpty time range stringUpper %s and lower %s time overlapIllegal upper time range %sTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Illegal lower time range %sBad option %c with time range %sUnable to allocate memory for time rangeImproperly specified time range: %sCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %schk_ftimeFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryFailed ftime table readFailed ftime table seekCannot allocate memory for interactive rename tableNo interactive rename table, links may failInteractive rename table out of memoryCannot update rename tableCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesUnable to store mode and times for created directory: %swrite_optnodir%s=%s is only supported when writing.Unknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optiontar_wrFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for ustar %sUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wrnobodyFile is too long for ustar %sLink name too long for ustar %sUstar cannot archive a socket %s/dev/ttyFatal error, cannot open %s%s: @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.70 2005/01/19 13:40:47 mpf Exp $DI:LRS:c:dfi:l:np:qrs:T:t:vw:number of packets to transmit is %s: %sbad interface address: %stos value is %s: %s%s: only root may use interval < 1sbad timing interval: %spreload value is %s: %spacket size is %s: %sttl value is %s: %smaxwait value is %s: %s-f and -i options are incompatiblebind-R option and -D or -T, or -t to unicast destinations are incompatiblesetsockopt IP_MULTICAST_IFgetsockoptCannot set the receive buffer sizePING %s: %d data bytes ping: recvfromPING %s (%s): %d data bytes Could only allocate a receive buffer of %i bytes (default %i)setsockoptsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_LOOPping: record routerecord route not valid to multicast destinationsunknown host: %sping: wrote %s %d chars, ret=%d pingerping: sendtopacket too short (%d bytes) from %s unknown option %x LSRR: 0.0.0.0 (truncated route) %s RR: (same route) NOP%d bytes from %s: icmp_seq=%u ttl=%d wrong data byte #%d should be 0x%x but was 0x%x%x (DUP!) time=%d.%03d ms%d bytes from %s: %ld packets transmitted, %ld packets received, %.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms -- somebody's duplicating packets!%ld duplicates, --- %s ping statistics --- Echo ReplyDestination Net UnreachableDest Unreachable, Unknown Code: %d Destination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF setfrag needed and DF set (MTU %d) Source Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDesination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffSource QuenchRedirect Network(New addr: %s) Redirect, Unknown Code: %dRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostUnknown ICMP type: %d Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime exceeded, Unknown Code: %d Frag reassembly time exceededTime to live exceededParameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xpatterns must be specified as hex digitsusage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host $OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $lost+foundwrong type to dirscan %d DIRECTORY CORRUPTEDNAME=%s fileerror%s=%s DIRLINK COUNT %s COUNT %d SHOULD BE %d (ADJUSTED)ADJUSTLINK COUNT INCREASINGUNREFmkentryUNREF %s (RECONNECTED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATElinkupSORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY DIR I=%u CONNECTED. PARENT WAS I=%u SORRY. NO SPACE IN lost+found DIRECTORYNO lost+found DIRECTORYCREATE (CREATED)RECONNECTmakeentryNO SPACE LEFT IN %s (EXPANDED)EXPANDckinodeDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSiblockPARTIALLY TRUNCATED INODE I=%ublk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot increase directory list cannot find inode %d CLEAR (CLEARED) I=%u OWNER=MODE=%o SIZE=%u MTIME=%12.12s %4.4s %d %s I=%uBAD STATE %d TO BLKERR b:dfm:npyAlternate super block location: %d ** lost+found creation mode %o bad mode to -m: %o -%c flag requires a %s checkfilesysCAN'T CHECK FILE SYSTEM.** Phase 1 - Check Blocks and Sizes** Phase 1b - Rescan For More DUPS%d files, %d used, %d free ***** REBOOT NOW ***** ***** PLEASE RERUN FSCK ***** ***** FILE SYSTEM WAS MODIFIED *****The following zero link count inodes remain: %u,The following duplicate blocks remain: %d,%d blocks missing %d files missing ** Phase 5 - Check Cyl groups** Phase 4 - Check Reference Counts** Phase 3 - Check Connectivity** Phase 2 - Check PathnamesINTERNAL ERROR: dups with -p** Root file system** Last Mounted on %s starting usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... INCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED)LINK COUNT TABLE OVERFLOWCONTINUEUNKNOWN FILE TYPE I=%ubad indirect addr: %d bad direct addr: %d bad size %lu ndb %d:HOLD BAD BLOCKbad size %lu:INODE I=%u HAS DTIME=%12.12s %4.4sPARTIALLY ALLOCATED INODE I=%uDUP TABLE OVERFLOW.EXCESSIVE DUP BLKS I=%u (SKIPPING)EXCESSIVE BAD BLKS I=%uBAD STATE %d FOR ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYCANNOT ALLOCATE ROOT INODE ROOT INODE UNALLOCATEDALLOCATEpass2MISSING '..'FIXBAD INODE NUMBER FOR '..'DIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dDIRECTORY TOO SHORTMISSING '.'I OUT OF RANGEREMOVEpass2checkUNALLOCATEDBAD TYPE VALUEIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)DUP/BADZERO LENGTH DIRECTORYEXTRA '.' ENTRYEXTRA '..' ENTRYCANNOT FIX, INSUFFICIENT SPACE TO ADD '..' CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'BAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUPsummary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dBLK(S) MISSING IN BIT MAPS #%dINODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADpass5ino_bitmap:ibmap:blk_bitmap:bbmap:BAD STATE %d FOR INODE I=%ld %u: %2x %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /r%s is not a character device Can't stat %s Can't stat rootmalloc failedrealloc failedstrdup failed%s is not a character device (NO WRITE)cannot allocate space for superblock setupLOOK FOR ALTERNATE SUPERBLOCKSLOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THE%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d WRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead cannot alloc %u bytes for typemap IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULT** File system is already clean %sile system is clean; not checking ** Fstate = %d NO WRITE ACCESS** %sCan't open %s: %s Can't stat %s: %s MAGIC NUMBER WRONGBAD LOG_BSIZEINCOMPATIBLE FEATURE BITS IN SUPER BLOCKcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %ld, original %ld, alternate %ld BAD SUPER BLOCK: %s %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ioctl (GCINFO): %s %s: can't read disk label PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK bad file type 0%o %s? yes %s? [yn] %s? no INTERNAL ERROR: GOT TO reply()cannot allocate buffer pool deadlocked buffer pool CANNOT %s: BLK %dProgram terminated MARKING FILE SYSTEM CLEAN cache missed %ld of %ld (%d%%) MARK FILE SYSTEM CLEANUPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:returning to single-user after filesystem checkSALVAGE (SALVAGED)UNKNOWN INODESC FIX MODE %d benstuvusage: %s [-benstuv] [-] [file ...] %6d @(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ifconfig.c,v 1.131 2005/02/15 19:45:22 reyk Exp $H\H\|\\H\H\H\H\ X[X[X[ aadZ_h`Xfgggg jjj(j4kDZP[`DXH]`H]lH]xH]p]]^XH\H\ H\H\@H\H\st8u ,tuuZZY \di i@$i ix0 0 <@D@P`X`lpxl!Н####$$$$%%%%&&''(())(*0*<+D+P,X,d,h-p-|-..//000011CCDD EE F(F4c<cHdLdXee\dhlpt|Ԗ     8 D  H  T X ` h p |    @ @ @ @ @ @ ` `         , 0 @ T  @ L `T \ @T \ h L @ L t  %ddBm %sieee80211_statustrailers-trailersarp-arpdebug-debug-aliasdeletegroup-groupnetmaskmetricmtunwidbssid-bssidnwkey-nwkeychan-chanpowersave-powersavepowersavesleepbroadcastipdstanycast-anycasttentative-tentativepltimevltimeeui64destroylink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstdescriptiondescrinetinet6-a-A-ma-am-mA-Am-minterface name '%s' too longextra address not accepted'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRSIOCGIFFLAGSSIOCGIFMETRICgetifaddrsstrdup%s: no such interface SIOCIFCREATESIOCIFDESTROYSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCSIFDESCRNote: trailers are no longer sent, but always receivedSIOCSIFFLAGSsetifflagsinvalid %s %s: %s%s not allowed for the AFinterface index is already filledcould not determine link local addressmetric %s: %sSIOCSIFMETRICmtu %s: %sSIOCSIFMTUsetifgroup: group name too long SIOCAIFGROUPsetifgroupunsetifgroup: group name too longSIOCDIFGROUPunsetifgroupbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xSIOCS80211NWIDsetifnwidmalformed BSSID: %sSIOCS80211BSSIDsetifbssidpersistpersist:SIOCS80211NWKEYsetifnwkeyinvalid channel: %sSIOCS80211CHANNELsetifchanSIOCG80211POWERSIOCS80211POWERsetifpowersavepowersavesleep %s: %ssetifpowersavesleep ieee80211: nwid chan %u bssid %s nwkey %d:powersave on (%dms sleep) (auto) SGIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sEthernetetherTokenRingtokenFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA1DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.83211a11b11gfhfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbackloopmasterEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %smedia mode %smediaopt instance %d physical address inet%s %s --> %s phys_statusno carrieractiveno ringinsertedno networkbackupUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu address: %s description: %s %s: no media types?SIOCGIFMEDIA media: status: supported media: inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime in6_alias%s: bad valueprefix %s: %s%s=%o%s=%xusage: ifconfig [interface] [address_family] [address [dest_address]] [[-]alias] [[-]arp] [broadcast addr] [[-]debug] [delete] [up] [down] [ipdst addr] [tunnel src_address dest_address] [deletetunnel] [description value] [[-]group group-name] [[-]link0] [[-]link1] [[-]link2] [media type] [[-]mediaopt opts] [mode mode] [instance minst] [mtu value] [metric nhops] [netmask mask] [prefixlen n] [nwid id] [nwkey key] [nwkey persist[:key]] [-nwkey] [bssid bssid] [-bssid] [chan n] [-chan] [txpower dBm] [-txpower] [[-]powersave] [powersavesleep duration] [[-]anycast] [eui64] [pltime n] [vltime n] [[-]tentative] [vlan vlan_tag vlandev parent_iface] [-vlandev] [vhid n] [advbase n] [advskew n] [maxupd n] [pass passphrase] [state init | backup | master] [syncdev iface] [-syncdev] [syncpeer peer_address] [-syncpeer] [phase n] [range netrange] [timeslot timeslot_range] [802.2] [802.2tr] [802.3] [snap] [EtherII] [pppoeac access-concentrator] [-pppoeac] [pppoesvc service] [-pppoesvc] ifconfig -A | -Am | -a | -am [address_family] ifconfig -C ifconfig -m interface [address_family] ifconfig interface create ifconfig interface destroy getifgroupsSIOCGIFGROUP groups: 1ACFLRSTWacdfghiklmnopqrstuxCOLUMNS%s: %s: %s: directory causes a cyclefts_readdisplay%qu%*s%*qd printlong%3d, %3d %-*s %*qd %*u total %lu %s %*u %-*s %-*s -> printlink ls: %s: %s %*s usage: %s [-1ACFLRSTWacdfhiklmnopqrstux] [file ...] mainifconfigmake_packetrtsol_check_timerrtsol_timer_updatesockopensendpacketrtsol_inputinterface_upinterface_statuslladdropt_fill)get_llflagprobe_initdefrouter_probesendprobeadDFfailed to open a socketfailed to initilizatoin interfacesselect: %sfailed to setup for probing routersfailed to initialize %skernel is configured as a router, not a hostkernel is configured not to accept RAsadDfFm1memory allocation failedinterface %s was already configuredfailed to get link layer information for %slink-layer address option has null length on %s. Treat as not included.memory allocation failed for %sNew timer is %ld:%08ldthere is no timer%s status is changed from %d to %dNo answer after sending %d RSstimer expiration on %s, state = %dset timer for %s to %d:%dstop timer for %sillegal interface state(%d) on %susage: rtsol [-dDF] interfaces... usage: rtsol [-dDF] -a usage: rtsold [-adDfFm1] interfaces... usage: rtsold [-dDfFm1] -a <%s> %swarnmsgprobing %sreallocmultiple interfaces foundff02::2inet_pton failed for %ssetsockopt(ICMP6_FILTER): %sIPV6_HOPLIMIT: %sIPV6_PKTINFO: %ssocket: %smalloc for send msghdr failedmalloc for receive msghdr failedsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketfailed to get receiving interfacertsol_inputinvalid icmp type(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on %s, state is %dreceived RA from %s on an unexpeced IF(%s)invalid icmp code(%d) from %s on %spacket size(%d) is too shortfailed to get receiving hop limitrecvmsg: %schecking if %s is ready...interface_up%s is duplicated%s is tentative%s is readyget_llflag() failed, anyway I'll tryioctl(SIOCSIFFLAGS): %sioctl(SIOCGIFFLAGS): %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS) on %s: %sunsupported link type(%d)get_llflagioctl(SIOCGIFAFLAG_IN6): %sgetifaddrs: %ssocket(SOCK_DGRAM): %sshutdown: %slo0defrouter_probedefault router list contains a non-link-local address(%s)ioctl(SIOCGDRLST_IN6): %sprobe a router %s on %ssendprobeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftinvalid namelen:%d/%luno nameunknown qtyperefused???unknown, type 0x%xrefused, type 0x%x%d bytes from %s, icmp_seq=%u hlim=%d(DUP!) time=%g ms dst=%sfailed to get receiving packet informationa:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW-R is not supported in this configurationinvalid source address: %sinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit -- %sillegal hoplimit %stoo small interval, raised to 0.01illegal timing interval %sillegal preload value -- %sMust be superuser to preloaddatalen value too large, maximum is %dillegal datalen value -- %sgetaddrinfo failedsetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_HOPOPTS)setsockopt(IPV6_DSTOPTS)-f and -i incompatible optionsUnable to allocate packetsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)%s: invalid interface namesetsockopt(SO_SNDBUF)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified recvmsgpollsetsockopt(IPV6_HOPLIMIT)setsockopt(IPV6_PKTINFO)setsockopt(SO_RCVBUF)you need -b to increase socket buffer sizeUDP socketUDP setsockopt(IPV6_PKTOPTIONS)UDP connectgetsocknamecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't set the last flagcan't allocate enough memorysetsockopt(IPV6_RTHDR)IPV6_MULTICAST_HOPSgateway resolves to multiple addressestoo many intermediate hopsgetaddrinfo for the gateway %s: %sping6: wrote %s %d chars, ret=%d sendmsg\%03odnsdecodeinvalid peernamepr_packunknown code 0x%x, type 0x%xNodeInfo NOOP HbH Options: Routing: Dst Options: -%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap %s(TTL=%u)pr_nodeaddr(TTL=infty) no address truncated --- %s ping6 statistics --- round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms %.1lf%% packet loss+%ld duplicates, IPv6 addressDNS labelIPv4 addressSuccessRefusedNo Route to Destinationpr_icmphDestination Unreachable, Bad Code: %d Destination Administratively UnreachableDestination Unreachable Beyond ScopePacket too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Bad code(%d) pointer = 0x%02x Erroneous Header Unrecognized Option Unknown Nextheader Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dNode Information QueryNOOP, invalid, oldfqdn, subject=%s(%s), no subject, subject=%s(invalid)Supported qtypesDNS namenodeaddrIPv4 nodeaddrNode Information Reply, %sVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphHBH RTHDR FRAG ESPICMP6: type = %d, code = %d Unknown Header(%d) DSTOPT IP6ff02::2:0000:0000nigroupusage: ping6 [-dfHmnNqtvwW] [-a [aAclsg]] [-b sockbufsiz] [-c count] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-h hoplimit] [-g gateway] [hops...] host usage: %s -l or %s [-q] name lqdkfrukjpsvnohuberuuasgsflabrplsinodeaddeclklk401swapctrlcapsdvorakmetaesciopenermachdep/dev/wskbd%dWSKBDIO_GTYPEList not available; sorry.kbd_listunknown encoding %sunknown variant %s%s: unsupported encoding %s on %s WSKBDIO_SETENCODING: %skbd: keyboard mapping set to %s kbd_set?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURELESS-E-G-LMOREWARNING: terminal is not fully functionalCannot allocate memoryticdcmsomdmbvbbc|^srget_termraw_modeLESS_TERMCAP_ltget_envLINESlicokrklkukdkPkNkh@7kDTERMhcxndadbNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunseek error to 0ESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off (P)+ [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found help(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Command not availableBrackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%sHOMEbin_file%s %s %sLESSOPENLESSCLOSE...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSplinenum~ Calculating line numbers (press RETURN)Invalid mark letterMark not setMark not in current fileLine number is required after -lless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThere is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesAllow help commandDon't allow help commandCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeBe less helpful in promptsBe helpful in promptspostoalinenumtoainttoaiprint_intiprint_linenumap_posap_linenumap_intNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned offP!\!h!l!t!!!!!!! $&!@T@'@ @@@@'' @@@4(@(T(`(bgdumbtimernfsv3rdirplusmntudpresvportnfsv2ac23a:bcdD:g:I:iL:lo:PpqR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sillegal -R value -- %sillegal -a value -- %sconflicting version optionsillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %sNFS Portmapcan't access %s: %snqnfs 2bad MNT RPCCannot MNT PRCcan't resolve address for host %sno : or @ spechostname too long [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path nodeusage: mount_nfs %s %s %s %s [-23PTUbcdilqs] [-a maxreadahead] [-D deadthresh] [-I readdirsize] [-g maxgroups] [-L leaseterm] [-o options]|_ho_TV__@_unused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB HPFS/QNX/AUXAIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech Thinkpad Rec Willowsoft $NEC DOS 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootBSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT ZmoJW,pc'C'vZ;=;h@^+iaVtr)Zɵh?Dq9gՇ˛}F׍ݜoZ}ԕ^wSAdr]egń-E6>ٽzίoT]k[[Wjm՚JWQN'ή?epy]E,{+.%YeYfY54_g9nl;YfyEۼˢU¢vβ:>y1~nK[ϡ׳W+^꾪7^vUgq_GH^+ۗj{<#r4z T{3|ŷU;/⟷7^SavD3]UOyWK߯tAxS"! jEdj(@} Y@($M=RV;eGikRR*(ndwʂ7퇟  3>P'AY _ Y涐|B50TyӯS:|1HP08%^.dV";yK CJ|%v u>0@, E5.~pƐBI!Cj'_<wW7D_s+C(i["%`K n4(g ą`n.$u1xcpJbЋ Gam֮VjJD15ٶiu@"z>Nz,/)Z"$+̐ =Ek/ld+H~=gA݆^)>xےnA@\}M#H Byg]iJAM*6Dh"Y*ST(5RfM x"C&D$])[m$uu+G;wR#R7(.\rQݑvB4"3w"=X_GJWːxI5@O$T5F8TgﯳG;ή\LpF ogb>NM;Qe]8 Z k,gٟESnjjĽ (`l\ eJ.(%1BRV"Vd7۝0ŋ8AMEJaoC F։)4}eOg&Ah{z q"G3Ď( V~ 'Cw(Aj9va yݕElZl fDD~7ڛ yJ"GNeD=tn)m@pSOx}$s`eZl .$~le( T2orceExh0WD;aL3xIϞs5bo}e9;Xo!~2Q5F0Kl\hZ91aU2,LkO(Ou߅qrHox7p&>Kÿt8F cx(4[y|0SD:V |LG"u}>8Ȍ[qMb~.WG$i@{bDH:8 >:ۯv4$F hA_y#՝M`{ h(0<BhI;`G9􎗰AQ/)v $h>*2;>rk>@J}R6DtDWs:ߡ$=")i#M|vdɼ$\/g5G}:A8aB&8իnyzNpWǥGbUl4 4mx&n$XbXLC"GG,tpGuS{J`0;^4oנTDAK:X, 9$V(+EKN (%j,!Ty`LFeJԇϜ!EÏ\i,C*[p&[Ð\ԡsN-$"NF4?Z گMR >ӌ  OƨUQqxBn!`zo  d;zw4{OODy|]zA+: ׀3÷O)Mw<͂h$5* LkeelwZ1gOS|)`1GDyooOZ׮m9"N_QJ" _NՋ/'mQ&usage: %s [-ieu] [-f mbrboot] [-c cyl -h head -s sect] disk -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry `disk' may be of the forms: sd0 or /dev/rsd0c. /usr/mdec/mbrieuf:c:h:s:Cylinder argument out of range [1..262144].Head argument out of range [1..256].Sector argument out of range [1..63].using builtin MBRCan't get disk geometry, please use [-chs] to specify.Please specify a full geometry with [-chs].Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statsEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tableWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes ----------------------------------------------------- ------ ATTENTION - UPDATING MASTER BOOT RECORD ------ ----------------------------------------------------- Do you wish to write new MBR? Do you wish to write new MBR and partition table?USER_initMBR is unchangedEnter 'help' for informationfdisk:%c%d> Aborting changes to current MBR.USER_modifyWriting current MBR to disk.Invalid command '%s'. Try 'help'. Offset: %d USER_print_diskBytesSectorsKilobytesMegabytesGigabytesask_cmd%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) ask_num'%d' is out of range. '%s' is not a valid number. %s [n] %s is not a character device or a regular fileDIOCGDINFODISK_getlabelmetricsDisk: %s geometry: %d/%d/%d [%.0f %s] geometry: Signature: 0x%X MBR_pcopyChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s Warning CHS values out of bounds only saving LBA values Starting Ending LBA Info:%c%1d: %.2X %4u %3u %2u - %4u %3u %2u [%12u:%12.0f%s] %s #: id C H S - C H S [ start: size ]------------------------------------------------------------------------Start of partition #%d after end!In memory copy is initialized to:Use 'write' to update disk.XreinitChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsInvalid argument: %s Invalid partition number %d. Swap with what paritition?%d same partition as %d, doing nothing. Invalid argument: %s Invalid partition number.Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorLoop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Partition %d is not an extended partition. Writing MBR at offset %d. Xwrite %s %s Machine code updated.Partition %d marked active. (standard input)(fd %d)invalid file type^%s[[:<:]]%.*s[[:>:]]%susage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxybinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpbinarybyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetscontext out of rangegrep version %u.%u without-matchUnknown binary-files optionBinary file %s matches [[:<:]][[:>:]]%lldaFfh:t:v%s: not a directory or special deviceumountfsBad MNT RPC%s: unmount from %s %s: not currently mountedusage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist]P!\!h!l!t!!!!!!! !Gsl9xu:g:m:o:not an MSDOS filesystemstat %sunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-o options] [-u user] [-g group] [-m mask] bdev dir $OpenBSD: fsck.c,v 1.19 2005/02/03 05:03:50 jaredy Exp $$OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $$OpenBSD: preen.c,v 1.14 2003/06/26 08:01:54 tedu Exp $start %s %swait %scheckfs%s/fsck_%sexec %sCan't get resource limit for data sizeCan't get resource limit to max data sizedvpfnyl:t:T:%s: unknown special file or file system.fsck_%sInvalid option stringusage: %s [-dfnpvy] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sCan't open checklist file: %s/etc/fstabBAD DISK NAME %s pass %d, name %s Unknown pid %ld%s: %s (%s): EXITED WITH SIGNAL %d done %s: %s (%s) = %x disk %s: %s in fstab more than once!mkfifom:invalid file mode.non-numeric major number.non-numeric minor number.major or minor number too largenode must be type 'b' or 'c'.usage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p @(#) Copyright (c) 1997, 1998, 1999 Bill Paul. All rights reserved.@(#) $OpenBSD: wicontrol.c,v 1.57 2004/11/24 18:11:15 fgsch Exp $drxrrrrrr s$s4s Ps ps s s ssssssssssssss!s"s#s$s&t%d station%s: %02x:%02x:%02x:%02x:%02x:%02x asid=%04x, flagsAUTHASSOCPERM, capsESSIBSSPOLLABLEPOLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SHORT_SLOTTIME RSNDSSSOFDM, rates1M2M5.5M11M, sig=%d/%dwi_dumpstationsSIOCHOSTAP_GETALLLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB)SIOCGWAVELAN (0x%x)wi_getvalwi_setvalSIOCSWAVELAN[ %s ]must specify stringstring too longmust specify addressbadly formatted addressno WEP option available on this cardencryption key must be no more than 13 characters longonly 4 encryption keys availableencryption key must be no more than 26 hex digits long[ 0xUnknown Lucent chipUnknown PRISM chip[ %s, Firmware %d.%02d variant %d ][ %s, Firmware %d.%d.%d ][ On ][ Off ][ Firmware WEP ][ Software WEP ][ Unknown ]AP Informationap[%d]: netname (SSID): [ %s ] BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Beacon Interval: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] DataRate [Mbps]: [ %2.1f ] AvailableRates [Mbps]: [ %d.%d Capinfo: [ PRIV IBSS ESS [dBm]: [ %d / %d / %d ] NIC serial number: Station name: SSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Process 802.11b Frame: Port type (1=BSS, 3=ad-hoc, 6=Host AP): MAC address: TX rate (selection): TX rate (actual speed): Maximum data length: RTS/CTS handshake threshold: Create IBSS: Antenna diversity (0=auto,1=pri,2=aux): Microwave oven robustness: Roaming mode(1=firm,3=disable): Access point density: Power Management: Max sleep time: Enhanced Security mode: Intersil Prism2-based card: Card info: Encryption: Encryption algorithm: Authentication type (1=OpenSys, 2=Shared Key): TX encryption key: Encryption keys: Transmitted unicast frames: %u Transmitted multicast frames: %u Transmitted fragments: %u Transmitted unicast octets: %u Transmitted multicast octets: %u Single transmit retries: %u Multiple transmit retries: %u Transmit retry limit exceeded: %u Transmit discards: %u Transmit discards due to wrong SA: %u Received unicast frames: %u Received multicast frames: %u Received fragments: %u Received unicast octets: %u Received multicast octets: %u Receive FCS errors: %u Receive discards due to no buffer: %u Can't decrypt WEP frame: %u Received message fragments: %u Received message bad fragments: %u usage: %s [interface] [-olL] [-t tx rate] [-n network name] [-s station name] [-e 0|1] [-k key [-v 1|2|3|4]] [-T 1|2|3|4] [-x 0|1] [-F 0|1] [-c 0|1] [-q SSID] [-p port type] [-a access point density] [-m MAC address] [-d max data length] [-r RTS threshold] [-f frequency] [-M 0|1] [-P 0|1] [-S max sleep duration] [-A 1|2|3] [-D 0|1|2] [-R 1|3] [-E 0|1|2|3] wi0a:c:d:e:f:hi:k:lm:n:op:q:r:s:t:v:x:A:D:E:F:LM:S:P:R:T:get_if_flagsset_if_flagsbssad-hocunknown port type %s@(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: route.c,v 1.83 2005/02/18 04:00:21 jaredy Exp $$OpenBSD: show.c,v 1.40 2005/02/18 04:00:21 jaredy Exp $UGHRBD M@dmCXLS1@2 3c0123456789abcdefold usage of trailing 0assuming route to if entry in usenot in tablerouting table overflow: gateway %s (%s)netmask missingold usage of trailing digit, assuming route via gatewaybotched keyword: %susage: %s [-dnqtv] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtv/dev/nullroute-sysctl-estimate%-20.20s donewrite to routing socketgot only %d for rlen Examining routing table from sysctl(address family %s) actual retrieval of routing tablemust be root to alter routing tableinet6_makenetandmask128%s: resolved to multiple values%s: bad address%s: not a network%d: bad address familyinternal errorprefixlen is not supported with af %dactual retrieval of interface tablegot message of size %d on %sread from routing socketwriting to routing socketso_labelso_ifaso_ifpso_genmaskso_maskso_gateso_dstRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departurerouting message version %d not understoodprint_rtmsg%s: len %d, if# %d, link: %s, flags:name: %s, pid: %ld, seq %d, errno %d, flags:metric %d, flags:if# %d, name %s, what: departurearrival route to: %s destination: %s mask: %s interface: %.*s flags: label: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8lu%c %8ld%c sockaddrs: gateway: %s RTM_GET: %s (errno %d)message length mismatch, in packet %d, returned %d locks: inits: sockaddrs: %s: link %s; sodump%s: inet %s; %s: ipx %s; %s: inet6 %s; label too longRouting tablessysctl of routing tableGatewayFlagsRefsUseMtuInterface%-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s PortProtoSA(Address/Proto/Type/Direction)Source%-18s %-5s %-18s %-5s %-5s %-22s %-*.*s Address%-6.6s %6d %8ld %6ld %6s %.16sp_rtentryInternet Protocol Family %d: XNSX.25AppleTalkIPXInternet6Encapp_flagsroutename(%d) %s%u.%u.%u/%d%u.%u.%u.%u/%d%u.%u/%d%u/%d%s/%dnetname6illegal prefixlenaf %d: %s*.**.0x%XHany%XH.%s%s.%XH%02X%02X%02X%02X%02X%02XHlink#%dblackholechangecloningdstexpiregatewaygenmaskhopcountifaifpipxlinkllinfolockrestmpathnostaticproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xresolve KMGTPimagetenexusage: %s [ | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.We only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] APPESTORSTOUlocal-filesusage: %s local-files Continue withmput%s: not foundr+wusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files mgetand logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Macros: usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdDELE %susage: %s remote-file mdeletefrom-nameto-nameRNFR %susage: %s from-name to-name RNTO %susage: %s remote-directory local-file nlistLISTNLSToutput to local-file:usage: %s remote-files local-file Try again latershellusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. PWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameMKD %susage: %s directory-name MKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1SITE CHMOD %s %susage: %s mode file-name SITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. usage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". |%sCan't allocate memory for $PAGERaccountbellbyecasecdupclosedisconnectepsv4formgateglobhashidlemacdefmdirmlsmodtimemsendnewernmapntranspagepassivepreserveprogresspromptpwdquoterecvregetresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquetraceumaskverbose'%s' macro not found. domacroRetrieving %s/%s auto_fetchExtra `@' characters in usernames and passwords should be encoded as %%40Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sReading from filehost %s, port %s, path %s, save as %s. (unknown)Trying %s... r+Requesting %s (via %s) GET %s HTTP/1.0 %s User-Agent: OpenBSD ftpRequesting %s Can't allocate memory.GET /%s HTTP/1.0 Host: [%s]:%s %s GET /%s HTTP/1.0 Host: [%s] %s GET /%s HTTP/1.0 Host: %s:%s %s GET /%s HTTP/1.0 Host: %s %s Writing HTTP requestreceived '%s' 301302200Error retrieving file: %sContent-Length: Location: Redirected to %s Can't open %sCan't allocate memory for transfer bufferReading from socketRead short file. Successfully retrieved file. Auto-login using ftp URLs isn't supported when using $ftp_proxyReceiving HTTP replyWriting %sImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'*?[]{}Can't allocate memory for URL decoding:/ftpgatehttp%s: bad port number `%s'connect to address %ssetsockopt TOS (ignored)fdopen failed.Connected to %s. hookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command.%c%c%c421 Service not available, remote server has closed connection. getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s %s: not a plain file. REST %ldnetoutsendrequest receive aborted waiting for remote to finish abort. receivednetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. wrong server: return code must be 227 %u,%u,%u,%u,%u,%uwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode AF mismatch. Shouldn't happen! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s runique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssu-r requires numeric argument46Aadegimno:pP:r:tvVRetrying... FTPSERVERPORTFTPMODEunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERftp> sorry, input line too long. Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadegimnptVv] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] anonymous4K macro buffer exceeded. Unknown .netrc keyword %sError: .netrc file is readable by others.Remove account or make file unreadable by others.Missing macdef name argument. Macro definition missing null line terminator. Remove password or make file unreadable by others.ruserpasspasswordpasswdmachine%s/.netrc: %s%s/.netrcstringlist|%.*s%*s| %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterAlready connected to %s, use close first. usage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. %s@Name (%s): Name (%s:%s): Password:Login failed.$initftp_loginsorry, arguments too long. (%s) unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %scan't find list of remote files, oops.can't find list of remote files, oops. remglob%s %s? n, y, p, a, are the only acceptable commands! Interactive mode: off. Prompting off for duration of %s. confirmSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. %3d%% *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d ptransfer/etc/rcWARNING: some process(es) wouldn't die(can't restart init): SIGTERM processes/dev/consolesetsidrevokeSIGTSTP inithalted (with powerdown) by %shalted by %srebooted by %sdlnpq~usage: %s [-dn%sq] P!\!h!l!t!!!!!!! %@!ij$&%reloadfilesystem must be mounted read-only; you may need to run fsckusage: mount_ffs [-o options] special node mediumreason/etc/dhclient.confalias_routehandlerc:dl:qucallocInterface name too long%s.%s/var/db/dhclient.leasesasprintf%s: no link ... giving up got link cannot open %s: %m_dhcpno such user: _dhcp, falling back to "nobody"no such user: nobodycan't open and lock %s: %mPREINITAF_ROUTE/var/empty/chrootchdir("/")can't drop privileges: %musage: %s [-dqu] [-c conffile] [-l leasefile] interface ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.BOUNDRENEWREBINDREBOOTold_new_bound to %s -- renewal in %d seconds.BOOTREPLY from %s rejected.DHCPOFFERDHCPNACKDHCPACK%s from %s rejected.BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSENDdhcpoffer: no memory to record lease.dhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.dhcpoffer: no memory for option %dInvalid lease option - ignoring offerDHCPNAK from %sDHCPNAK with no active lease. Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. EXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %dcan't create %s: %mlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } buf_open: %mbuf_add: %mbuf_close: %mscript_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbinip_addressnetwork_numberbroadcast_addressserver_nameprepend optionappend optionno space to %s %sexpirypriv_script_write_paramsunexpected msg type %ureceived corrupted messageREASON=NBIfork: %mwait: %mexecve (%s, ...): %mpriv_script_goscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sdaemonInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xoption_as_string: bad code %ddhcp option too largecannot fork%s [priv]poll errorno memory for client state.no memory for client config.Corrupt lease file - possible data loss!not allowed here.hardware address parameter %snested interface declaration.expecting a statement.semicolon expected.expecting string or hexadecimal datastring constant too long.expecting hexadecimal constant.hexadecimal constant too long.expected option name.expecting semicolon.%s: unexpected option name.%s: too many options.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.Insufficient memory to record interface %sno memory for state on %sno memory for config for %sno memory for lease.unterminated lease declaration.expecting lease declaration.expecting identifier after option keyword.no memory for vendor information.expecting identifier after '.'no vendor named %s.no option named %sno option named %s for vendor %sexpecting number.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.expecting string.option data buffer %soption data buffer overflowout of memory allocating option data.parse_option_declExpecting media options.no memory for string list entry.no memory for reject list!parse_reject_statementexpecting IP address.getifaddrs failedno space to remember ifpdiscover_interfacesCan't allocate poll structures.No live interfaces to poll on - exiting.poll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %mCan't allocate timeout structure!can't allocate protocol struct for %sCan't create socketinterface_link_statusCan't add %s to hash table./dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfsend_packet: %msend_packetcSclarger than bufferoption %s (%d) %s.Many bogus options seen in offers. Taking this offer in spite of bogus options - hope for the best!rejecting bogus offer.Can't allocate storage for option %s.Can't expand storage for option %s.cons_optionspretty_print_option: bad code %d%s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of arrayUnexpected format code %cpretty_print_optionDiscarding packet with invalid hlen.do_packetno memory for cons.eof in string constantstring constant larger than internal buffernumeric token larger than internal bufferlways-reply-rfc1048llowbandoneduthoritativeackoff-cutoffootingoot-unknown-clientslassiaddrlient-identifierlient-hostnameomainenyefaultynamic-bootp-lease-cutoff-lease-lengththernetxpireixed-addressddiet-lease-hostnamesardwarenitial-intervalnterfaceax-lease-timeediameserveretmaskext-serverne-lease-per-clientrependequestequireetryenewebindeboottartsubnethared-networkerver-nameerver-identifierelect-timeoutcriptupersedeimestampoken-ring-host-decl-names-lease-addr-for-default-routenknown-clientsendor-classexiting. %s line %d: %s%s^^ subnet_numberbroadcast_addraddr_eqpiaddr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetssubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endpaddhcpCan't allocate dhcp option hash table.value %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dfilename must be a stringno memory for string %s.expecting a network hardware typehardware address too longExpecting numeric lease timecan't allocate space for numeric aggregateunexpected end of fileexpecting numeric value.too few numbers.no temp space for number.can't allocate space for numeric aggregate.Bogus number: %s: digit %d not in base %dBogus number: %s.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.short write: wanted %lu got %ld bytesconnection closedbuf_read: %mshort read: wanted %lu got %ld bytescorrupted message receivedreceived unknown message, code %ddispatch_imsgcannot read temp filecannot seek temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_ciphercbc_decodedecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiter& no previous commandunexpected end-of-filecannot close input filecannot open input file%lu newline inserted newline appended cannot read input filecannot close output filecannot open output filecannot write filecannot read stdin \abfnrtv\\ warning: file modifiedinvalid filename@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? script, line %d: %s number out of rangeinvalid redirectioninvalid destinationno previous substitutiondestination expectedcannot nest global commandsno current filenameunexpected command suffixinvalid command suffixunexpected addressno matchfilename too longshell access restrictedinvalid mark charactered.hup/ed.hupno previous patterntrailing backslash (\)unbalanced brackets ([])infinite substitution loopnothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: name too long (not copied)cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s and %s are identical (not copied).overwrite %s? readlink: %sunlink: %scopy_linksymlink: %smkfifo: %smknod: %schown: %schflags: %sutimes: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source_file target_file %s [-fip] [-R [-H | -L | -P]] source_file ... target_directory t{<}v `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      inflate 1.2.2 Copyright 1995-2004 Mark Adler  #+3;CScs !1Aa  0@`@@P`Py(8Py%s not a regular file%s%s already has %s suffix -- unchanged/dev/stdout%s: unknown suffix: ignored%s%s: name too long%s: input: %soutput: %sdeflate.gzzcatzipunknown program nameGZIPGZIP is too longoption -a is ignored on this systemillegal bit count -- %s-o argument is too long123456789ab:cdfghlLnNOo:qrS:tvV/dev/stdin-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchangedcompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errordodecompressZgzztgztaz.-_method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out usage: %s [-cdfghOqrtvV] [-b bits] [-S suffix] [-[1-9]] [file ...] 1.2.2put_headerfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionneed dictionarystream endHLPRXfghorstuwxinvalid flags: %sinvalid flag: %sthe -R and -h options may not be specified together.%s: invalid user name%s: invalid group nameusage: %s [-R [-H | -L | -P]] %s file ... [owner][:group]usage: %s [-R [-H | -L | -P]] [-f] [-h] %s file ... $OpenBSD: dir.c,v 1.17 2004/07/05 02:31:54 pvalchev Exp $$OpenBSD: inode.c,v 1.26 2003/10/11 01:43:45 tedu Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.26 2005/02/03 05:03:50 jaredy Exp $$OpenBSD: pass1.c,v 1.15 2003/10/11 01:43:45 tedu Exp $$OpenBSD: pass1b.c,v 1.9 2003/08/25 23:28:15 tedu Exp $$OpenBSD: pass2.c,v 1.19 2003/10/11 01:43:45 tedu Exp $$OpenBSD: pass3.c,v 1.8 2003/06/02 20:06:15 millert Exp $$OpenBSD: pass4.c,v 1.10 2003/10/11 01:43:45 tedu Exp $$OpenBSD: pass5.c,v 1.17 2003/10/11 01:43:45 tedu Exp $$OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $$OpenBSD: setup.c,v 1.21 2003/09/25 04:19:39 deraadt Exp $$OpenBSD: utilities.c,v 1.20 2003/08/25 23:28:15 tedu Exp $?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@dirscanexpanddir blk + cnt %d > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listSIZE=%llu CG %d: BAD MAGIC NUMBER dfpnNyYb:c:l:m:conversion levelusage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) phase 1, inode %d/%dcheckinodebad size %llu:convert symlink %d(%s) of size %llu bad size %llu ndb %d:cannot read symlink phase 1b, inode %d/%dphase 2, directory %d/%dphase 2, parent directory %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %d (REMOVED)BAD WHITEOUT ENTRYphase 3, directory %d/%ldphase 4, inode %d/%dphase 5, cg %d/%dCREATCANNOT %s CLUSTER MAPS SUMMARY INFORMATION BADBLK(S) MISSING IN BIT MAPSALLOCATED FRAG %ld MARKED FREE ALLOCATED INODE %ld MARKED FREE FREE BLK COUNT(S) WRONG IN SUPERBLKCREATE CLUSTER MAPS%sING CLUSTER MAPS DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSUNKNOWN ROTATIONAL TABLE FORMAT %d INFORMATION; SEE fsck_ffs(8).IMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKcannot alloc %u bytes for cylinder group summary area cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead CONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATIMPOSSIBLE MINFREE=%d IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKclean = %d CPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEoffset %d, original %ld, alternate %ld NCG OUT OF RANGE%s: NOT LABELED AS A BSD FILE SYSTEM (%s) UPDATE STANDARD SUPERBLOCKreturning to single-user after filesystem check catchquitcatchinfoffs_isblockffs_clrblockffs_setblockffs_isfreeblock   init: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'ignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated, restartingsingle user shell terminated.single_userautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modesession database close: %ssession database open: %sinsert %d: %sdelete %d: %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %dcan't exec %s for %s %s: %msome processes would not die; ps axl advisedNOS:T:a:b:c:d:e:f:g:h:i:k:l:m:n:o:p:qr:s:t:u:x:z:P:T:a:b:c:d:e:f:i:m:o:s:%s: can't figure out file system partitiondisagrees with disk label%s (%d) %s (%lu) Warning: calculated sectors per cylindermfs:%dNumber of cylinders restricts cylinders per group to %d. Warning: changing optimization to space because minfree is less than %d%% %s: no default sector size%s: no default #sectors/track%s: no default #tracks%s: maximum file system size on the `%c' partition is %d%s: `%c' partition overlaps boot program%s: `%c' partition is unavailable%s: %s: not a character-special device %s: getmntinfo: %s%sr%snewfs_%s%s/newfs_%s%s not found%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count %s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad sectors/track%s: bad spare sectors per cylinder%s: bad total tracksinsane maxpartitions value %d%s: mount: %sabnormal terminationioctl (WDINFO)%s: can't rewrite disk label-N do not create file system, just print out parameters-O create a 4.3BSD format filesystem-P src populate mfs filesystem-S sector size-T disktype-a maximum contiguous blocks-b block size-c cylinders/group-d rotational delay between contiguous blocks-e maximum blocks per file in a cylinder group-f frag size-g average file size-h average files per directory-i number of bytes per inode-k sector 0 skew, per track-l hardware sector interleave-m minimum free space %%-n number of distinguished rotational positions-o optimization preference (`space' or `time')-p spare sectors per track-r revolutions/minute-s file system size (sectors)-t file system type-u sectors/track-x spare sectors per cylinder-z tracks/cylinderusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s: exitedchdircannot stat %s%s: not a dir or a block device-rw-pe/bin/paxcopy %s to %s failedunmount %srmdir %smount %s %s/mnttmp mountpoint %s busygettmpmnttmp mountpoint %s too longmntXXXXXXXXXXmkdtemp %stmp mount point too long%s: initializing cg %ld/%d siginfopreposterous size %dpreposterous ntrak %dpreposterous nsect %dillegal expected average file size %dillegal expected number of files per directory %dblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dno block size to support this diskminimum bytes per inode isWith a block size of %d %s %ld With %d sectors per cylinder, minimum cylinders per group is %ld CylinderWarning: cylinder%s groups must have a multiple of %ld cylinders panic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %ld cylinders!mapcramped && !inodecrampedBlock size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder (not %d) File system performance may be impaired. and ntrakrotational layout tables with nsect%s %s %d %s %d.%sWarning: insufficient space in super block for Warning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. mkfsfsinit failedsuper-block backups (for fsck -b #) at:%s: %d sectors in %d %s of %d tracks, %d sectors %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) cg summaryWarning: %d sector(s) in last cylinder unallocated filesystem must have at least %d sectorsinode blocks/cyl group (%ld) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increased%s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment sizeWith %d bytes per inode, Minimum bytes per inode is %ld block size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %dpanic: cylinder group too bigcg 0: bad magic numberinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic number (0x%06x != 0x%06x)fsinit: inode value %d out of rangerdfs: read error on block %dwtfs: write error on block %disblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d dfiPRrWrm_overwrite%s (inode %u): not overwritten due to multiple links%s: malloccheckoverride %s%s%s/%s for %s? remove %s? "." and ".." may not be removedusage: %s [-dfiPRrW] file ... bsfbsrdensityeomfsffsrofflinerewindrewofflretensionweoff:%s: illegal count%s: unknown commandioctl MTIOCGETWriteProtectMounted76543210%s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) %d: unknown tape drive type usage: %s [-f] device usage: %s [-f device] command [ count ] Lost connection to remote host.shell/tcp: unknown service/etc/rmtwho are you?invalid user name: %sO%s %d rmtopenC S I%d %d ioctlrmtioctlProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pusage: %s [-p] [-m mode] dirname ... $OpenBSD: compile.c,v 1.20 2004/07/10 11:41:26 otto Exp $0123456789/\$invalid command code %cextra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandunexpected }branchempty labelread commandw commandfilename expectedunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashextra text at the end of a transform commandcommand %c expects up to %d address(es), found %dcommand expectedunexpected EOF (pending }'s)\ can not be used as a string delimiternewline can not be used as a string delimitercompile_reRE error: %sunterminated substitute in regular expression123456789\%c not defined in the REunescaped newline inside substitute patternnumber in substitute flags out of rangemore than one number or 'g' in substitute flagsbad flag in substitute command: '%c'compile_flagsno wfile specifiedunterminated transform source stringcompile_trtransform strings are not the same lengthunterminated transform target stringtransform pattern can not be delimited by newline or backslashcompile_textexpected context addressunterminated regular expressionwhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'$OpenBSD: main.c,v 1.9 2003/06/10 22:20:50 deraadt Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s ..."$OpenBSD: misc.c,v 1.6 2004/07/20 03:50:26 deraadt Exp $sed: %lu: %s: $OpenBSD: process.c,v 1.12 2003/11/07 02:58:23 tedu Exp $\%d not defined in the REflush_appends\ \abfnrtv%03ofirst RE may not be empty7794 9X 9X, @A" 9\, 9 98C 9d< 9> 9; D" P! 9\, 9\, 9l: 98( 9@= 9@= <E HM\;K `;F d;` h;V p;` |;V ;,S ;_ ;T ;F ;T ;W ;F ;XZ ;S ;8M ;M ;` ;F ;$p ;G <X -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$),= 0> D> T> `> x>$ > >| >p >< > B Dp > TȜ >؏ >d ?( ? $? 0?@ @?  L? X?ا d?` p?L ?< ?( ? ?T ? ? ?$ ? ?` @ @ @ <@ X@ h@ |@0 @̤ @ ЯP @L 8A` @ @Ļ @ @ @8 A Ahb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /.&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD$PD++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():,H8HDHIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }`LPD\VNC\OahOtOc|OOOeOOOik(lOX mOC%nOfOOxJbOuOP PpTCrlssPh vM$P,P8PHPXPxlet(SS S(S ,S R | 4S  > V\V(VF 8V j DV DLLVXVdVlVtV|V@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBunable to allocate memoryLPrestricted shell - can't cdOLDPWDdon't know current directoryCDPATH%s: bad directorytoo many argumentsno OLDPWDno home directory (HOME not set)can't get current directory - %sRnprsu,-p: %s-u: %s: %spvVpv is a reserved word special is a%s shell builtin is a function undefined (autoload from %s) tracedn exported%s is *GOK*exported is an %salias for alias %s= is a tracked %salias for not foundL#R#UZ#fi#lprtuxfunction %s %T %s() %T %s: not identifierexportreadonly%s[%d]typeset -U -u -l -Z -R%d -L%d -t -r -x -i only -t, -u and -x options may be used with -funalias-tadprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzjob control not enabled%%%*d %*s %s%*d %*d %sls:bad signal `%s'Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %s: arguments must be jobs or process IDsmissing name argument%s: is not an identifierarguments changed since last callOPTARGc_getopts: no argvmissing options argumentlm+alias+cd+command*=export+fc+getopts+jobs+killlet*=readonly=typeset+unaliaswhence+bg+fg%s%*ldm%ld.%02lds%snothing to shift%s: bad numberc_umask=+-rwxugoXsbad maskaugo%#3.3o ugorwxprsu,%s is read onlytrap -- bad signal %s%s: can only %s %d level(s)%s: cannot %sfv%s%*ld.%02ld%sreal user sys system user real :ptime: -%s requires an argumenttime: -%s unknown option*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unset-tmissing ]internal error: unknown opunexpected operator/operandmissing closing parenmissing argumentmissing expression operatormissing second argumentexpression expectedtime(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)ulimit: %cunlimited%-20s unlimited bad limit: %sexceeds allowable limitinvalid limit: %sx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}*&;#|<>"'`beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-fileprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcommentx_search_hist I-search: nothing to yank yank something first%s = '%s' %s: no such functioncannot bind, not a ttyPOSIXparameter null or not setexpand(NULL)%S%s: bad substitutionsubstitute%s: parameter not set%s: cannot open $() input%Rfunny $() command: %s*+?@! coprocess already existsPS4%s: can't find function definition file%s: can't find function definition file - %s%s: function not defined by %sCFUNC %d%s: can't open function definition file %s - %s%s: cannot execute - %s%s: restrictedcommand -p: restrictedbuiltin: %s: not a builtinEXECSHELL%s: %s: %sshcomexec: %scould not finish (dup) redirection %s: %sdupcannot %s %s: %s%s%s herein: yylexerror writing %s: %scan't %s temporary file %s: %shere document missing-rPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)%s: unexpected `%s'end of expression%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )missing :zero divisorhistory functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,-%c%scan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e%.*s ${FCEDIT:-/bin/ed} $_error reading temp file %s - %scannot open temp file %serror writing temporary file - %scannot create temp file %s - %s-16substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrinkinternal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againillegal file descriptor namefd not open for readingfd not open for writingbad file descriptorno coprocess/tmp%s/shXXXXXXXXstoppedrunning and You have %s%s%s jobs no such jobambiguousargument must be %job or process idwarning: won't have full job controlj_init: tcsetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcgetpgrp() failed: %sj_init: getpgrp() failed: %s[%d]jw:last procchildexchild: execute() returnedexchild: XPIPEI and no last_job - pid %dcannot fork - try againwaitlast: no last jobjw:waitlastwaitlast: not startedjw:waitfor| jw:resumecannot continue job %s: %sfg: 2nd tcsetpgrp(%d, %d) failed: %s1st tcsetpgrp(%d, %d) failed: %s[%d] job not job-controlledjobsnotifyzombiej_async: bad nzombie (%d)j_async: job not startedj_waitj: tcsetpgrp(%d, %d) failed: %scheckjobcheck_job: job started (flags 0x%x) Running (core dumped)%-20s %s%s%sj_print%s%5d %-20s %s%s %s%s%s%s %5d [%d] %c DoneDone (%d)remove_job: job not found (%s)no closing quote here document `%s' unclosed PS1PS2dopprompt\%c%r%l:%M:%S%a %b %d~/%smissing ] MAILyou have mail in $_typesetKSH_VERSION-xPPIDOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccdatemailmakeprviwhopdkshENVSH_VERSION$ /etc/suid_profile/etc/profile$HOME/.profileCannot determine current working directory-c requires an argumentUSERinclude: %dUse `exit' to leave ksh shell: %dalloc: %s%s%s-`%c' requires argument%s%s-%c: unknown option |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEFallexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivemarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextrace%-*s %sCurrent option settings -o %sgetoptionsparse_args: `%c'%s: bad optionA:o;sgmatch'\'%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_reopen: missing read/writeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: bsize %dshf_read: flags %xshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: no fdshf_putchar: flags %xshf_write: nbytes %dshf_write: flags %xshf_snprintf: buf %lx, bsize %dshf_vfprintf0123456789abcdef(null %s)too many <<'s for%s: bad identifier too many redirections %s: invalid function name thenelseeliffiesacwhileuntildo{}[[&&||;;((|&unexpectedunmatchedsyntax error: `%s' %s ?%dsyntax error: unexpected EOF Error handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-args# #no-vars# ( %T) %T| %T%;%T%s %T ]] %Sdo%N%T%;done in %;for %s select %s case %S in%N(%S%c%;%T%N;;%Nesac %s %T%;doif %Telif %Telse%;%T%;fi then%N%T{%;%T%;} %T& function %s %T%s() %Ttime %T%T|& < >| <> <<- << >> <&>&wdscan: unknown char 0x%x (carrying on)j_ttyinit: can't set close-on-exec flag: %sj_ttyinit: dup of tty fd failed: %sNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorOPTINDPOSIXLY_CORRECTHISTSIZEVISUALMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENO%s: subscript out of range0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZsetstr: %s=%s: assigning to self%s: is read only%0*s%.*s%*s%.*sy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-%s: destination pathname too longdo_moverename %s to %scan't remove %scannot resolve %s: %scannot rename a mount point%s: remove%s: set times%s: set flags%s: set mode%s: set owner/group%s: set owner/group; not setting setuid/setgid%s: waitpid/bin/cp%s: terminated with %d (non-zero) status%s: did not terminate normally/bin/rm-rf-PRpusage: %s [-fi] source target %s [-fi] source ... directory |&=<>+-*/%:()syntax erroreval5division by zeronon-numeric argument_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: dmesg [-M core] [-N system] sethostnamegethostnameusage: %s [-s] [name-of-host] $Id: logout.c,v 1.7 2004/05/28 07:03:47 deraadt Exp $/var/run/utmplogout%s: not a device nodereadlabelfs%s: bad filesystem type in label%s: couldn't read disklabel$Id: login_tty.c,v 1.6 2004/05/28 07:03:47 deraadt Exp $%s%s%s%c$NetBSD: getrawpartition.c,v 1.1 1996/05/16 07:03:33 thorpej Exp $/etc/fbtab(null)%s: bad entry: %s%o%s: %s: %mlogin_protect/*%s: chown(%s): %m%s: chmod(%s): %m%s: opendir(%s): %m$OpenBSD: fmt_scaled.c,v 1.6 2005/03/09 09:27:57 otto Exp $%lld.%1lld%c%lld%c0B$Id: logwtmp.c,v 1.8 2004/09/18 19:22:09 deraadt Exp $/var/log/wtmplogwtmp$NetBSD: getmaxpartitions.c,v 1.1 1996/05/16 07:03:31 thorpej Exp $$OpenBSD: fparseln.c,v 1.5 2004/05/28 07:03:47 deraadt Exp $\\#TERMPATHtgetent.termcap /usr/share/misc/termcap/usr/share/misc/termcapTERMCAPOOPS?Ynacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error yn: DOMAIN error ynynflgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10: SING error log10log10flog10: DOMAIN error pow(0,0): DOMAIN error powfpowpow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanh: DOMAIN error atanhatanhfatanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error 0C0longjmp botch. $OpenBSD: sigcompat.c,v 1.4 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: bsearch.c,v 1.4 2003/06/02 20:18:37 millert Exp $no errorunknown/invalid errorresolved protocol is unknowninvalid value for hintsmemory allocation failureaddress family for name not supportedservice not supported for ai_socktypeai_socktype not supportedai_family not supportedno address associated with namenon-recoverable failure in name resolutiontemporary failure in name resolutionname or service is not knowninvalid value for ai_flagsxxswfstabscanfstab: $OpenBSD: strtok.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: heapsort.c,v 1.6 2003/09/08 16:24:05 deraadt Exp $$OpenBSD: nice.c,v 1.6 2003/06/02 20:18:34 millert Exp $rcmd: socket: %s rcmd: socket: All ports in use $OpenBSD: rcmd.c,v 1.51 2005/03/08 18:34:42 deraadt Exp $RSH%s: %s rcmd_afconnect to address %s: rcmd: %s: %s socket: protocol failure in circuit setup. rcmd: accept: %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: write (setting up stderr): %s iruserok%s/.rhosts.rhosts lstat failed.rhosts not regular fileiruserok_sa.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owner/etc/hosts.equiv__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopgetnameinfoip6_parsenumeric$OpenBSD: rcmdsh.c,v 1.9 2004/04/01 04:14:29 marc Exp $/usr/bin/rshlocalhostrcmdsh: socketpairrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: execvp %s failed: %s -lrcmdshrcmdsh: setuid(%u): %s rcmdsh: fork failedrcmdsh: unknown user: %s (iDiTipiiResolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with nameResolver internal errorUnknown resolver error$OpenBSD: rresvport.c,v 1.6 2003/06/03 02:11:35 deraadt Exp $rresvport_af$OpenBSD: killpg.c,v 1.5 2003/06/02 20:18:33 millert Exp $$OpenBSD: strcoll.c,v 1.4 2003/06/11 21:08:29 deraadt Exp $$OpenBSD: rand.c,v 1.7 2003/06/02 20:18:38 millert Exp $%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%ukkkPkkkkkkkkkkk-k>kkkkll lll$l,ld4l?@[\]^_`{|}~lowerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ punct!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefalnumABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789NULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL[:<:]][:>:]]$OpenBSD: auth_unix.c,v 1.17 2005/01/08 19:17:39 krw Exp $authunix_createauthunix_create: out of memory authunix_create_defaultauth_none.c - Fatal marshalling problemk,t4t@tHt\tltxttttttttttu(u4u@uPudu|uuuuuuvv,vk,t4t@tHt\tltxttttttttttu(u4u@uPudu|uuuuuuvv,voption requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %s$OpenBSD: getopt_long.c,v 1.17 2004/06/03 18:46:52 millert Exp $$OpenBSD: inet_net_pton.c,v 1.3 2003/04/25 19:40:25 henning Exp $0123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 9n >= 0 && n <= 15$OpenBSD: assert.c,v 1.7 2003/06/11 21:03:10 deraadt Exp $assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" ipx_addr%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x,%x,%x%3x%3o%3drb0b1ncdtscilhssbpxbxfxoxtxdxsimulated$OpenBSD: getcap.c,v 1.22 2004/05/18 02:05:52 jfb Exp $getenttc%s.dbcgetnext|:$OpenBSD: strcspn.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: setenv.c,v 1.7 2005/02/16 21:20:22 millert Exp $$OpenBSD: strspn.c,v 1.4 2003/06/11 21:08:29 deraadt Exp $execlexecleexeclpexecvpexecvp: : path too long $OpenBSD: strsep.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: authunix_prot.c,v 1.4 2001/09/15 13:51:00 deraadt Exp $$OpenBSD: xdr_array.c,v 1.6 2002/08/01 01:05:24 deraadt Exp $xdr_array: out of memory $OpenBSD: rpc_commondata.c,v 1.4 2003/12/31 03:27:23 millert Exp $LC_ALLLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_MESSAGES/usr/share/localePATH_LOCALE%s/%s/%s/%s/%s/%sloadlocale%s/%s/%sLANG$OpenBSD: realpath.c,v 1.11 2004/11/30 15:12:59 millert Exp $realpath__opendir2$OpenBSD: qsort.c,v 1.8 2003/06/02 20:18:38 millert Exp $$OpenBSD: rindex.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $__svfscanf$OpenBSD: gethostnamadr.c,v 1.60 2004/07/29 03:09:40 itojun Exp $gethostby*.getanswer: asked for "%s", got "%s"-_/getanswergethostby*.getanswer: asked for "%s %s %s", got type "%s"gethostbyaddr%x.%x.ip6.arpa/etc/hosts%u.%u.%u.%uhosts.byaddr_yp_gethtbyaddrhosts.byname$OpenBSD: bcmp.c,v 1.6 2004/11/28 07:16:54 mickey Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$%s%.*s$md5crypt$OpenBSD: md5.c,v 1.7 2004/05/28 15:10:27 millert Exp $MD5Pad warning: malloc_initmmap(2) failed, check limits unknown char in MALLOC_OPTIONS MALLOC_OPTIONS/etc/malloc.confallocation failed malloc() has never been called junk pointer, too high to make sense modified (chunk-) pointer chunk is already free pointer to wrong page modified (page-) pointer junk pointer, too low to make sense recursive call in malloc(): in free(): in realloc():page is already free freelist is destroyed $OpenBSD: exit.c,v 1.9 2003/06/02 20:18:37 millert Exp $stack overflow in function %s$OpenBSD: getdtablesize.c,v 1.3 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: clnt_udp.c,v 1.21 2005/01/08 19:17:39 krw Exp $clntudp_create: out of memory clntudp_callС̡''''''gethostby*.getanswer: asked for "%s", got "%s"explore_numeric# _gethtentipnodes.bynameres_querydomainNres_query%.*s.%.*sres_querydomainHOSTALIASES__hostalias __res_nameinquery__res_queriesmatch__res_send 48T\lp   ȫ̫    (<@P%TXlt qЬSܬ,$48DHhl !"Эح (LTdltef#̮Ԯ%d day%s%d hour%s%d min%s%d sec%s0 secssystatdaytimenetstatqotdchargenftp-datatelnetsmtprlpwhoisaptsapfsbootpsbootpctftprjefingersupdupnewaccthostnamesiso-tsapx400x400-sndcsnet-nspop-2sunrpcauthsftpuucp-pathnntperpcntpstatsrvprofileNeWSsnmpsnmp-trapprint-srvicmpigmpggpuclegpigpnvp-IIpupchaos;; res options:;; ->>HEADER<<- opcode: %s, status: %s, id: %u; flags:; Ques: %u, Ans: %u, Auth: %u, Addit: %u;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: __fp_nquery ;; ...malformed ;; ...truncated ad UNUSED-BIT-ON ra rd tc aa qr__p_cdnname__p_fqname %lu;; packet size error (found %ld, dlen was %d) __p_rr %s ; proto %u, port %u ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %s %s ( "\ ""?" ;; *** Warning *** OS-type missing ; LABELS WRONG (%d should be %d) ( %s ) ; BAD BASE640x%04x %u ( %u %u %u %u %u %u "%.*s" ?%d? %uINCHAOSHSHESIODANYname serverMDmail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authorityMBmailboxMGmail group memberMRmail renameNULLnullWKSwell-known service (deprecated)PTRdomain name pointerHINFOhost informationMINFOmailbox informationMXmail exchangerTXTRPresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressrouterNSAPnsap addressNSAP_PTRsignaturePXmapping informationGPOSgeographical position (withdrawn)AAAALOClocationNXTnext valid name (unimplemented)EIDendpoint identifier (unimplemented)NIMLOCNIMROD locator (unimplemented)SRVserver selectionATMAATM address (unimplemented)IXFRincremental zone transferAXFRMAILBmailbox-related data (deprecated)MAILAmail agent (deprecated)UINFOuser information (nonstandard)UIDuser ID (nonstandard)GIDgroup ID (nonstandard)NAPTRURN Naming Authority"any"?0x%lx?usevcigntcprimry(unimpl)aaonly(unimpl)defnamdnsrchstyopninsecure2edns0insecure1recurs%ld.%.2ld%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %sm; error: unknown LOC RR versionABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~QUERYIQUERYCQUERYMCQUERYUNOTIFYUPDATEAUPDATEDUPDATEDAUPDATEMUPDATEMAZONEINITZONEREFNOERRORFORMERRSERVFAILNXDOMAINNOTIMPREFUSEDNOCHANGE  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~%u.%u.%u.%uinet_ntop4inet_ntop6/&/etc/resolv.conf;#lookupsearchnameserversortlistres_initRES_OPTIONSenvLOCALDOMAINndots:$OpenBSD: atoi.c,v 1.3 2003/06/02 20:18:37 millert Exp $01234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~$OpenBSD: strcasecmp.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: _yp_check.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: yp_get_default_domain.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $/etc/services,/$OpenBSD: fgetln.c,v 1.5 2004/09/28 18:12:44 otto Exp $$OpenBSD: strpbrk.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: strtol.c,v 1.5 2003/06/02 20:18:38 millert Exp $$OpenBSD: strtoul.c,v 1.5 2003/06/02 20:18:38 millert Exp $syslog_r: unknown facility/priority: %xvsyslog_r<%d>Error %d[%ld]%h %e %T syslog: unknown facility/priority: %xconnectlog_r/dev/log@DHLPTX\`dhlpxP̺غܺ $,8DP`dh$OpenBSD: strftime.c,v 1.14 2004/10/18 22:33:43 millert Exp $JanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %YAMPM%a %b %e %H:%M:%S %Z %Y_fmt%Y-%m-%d%H:%M%04ld%2d%03d%I:%M:%S %p%e-%b-%Y%04d_conv_lconvGMTmn/usr/share/zoneinfotzload/etc/localtimeposixrules,M4.1.0,M10.5.0TZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec%.3s %.3s%3d %02.2d:%02.2d:%02.2d %-4ld %.3s %.3s%3d %02.2d:%02.2d:%02.2d %ld $OpenBSD: strstr.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: ypmatch_cache.c,v 1.11 2003/06/25 21:51:56 marc Exp $yp_match: clnt_callyp_next: clnt_call$OpenBSD: yp_bind.c,v 1.14 2003/06/02 03:48:42 deraadt Exp $/var/run/ypbind.lock_yp_dobindclntudp_createfcntl: F_SETFDYP server for domain %s not responding, still trying clnttcp_create%s/%s.%d/var/yp/binding <Phx4Pd0Ld$OpenBSD: clnt_perror.c,v 1.15 2002/09/10 05:39:07 deraadt Exp $; errno = %s ; s1 = %u, s2 = %u ; why = (unknown authentication error - %d) ; low version = %u, high version = %u RPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolRPC: (unknown error code)%s: %s - %s Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)$OpenBSD: strerror.c,v 1.6 2004/05/03 05:07:34 espie Exp $$OpenBSD: strlcat.c,v 1.11 2003/06/17 21:56:24 millert Exp $$OpenBSD: clnt_tcp.c,v 1.20 2005/01/08 19:17:39 krw Exp $clnttcp_create: out of memory $OpenBSD: auth_none.c,v 1.7 2001/09/15 13:51:00 deraadt Exp $$OpenBSD: rpc_prot.c,v 1.8 2005/01/08 19:17:39 krw Exp $$OpenBSD: xdr_mem.c,v 1.10 2004/09/14 22:20:01 deraadt Exp $bindresvport_sa$OpenBSD: pmap_getport.c,v 1.8 2005/01/08 19:17:39 krw Exp $$OpenBSD: pmap_prot.c,v 1.4 2002/02/13 22:36:52 deraadt Exp $$OpenBSD: xdr_rec.c,v 1.9 2002/02/16 21:27:24 millert Exp $xdrrec_create: out of memory perror$OpenBSD: strerror_r.c,v 1.2 2004/05/03 05:07:34 espie Exp $Unknown error: _catopen/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LNLSPATH$OpenBSD: index.c,v 1.4 2003/06/02 20:18:38 millert Exp $ $8Ph|$-$HXh|0t@dx,Ld|8H`8\p,Dh|,DXt$OpenBSD: errlist.c,v 1.7 2003/06/02 20:18:34 millert Exp $Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not found$OpenBSD: strlcpy.c,v 1.8 2003/06/17 21:56:24 millert Exp $$OpenBSD: xdr_ypbind_resp.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypbind_binding.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypbind_resptype.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: strdup.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: xdr_ypreq_key.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_domainname.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_mapname.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypresp_key_val.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_keydat.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypresp_val.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_valdat.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypstat.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr.c,v 1.7 2005/01/08 19:17:39 krw Exp $xdr_bytes: out of memory xdr_string: out of memory $OpenBSD: ypprot_err.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: db.c,v 1.8 2003/06/25 21:15:04 deraadt Exp $$OpenBSD: rec_open.c,v 1.9 2003/06/02 20:18:34 millert Exp $$OpenBSD: bt_open.c,v 1.11 2003/06/02 20:18:33 millert Exp $%s/bt.XXXXXX$OpenBSD: bt_get.c,v 1.6 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_conv.c,v 1.7 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_put.c,v 1.11 2005/01/03 22:30:28 millert Exp $__bt_put$OpenBSD: bt_delete.c,v 1.9 2005/01/03 22:30:28 millert Exp $$OpenBSD: bt_seq.c,v 1.9 2005/01/03 22:30:28 millert Exp $$OpenBSD: bt_search.c,v 1.8 2005/01/03 22:30:28 millert Exp $$OpenBSD: bt_utils.c,v 1.7 2005/01/03 22:46:43 millert Exp $$OpenBSD: getenv.c,v 1.6 2003/06/02 20:18:37 millert Exp $$OpenBSD: vfprintf.c,v 1.28 2004/09/28 18:12:44 otto Exp $__sbprintfbug in vfprintf: bad baseInfNaN__find_argumentsexponent?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZ@=| > A(> =d> > $>(>0> Xz` 8>t @> $OpenBSD: modes.c,v 1.9 2004/09/16 09:55:09 deraadt Exp $$OpenBSD: print.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $````````aaaaa a(a0a8a@aLaXa`ahaxaaa`aaaaa%a(aaPyPyPyPyPyPyPy%(ZPyPy!Py`PyPy%PyPyi/tmp/EdDk.aXXXXXXXXXX:$OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: editor.c,v 1.99 2005/01/07 21:58:14 otto Exp $````````aaaaa a(a0a8a@aLaXa`ahaxaaa`aaaaa%a(aaPyPyPyPyPyPyPy%(ZPyPy!Py`PyPy%PyPyi abcdfiklnoprstuvwxBDEGHLPTUXYZ0tdX<hTCLd80<@hTC|nd0<PhTCn0<PhTC(dGh~dG\~t~,(̉\Th~\~t~TC8T.? ɚ; ...@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.14 2005/02/03 05:03:50 jaredy Exp $````````aaaaa a(a0a8a@aLaXa`ahaxaaa`aaaaa%a(aaPyPyPyPyPyPyPy%(ZPyPy!Py`PyPy%PyPyi@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.16 2004/05/21 02:11:33 jolan Exp $xl!( , 0 4  ؎Ȏ@̑$OpenBSD: cmp.c,v 1.5 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.23 2005/03/10 00:22:08 jaredy Exp $P.|$OpenBSD: print.c,v 1.23 2005/01/10 20:16:15 otto Exp $$OpenBSD: util.c,v 1.11 2003/08/06 19:09:09 tedu Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. @(#)ping.c 8.1 (Berkeley) 6/5/93.dA$$%%%DLgt<$);))) ) ) P ) )))))L))A$***** *0* 8*@@*H*"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)5al<55bl@d55Bl 646cl`666dlA,66el7$787flX7p7Fl77gl77(8hl\8x8HA 88il889jl,9<9Jl!`99lHLl99ml999nl"9:(:plH\PlH:qlT:|::rl"0::;sl!D;\;Sl!(|;;ul"D;;;Vlwl" ; <T<xl(T<<XlA8<<yl<=zl4(=@="ll`=~l!l==?lT#l@==.lA==T (press RETURN)... (interrupt to abort),l,,381@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUl4fgl4gg(gA8gBCDHgEXgFhgGxgUЯV%agb|cgefghgigLglgngqgqgrgshvhw$hx0hu@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.16 2003/07/29 18:38:36 deraadt Exp $$OpenBSD: mount_msdos.c,v 1.18 2003/07/03 22:41:40 tedu Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $&&@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.13 2003/06/02 20:06:15 millert Exp $ pwwwAwwBwxx,xC@x`x71xxxxxDxy y@yTy%y-yy y yC z81(z Hz Xzhz*zzzkacde fm(nTpqTrsTtxA*DECM%P R-S TF71Pȳ 8d؅@l pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD LABEL@̋ԋ܋<  Ġ   $ $0  ,4` @!H"P#\$d%h&p't()*+,-`xg$a$aprH7-Pysend account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote filelist contents of remote directoryterminate ftp sessionexecute macrotoggle use of EPSV/EPRT on IPv4 ftpset file transfer formattoggle gate-ftp; specify host[:port] to change proxytoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryprint local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingview a remote file through your pagertoggle passive transfer modetoggle use of PORT/LPRT cmd for each data connectiontoggle preservation of modification time of retrieved filestoggle transfer progress metertoggle interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecountremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose mode=t8 @W̚TC|`Ԛ(xgĘxܚ CF@-.(O\lA(\C?Fԙ-@1@4(\CP(\ C tpHĠPt+Ț(-$X)l44,TtBĘxx0TUЕ<q@44ܛP$1<5̎4| @H8=Dp5 Hܛ  U@`Od*?XzhSp<#X80O"`Px()-ȡ(BLgX: *4Sh@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. X(̚ 4@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.26 2004/07/09 18:49:57 deraadt Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.17 2003/07/03 22:41:40 tedu Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $HPATH=/usr/bin:/usr/sbin:/bin:/sbin/sbin/dhclient-script( 0(EHC P E(  0(EHDHC Pyf$aftMf|ffff(f4fDf Pf `f |f -f LfLf$afLfLf_f_ff-f,pf<fTlfp-f_f$af_f_f_f$af f!_f"(f#<_f$Tpf%df&|_f'Lf(f)f*f+f,f-pf.Lf/$f04f1H$af2`f3ppf4pf5$af6f7Lf8-f9f:f;$Lf<<f=Tf>`f?lLf@|fALfBLfCfDfEfFfGfHfIfJfK(fLPLfM\fNhfOtfPfQfRfSfTfUfVfWfXfYfZf[f\f] f^,f_8f`DfaPfb\fchfdtfefffgfhfifjfkflfmfnfofpfqfrfs(ft4fu@fvLfwXfxdfypfz|f{f|f}f~ffffffff ff$f0f<fHfTf`flfxffffffffffffff f,f8fDfPf\fhftfffffffffffffff(f4f@fLfXfdfpf|ffffffffffff ff$f0f<fHfTf`flfxffffffffffffff f,f8fDfPf\fhftfffffffffffffff(f4f@fLfXfdfpf|fffff249:;<=   !"#$%&'()*+,-./017>?@ABCDEFGHIJKLNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~;Zx0N$OpenBSD: buf.c,v 1.16 2003/10/18 19:15:43 jmc Exp $k$OpenBSD: cbc.c,v 1.13 2004/05/08 07:05:19 deraadt Exp $@ $OpenBSD: glbl.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: io.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: main.c,v 1.28 2003/06/11 23:42:12 deraadt Exp $ o<H$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.8 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.29 2004/12/13 20:25:34 otto Exp $Py$OpenBSD: utils.c,v 1.26 2004/12/10 10:23:30 jmc Exp $lptx|@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.18 2004/07/01 18:25:47 otto Exp $ ... ...````````aaaaa a(a0a8a@aLaXa`ahaxaaa`aaaaa%a(aaPyPyPyPyPyPyPy%(ZPyPy!Py`PyPy%PyPyi@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.36 2005/03/13 13:53:23 markus Exp $DS $OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.50 2004/08/12 07:53:50 otto Exp $P!\!h!l!t!!!!!!! %@!@@ @%s: can't read disk label; disk type must be specified (HXl4Pp @Th$OpenBSD: mkfs.c,v 1.46 2005/01/06 08:57:30 otto Exp $......@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.17 2004/06/02 06:58:54 otto Exp $@(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mt.c,v 1.23 2003/06/02 23:32:08 millert Exp $m$(,@<4 @ 8<@HPp<Xd`@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.17 2004/07/01 18:25:47 otto Exp $ {}abcdDgGhHilnNpPqrs tw xy !:#=@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. &\`&$' / P`LPDhL`LtLC\V 1`LMxL`LMLLL LMM M8MPMhMxMMMMM M0MMuxqMMPM0%lsMMM _@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.30 2004/12/13 20:22:52 otto Exp $@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: dmesg.c,v 1.17 2003/06/02 20:06:14 millert Exp $Y@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: hostname.c,v 1.7 2003/06/02 23:32:08 millert Exp $````````aaaaa a(a0a8a@aLaXa`ahaxaaa`aaaaa%a(aaPyPyPyPyPyPyPy%(ZPyPy!Py`PyPy%PyPyiBKMGTPE@$OpenBSD: termcap.c,v 1.8 2003/06/02 20:18:42 millert Exp $$OpenBSD: tgoto.c,v 1.3 2003/06/02 20:18:42 millert Exp $$OpenBSD: tputs.c,v 1.3 2003/06/02 20:18:42 millert Exp $5MS7) $OpenBSD: setjmperr.c,v 1.4 2004/05/18 02:05:52 jfb Exp $ b$OpenBSD: signal.c,v 1.6 2004/05/03 17:25:00 millert Exp $`b$OpenBSD: sethostname.c,v 1.7 2003/07/15 17:32:41 deraadt Exp $$OpenBSD: vis.c,v 1.13 2004/05/18 02:05:52 jfb Exp $$OpenBSD: fstab.c,v 1.13 2004/05/18 02:05:52 jfb Exp $ddd$OpenBSD: asprintf.c,v 1.10 2003/06/17 21:56:24 millert Exp $$OpenBSD: inet_makeaddr.c,v 1.4 2003/06/02 20:18:35 millert Exp $Pe$OpenBSD: getservbyport.c,v 1.6 2004/10/25 03:09:01 millert Exp $g$OpenBSD: herror.c,v 1.6 2005/03/02 12:26:24 millert Exp $$OpenBSD: wait.c,v 1.4 2004/05/18 02:05:52 jfb Exp $i$OpenBSD: sleep.c,v 1.10 2004/05/18 02:05:52 jfb Exp $$OpenBSD: cfgetospeed.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$OpenBSD: vprintf.c,v 1.5 2004/09/28 18:12:44 otto Exp $(j$OpenBSD: alarm.c,v 1.5 2003/06/11 21:03:10 deraadt Exp $dj$OpenBSD: tcgetpgrp.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$OpenBSD: basename.c,v 1.13 2005/03/02 12:27:26 millert Exp $j$OpenBSD: ftell.c,v 1.5 2004/09/28 18:12:44 otto Exp $$OpenBSD: ipx_ntoa.c,v 1.5 2003/09/26 06:19:25 deraadt Exp $xxxxxxxxH.xx:xx:xx:xx:xx:xx.uuuuu$OpenBSD: setproctitle.c,v 1.10 2005/03/08 15:38:46 moritz Exp $<$OpenBSD: signame.c,v 1.3 2003/06/02 20:18:35 millert Exp $$OpenBSD: getbsize.c,v 1.9 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: ethers.c,v 1.17 2004/02/16 19:41:12 otto Exp $xx:xx:xx:xx:xx:xx$OpenBSD: regerror.c,v 1.12 2004/11/30 17:04:23 otto Exp $$o0oLoXotoooooooop$p0p LpXp lpxp pp p pppqq$qHqTqPyo$OpenBSD: getttyent.c,v 1.7 2004/05/18 02:05:52 jfb Exp $$OpenBSD: ttyname.c,v 1.10 2004/05/18 02:05:52 jfb Exp $$OpenBSD: setmode.c,v 1.16 2005/03/01 13:51:47 miod Exp $$OpenBSD: errx.c,v 1.7 2003/06/02 20:18:34 millert Exp $$OpenBSD: verrx.c,v 1.7 2004/05/18 02:05:52 jfb Exp $$OpenBSD: getproto.c,v 1.6 2004/10/25 03:09:01 millert Exp $$OpenBSD: getprotoent.c,v 1.7 2004/10/25 03:09:01 millert Exp $$OpenBSD: getnetnamadr.c,v 1.23 2003/06/03 21:09:00 deraadt Exp $$OpenBSD: getnetbyaddr.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: getnetbyname.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: getnetent.c,v 1.9 2003/06/02 20:18:35 millert Exp $$OpenBSD: inet_network.c,v 1.8 2003/06/02 20:18:35 millert Exp $$OpenBSD: confstr.c,v 1.6 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: getlogin.c,v 1.9 2003/06/11 21:03:10 deraadt Exp $r$OpenBSD: pwcache.c,v 1.7 2004/05/18 02:05:52 jfb Exp $$OpenBSD: getgrent.c,v 1.21 2004/06/07 21:11:23 marc Exp $sPs$OpenBSD: siglist.c,v 1.3 2003/06/02 20:18:35 millert Exp $$OpenBSD: tcsetattr.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $vvw$OpenBSD: glob.c,v 1.24 2004/10/07 16:34:04 millert Exp $$OpenBSD: getpwent.c,v 1.32 2004/05/18 02:05:52 jfb Exp $x$OpenBSD: err.c,v 1.8 2003/06/02 20:18:34 millert Exp $$OpenBSD: verr.c,v 1.7 2004/05/18 02:05:52 jfb Exp $$OpenBSD: warnx.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: vwarnx.c,v 1.7 2004/05/18 02:05:52 jfb Exp $$OpenBSD: fputc.c,v 1.6 2004/09/28 18:12:44 otto Exp $ty$OpenBSD: fgetc.c,v 1.4 2004/09/28 18:12:44 otto Exp $y$OpenBSD: cfmakeraw.c,v 1.5 2003/06/11 21:03:09 deraadt Exp $z@z$OpenBSD: putchar.c,v 1.6 2004/09/28 18:12:44 otto Exp $$OpenBSD: regcomp.c,v 1.14 2004/11/30 17:04:23 otto Exp $d|l|PyzzPyzjPyzzPyz|Py{{Pyh{p{PyD{Py{{Pyp|Py |(|PyD|L|PyPy||||||ȶ||||| | | ? | | } } } } $}(},}0}4}8}<}@}D}H}L}P}T}.X}a\}`}d}h}l}p}p t}!}"}#}$}%}&}'}(})~* ~+~, ~-(~-8~.@~.~//|Y01L~2P~3X~4`~5h~6l~7t~8|~9~:~;~<~=~>~?~@~[~\\](^4^H_T_``p{|{|}}~$OpenBSD: regfree.c,v 1.6 2004/11/30 17:04:23 otto Exp $`h$OpenBSD: _sys_siglist.c,v 1.2 1996/08/19 08:21:27 tholo Exp $$OpenBSD: siglist.c,v 1.3 2003/06/02 20:18:35 millert Exp $$OpenBSD: siglist.c,v 1.3 2003/06/02 20:18:35 millert Exp $D?Py<$OpenBSD: utime.c,v 1.4 2004/05/18 02:05:52 jfb Exp $$OpenBSD: daemon.c,v 1.5 2003/07/15 17:32:41 deraadt Exp $$OpenBSD: ipx_addr.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: sscanf.c,v 1.7 2004/09/28 18:12:44 otto Exp $$OpenBSD: fts.c,v 1.34 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: regexec.c,v 1.10 2004/11/30 17:04:23 otto Exp $$OpenBSD: engine.c,v 1.14 2005/01/03 19:51:14 otto Exp $$OpenBSD: disklabel.c,v 1.9 2003/06/11 21:03:10 deraadt Exp $````````aaaaa a(a0a8a@aLaXa`ahaxaaa`aaaaa%a(aaPyPyPyPyPyPyPy%(ZPyPy!Py`PyPy%PyPyiЄ$OpenBSD: errno.c,v 1.4 2004/07/17 20:38:43 marc Exp $$OpenBSD: tcsetpgrp.c,v 1.5 2003/06/02 20:18:40 millert Exp $ $OpenBSD: getmntinfo.c,v 1.6 2004/05/18 02:05:52 jfb Exp $$OpenBSD: puts.c,v 1.5 2004/09/28 18:12:44 otto Exp $H$OpenBSD: cfsetospeed.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$OpenBSD: setbuffer.c,v 1.4 2004/09/28 18:12:44 otto Exp $$OpenBSD: cfgetispeed.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$OpenBSD: cfsetispeed.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$OpenBSD: popen.c,v 1.15 2004/08/06 18:31:11 pedro Exp $$OpenBSD: exec.c,v 1.16 2003/06/11 21:03:10 deraadt Exp $ą$OpenBSD: waitpid.c,v 1.5 2003/06/02 20:18:35 millert Exp $$OpenBSD: printf.c,v 1.5 2003/06/02 20:18:37 millert Exp $D$OpenBSD: warn.c,v 1.7 2003/06/02 20:18:35 millert Exp $$OpenBSD: vwarn.c,v 1.7 2004/05/18 02:05:52 jfb Exp $$OpenBSD: setlocale.c,v 1.11 2003/06/02 20:18:35 millert Exp $tCCCCCCC|$OpenBSD: getcwd.c,v 1.11 2005/01/06 03:26:02 millert Exp $$OpenBSD: closedir.c,v 1.5 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: seekdir.c,v 1.6 2004/05/18 02:05:52 jfb Exp $$OpenBSD: opendir.c,v 1.11 2005/03/01 13:51:47 miod Exp $ԇ$OpenBSD: telldir.c,v 1.5 2004/05/18 02:05:52 jfb Exp $$OpenBSD: readdir.c,v 1.7 2004/05/18 02:05:52 jfb Exp $$OpenBSD: fscanf.c,v 1.6 2003/06/02 20:18:37 millert Exp $$OpenBSD: vfscanf.c,v 1.10 2004/09/28 18:12:44 otto Exp $  $OpenBSD: fread.c,v 1.5 2004/09/28 18:12:44 otto Exp $$OpenBSD: ungetc.c,v 1.6 2004/09/28 18:12:44 otto Exp $$OpenBSD: crypt.c,v 1.19 2004/09/14 22:56:57 deraadt Exp $./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:$OpenBSD: md5crypt.c,v 1.13 2003/08/07 00:30:21 deraadt Exp $./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzd$OpenBSD: linkaddr.c,v 1.3 2003/06/02 20:18:35 millert Exp $0123456789abcdef$OpenBSD: malloc.c,v 1.71 2004/08/11 06:22:45 tdeval Exp $$OpenBSD: stack_protector.c,v 1.7 2004/09/14 22:19:30 deraadt Exp $$OpenBSD: findfp.c,v 1.5 2004/09/28 18:12:44 otto Exp $* hllll ll\h$OpenBSD: sysconf.c,v 1.7 2004/05/18 02:05:52 jfb Exp $LXTYYY|ZZ$OpenBSD: res_query.c,v 1.21 2003/06/02 20:18:36 millert Exp $$OpenBSD: res_mkquery.c,v 1.14 2003/06/02 20:18:36 millert Exp $$OpenBSD: res_send.c,v 1.16 2004/11/17 01:42:26 itojun Exp $$OpenBSD: setbuf.c,v 1.4 2004/09/28 18:12:44 otto Exp $$OpenBSD: setvbuf.c,v 1.6 2004/09/28 18:12:44 otto Exp $$OpenBSD: res_debug.c,v 1.18 2005/03/06 16:17:23 moritz Exp $ d'@Bʚ;$OpenBSD: res_comp.c,v 1.11 2003/06/02 20:18:36 millert Exp $$OpenBSD: tolower_.c,v 1.7 2004/05/18 02:05:52 jfb Exp $$OpenBSD: wbuf.c,v 1.7 2004/09/28 18:12:44 otto Exp $$OpenBSD: res_data.c,v 1.2 2003/06/02 20:18:36 millert Exp $ (08@8`LdHPXdlx`Ldph IJ$OpenBSD: nsap_addr.c,v 1.4 1997/07/09 01:08:45 millert Exp $$OpenBSD: toupper_.c,v 1.7 2004/05/18 02:05:52 jfb Exp $β$OpenBSD: inet_ntoa.c,v 1.4 2003/06/02 20:18:35 millert Exp $$OpenBSD: inet_ntop.c,v 1.5 2002/08/23 16:27:31 itojun Exp $$OpenBSD: res_init.c,v 1.30 2004/06/07 21:11:23 marc Exp $h$OpenBSD: gethostname.c,v 1.6 2004/05/18 02:05:52 jfb Exp $$OpenBSD: inet_addr.c,v 1.7 2003/06/02 20:18:35 millert Exp $$OpenBSD: inet_pton.c,v 1.4 2002/02/16 21:27:23 millert Exp $$d$OpenBSD: getdomainname.c,v 1.6 2003/07/15 17:32:41 deraadt Exp $$OpenBSD: fgets.c,v 1.7 2004/09/28 18:12:44 otto Exp $$OpenBSD: getservbyname.c,v 1.9 2004/10/25 03:09:01 millert Exp $$OpenBSD: getservent.c,v 1.9 2004/10/25 03:09:01 millert Exp $ķ$OpenBSD: fopen.c,v 1.4 2004/09/28 18:12:44 otto Exp $$OpenBSD: rewind.c,v 1.4 2004/09/28 18:12:44 otto Exp $$OpenBSD: fseek.c,v 1.6 2004/09/28 18:12:44 otto Exp $8t$OpenBSD: syslog.c,v 1.27 2005/03/08 15:41:03 moritz Exp $$OpenBSD: send.c,v 1.3 2003/06/02 20:18:36 millert Exp $@(#)strftime.c 7.64@(#)localtime.c 7.80$OpenBSD: localtime.c,v 1.25 2004/10/18 22:33:43 millert Exp $WILDABBR@(#)asctime.c 7.22$OpenBSD: asctime.c,v 1.11 2005/03/06 01:40:05 cloder Exp $<$OpenBSD: usleep.c,v 1.9 2004/05/18 02:05:52 jfb Exp $$OpenBSD: vsnprintf.c,v 1.7 2004/09/28 18:12:44 otto Exp $x 0$OpenBSD: fprintf.c,v 1.5 2003/06/02 20:18:37 millert Exp $$OpenBSD: fputs.c,v 1.5 2004/09/28 18:12:44 otto Exp $ Llkn|nn4onXs s\sdslss@t$TwwyTyyyyPw xxyTyyy zPwt<~@dЂ$OpenBSD: perror.c,v 1.7 2004/09/28 18:12:44 otto Exp $X$OpenBSD: catclose.c,v 1.4 1997/07/09 01:08:57 millert Exp $$OpenBSD: catgets.c,v 1.5 1996/09/15 09:31:22 tholo Exp $$OpenBSD: catopen.c,v 1.10 2002/02/16 21:27:23 millert Exp $xTP$OpenBSD: time.c,v 1.4 2003/07/08 00:11:50 jfb Exp $\$hT$OpenBSD: mktemp.c,v 1.18 2004/09/28 18:12:44 otto Exp $$OpenBSD: snprintf.c,v 1.9 2004/04/10 19:34:44 millert Exp $T 0000000000000000}$OpenBSD: ctype_.c,v 1.6 2003/06/02 20:18:34 millert Exp $@D$OpenBSD: _def_monetary.c,v 1.3 1997/07/23 21:14:38 kstailey Exp $$OpenBSD: _def_numeric.c,v 1.3 1997/07/23 21:14:39 kstailey Exp $$OpenBSD: umoddi3.c,v 1.4 2004/10/17 17:49:21 otto Exp $$OpenBSD: isinf.c,v 1.1 2004/02/01 05:30:40 drahn Exp $$OpenBSD: isnan.c,v 1.1 2004/02/01 05:30:40 drahn Exp $$OpenBSD: fclose.c,v 1.4 2004/09/28 18:12:43 otto Exp $$OpenBSD: ftruncate.c,v 1.12 2004/06/07 21:11:23 marc Exp $$OpenBSD: rget.c,v 1.5 2004/09/28 18:12:44 otto Exp $$OpenBSD: refill.c,v 1.7 2004/09/28 18:12:44 otto Exp $$OpenBSD: qdivrem.c,v 1.6 2004/10/17 17:49:21 otto Exp $$OpenBSD: fwrite.c,v 1.4 2004/09/28 18:12:44 otto Exp $$OpenBSD: fvwrite.c,v 1.13 2004/09/28 18:12:44 otto Exp $$OpenBSD: wsetup.c,v 1.6 2004/09/28 18:12:44 otto Exp $$OpenBSD: makebuf.c,v 1.6 2004/09/28 18:12:44 otto Exp $$OpenBSD: getpagesize.c,v 1.5 2004/05/18 02:05:52 jfb Exp $$OpenBSD: sysctl.c,v 1.6 2004/05/18 02:05:52 jfb Exp $$OpenBSD: mmap.c,v 1.12 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: isatty.c,v 1.5 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: tcgetattr.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$OpenBSD: fflush.c,v 1.4 2004/09/28 18:12:44 otto Exp $$OpenBSD: fwalk.c,v 1.5 2004/09/28 18:12:44 otto Exp $T$OpenBSD: pread.c,v 1.6 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: fdopen.c,v 1.4 2004/09/28 18:12:43 otto Exp $$OpenBSD: stdio.c,v 1.6 2004/09/28 18:12:44 otto Exp $$OpenBSD: lseek.c,v 1.11 2004/06/07 21:11:23 marc Exp $$OpenBSD: flags.c,v 1.5 2004/09/28 18:12:44 otto Exp $$OpenBSD: raise.c,v 1.4 2004/05/18 02:05:52 jfb Exp $$OpenBSD: pwrite.c,v 1.6 2003/06/11 21:03:10 deraadt Exp $D D D $OpenBSD: ashldi3.c,v 1.5 2004/10/17 17:49:21 otto Exp $alK$NetBSD: ffs.S,v 1.5 2003/04/05 23:08:52 bjh21 Exp $$NetBSD: strncmp.S,v 1.2 2003/04/05 23:08:52 bjh21 Exp $$NetBSD: strcmp.S,v 1.3 2003/04/05 23:08:52 bjh21 Exp $$NetBSD: memcmp.S,v 1.2 2003/04/05 23:08:52 bjh21 Exp $.shstrtab.init.text.fini.rodata.data.eh_frame.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident PP$tt@@$dd%hdhd$+5>C JQZt _fq44~a  in}of!NI u p + & d _afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3dLGhc" 8 3 r _ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmspfa#A< r m & ! P K  _ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"NI  i d   _ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/csh2_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/csh3proxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T vq ~ > 9 j e !  _ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin"vm,%KB k f  u p / * Q L   nobody*Unprivileged user/nonexistent/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/csh1root\Vpk-( Z U    z + & _tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplg&!72 N I  _rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd . install.md set_term() { [[ -n $TERM ]] && return ask "Terminal type?" ${MDTERM:-vt220} TERM=$resp export TERM md_set_term } welcome() { local _q cat << __EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD in a simple and rational way. At any prompt except password prompts you can run a shell command by typing '!foo', or escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C and then RETURN, but quitting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat << __EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat << __EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat << __EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat << __EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat << __EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it..." } get_dkdevs() { bsort `sed -ne "${MDDISKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}" /var/run/dmesg.boot` } get_cddevs() { bsort `sed -ne "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}" /var/run/dmesg.boot` } get_tapedevs () { bsort $(egrep "^(ct|mt|st|ts|wt)[[:digit:]]+ " /var/run/dmesg.boot \ | sed -e "s/ .*//p" ) } get_ifdevs() { ifconfig -a \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_serialdev() { local _devs _d _bd _td [[ -n $MDSERIAL ]] || exit set -- $MDSERIAL _d=$1 _bd=$2 _td=$3 _devs=$(sed -ne "/^${_d}\([0-9]\) .*/s//\1/p" /var/run/dmesg.boot) _devs=$(bsort $_devs) set -- $_devs echo "${_bd}${1} ${_td}${1}" } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } get_partition() { local _drive=$1 _fstypes=$2 _part _fst disklabel $_drive 2>/dev/null \ | grep '^ [a-p]: ' \ | egrep -v "swap|unused" \ | sed -e 's/^ \(.\): *[^ ]* *[^ ]* *\([^ ]*\) .*/\1 \2/' \ >/tmp/parts.$_drive disklabel $_drive 2>/dev/null | grep '^ .:' ask_which "$_drive partition" "has the $MODE sets" \ "$(sed -e 's/^\(.\).*/\1/' /tmp/parts.$_drive)" [[ $resp == done ]] && return 1 _part=$resp _fst=$(sed -ne "/^$_part /s///p" /tmp/parts.$_drive) ask_which "filesystem type" "should be used to mount $_drive$_part" "$_fst $_fstypes ffs" case $resp in done) return 1 ;; $_fst) resp="$_part" ;; *) resp="$_part $resp" ;; esac return 0 } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while : ; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while : ; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [ "$_a" = "$_b" ] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [ "$_a" != "$_b" ] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file > /tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >> /tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" << __EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null DEVSMADE=$(addel $_dev $DEVSMADE) } addhostent() { sed "/ $2\$/d" /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$1 $2" >> /tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action while : ; do _action= cat << __EOT The following sets are available. Enter a filename, 'all' to select all the sets, or 'done'. You may de-select a set by prepending a '-' to its name. __EOT _next= for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "\nFile name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while : ; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat << __EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat << __EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.* /etc/dhclient.conf if [[ -n $_hostname ]]; then echo "send host-name \"$_hostname\";" >> /etc/dhclient.conf echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >> /etc/dhclient.conf << __EOT request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT cat >> /etc/resolv.conf.tail << __EOT lookup file bind __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && $2 == "0.0.0.0" ]]; then ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 fi mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" > $_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" > $_hn fi ;; esac } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while : ; do ask_until "$_prompt" "$_dr" case $resp in none|dhcp) break ;; esac route delete -inet default > /dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } isalphanumeric() { local _n=$1 while [[ ${#_n} -ne 0 ]]; do case $_n in [A-Za-z0-9]*) ;; *) return 1;; esac _n=${_n#?} done return 0 } enable_network() { local _netfile for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} if ! isalphanumeric "$if"; then continue fi ifconfig $if > /dev/null 2>&1 if [ $? -ne 0 ]; then continue fi while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|""|"rtsol") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= ifconfig $if $name $mask $bcaddr $ext1 $ext2 down cmd="dhclient $if" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) continue ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $(< /mnt/etc/mygate) fi route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat << __EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" "${_get_server_list:-yes}" _get_server_list=$resp if [[ $_get_server_list == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while : ; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp _passwd=root@`hostname` if [[ $_ftp_server_login != anonymous ]]; then resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _mp=$1 _dir=$2 while : ; do ask_until "Pathname to the sets? (or 'done')" "$_dir" case $resp in done) return ;; *) [[ -d $_mp/$resp ]] && { _dir=$_mp/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." ;; esac done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { local _drive _part=c _fstype="-t cd9660" get_drive "CD-ROM" "$CDDEVS" || return _drive=$resp if [[ -z $(disklabel $_drive 2>&1 | grep '^ *c: .*ISO9660') ]]; then unset _fstype get_partition $_drive "cd9660" || return set -- $resp _part=$1 [[ -n $2 ]] && _fstype="-t $2" fi mount $_fstype -o ro /dev/$_drive$_part /mnt2 || return install_mounted_fs /mnt2 "$SETDIR" umount -f /mnt2 > /dev/null 2>&1 } install_disk() { local _drive _part _fstype _fsopts get_drive "disk" "$DKDEVS" || return _drive=$resp get_partition $_drive "$MDFSTYPE" || return set -- $resp _part=$1 [[ -n $2 ]] && _fstype="-t $2" [[ $2 == $MDFSTYPE ]] && _fsopts=$MDFSOPTS mount $_fstype -o ro,$_fsopts /dev/$_drive$_part /mnt2 || return install_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 } install_nfs() { if [ ! -f /sbin/mount_nfs ]; then echo "/sbin/mount_nfs not found. Cannot mount NFS filesystems." return fi ask_until "Server IP address or hostname?" "$_nfs_server_ip" _nfs_server_ip=$resp ask_until "Filesystem on server to mount?" "$_nfs_server_path" _nfs_server_path=$resp _nfs_tcp= ask_yn "Use TCP transport? (only works with capable NFS server)" [[ $resp == y ]] && _nfs_tcp=-T if ! mount_nfs $_nfs_tcp -o ro ${_nfs_server_ip}:${_nfs_server_path} /mnt2 ; then echo "Cannot mount NFS server." return fi install_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _z _bs if [[ ! -x /bin/mt ]]; then echo "/bin/mt not found. Can't $MODE from tape." return fi get_drive "tape drive" "$TAPEDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while : ; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d cat << __EOT You will now specify the location and names of the ${MODE} sets you want to load. You will be able to repeat this step until all of your sets have been successfully loaded. If you are not sure what sets to ${MODE}, refer to the installation notes for details on the contents of each. __EOT while : ; do _d= cat << __EOT Sets can be located on a (m)ounted filesystem; a (c)drom, (d)isk or (t)ape device; or a (f)tp, (n)fs or (h)ttp server. __EOT [[ -z $DEFAULTSETS ]] && _d=done ask "Where are the $MODE sets? (or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) install_cdrom ;; d*|D*) install_disk ;; f*|F*) install_url ftp ;; h*|H*) install_url http ;; m*|M*) install_mounted_fs /mnt ;; n*|N*) install_nfs ;; t*|T*) install_tape ;; *) ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done < /tmp/fstab > /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat << __EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the ${MODE}. __EOT exit fi done < /etc/fstab } check_fs() { local _dev _mp _fstype _rest _fail echo "Checking non-root filesystems..." while read _dev _mp _fstype _rest; do [ "$_dev" != /dev/"$ROOTDEV" ] || continue [ -f "/sbin/fsck_$_fstype" ] || continue _rest=${_dev#/dev/} makedev ${_rest%[a-p]} || continue echo -n "fsck -p ${_dev}..." if ! fsck -fp ${_dev} > /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done < /etc/fstab echo "...done." [ "$_fail" ] && exit } get_fqdn() { local _dn _dn=$(hostname) _dn=${_dn#$(hostname -s)} _dn=${_dn#.} echo "${_dn:=my.domain}" } donetconfig() { local _dn _ns _n configure_ifs if [ -f /tmp/resolv.conf.shadow ]; then mv /tmp/resolv.conf.shadow /tmp/resolv.conf for _n in $(grep '^nameserver ' /tmp/resolv.conf); do [[ $_n == nameserver ]] || _ns="$_ns$_n " done set -- $_ns _ns=$* _dn=$(sed -n \ -e '/^domain[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '/^search[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '${g;p;}' /tmp/resolv.conf) fi ask "DNS domain name? (e.g. 'bar.com')" "${_dn:=$(get_fqdn)}" hostname "$(hostname -s).$resp" ask "DNS nameserver? (IP address or 'none')" "${_ns:=none}" if [[ $resp != none ]]; then echo "lookup file bind" > /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >> /tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _bd _td ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >> /mnt/etc/rc.conf.local fi ask_yn "Start ntpd(8) by default?" no if [[ $resp == y ]]; then echo "ntpd_flags= # enabled during install" \ >> /mnt/etc/rc.conf.local fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" yes if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf > /tmp/sysctl.conf fi fi [[ -z $SERIALDEV ]] && return set -- $SERIALDEV _bd=$1 _td=$2 ask_yn "Change the default console to $_bd?" [[ $resp == n ]] && return ask_which "speed" "should $_bd use" "9600 19200 38400 57600 115200" [[ $resp == done ]] && return echo "stty $_bd $resp\nset tty $_bd" >>/mnt/etc/boot.conf sed -e "/^${_td}/s/std.9600/std.${resp}/" \ -e "/^${_td}/s/unknown/vt220 /" \ -e "/${_td}/s/off/on secure/" /mnt/etc/ttys >/tmp/ttys } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /var/run/dmesg.boot DKDEVS=$(get_dkdevs) CDDEVS=$(get_cddevs) IFDEVS=$(get_ifdevs) TAPEDEVS=$(get_tapedevs) SERIALDEV=$(get_serialdev) DEVSMADE= THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="bsd base${VERSION}.tgz etc${version}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat << __EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b 0123456789abcdefY`)O`(mY` P  @ Y`, $n j Y`H|8̏ܐY`:|8̏ܐ08KY`<Y`+Y`,PY`)ر |̏ܐ< Y`ر |̏ܐY`g$|̏ܐY`H|̏ܐ8V`Y` @@@2X Xd$`Y`Y`4\`8\`<\`@\`D\`Y`Y`P\`Y`Y`T\` ʚ;5ym8@ E82(@AAA==(A*PY`TY`XY`dY``Y`Y`lY`pY`tY`xY`\Y`|Y`Y`hY`gQ X\`X\` HdHdHdHd Hd$Hd(Hd,Hd0Hd4Hd8Hd>??  ` ~ ^ "' AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy84ȥBoldface.iso1 0`wfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp`0`  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ް(`(`2)`)[`a``````````  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~`o^`````  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     `a?` ```&`!,`@($NetBSD: blockio.S,v 1.4 2001/06/02 11:15:56 bjh21 Exp $.symtab.strtab.shstrtab.text.start.data.sbss.bss.arm.atpcs.ident!z`( @.`z`4`z`{9z`Dz`9{`K}`0y  4aK ``  ? "^8-d:`E\UXnK h{P8Q X2 H6 L% 0l`xt',/lB4Op[\ iA{(F , ľTS >`b`&@/,><LO84 e t _l$D  H6\- ,  pd D  jdX) 0<Hb`Rx\6edr`{Юl\px`L 4 & ,c<hG-XY\l};Ȓ`< H5 $ؒP QA 8:Xb,T q/|S9C B`G<TLhDx> t@ Ju<(: <P $PX<P&0<"GS!<[D l(`yF 8U d Thb|\0b c hclc@(L *2t>KlHYHb4$rHvdHL R ̕T ,C (P)d d`v d'0,;;NJ\\ bjh~b`\9$$1` U ( D- ( <d5 D pD "Q xc^ Xs t P U  Jd ht  a` 0 }8  l x9 . D8 hd0B 8Td M hT g Q xz tb g`  4c  T7 @ l! \ `b h @/  t1 hX <& D0 hib8 XE P 4 PY (g c 4g\  ~ q |X t lp  c`0 9) `h7  h@ N ؤ X p9tl 0 ~ < c    6T *h p D P D hbD  x(( t`= DG ZxT  $c R w p \ $ @ T j g 5h C 4PP D%|.  A cKo\hgHn < + q8$  T( `f @T A"d5hZ?(H P85Zj( yؑ`d8 $ L@w9 Hb3 |dli l ! l$ d82c>9XL\ h,@}<b4TLn|\N hdd}d 4pTM,2\B$P\NHr yX%0t`b X<$,)dli,  !8d-Jd6JdED#xUF k0B ,t,> |2#$> \D Xo@-$G $\ 'H2D 0LhL n~$b\ QD0r: tpT| T̂4l(_ l'p 2. >,pFbS^|ul t\g`pc_ l @T9PWDTdb#1=ܼR! L^yj b`w X7 Xe`Hdh&$>qU @b8_\nbzJ b0 bb@ 4`P l!hH 0> E, Zl v @d3  ccPķbX1 [`F  G N+<<bFDRh)L\D9kw@I  ^ p0 , cx! P!<T $lWtn (dd 0 ,<D EdXbg8hv\O@~T\4 T`9LP  <p\c0db- C L|x$Jd;dG0QhdvbL8ȟ4T0\a`P `&0D> O`^;xj8\`t0xx^ (dk\p< ($,TTb(Xu%Q@;R9 j@y dX<w LH6t ((Ud OTԄ*pJJdXkcs%pe`jb LlP}  ,|TO Xy l4& ) 7(G8" P Nfb$t \ (WlDw@F 8 $A(t L \E0'#?, IH\ RblpX4# \C ` PK| "X  P$ J|4 g? \jI cR = c |Xr hb$ ̑    l  9P $k x7  @pt!PmH !( L$!c3!\$pgDF$H6 Z$((o$@z$1$$x$$$ $F,$,d$ \$<@% %(%P(5%`F%@T%8 \%(n%x~%%8%Tl%L % T%7 $%b%`%Y`%P&@&u, +&: $?&t pN& X& Pb&' t&Z \&&<&4p&8m&&LId &&,0'N '0V 'O ,'+ 9'DI'(Y'@:Lj'R'~'D@'(`'8 'd`'x'dHdx'pUd' `' (U(d+(,6( F(=Lb(C s(c(t (B(Jd(r(̋(+ܦpO+%_+$k+0z+Y`++]`++|u\++ +`+h+P`,Г`,I $,82,0\<,F,/U,tc^,h4q,|x,,,l, ,,N,=X,< ,h#-$X -! -t*-Vd5-D-BV-(d-Ȉ`x-X`-c-܇ 8--B-P2H- c`-H-(|-R.`.2 ". -.|`5.(XC.,V.8L\.j e.{.Jd. . .9x. V ."..؉.x`.8.$S //Z./ 0=/@xG/4<[/`l/8 z/$/$ /9/ L/$/ /$ /T/v4/8D/X 0Pzl0f0&0HTd10 c;0 I0cT0S (^0ph0 r0<h0p00Jh00\0x 0 0%00c00- 1h1"1H$11Z;1$G1h[16e1ptx11 1<- 1b1 |101|P1#1f`1p2(2 2| \%282$A2HPO2c$]2xTl2F |2b 2,|2zt2(2| 2@$22w 22T33lG<3*393G3T Q3qY3L0b3`w303tt3p383J 3h3< p3 q@303d4c4|b(#4>4h3K4LjS4̋ <^4ěhp4T444G 4d42T4̨t4X0 4<4`4A5899T  99D9`9H  ::ԟT": .:|::l D:bdW:d- f:Lp:v:l:$H:D: :p.p:R:8@:W:[` ;;d; );|x3;Dm 4?; <L;hXT;^; Ps;ԙ`;DX;b;;` ;J h;DD  ;;O;H;8;8H<,9<C#<p4<dH<pt>>u p%>(9>0IE> U>@5 l> 4 >L>p>x` >E 4>t,>><>9$>\X>D ?l?p|$?| ,+? D:?LE?(0U?G ^? i?(y? ?d? G ?4>L?X ?p?a8?X@`@XId@o'@c5@cb=@|C@L%O@c@ m@|@l@pP@@@b@.@lF0@b@[ @hAQ`APP AH~/AO$CA3 YA`A< fA(nA}AALdAFxA7pA HC+ UCdChg`jCe`vC Ch" PClYC C&$C. C,<C@SC}`Ch{D(S"Dd4 8DJDpZDPDfDvD0D`%D`w`DD d$DlDFPDd=Df`E @ E`! EhQ.EtAEVEX bEuEExEhETELtE$(`EEH"E@bEF`3 F0p+F 8F J  JԮJD$(J0 K0<!Kp} )Kc9K| `IKBTKiK`yKKNK3KcKE|K$p KTcPK, KlKHKDH  L,LL0 #L8<7L8ILxTL8_LjL`{ uLbxLLLJ $Lt~L/pL,_L L7 L @LrL L  M`Ml MxV )M4V =MԶJMĩbQM- ]MxvMlulMpMJdMH\8M8(M , MY`MT Ml0N  NJL"N*N6NLQdNQ YQ4kQ L|Q$QdtQQTQIlQDQW QcR8#R,$R0\;R, LRTdRyR\cRtUdR@|RS R(dRlRRIRXRxS!0 S7PS8<2Sxb:S8FS\YSBmSduStXSxS]`S  S\$ SSRS S<StTx DTXT8h)TX;T0LTA VTP$[TbhT U ThTHT,`0T0 PTHbTT T TWTdUHd UTU x'U`5U8DU LUQU^UjUsU DUl TU(<UdUtU؄ DU)xU UUU VubV(&V`/V]4 ( ]d_]08 ^^} \)^Zx4^&$D^cI^XS R^bc^r^p^b^d@^*d^Q^4^p^ ^!0^^l^b _H_(}H(_ 4_F_pW_, f_Lr_P6 $_N__QD_|x_``_,_ |_4 _0_x`d ``DP'`D@B`|bM`bV`- f`X[{`L```cP`!t`oD`L 4`jT`d ` 8```,  aG aN-a81 c4@c`cHd dL[ dwd %dl2d @dbLdd`\dh Hid<pd 8 $d d||d|dDd@dcdD dDtd  e`Y`eJd/elkmrmm, mm`m#mp m)Dm8 @mX mxm -q6qbDq,$[qgqHK (sq\Lq4JlqC q|`q0*\qT qx! q̋LqM$qXqPpq qr4r`ad(r;rG Trt_rHdur- |rDr rT> 0r r5 rHrrf`r(  ssRs$0(s4U5s`qAsxIsY 8Rs b[sx8hs,ss- s8 s scssv s c|s s$ Hsf`s$t)t<(t(/t\6tAtJdQtll]tot)t`ti t@tDtEtPtt̚t\cup\u 0*ul8ux hKu)@Zu$bu(suu u($u u̪4u\`u{du\8u\huX DuL\udcvhbvlsv0c 4(v{88vcFvdTv $]vg gvXSdsvvv,vv< dv_ xv0| vwvLwp w`wq8,wdhDHwpSwa 8cwlw(t|wdw Tw`0@wbw<wF w]w|Hwq|wdwXx`^ xxTz x$b-x$AxHKx@VxN]x{nx<{x xTxl<xXjxp$x^8x<x,H x- x 4xB y7yD!y H1yPV (>yT2 Fy܈ DOy\YyUdsytb~y Ty;@yy|ytyXcy@jbypz/ z0 z0u! t`L  ĀЀRd,l   # ,](6 FQ7 bbni{ 2lDpz t 4 ցH\P  @4k4`e*x:H|KR(m]<cl`zp0 t‚bɂ+ Ղ*X `ct'%8/k>H0<PlkH{4F  TɃ,~d݃#Tc$3 q *!)1 8D!T.ad7dm>|v HH  DʄpքX d hFH04(L+\9 <E Ud @_<tkt: Hԃ7 pdɅ<مt4hbX -  tT-8|3Oa ZD La&jL8|H TX XH @ 0D|1hц܆  <Բ4(tc-`D>Ѝ`D0 <O elp! zp#<@L pY`4`pPՇ\އ,t| P0 $$E5]b@WA WbaAjx8 ${| p0خ `hlm <DՈld.k (*PP $# ,t3\<?SxB(\ck0z,, @#`v`rLx bˉ b` H<"LH$M 1̐ 0;4H J| XTTo 8[8Ngx1 wlc< |Ê͊h 8(1  _0+;"I- WpfTr! H HT DpXŋdۋr4Ipt4 Zt%&1 h6$CJdZ^npH zPPUdq+ Œl1ҌPLbhdc pH b%cL/CcNX[k pjD@v ,Lb8T T6 ōY܍ . 0b(*t  T /M= ]bPPbYl  z\|1 lb0ƎTyL͎, \4a #(O/d>0U8gT~t | @4L\`!Y`(Ĥ; cF` 4PHdq Dz$ `'PdҢ0/ ̦,\@4 $ >q% 0X>LLGbQt0]tfc4nMzl2x laXУ@.,<$c $! X- 2X> 0@ J^ n\ |Ⱥ 6 $\c0(Ȥcפ x,TdJdqD  D \,;,CFDP@\`hx}8H` DjbȥV٥ ,8t&3 0B<0L $YPqte!@tG x H(^`ͦ\צEt<Pb\j 4$4'$7|@Od[,ebl`N,|Tܔ`l<ɧЧ`THV L2047t2< E{]PoȳLyLHH ub0iɨ V H PT94L%|L1< EDYLh#4{~p7  , 8P  ĩ!өH``x",+8عBY`Q-dTUdr! L|$gX`HR@Ud( ƪ4ڪ6  x3|-88;xQPG=WL l \$>8Ds V lbǫ`իdFDLXb8fl,$*Sl6 VHFJdO c]`- jp}ر t ($G TXR `ʬ7Ӭb4`88 0*<KHXL5dgz44Uh,ؖ ŭ\,) d~0h"8L:!HIW5 $f(^dw0 0. Ud8v -®lDʮbٮ <XLp9D 0cx@ +X\`<6],E{XLhDT0 4_ wlT  c,lci|ʯЯb߯\Id 8l @ I`*@BXf K`Ul, x4`P|D ð/ ʰF L` d  #T: =~L TWpPlbkduV p" d\YT1űA бb$ޱ 8D M Jd$n h\F$0=<Kx^;Tp4 {6 bw |Ȳ)Pֲ PTH b\  ^(*;3 I_\pH1 LC HDn@Y`ɳRӳ, ,޳ph4T $;Lt$L* . >d\T|<G I U0fhqL9 .  $@ H(l@o X7 $ tx !]@*@5cCPT\]0F l y4PsXL M JdH b L f`00 ! q2bA\Ml \lY|nLz | , t (<H H\P $C  7t$t1hP9 B8O hhWtd_h~4k @_8l|$, L >X$c p+\-l4`> |L6 \HY iYu p$H  <$t4rP`Gt b( )t D3mAbQ4l {d*\ <>lG  XA l+@vx$LI09|EbOGd_؆ps chcpJ ]@:x00̌ T* $I tb 4zHb\e`"D;XKcU$i qV`pyPC 4? @^`DO xB <Ecb W* (XP8KP @_0j|c} r<l3 Pls`Lcd@B|cd$<h- {6TA\@K LX$&fs $subzY LH`Pl(X8@ $JH2Pk LA@(O<X0beHqP< |`(N, dLb  h_hG c P` ؓ`.( ,:/A0Q( ] kix u`xX$Tc </ D)7 $8p}BH^QPH`g`fX$}\h`xpU$PxJ 4\ z d6 KcX k x*%,- $H Hƈl L|<`.xB Kh;Pb4l tz88X(#@d\ 0 D ``h,[,=+ G M+dB p,tXm$y`t|bx,P/LTd'(44> :LIthU~,d$8sz|`$(Ud` (x p(] 8?LHP p #`H 3D\C` PF[xdh vJdK$A Gd̔hȔ Y$$-p7Jd`8R @^lbHr`$ ct 8d0DtT4!0P(4)90 H@ (W k@`v(@4lH b44sx@h0lX'pY`8EDQ<\ljT+u- @ 1X0z 0@(`\`X PE#4-Px=TJh(Y\~4pHAp( DTbhF dblP$ l*7,@CPH O[]cmتX Db  [Li 8dhI8,P94Ffā<v0}Pb M8` Dl,{bЭл   0#xd3^ =$bF F `R`[gz@X,"Ь V9 $tx\ 4"0$0 =8 0HHXL ^|hiP{ 8$  <l`d( %8#?KHZqd( nVdvpT3 t`LR$,(J $ d$8X840  q#Pc2AJ<20Y DcBnD C  =h4xl8,<PbP0 pd `#T( 43tFLpV_`i̔`xlxlPTb`0(c48c0 =8*dP<<g"z`4<   T- 84( |,Ԣ F *dp1&HK_bjQds, Уb(3 ̔`\D*T ̚  X|%Lr5B2JtWmTy0E,$dH|<pd db`dp&X4`@-Sܓ`a(s1 `u` Tl4TZآ\| {Ԁ T,@\tD x*R\74 LDV ft \{pc `60/ 4] Xx \?c);`B 1pT(LTc0/ o/X} M<`j,I LzHd XXp5 $Ԝ, (8". 0TSd7 <pLS, $` u0N0a`X  g\P#JdTDO$tp;cAdMcXHg t T<)b`04<?D_hPxwW$c @cЪLi\k\q]` HdL`0Nhc PRd,d#lX. 82$JqPe`\ԿHi s$p 4( ,I H pH pY 7xi\ D(2 7XDPcȕwx d0! ub&  cH. \Oc5 $,5 @R8 ]  k.x{9P$u l @4Jt ܑ`l<^LP'P>@5`AI,P \cc {]\\ HX- $(9 $~@|2 x4 (,8< PT<[IdzN 86 0 Hb``Id,,8̕H 8`+`:@GX_`ev0b`$L[) r8@Whcf`!t14T;dH F,xQ4 $_ mt }0(< L``$8Id@d`pd` , b`3$ @<X F`Td]6l w`ibt |_ 'XP O)h@xDt8$O@+ԓ`9itK00Rh8 T` @kbx ` ` @ <T l2L\H   c"/TD8Na@u` h`{l7 $^zTh$x~ |_ DtY`+G8<\Ed&D[ fPzG4   N GzX,I\'`80Td%( 2C0KX |Yb`(pLz 9<08 + $bp 0p\#(%c`@@? (Xh x@YLܼlUdJdb$tl`  ,&8(p 86XD W0G xb|JwH2  s$jbQ||&pP#x,\)e@`L ] dhbq pu  (d8D <bP`@ X OH%(.@ `?BOiY Dgppbv$~X;$h   \ "d `Q@ ,&t67tTxhD{5 h%$t bx 8l4 $l  0,2h4>N]^ TeO4jb#H| LDhn Pt1 'dG$?0P(m D[X`d( rchbcZhXX 8du$10 hbФLY`T*P%|9x.@AST(jH`{cPȊ8 cTK-0eWDP |<(9Hd1 R ZXbbxr`iy x;Et\0`<|,D$dd db< X7414.?DJ4$0Xo~C D:\  "hV\X\b`, ,A p(7LA`GP Uw(asPPre`,, 4_Tt l(b`P&R 0|MVؼl @  9   +  ؾ \< T  x H% ,88 HM u D^ C l t f`z  4 B z  H jL ,  PL(&D2Z`<, FYJdcԖ m`z4Tdc< L,R}ؤb| h 8" 0  6LF C c$L$0 Lb<r؊ |,X{: Xd`b  \$W,$d$2.BLUdGH8V`{o|Hl}-`4d$$ D RdGdH&.؞\;\F0OcZcjpc(u@n`L<ԊVdN0,P X%$8($Pp@,doc{4MDh( b` )d ,<,\hm$.Y@> tG\MdxC b`sxbLcL7/L TdO T&U6<FcY0c`\kd yTd c <Jdc i(Ԕ `,@ rh#2b;tPKbWX`Elbs}t.\lb`p 4- <`b $)( |H !r @,ܤb 5ē`Ax dNY`[8f 8s X(v$WLb $dibHf@ F `$ -De`3P@@IV`$e4 mtT~`L[TdT_' H'|XT'h'@x''aL'? 'c'6 'cd'D`' '(\'hx 'K( ( e $(U 1(.,A(\Q(tZ(0c(r( (w`(P(TI (1 (@\(خ$(ܐD(4\`( ((H|)VH)X*)X5)+ ?) 0I)WY)! e)xz)h6X))@)) )$) 8)e0)l)*R *P&*t6*G@*I*S@X*a*hY`n*(v*P*#*7M7q Z7tdh7Ds7TD7 L7Dw 074`7|`7A 7x @7 78 7d 8~|8KA (83?8s|O8X8p`a8tzHv8dg 8<> 8P8x58"88 ,8P @8 T8d8b89l8p9TKx+9b`39 D=9:LI9i |Z9`kl9{99Gd9XT9(9t 9yD9\9`9 9c9  :ȥ:4, t$:LK7:hD:|TO:eP\:\,k:D ~:4 :Ud :X::x2d:th:HX;  ;h@;X(; 5;H C; |M;V`];D m;Kd;xx<X <<c< <0< P<< b< =|(= P4=XG=F X=ba=! Ll=l({=b=H==b=H|= =̳ |=, =5=0H  >J l>, >d-> => DJ>. W>  h><$t≯>h>>s> >Y`>`>Ld>N ?@2,?#"?xH-?8$;?,bD?pP?`Z?s??t6 ?̠H?`?2?b?'@?h X??8 X@ @`$ @3@B@\ XO@b@ o@@ x@ED@B,@f @cl@J @$I @x@9 $@M,A(A}@Ar (A 4Au?AhNA`r 8\A LgA\dxA$A- AA dA@AP8AФ ,A$6 $AuAtA< BO(B$5B= KB$XBkBX TzBBL B$ B hB@BL`BLBN`BتBVdC8 $ChCc7CX8>CГKCb^CL dhC0 'rC TC0CCH`C`CH\`CCȾCg`Cp C CX DD (D HEDP RD]D|oD/$DFdDH D D6TD8I D0Dd1 D4D*DȞ E|V @E;p!E0E >EFEt PE|8eEpEb|ELjbEFdUFL]F84iFxw@zF&\FFHI|FJDFF F:hF<G( G8: |GKd8*G(;GKGhX`ZG\&@qG,|GG`GG. GX GG< G 01GpHdHPb H/H9HbGHVHh}`H`n@kH<{H H` HLHt8HH8HT[HHP[Hn@H` I`Ib`&I`$3IHtAIp|dQIBlaI vI|Y`I |1IIIV IT0ICIsI^IHhI J48JdJx,J`Zx>JOpIJpWJdJȳDvJJddtJUdJWJJ J,iJcJK K`<K$'Kc<3K L>K`?@PK`XK0mK`tK`~KhKL*Kԇ`K8 spec_vnodeop_opv_descpfslowtimonanouptimeuvm_map_callrandomreadem_set_mac_typeuvm_page_lookup_freelistnfsv2_procidpcscp_write_reglongjmpffs_vnodeop_opv_descvfs_opv_descskdb_trapvfs_allocate_syncvnodevga_pci_mmaparpresolvedp8390_readchange_displayparamchrtoblktblsys_minheritputcharbufq_default_allocchild_returnvga_setfontrtlabel_unrefne2000_write_mbufuvm_map_initipsec_soft_first_usenkmempageswdc_atapi_drive_selectedcopyinstrncr53c9x_scsi_cmdaue_miibus_readregsys_getgidext2fs_vnodeopv_descsdofilewritevdumpmagttyflushsys_setsockoptfxp_stats_updatevop_lookup_vp_offsetscomdefaultratedefrouter_lookupinetswohci_powerpowerhook_establishwdog_periodpcdisplay_erasecolsip_reassin6addr_anyrt_maskedcopyVOP_ACCESSusbd_get_quirksip6_get_prevhdrscheduler_startdb_logpciide_triones_productslc_isa_cadisk_finddc_ioctluvm_maxkaddrnsphy_cdfootbridge_do_pendingmainbusprintohci_waitintrsys_closeahc_run_qoutfifode_cdusbd_do_request_flagsxl_encap_90xBrtflushclone1in6_purgemkludgeffs_inode_allocnfs_receivemountlist_slocksys_setsidahc_platform_intrusbd_intr_transferem_init_rx_addrslemac_resetiha_pci_ca__ashldi3vn_statvop_getattr_descunp_detachsiop_scriptnd6_nud_hintether_ip6multicast_minusbd_submatch__mainwdc_ioctl_getaue_stopufs_quota_deletehardclockmyip_ifpwdc_reset_channelvga_extended_attachin6_domifdetachdevopnsiop_pci_attachnfs_syncukbd_keydesc_no_nodeadwskbd_cndetachvop_whiteout_vp_offsetsdb_get_variablecd9660_vgetgeneric_armv4_bs_wm_2tprintf_openwsdisplay_burnerfiq_claimohci_device_intr_closedest6_inputgsignalipport_firstautomii_mediachgaue_devsipsendredirectsbpf_setifem_encapVOP_SETEXTATTRunp_internalizetk_rawcc__wdstartevcount_intrfc_lfcemptyvfs_export_lookupif_cloners_countifnetyieldohci_endpdm_freemwsmuxattachfilt_seltruesc_print_addrcomspeeddc_setfilt_asixlogusbkqfiltervn_writechkin_ifscrubarmv4_tlb_flushIdp8390_media_initpdevnames_sizevfs_stdextattrctlmainbus_bs_wm_2route_dstpckbdprobeinit_execwskbd_cdsys_getdirentriesbcmpgeneric_bs_r_1db_set_breakpointsnd6_dad_startexec_maxhdrszdb_force_whitespacemmmmapuvm_map_spacefitssetjmpprefetch_abort_handler_addresswdc_disable_intrwsdisplay_switchiha_alloc_scbspci_subclass_communicationsuvm_deviceopslogread_filtopsvndxfer_poolfilt_fifowriteem_set_multiffs_specop_ptcp6_mtudisc_callbackcopyoutstrext2fs_fifoop_opv_descpte_l2_s_prot_uuvm_swapinusb_transfer_completesa1_cache_clean_sizefxp_mediastatussd_scsibus_get_parmstcp_attachwskbd_cngetcvop_print_vp_offsetsbuf_dirtysoo_writesystempagem_zeropdc20262_dma_startffs_specop_entriesunp_gcingbdevswbaddynamicportsohci_root_ctrl_closelemac_rne_intrX_db_line_at_pcuvm_mk_pclusterbswap16domainnamelockinitttywrite_filtopsnd6_ns_outputbpfkqfilterVOP_LEASEwi_headnfsfifo_readttyunblockremovedevga_accessopsigmp_timers_are_runninguvm_deallocatefilt_procattachpckbc_xt_translationufs_quota_free_inode2filt_procdetach__divdi3sys_clock_settimesiop_led_offfootbridge_pci_chipsetwdc_floating_busiha_pci_probelocnamesnfs_vinvalbufdisk_busydb_breakpoint_alloctcp_pulloutofbandevcount_sysctlsddetachpool_set_drain_hookmouse_copy_extend_lineukbd_keydesc_jparprequestsiginitpci_mapreg_mapvga_console_screenvn_default_erroriha_pop_done_scbusb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhffs_fifoop_opv_descusbd_clear_endpoint_stallsetdisklabelnfs_disconnectknote_removesii3112_drv_probepmap_bootstrap_pv_page_allocdc_ifmedia_stsroutedomainhid_locateicmp6_errorVOP_MKDIRdc_txeofrtl80x9_media_initip_protoxsys_settimeofdaysdstrategyaddloguvm_page_physgetmsdosfs_syncstackgap_randompmap_pte_init_genericfiq_setregsffs_clrblockusbd_set_hub_featurepdc202xx_chip_mapbpf_filterchgproccntip_draindb_map_print_cmdumass_init_shuttlesoqremque__adddi3vr_stoppci_classuvm_map_inheritfifo_printinfocd9660_syncem_display_debug_statsin6_ifawithscopevop_inactive_descnfs_rootuvm_schedulersync_printnchashvnopspool_cache_initsys_lchownmsdosfs_removecd9660_readdb_read_tokenzeroin_addrwdc_set_driveuvm_map_protectwsfont_enumusbd_get_xfer_statusprintfin6addr_nodelocal_allnodessched_lockahc_find_softcrandomwriteprelist_updatenfs_sigintrip6_protoxsys_recvfromttrstrtsys_sbrkiha_se2_instrrandomsysctl_doprockcopysiop_modechangewsdisplayopenext2fs_initahc_platform_set_tagsrtfreecd9660_linkdc_list_rx_inithostnamelencd9660_specop_entriesusb_needs_reattachmulticast_register_ifm_tag_freeahc_shutdownnfs_flushttyopenraw_ctlinputnd6_ioctldc_watchdogphyslockpte_l1_s_protousbd_get_stringipsec_exp_allocationsbpfclosedevwaitusbd_probe_and_attachsoftdep_setup_removesys_writevsys_setprioritym_tag_prependE_abs_script_sched_slot0_Usedumass_detachusbd_free_iface_dataip_defttlsys_undeletefxp_detachusb_schedsoftintrarpintrwsemul_vt100_output_scs94_percentkqueue_registercred0in_delmultipmap_procwrnfs_fsyncuvm_forkvfs_op_descsuid_findumass_activatend6_rtrequestncr53c9x_selectuvm_km_suballocusb_delay_msbpfdetachsys_closefromfifo_ioctlttydefcharssigexithidirtypagesin6mask128dc_eeprom_getword_pnicdead_lookupbus_space_read_raw_multi_4atapiscsi_cauvm_amap_poolin_pcballocVOP_LOOKUPdc_stopdb_shift_exprphysical_startbs_notimpl_bs_c_8pcred_poolenqueue_randomnessusbd_set_idleexphyattachserverworks_pci_intremul_nativewskbd_inputmachine_archnfsm_strtmbufvop_rename_vp_offsetssys_ovadviselockmgr_printinfowsmux_attach_scusbd_pipe2device_handlecpu_do_powersavemainbus_bs_freeaue_rx_list_initbufq_default_freewsdisplay_kbdholdscreenufs_quota_alloc_inode2VOP_WHITEOUTmicrouptimesocket_poolnfs_realign_countpgrphashsys_setpgidfxp_int_delayprofhzcache_enterdb_watch_tableexec_elf32_makecmdsext2fs_bufatoffsys_setlogininitarmmainbus_bs_r_1db_traptcp_do_rfc3390sys_setresuidadv_cdsimple_lock_debuggervr_miibus_statchgrn_deletedp8390_debugiskmemdevstat_rush_requestsfcomcloseipsec_def_compfc_lmdistancewdc_atapi_ctrlnch_poolsomaxconnip6_mrouter_veripsec_exp_timeoutip_directedbcastahc_softc_comp_bus_dmamap_loaduihashtblscsi_get_xsamap_initffs_flushfilesffs_blkprefetherip_allowicmp_sysctlsys_lseekmainbus_bs_subregionpool_cache_getnprocsllinfo_arpmsdosfs_pollpci_lookup_quirkdatamsdosfs_accessaddupc_intrdvd_read_bcawsevent_finiip6statnfs_connectnfs_doiouvm_pageboot_allocconfig_pendingmii_phy_updateswwritexl_read_eepromether_crc32_leaue_csr_write_1piix3_4_setup_channelnfs_numasyncrn_searchds1687_writeipipstatsecureleveldb_consolearpt_keepsavectxdb_printsympte_l2_l_cache_mode_ptsys_seteuidwskbdpollsa1_cache_purgeD_Euvm_map_checkprotmax_protohdrohci_pci_matchdb_access_irq_spextent_findumass_scsi_attachwdc_atapi_intr_databufpagesrandomkqfilterpckbd_consopsusbrev_strsys_keventcopyargsarc4_reinitmi_switchcd9660_statfsrndwrite_filtopssysctl_sensorskern_sysctlnd6_delaypckbc_send_cmdin_pcbinitbs_notimpl_bs_rm_4nmbclust_updatefdremoveuvm_tree_RB_NEXTigmp_fasttimophtree_SPLAY_INSERTscsi_user_donekillprocuserconf_cmdbufumass_bbb_statedb_print_loc_and_instohci_device_ctrl_abortvop_pathconf_vp_offsetsfxp_load_ucodert_mpath_matchgateuvm_map_entry_poolcrgetunp_bindtcp_delackiha_msgin_sdtrem_clean_transmit_interruptscsignalreaddisklabelisa_chipset_tagdb_print_cmdwskbd_set_displayusbd_clear_endpoint_stall_asyncvirtual_availbs_notimpl_bs_rr_2tcpstatatapi_mode_sensewddkdriverdb_break_tablencr53c9x_pollfillmapentrynfsspec_accesstcp_timer_persistnfssvc_iodrelookupwsemul_vt100_output_esc_hashsys_umaskpci_subclass_i2osyn_cache_reaperfilt_fileattachsysentpmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistwsscreen_lookup_syncufs_ihashlookupmemmovesii3114_mapchanicmp_rediracceptvop_reclaim_descwsemul_vt100_detachusbd_get_hub_statusdb_boot_halt_cmdAscResetBussoftdep_setup_inomapdepip_outputbpf_mtapfcomcons_bs_mappckbc_cleanuppckbd_set_ledsfindblknamenfs_reconnectkue_rx_list_initpool_initsa1_cache_purgeD_rngbpfreadxl_pci_attachpool_putm_copym2sysctl_structohci_hash_rem_tdpmap_pinitnfs_ngetsysctl_rdstringuvn_attachxl_newbuflasttimefiforead_filtopsxl_pci_devicessysctl_disklockcnkqfilterdesiredvnodesbs_notimpl_bs_r_2ufs_pollusbd_remove_devicepmap_map_sectionmsdosfs_readlinkpmap_devmap_bootstrapahc_restartusbd_get_device_statusspec_vnodeop_pahc_initlookupnchinitexec_mapdb_qualifycomcngetcsnprintfext2fs_readlinksoftdep_setup_blkmapdepether_ioctlumass_bbb_transferrnd_attachedip6_forwardinganon_swap_offkue_resetarp_allocated_bus_dmamap_load_mbufwdc_print_capsfootbridge_create_mem_bs_tagifindex2ifnetcd9660_ioctlem_initrt_mpath_conflictvga_50lscreen_bfusbd_get_config_desc_fullin6_savemkludgein_pcbnotifyallmouse_copy_worduvm_pglistallocsyn_cache_addohci_device_ctrl_transferwsdisplay_addscreenincorehzwskbddoioctldefrouter_resetcd9660_ihashinssiop_script_writewdc_atapi_send_packetcheckaliascue_activatettyretypestartuphook_listpte_l1_s_cache_modekue_detachrt_timer_queue_changelf_initcpu_attachuvm_km_pages_lowatrn_mpath_countsd_switchwdc_preata_drivemii_phy_matchsdclosevop_poll_vp_offsetsvop_generic_kqfilterpffasttimoinitsiginfosys_getuiddb_set_cmdiha_del_pend_scbuvm_unlock_fpageqcpuidsexec_setup_stackpager_map_wanted_locknfs_clientduao_createdb_free_watchpointsvr_list_rx_initaue_lock_miiidentify_arm_cpuffs_realloccgiha_devwskbd_load_keymapcd9660_bufatoffiha_state_5groupmemberuvmspace_init_vga_scrlistether_sprintfmsdosfs_unlockselwaitpmap_init_l1icmp6_mtudisc_callbacksfootbridge_pci_bus_maxdevssys_forknfs_readdirvop_setextattr_descip_setmoptions__qdivremspec_openpmap_vac_me_kpmapfilt_bpfreaddb_watchpoint_freedc_eeprom_getwordwsdisplay_emulinputuvm_fault_wireusbd_abort_pipekernelstacksi_freeahc_lookup_phase_entrynfs_niothreadsvm_nphyssegip6_randomidproc_filtopsfiq_nullhandleruvm_lock_fpageqelf32_os_pt_notewdc_print_current_modesfiledescopensys_vforkpmap_vac_me_uservop_reclaim_vp_offsetscomcnspeeduvm_pager_initcpufuncsCopybufferwinChkNamest_decide_modedvd_read_copyrightvmi_list_slockpool_draindb_history_prevem_setup_receive_structuresmyip_initializedsync_vnodeop_psys_mkdiruao_reference_lockedpmap_devmap_tableufs_fhtovpwskbd_translatedumppcbrttrashohci_root_ctrl_abortmblowatgetnewvnodeufs_inactivepciide_natsemi_productskue_load_fwnd6_mmaxtriessiop_intrem_print_link_statussys_socketdead_vnodeop_opv_descohci_shutdownahc_match_scbpckbd_cananotimevop_generic_bwriteufsspec_writedead_vnodeop_entriesxl_freetxrxiso_disklabelspooffifo_badopfdfreeahc_update_neg_requestadv_devtty_countadv_intrpciide_chipenraw_disconnectipsec_ipcomp_default_levelsis_south_matchKERNEL_BASE_virtremove_coproc_handlerbrelvpwdc_logmsdosfs_mountfsahc_pci_intrem_82547_update_fifo_headip6_sprintfsync_fsyncsyscall_fancyvop_setattr_vp_offsetssetstatclockratecd9660_strategyohci_allocmuserconf_parseip6_keepfaithext2fs_allocdb_eregsst_loadfdcopysa1_cache_flushD_SEb_to_qbus_space_read_raw_multi_2vga_is_consolecmd0643_9_chip_mapusb_blk_freelistudp_sendspaceahc_set_widthnfs_mknoddc_newbuflemac_txd_intrifg_headvfs_rootmountalloccue_tx_list_initnetintrbs_notimpl_bs_sr_2rw_initcd9660_openwsemul_vt100_output_dcsuvmcnt_dumpip6_mforwardsoftdep_setup_allocindir_metaohci_root_ctrl_startcmaskpckbc_cnattach_bss_end__ext2fs_blkprefdb_pool_print_cmdvga_stdscreenahc_pci_ident_tabledb_delete_linerpc_auth_unixVOP_ISLOCKEDsys_kqueueuao_referenceusbd_kill_pipefootbridge_intr_reportin6_addrscopevr_rxeocdb_searchbs_notimpl_bs_wm_4maxlockdepthraw_usrreqnblkdevuhidev_detachbs_notimpl_bs_wm_2scancttyinput__stack_smash_handlerlemac_intrukbd_consopsbiodonedb_set_breakpointmaxslpext2fs_makeinodecue_startaue_csr_read_2usb_eventsst_read_block_limitsufsread_filtopsufs_symlinkcd_scsibus_set_modepcscp_read_regufs_mkdirpci_subclass_satcomusbd_get_no_altsin_iawithaddr__anddi3rt_missmsgdofilereadVOP_BMAPfcominitip_dooptionsvn_lockcue_tick_taskahc_handle_seqintrip6_ctlinputwsemul_vt100_handle_csiumass_cbi_adscsbdropfcomioctlmsgbufphystcp_debugusbd_transferinpcb_poolohci_hubdohci_pollnextralocpcib_callbackfxp_ioctlsys_setegidwdc_wait_for_statusbus_space_write_raw_multi_4rn_matchfifo_readcd9660_symlinknfs_progautoconf_verbosein6_setpeeraddrunp_externalizesys_munlockalluvm_faultrandomioctliha_append_free_scbsoreceivedc_decode_leaf_miipool_getuextralocdb_show_radix_noderootfsnfs_in_committed_rangeohci_root_intr_startrip6_outputsoftdep_freefilescsibus_cdndflushcompose_tab_cmprn_insertspec_pollAscInquiryHandlingfcomstopfilt_kqdetachdb_flush_lineaue_unlock_miiipsec_exp_bytesbufqueuesconfig_deferem_check_for_link_bus_dmamem_allocm_tag_initfilt_usbreadusb_add_eventif_attachlemac_isa_probem_reclaimnameiem_read_pci_cfgbs_notimpl_bs_sr_4ext2fs_readdirip6_ctloutputdead_pollversiondc_rxeofem_rx_int_delay_dflt_bus_dmamap_synckqueue_initata_dmaerruvm_pagezeronfs_readrpcin6_setsockaddrigmp_leavegroupcom_common_getcvga_cnattachbs_notimpl_bs_rr_8mountlistuserconf_histbufwdc_atapi_the_poll_machinenfs_mknodrpccomsoftVOP_REVOKEconfig_deactivatescsi_probe_bussesclallocisa_bs_sr_2ipsec_esp_trans_default_levelbiowaitpci_subclass_inputfilt_ufsreadunixswdc_apply_fixupadv_pci_casccsdb_stop_at_pcwsdisplaymmapccpupmap_updatencr53c9x_readregsuvm_map_replaceem_setup_linkgeneric_bs_sr_1acard_chip_mapxl_intrboothowtofdinitarc4randomnsphy_funcstcp_delack_ticksttopenata_get_paramsether_ipmulticast_minconfig_rootsearchrip6_sendspacescsidebug_lunsuao_dropswapenxioisascanusb_cdem_rx_abs_int_delay_dfltrnd_event_headahc_check_extportwsdisplay_switchtoconsolein6_maxmtupmap_enterxl_list_tx_init_90xBundefined_handler_addresssys_setreuidusbd_ratecheckvga_console_attacheduvm_map_findspacewsevent_initl1_sec_tablecomcnattachcachetabsdsizesys_pwritevkqueue_scanvop_print_desctcp_closenfsnodehashohci_free_stdsd_patternsX_db_search_symbolscsi_initmsdosfs_advlockwdog_registerkue_attachukbd_keydesc_svif_indexlimusbd_free_xferdb_varsst_switchfallocbufferspcscp_dma_resetahc_set_syncratepckbc_submatchisa_bs_w_1iha_reselisa_bs_rr_1deadproc_mutexdb_breakpoint_freepfctlinputcomcnprobephys_mapuvm_anon_removeumass_bbb_methodssoft_intrqufs_lockcomintrisa_attach_hooksys_accessem_read_mac_addrnsphy_statususerconf_initiha_read_eepromkillpg1xl_ifmedia_stsukbd_keydesc_frisa_bs_wr_4vputonfreelistmouse_removewdioctlnfs_getreqext2fs_mountrootpciide_mapregs_compatregyearem_update_stats_counterspage0ahc_validate_widthsetrunnablepool_do_putnfs_closedb_check_interruptahc_pci_attachcue_ioctlnd6_prefix_onlinkatapi_to_scsi_sensewdc_atapi_ioctlcue_attachosversionelf32_read_fromhid_is_collectionem_free_receive_structurestvtohzip6_mroutervr_startvmi_listudp6_usrreqratecheckin_rtchangevfs_syncwaitaue_crccansignalmsdosfs_check_exportwsmux_muxopslf_setlocknbigpipewsfont_map_unicharcue_devsnfsv3_procidin_controllmaxahc_send_asyncuvm_pagecopysa1_cache_purgeDsysctl_quadsys_readexec_process_vmcmdskue_tx_list_initem_phy_igp_get_infocmd_chip_maprddkdriverohci_freemmbstatuhidev_intrttyinfodb_flush_lexnfs_savenickauthttyinramdisk_devsohci_root_ctrl_donegetnulldevusb_get_next_eventdb_dmesg_cmdxl_ioctlpciide_dma_initextent_destroydb_lpip6_forward_srcrtnfs_writebploop_clonerwhichqsgetcttsetwaterdb_last_addrmouse_copy_startem_clear_hw_cntrspmap_enter_pvmsgbufenabledunp_disconnectufsfifo_writesys_listensys_mountfifo_nfsv2nodeop_ppgsignalfirstcdb_read_bytestcp_rndiss_initpcdisplay_eraserowsuhub_detachuvm_page_rehashvop_getattr_vp_offsetsvop_islocked_vp_offsetsffs_fsyncnfs_sillyrenamewsdisplay_consinetdomainwsfont_findmemcpyppbprintwdc_enable_intrkthread_exitdc_parse_21143_sromiha_msgout_extendedcue_newbufsi_getdisk_constructvfs_unbusywsdisplay_paramip_nhopsrip_usrreqfilt_usbrdetachspec_writesiop_wdtr_msgipsec_esp_network_default_leveldb_map_equalin_broadcastpool_page_free_oldnointrfd_getfiledc_setfilt_admtekncr53c9x_free_ecbmsgbufaddrsdioctlrpc_msgdeniedutsnameexit2__hex2asciiwsmux_isset_displayaue_resetkue_open_pipesvr_miibus_readregacer_setup_channelip6_mloopbackext2fs_cgupdatecurpriorityrddumpem_enable_intrcpu_setperfufs_lookupsiop_pci_resetufs_bmapdoasyncfreeip6_mrouter_detachip6_randomflowlabelsync_vnodeop_opv_descttpolldegetlogpollkthread_createsi_findpckbc_cleanqueuedb_elf_sym_initwdc_default_read_raw_multi_2cd_scsibus_get_modelemac_inputffs_fifoop_entrieslogclosefootbridge_create_io_bs_taggeneric_bs_wr_4nbuffcomreadinstall_coproc_handlervop_setextattr_vp_offsetsohci_rhscufs_strategyohci_device_requestkue_watchdogphysical_freeendbounds_check_with_labelether_input_mbufif_qflusharc4_timeoutpci_subclass_networkext2fs_checkpathns_scx200_chip_mapsocantrcvmoreAscISRdevclsfile_filtopsiha_print_infost_cdtodclock_cadc_pci_attachmsdosfs_renamesysctl_proc_argssiop_adapterext2fsfifo_reclaimpipe_wfiltops__lshldi3AscInitDriverpckbc_init_slotdatasd_scsibus_mode_sensepmap_activatevop_create_vp_offsetsconfig_make_softcncr53c9x_msgoutunp_discardcue_csr_write_1ip6_outputvga_pci_ioctlip6_mrouter_getukbd_keydesc_sv_nodeadswap_syscall_lockufs_kqfilterem_is_valid_ether_addrlemac_initscsi_autoconfcheckdirsexecswwsemul_vt100_output_csiumass_atapi_attachin6_are_prefix_equalin6_controlahc_print_registerem_setup_ledleapyearsys_sigsuspendcd9660_unmountwsemul_vt100_output_scs96pciide_dma_startwdc_atapi_the_machinetrapsignalcurprocmainbus_bs_allocrushjobpmap_devmap_registerrn_inithead0db_single_step_cmdwd_flushcachend_defrouterfdcloseexecpckbc_slot_namesevcount_attachlimcopynfs_vptofhtcp_timer_rexmtsiop_pci_cart_timer_initnd6_useloopbackputsfootbridge_pci_intr_disestablishrip6stattcp_debxcnpollcd_casys_truncateesigcodescsi_xfer_poolsysctl_wdogarmv4_tlb_flushIDnfs_boot_getfhohci_add_doneem_read_phy_regsrv_ipohci_add_edwdc_xfer_poolsoacceptkqueue_pollbus_space_copy_2cdgetdisklabelvop_bmap_vp_offsetsdb_call_depthasc_mcodepool_page_alloc_kmemdb_printfin6_ifaddloopufs_creatend6_optionscd9660_seeknd6_llinfo_settimermsdosfs_unmountelf32_load_psectionrn_mpath_nextarm_pcache_unifieddb_add_symbol_tableppbattachm_tag_nextohci_intr1msdosfs_writecue_resetbs_notimpl_bs_w_1exec_script_makecmdsfilt_pipedetachcd9660_rootdb_unaryselrecordcomstoprip_outputext2fs_accessmld6_fasttimeokthread_qimaxvop_unlock_vp_offsetsohci_free_sedstioctluserconf_pdevuvm_object_printitmbpoolst_write_filemarkstcp_canceltimersrip_recvspaceroute_initdb_store_countsd_scsibus_flushlink_rtrequestwdc_get_xferuvm_vmspace_poolvr_mii_readregspec_lookuppipe_createnfsbootdevnamefifowrite_filtopssysctl_vnodepdc202xx_setup_channelnd6_sysctlpciide_amd_productspci_subclass_multimediavn_opennfssvc_sockheadif_clone_createuao_detachpckbd_set_xtscancodecpufunc_controlmallocahc_platform_freeamap_pp_adjrefrpc_versapollo_chip_mapin_pcbrtentrynfs_iodwantknote_dequeue__udivsi3calibrate_delaytcp_outflagskqueue_statnfs_boot_initcd9660_rrip_analyzeohci_hash_find_tdexphymatchnfs_vfsopsip6_v6onlysys_preadvdb_tok_stringuserretnfsv3_typesys_recvmsgvga_setfontsetpipe_statvn_writevop_mkdir_vp_offsetsVOP_LINKxl_txeoficmp_inputuvm_km_free_poolpage1umass_cdvcountrd_root_sizevm_page_zero_enablein6_delmultistathzwdog_ctl_cbahc_qinfifo_requeue_tailwskbd_cnattachwdc_ata_bio_intrvirtual_enduhidev_get_reportsys_getloginbuckstring_initicmp6_rediracceptext2fs_vnodeop_opv_descpckbcintrdetruncdb_elf_symbol_valuescopyoutisa_bs_wm_4pfindcomconsaddrip_ctloutputwsevent_readuhidev_set_report_asyncarp_ifinitdb_write_variableufs_dirbadcd9660_readdirvfs_unmountallwsdisplaypollohci_allocxcopyrightsdattachvop_whiteout_desctcp_timer_keepusbd_devinfo_vpwsemul_vt100_cnattachtcp_mss_updatepciide_lookup_productfree_pagesffsfifo_reclaimdb_proc_print_cmdrw_enter_readdb_show_all_procsvunmapbufip6_sourcecheck_intervalroute_outputrti_deletevop_kqfilter_descsys_geteuidhostzeroisbroadcastdb_output_positionpckbd_bell_fnisa_intr_typenameicmpmaskreplin6_pcblookup_listenmsdosfs_mknodfcomttycd9660_specop_pip6_defmcasthlimsys_munmapdc_mii_readbitsii3114_dmactl_writefilt_solistenvsnprintfisaattacharplookupdc_initwsemuldisplaydevprintuvm_map_pageableproftimer_trampolineem_write_reg_iochainallocsa1_cache_purgeIDifmedia_baudratepckbd_hookup_bellusbd_setup_default_xferem_82547_tx_fifo_resetuvm_pagelookupsoshutdownuserconf_hist_cmdnfs_writerpctcp_rndiss_reseeduserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tablewsemul_vt100_scrolldownwsdisplay_getc_dummybpf_iflistPaste_availem_reset_adaptivewdc_downgrade_modeip6intrqnd6_rs_inputAscInitASC_SOFTCpciide_mapreg_dmawdc_atapi_real_start_2soabortem_get_bufem_82547_move_tail_lockedunp_inologkqfilteruvm_tree_RB_INSERTdb_extent_print_cmduprintfdb_clear_single_stepuvm_page_printitmainbus_canfs_pollsoftdep_flushworklistsys_issetugidinitclocksadv_switchcd9660_mmapsd_reassign_blocksif_detachaue_watchdogwsmuxopenwdc_ata_bio_startnd6_cache_lladdrifqmaxlencatqsession_poolext2fs_specop_opv_descunp_connectuvm_pagermapinxl_setmodeif_detached_startpool_serialaue_ioctlirq_entryvfs_mountedondb_expressionpckbc_slot_enablecputypepmap_deactivatefc_lookup__bss_start__vr_ifmedia_stsif_downndqbfilt_rndreadisa_bs_rm_1allocsysVOP_GETATTRnfs_reclaimsiop_add_reselswuvm_km_pages_headahc_freenfs_advelf32_check_headertcp6_usrreqsyscall_internpckbc_poll_cmdlemac_txmaxdb_historydc_decode_leaf_siainphy_cdukbd_parse_descnfs_loadattrcachenfsm_rpcheadtcp_rndiss_cntisa_bs_wm_1footbridge_cdpmap_unwireipaddrxl_mii_readregem_tx_int_delay_dfltip6_auto_linklocaluvm_pageunwirewsmuxdoioctldc_setcfgip6_mrtprotoiha_selectdc_eeprom_widthcdattachuserconf_devicein_localaddrdc21285_fclksys_sigaltstacksii3114_dmatbl_writesoisdisconnectingnfs_vgetsyn_hash2rttimer_queue_headarm_pdcache_sizedp8390_enableiha_bad_seqexphy_cartredirectuvm_map_printitwdc_atapi_pio_intrdb_read_variablesoftintr_initdb_regsdb_stack_dumpcd_scsibus_setchanttymodemdb_lbuf_endwsdisplay_defaultscreensmtx_enterkqueue_poolvntblinitallcftablesuhub_activatexl_startscsiforcelun_targetsnfsrttonVOP_REALLOCBLKSdc_shutdowndc_devsE_abs_tag0_Usedsys_setresgidsdebugmsdosfs_sync_vnodesplassert_failvr_watchdogarm_picache_waystty_initahc_setup_datawsdisplay_clearonclosesdzerorefudp6_recvspaceuvm_km_freesys_killstart_nfsiouserconf_numberperflevelcomconsiohpmap_set_pcb_pagedirem_watchdoginsw16rt_setmetricssys_getegiddb_set_single_stepisa_bs_w_2st_spaceem_phy_m88_get_infopckbc_flushumass_init_insystemserverworks_setup_channelst_quirk_patternsem_validate_eeprom_checksumdirchkexphy_resetipip_outputpipecloseext2fs_fifoop_entriesVOP_REMOVEpci_mapreg_typeconsinitiha_msgoutext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctnfs_timerconfig_detachifaof_ifpforaddrrt_timer_queue_destroysd_cdnfs_createnfs_sndlockicmp_mtudiscipport_hifirstautosys_fstatlemac_read_eepromem_read_eepromuserconf_enabledb_endlpumass_bbb_resetahc_set_recoveryscbem_driver_versiongeneric_bs_w_1sa6_anysys_getprioritypci_subclass_cryptonfs_bioreadsysctl_diskinitE_ldsa_abs_reselect_Useduvm_km_valloccue_getmacnatsemi_chip_mapvga_pci_attachsys_unmountbootdvmainbus_bs_tagelf32_probesin6ifa_ifpwithaddrvgoneliha_se2_rdsofreectrl_eventinphyattachdb_del_symbol_tabledb_add_exprsiop_timeoutpmap_removenfs_statfsahc_acquire_seepromicmp6_fasttimoext2fs_removeif_clone_destroywdccommandukbd_keydesc_nomyipbpf_setfuserconf_historydc_mii_readreguvm_page_unbusytk_noutext2fs_mountmif6tablepmap_collectukbd_enabledb_symformat_elfpciide_compat_intrgeneric_bs_rr_4cpu_sysctlcd9660_vnodeop_pcd9660_deftstampwskbddocloseip_randomidfxp_attach_commonaue_tx_list_initnosuidcoredumpukphyattachvop_poll_desccddumpiha_state_2db_search_cmdpckbc_attachwsdisplay_noemul_caasttcp_disconnectvop_open_vp_offsetsuvmspace_execwsmux_createsys_mmapbootnd6_is_addr_neighborwsemul_vt100_output_normalunp_rightshostnamedb_print_llinfocmd680_setup_channelwsdisplay_emulbellext2fs_bmapuvmexpdc_intrufs_diremptyreinsertfinishdupukphy_serviceqsphy_resetpool_destroylogwakeupshutdownhook_listip_dosourcerouteukbd_keydesc_sfsoread_filtopscpu_swapoutbdevsw_lookupdisk_changewsemul_vt100_resetopamap_lookupsdoreallocblksadv_initahc_minphysamd756_setup_channelbpfread_filtopssoinitdc_read_sromem_get_speed_and_duplexVOP_MKNODuvmnd6_ifdetachin6_ifaddrroute_protoext2fs_truncatecd_play_tracksfootbridge_bs_tagvirttimer_trampolineip6_maxfragpacketsdb_errorprefetch_abort_handleruvm_km_threadpckbd_keydesctablminscsi_probe_bussys_fpathconfwsmuxpollarpt_pruneohci_device_bulk_methodssoconnect2knote_poolcnopennatsemi_setup_channelscsi_test_unit_readyarc4random_bytesnmbclustvop_reallocblks_vp_offsetssominconnnchashtbluvm_vnp_syncwsmux_set_displayarpt_downwsmoused_wakeuprdgetdisklabelpckbd_cdarm_pdcache_line_sizebpf_tapdb_lookupwsmousedmii_phy_autonfs_mountrootmax_datalenfcomcons_bs_tagmsdosfs_initohci_device_ctrl_startvop_readdir_descesp_cdext2fs_writelf_clearlockfcomcons_bs_freegeneric_armv4_bs_wr_2nfs_udpsockdb_lastsymsiop_resetbusip_srcrouteip6_accept_rtadvpte_l1_s_cache_masksys_setregidusbd_device2interface_handleusbd_dopollne_pci_prodvinvalbufpckbc_poll_datafootbridge_bs_subregionnfs_mkdirsys_ftruncatem_splitsoftintr_disestablishncr53c9x_attachfifo_polltcp_timer_initdb_tab_stop_widthdb_putncharssii3114_dmactl_readmainbus_bs_unmapnd6_maxnudhinttcp6_inputwdc_atapi_donesosetopttcp_msscache_purgebpf_mcopyxl_attachlemac_modessiop_printstatssa110_setupfork1curpcbdb_activevfs_hang_addrlistst_cacue_tickmrt6statdead_writeufs_dirrewriteinsmntquettreadtk_canccdb_write_bytesvga_initext2fs_blkfreeudp_outputfind_last_setcd9660_vnodeop_entriestcp_rndiss_msbsys_chmodprelist_removeffs_vgetinitprocahc_set_unitsa110_options__umoddi3arm_dcache_alignip6_log_intervaluvm_page_physdumpiha_append_pend_scbrootconffcomcons_bs_unmapwsemul_vt100_nextlinenfs_readlinkrpcX_db_sym_initsyn_cache_timervt100_initchartablessolisten_filtopsin6_update_ifa__wdcerroriha_busfreevop_bmap_descsuser_ucredfxp_startsd_shutdownmem_noext2fs_buf_allocdp8390_startxl_start_90xBmainbus_bs_rm_2iha_switchlemac_info_getstwritepmap_free_l2_bucketrevarprequestkernel_mapdumpdevcd9660_lockdc_list_tx_initem_check_polaritydb_not_taken_bkptvfs_mount_foreach_vnodekqueue_kqfilterip6_mrouter_donepckbd_enablezeroin6_addrstrncasecmpcpu_swapinohci_device_bulk_start__guardwdc_atapi_minphysin_ifaddrnd6_optioncurrent_spl_levelwin2unixfnmax_hdrffs_readm_freevop_default_descscsi_inqmatchfdesc_poolusbd_add_drv_eventcmd_pci_intrvop_strategy_vp_offsetspool_page_allocin_pcblookupm_tag_delete_chainfilt_pipewritecd9660_pollpool_head_slockahc_actionbadaddr_read_4bzerofxp_pci_devicestickfixintervalarmv4_drain_writebufufs_closeem_tx_abs_int_delay_dfltfixjobcpcdisplay_getchardb_show_all_cmdspci_subclass_daspscsi_execute_xsin6_addmultirn_newpairvop_setattr_descdb_find_breakpoint_heresys_obreak__udivdi3fxp_powerusbd_set_config_noiha_xfer_datausbpollpciide_cdlastddateem_check_downshiftadv_pci_devicespmap_curmaxkvaddrin6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotmbinitusbd_get_reportvga_common_attachabortwskbd_default_bell_datascsi_readsafe_cmdvga_cdamap_allocVOP_LOCKMD5Finalpckbd_cnpollcwskbd_matchsd_scsibus_opscp_timecd9660_vget_internaldb_page_print_cmdukbd_keydesc_usne_pci_matchvgetrd_attachwinChksumserverworks_chip_mapfreeclusterchainmld6_initprocfs_checkiopermmainbus_bs_w_4disk_initnfs_nameicd9660_fifoop_opv_descohci_hash_rem_itdohci_bus_methodsrip6_ctloutputnfs_getattrcachewdcrestartnetioaue_sendusbd_getnewaddrnd6_na_outputext2fs_fhtovpumass_cbi_transferext2fs_createem_local_timerusbd_bulk_transfer_cbnfs_realignvfs_opv_init_explicitpipe_pollnsphy_casysctl_dopoolcd9660_fifoop_puhub_matchpmtu_expiretcp_respondsys_readvamap_cow_nowroundrobinbadaddr_readuvm_map_createvfs_opv_initissignalwdprintCopybuffer_sizenetclscdevvp_setsoftintrfootbridge_pci_io_bs_tagigmp_joingrouprandompolluiomoveohci_device_isoc_doneoutsw16msdosfs_startdevioclf_allocdb_loop_countpciide_dma_table_setupfiq_releasebpf_reset_dnd6_dad_stophid_start_parseuseloopbackds1687rtc_cauvm_waitnfsfifo_closenexecsststartxl_powerpmap_referencesys_bindloioctlrw_exit_writebs_notimpl_bs_wr_8pmap_bootstrapbs_notimpl_bs_wr_2ipsec_auth_default_levelsys_mqueryarm_picache_line_sizebigadjkmeminit_nkmempagesnfs_sysctlspec_vnodeop_entriesiha_xpad_inusbd_new_devicewdzeroreffootbridge_bs_freescsiforcelun_busesfillinusemaprecvitfill_kproc2fxp_scb_cmdfilt_sowriteuvm_kernacccnpollcsys_linklog_openevcount_initfragtbl124userconf_totdevvop_inactive_vp_offsetsrt_ifmsgrt_tableswdc_atapi_real_startrealitexpireipstatunix2dostimenfs_initscsibus_caiha_reset_tcsusbd_delay_mspool_page_free_kmemcrfreecnputcsa1_setttbpte_l2_s_prot_wip6_lasthdrahc_clear_intstatohci_device_isoc_abortuhub_uhub_catcp_reapernfs_bmappool_sethiwatwsemul_vt100_output_c0c1wdgetdefaultlabelmicrotimeahc_print_scbxl_resetuvm_swap_getpciide_serverworks_productsext2fs_reloadif_detach_rtdeleteelf32_copyargsisochariha_pop_free_scbuvm_km_alloc1siop_cdcdopentcp_usrclosedaue_ifmedia_stsphysmemwskbd_holdscreeninferiorukbd_attachclusterallocahc_abort_scbsext2fs_fifoop_pltsleepwskbd_attachin_pcbbindumass_cbi_statenfs_node_poolxl_mediacheckrtalloc2endtsleepfcomconstagpckbc_isa_intr_establishuvm_pageratopsigactssharedb_set_watchpointnfsrvw_sortbpfattachif_detach_queuesitimerdecrusb_create_event_threadether_outputpci_cdem_phy_setup_autonegpmap_bootstrap_pv_page_freenfs_removebpfilter_lookupm_copym0vga_init_screenvm_physmemiso_shipdirrdwriternd_timeoutahc_softc_inserticmpmaskpipe_ioctlwskbd_enablepmap_devmap_find_vacd9660_mountrootnetlckbpf_allocbufsset_stackptrmsgbufmappedohci_device_setintrcomprobe1getphysbufcdsizedb_symbol_valuesumass_lookupdb_evarssa1_cache_purgeID_Eufsfifo_closewakeupsoftdep_slowdowngetnanotimepciide_matchtcprexmtthreshkprintf_mutexrt_getifadb_malloc_print_cmdenosyslockmgrrtlabel_name2iduvm_vnodeopsvfsconfVOP_OPENcompwroffwsdisplay_console_inittedbuckstringsiop_scsicmd_endusbd_fill_deviceinfoscsi_interpret_senseext2fs_flushfilesfakeintrmsdosfs_vnodeop_pcomconsattachedufs_readlinkrdopendoscheckpathnfsv2_vnodeop_opv_descpcbmapnd6_option_inituvm_km_alloc_poolpage1com_isa_probepiix_setup_channeliha_state_4em_print_debug_infoin6_init_prefix_ltimessoftdep_change_directoryentry_offsetnchstatscd9660_fhtovpmsgbufpE_ldsa_abs_selected_Usedsys_setgiduserconf_common_attrswapconffilt_ufswritert6_flushrd_ioctl_serveruvm_mlk_callatapiscsi_attachgeneric_bs_r_4E_ldsa_abs_slot_Usedmmrwffs_bufatoffem_init_hwuvm_errno2vmerrordohooksahc_find_pci_devicenfs_quotactliha_state_8pcscp_adapterem_pci_set_mwiwdc_atapi_tape_doneukbd_activateem_disable_intrsiop_sdpaue_setmultiem_powerif_detached_ioctllocnampadv_pci_matchvop_close_descuserconf_showip_mtudisc_timeout_qaddress_exception_entryffs_fhtovpgetvnodefilt_ufsvnodepool_setlowatkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmpsysctl_emulsys_sigprocmaskdb_commandvga_load_fontnfs_renamerpcds1687rtc_cdin6_if_upfilt_pipereadskip_spc_rightukbd_keydesc_uksoreservepidtakendb_formatwsmux_displayioctlconsoleuvm_mmapxdr_string_decodeusb_activateufs_quotactllemac_isa_findaroundin6_pcbnotifystrrchrusbd_clear_endpoint_togglest_check_eodgetdevvpfootbridge_bs_allocpci_mem_finddefrouter_selectamap_unrefext2fs_statfscrdupamap_wiperangetickdeltaisodirinodb_strlcpycfrootslease_checkchrtoblksiop_get_lunswscsiprintuserconf_pdevnamminphysukbd_matchrtalloc_noclonetimeout_mutexcd9660_specop_opv_descether_addmultivga_burnervop_mknod_descvga_ioctlip6qffs_vptofhifunitvfs_isbusyirqstackbawritetputcharwskbd_detachpmap_postinitpool_print_pagelistffs_fragacctsys_fchowndb_breakpoint_cmdnfs_strategyvwaitforiomii_phy_tickcd_read_subchannelextendfilelortrequesticmp6_inputwsemul_vt100_outputuserconf_addwdc_atapi_resetnfs_openohci_device_intr_methodscreatedesbreleasedb_history_sizeisa_bs_mapmsdosfs_islockedmax_linkhdrumass_attachem_dma_freewsdisplayioctlget_stackptrsysctl_rtablemsdosfs_reclaimvop_mknod_vp_offsetsuserconf_hist_eocfxp_stopext2fs_getattrrtlabel_id2namesbdroprecorduvm_coredumpahc_find_periodem_write_phy_regwdsizeip6_sysctlsuserdiskconfisa_io_bs_tagvn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1tk_ninsysfilt_opspciide_mapchanclusterfreerootdevufs_ihash_slockm_tag_firstem_82547_move_tailcdmatchpmap_map_entryvga_setscreentypeusbd_get_config_descriptorpciide_machdep_compat_intr_establishdumpsysicmptstampreplif_detached_watchdogusbd_ar_pipecy693_setup_channelext2fs_fsyncnfs_ticksdoforceiha_intrsys_fsyncuserconf_add_readusbd_reset_portifconfsiop_led_onpciide_pci_intramap_wipeoutuser_configdb_map_currenttcp_rndiss_nexttcp_outputnsphyattach_bus_dmamem_mmapwsdisplay_emul_attachupdate_ledsext2fs_updatenfs_accesstcp_timer_2mslne2000_writememaue_openpipesvr_shutdownffs_reload_vnodeif_addgroupmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointpool_allocator_freefilt_proceopnotsuppfifo_lookupahc_validate_offsetffs_reallocblksnfs_removeitrandomcloserootvpem_print_hw_statsuserconf_maxlocnamespool_reclaimusb_quirkspci_subclass_serialbusbpf_sysctlvflushcddetachpmap_clear_modifytcpctl_varsarptimertcp_reass_limitm_copymruaddrdstrategymouse_copy_extend_charbcopy_pagedb_free_breakpointsif_upwsfont_getflgfootbridge_sa110_cc_setupnfsnodehashtblne2000_ring_copyde_caVOP_BWRITErt_timer_queue_createwddonemsdosfs_ioctlpciide_dmatbl_writesys_openinet6domainvga_pci_cafxp_pci_attach_bus_dmamem_alloc_rangepgdeleteuvm_pageidlezerophtree_SPLAY_MINMAXdb_symtabsraw_attachpcib_printdb_boot_sync_cmdastpendingether_ip6multicast_maxpipe_pooluao_initvop_abortop_descifa_ifwithrouteparse_mi_bootargsspec_kqfilternfs_renametcp_notifycd9660_tstamp_conv7randomattachsys_sstkem_smartspeeddb_print_positionnfs_lookuprtflushclonedb_radixgetblkmouse_pasteem_tbi_adjust_statsnfs_readdead_vnodeop_pmouse_copy_endmaxsmapwdc_ata_biosoconnectwskbd_repeatpmap_pte_init_sa1nfs_writenobuffersdata_abort_handler_addressrtrequest1__lshrdi3db_find_watchpointusbd_errstrdc_crc_lenfsd_waitingtcp_identtcp_rst_ppslimrtrequestifinitcd_load_tocunpst_recvspacedc_miibus_statchgrpc_callkue_initraw_inputcd9660_reclaimiha_next_statekue_ioctlisa_mem_data_vaddrnfs_nhinitfilt_logrdetachnd6_ifattachunpdg_recvspaceoutswm8pipe_closecd9660_inactivesoftdep_mountmsdosfs_rmdiruvm_km_getpageiha_timeoutmsdosfs_fsynccfdataffsahc_index_busy_tclusbd_do_request_async_cbufs_checkpathem_init_eeprom_paramspfxlist_onlink_checkdb_elf_lookupm_tag_findinittodrxl_miibus_writeregvga_mapcharvputdk_establishpte_l1_s_cache_mode_ptvector_page_setprottcbhashsizecd9660_setattrusbd_get_configcyhc_slockufs_quota_initkqread_filtopsusbd_setup_pipeaue_csr_read_1em_read_part_numbioopscpu_classesbpf_setdltmsdosfs_statfslboltpipe_initusbd_open_pipe_intrsyncerprocufs_ihashinsin_setpeeraddrwdcactivateinphymatchdb_readlinewsdisplay_delscreenether_ifdetachvop_fsync_vp_offsetsuhidev_get_report_descuserconf_histcurrndstatscy82c693_writest_touch_tapenfs_bwritemsdosfs_inactiveusb_knowndevscurrent_intr_depthpanicstrwsdisplay_kbdinputumass_scsi_cbpdc20265_pci_intrext2fs_sync_vnodeahc_softc_initunpdg_sendspacesession0viscpyE_abs_lunsw_return_Usedahc_calc_residualcopyin__umodsi3comparamsiop_common_resetxl_mii_synccd9660_defattrohci_device_bulk_closeahc_print_devinfopckbc_set_inputhandlerrtalloc1bs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetne2000_read_hdrsigacts0ncr53c9x_dequeuefindblkmajorpager_mapntohlsorflushttioctlarpintrqvprintfslpqueohci_root_ctrl_methodsttycharsisa_footbridge_initsyncdelayffs_mountext2fs_specop_entriesicmp6errppslimbadaddr_read_2usb_neventspool_inactive_timedp8390_mediachangeconfig_process_deferred_childrenohci_ifcdwsdisplaywritepool_cache_reclaimbs_notimpl_bs_sm_2in6_setmaxmtuem_camsdosfs_rootusbd_finishsoftnet_intrhandbpf_getdltlistfxp_eeprom_putwordm_tag_getpckbc_startsb_lockdc_attachohci_root_intr_abortrt_labelssuid_clearttwriteiha_exec_scbswapdev_vpdp8390_resetdead_readufs_pathconffile_pooldb_boot_reboot_cmdohci_timeoutAscExeScsiQueuevop_symlink_vp_offsetsunputcendppb_cdwskbd_isset_displayVOP_CREATEprobe_switchvop_readlink_descAscReInitLramuvm_map_referencespec_ebadfphtree_SPLAYnd6_recalc_reachtm_intervalpagetables_startin_ifinitfifo_closeohci_device_ctrl_closedc_startpciide_mapregs_nativein_pcbhashlookupem_setup_transmit_structuresmainbus_bs_mmapcd9660_vnodeop_opv_descVOP_ABORTOPvr_encapem_identify_hardwarefootbridge_imaskdefault_chip_mapsys_acceptuvm_map_entry_kmem_poolem_process_receive_interruptsasc_mcode_chksumisa_bs_r_1tcp_rst_ppslim_countukbd_detachif_clone_listsys_futimessdgetdisklabelsiop_table_syncinternal_commandpci_subclass_wirelessin_losingsis_chip_mapVOP_SYMLINKgeteblkwsscreen_detachusbd_set_interfaceem_force_mac_fcscsibusmatchfcomcnpollcvn_ioctlufsspec_readdb_show_calloutpipespacefiqvectorohci_alloc_stdcmd646_9_irqackfootbridge_pci_attach_hookip6_sendredirectsdc_eeprom_idlevga_mmapddb_sysctlukphy_caitimerfixvr_attachip_stripoptionssyn_cache_countdc_eeprom_putbytexl_list_tx_initnd6_timer_chcpu_resetstatprevnfs_mounttcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1ohci_detachbdevvpifa_ifwithdstaddrAscInitFromASC_SOFTCfootbridge_pci_decompose_tagpim6statdb_watchpoint_allocin6_nigroupuihashtcp_keepintvlvop_reallocblks_descxl_shutdownvop_remove_desccdwriteufswrite_filtopsttybgconfig_searchusbd_printuvm_km_valloc_prefer_waitsyn_cache_pooliha_msgin_extendedpci_subclass_mass_storagepckbc_isa_matchffs_allocaue_tick_taskwrite_multi_1atapiscsi_cdcpufunc_faultaddressdb_previnphy_funcsbswap32ipsec_exp_first_useplimit_poolip6_defhlimumass_setup_ctrl_transfercd_scsibus_load_unloadunp_connect2usbd_set_pollingebsabootinforn_walktreepool_prime_pagepciide_ite_productsstclosesys_chownuvm_pagewirevop_lease_vp_offsetsem_stopin6_joingroupsys_munlockiha_setup_sg_listuvm_anfreeukbd_keydesc_befcomcnputcdofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfileiha_msginrw_exit_readip6_mrouter_settablefulluhub_exploretcp_maxidlemclpoolststrategyset_cpufuncscttyioctlffs_vnodeop_psys_lstatfilt_rndwriteiha_reset_dmanfs_clearcommitpckbc_poll_data1ahc_freeze_devqohci_timeout_taskohci_hash_add_tdiso_uiodircttyopencd_atapibus_opspmap_link_l2ptinet6ctlerrmapfifo_vnoperatedisknamesumass_quirksdumplomsdosfs_mountnullcnpollcuvm_km_initpciide_acard_productsbzero_pageffs_sbupdateudp_sysctlbs_notimpl_bs_wm_1vmmapbsyusb_add_taskuserconf_histlendb_list_breakpointsusbd_set_protocolisa_intr_allocnfs_getcacheblkvop_mkdir_descukbd_accessopsusbcloserpc_msgacceptedncr53c9x_resetsis96x_setup_channelpcipowercom_isa_cavector_pagevmspace0stmatchscsi_decode_sensettywaituvm_map_setuptcp_syn_cache_sizewdc_default_vtblnfsspec_readetextifa_ifwithnetmemchrrd_attach_hookohci_device_ctrl_doneqsphy_statuspte_l2_s_cache_maskncr53c9x_scsi_resetdc_pci_acpiboot_argsvt100_selectattributeumass_scsi_setupproc_poolaue_intrmainbus_bs_wm_1udp6_inputsys_writemap_forwmergedb_get_valuegeneric_armv4_bs_rr_2sb_maxvga_50lscreen_monousbd_fill_iface_data__bss_end__wsdisplay_maxscreenidxcnstopextent_print_allihashtblsys_dup2em_phy_resetnfs_asynciodb_inst_countdb_read_linewdc_ioctl_findwsdisplay_switch1siop_productswd_get_paramssa1_cache_clean_addrsys_readlinkcpufunc_faultstatus__ashrdi3scsibuszerorefbs_notimpl_bs_mmapohci_intrwsdisplay_burnpmap_dump_ncpgip6_auto_flowlabellf_splitifafreeVOP_STRATEGYtzrip_sendspaceamap_addtcp_freeqcom_attach_subrsii3114_dmacmd_readdvd_authexphy_serviceumass_scsi_cmdcdreadspec_inactivedp8390_stoppckbd_cngetcsys_sendtoicmperrppslimgeneric_filtopsknote_dropcue_watchdogin6_selectsrcukbd_keydesc_sg_nodeadsoftclock_siem_82547_fifo_workaroundin6_pcbsetportpckbd_initalldevsdp8390_rintwddumpicmp_do_errorvmcmd_map_readvnpmap_dumpusbd_get_interface_altindexamap_extendsigpropvmapbufdehashtblsocketopssiop_pci_matchdevioX_db_sym_numargsnd6_maxndoptip6_iduvm_map_clip_startrawcbtablespec_readfiq_nullhandler_endpcscp_dma_gounp_marksa1_cache_cleanD_Eicmp_mtudisc_timeoutnwsmuxskip_char_rightfootbridge_pci_conf_readttyread_filtopsuvm_mapusbd_bulk_transfervop_lookup_descdb_map_addrgetinoquotafifo_ebadfscsi_do_ioctlcd_resettimedeltaX_db_forallxl_txeocudpstatcd_read_toccdioctlcue_stopifmedia_addahc_release_seepromfxp_eeprom_shiftinpcdisplay_mapcharusbd_set_config_indexlogopeniha_wide_donebreadntcbtable__xordi3frag6_draindosdiremptyidleigmp_slowtimoifpromiscrtl80x9_mediachangesys_getsocknamecd9660_lookupnfs_getauthvop_fsync_descusbd_alloc_buffermask_rnheadvga_40lscreen_mononfsd_head_flagpcdisplay_putcharsi_headpte_l2_s_protoufs_roottcp_sysctlVOP_SETATTRisa_bs_freeahc_alloc_scbsusbreadpmap_kremovesigactsinitohci_pci_casa1_cache_cleanD_rngusbd_set_reportexec_elf32_fixuprt_newaddrmsgvop_generic_lockcomconsiotuvmfault_anongetconsttyvga_alloc_screenpcdisplay_copycolsuvm_pagealloc_stratpcscp_attachusermountext2fs_dirrewrite__ucmpdi2vn_closefileumass_discopci_findvendorip_mtudiscvfs_free_netcredpool_cache_do_invalidatemld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_paufs_whiteoutpidhashtblaue_matchusbd_get_protocoltcp_drainpmap_l2dtable_ctorm_pullupiha_status_msgbpendtsleepenterpgrpMPFailwsemul_vt100_output_string_esccnbellm_copydataumass_atapiscsi_devwdc_atapi_timer_handlerinswm8wsscreen_attach_syncuvm_cnt_headmtx_leavefilt_signalsigactsfreewdc_default_write_raw_multi_4ttymallocpckbc_cdsd_scsibus_get_optparmswsdisplaykqfilterfcomwritebs_notimpl_bs_sm_4kue_setmultipcisubmatchmmioctldb_nextumass_matchsendsigohci_device_ctrl_methodsbpf_ifnameohci_cdvfs_busymouse_copy_extend_afterfilt_ufsdetachiha_state_3lf_getlocksolistenwskbd_compose_valueAscInitFromEEPpciide_dmactl_readip_ecn_ingressmsdosfs_bmapfifo_bmaprip_ctloutputffs_vtblif_getgroupem_set_promiscuserconf_morekqueue_ioctlmax_processessa1_cache_cleanID_rngdc_mii_writeregem_free_pci_resourcessys_wait4rip6_recvspaceamap_share_protectusb_all_tasksfs_sysctlukbd_cnattachboot_filefilt_sordetachwsdisplay_console_confnfs_getattrconfig_pending_incrsys_osigaltstackusb_task_threadahc_execute_scbamap_pp_establishvr_list_tx_inituvm_anon_initffs_reclaimusb_free_deviceif_link_state_changepmap_virtual_spaceusb_disconnect_portpage0_endtcp_quenchbpfpollnumemptybufsupdatepriohci_activateahc_timeoutwskbd_cnbellnfs_printruntimevt100_decmodepciide_print_channelsoutswfilt_soreadpmap_remove_allzeropageipsec_def_encpool_logsizesoftintr_establiship4_input6pdevinit__iordi3inetctlerrmapffs_specop_opv_descresetpriorityenoioctlsigacts_poolexecsigsconfig_initcpufunc_null_fixupicmp6_redirect_inputkrpc_portmapiha_push_pend_scbpckbc_set_pollaue_read_macdc_ifmedia_updst_interpret_sensedb_access_abt_spscsistrategynd6_ra_inputin6addr_loopbackttypendvprintin6addr_linklocal_allroutersqsphymatchin_revarpinputstrlcpyX_db_symbol_valuesdc_setfiltusbd_reload_device_descext2fs_advlockknote_fdclosevop_lease_descxl_setmulti_hashif_clone_detachpipe_rfiltopsimaskin6_cksumcomcninitpciide_print_modesstrncmpvfs_opv_numopsvfs_shutdowngetsockbs_notimpl_bs_c_4mouse_hidein_interfacessyn_cache_respondllinfo_nd6sbcheckreserveuvm_iopreemptunixdomaindb_next_free_breakpointuvm_tree_RB_REMOVEscsibusattachetheripstatisa_bs_rm_4syn_hash1xl_list_rx_initulmindb_last_symtabproc0paddrrn_addmaskahc_resumeusb_attachbpf_bufsizeselscanahc_pci_capciide_promise_productssoo_poll_randseedukbd_keydesc_dk_nodeadsig_filtopsohci_device_bulk_transferukbd_cdwskbdopensa1_cache_purgeID_rngem_startttclosipsec_soft_allocations_bus_dmamem_mapst_mount_tapenet_sysctl_vga_scrlist_monocom_cdvop_getextattr_vp_offsetswskbd_do_ioctldead_ioctlfill_eprocaue_initusb_match__wdccommand_startsysctl_iflistvwakeupcmd680_channel_mappci_subclass_bridgeif_clonerswdcbit_bucketnfs_kqinitvgonewdc_probe_capspmap_initializedtcp6_ctlinputdb_stack_trace_cmdusb_allocmemufsspec_closend6_prefix_offlinkuvm_anon_dropswapigmp_inputvop_ioctl_vp_offsetskmemusagenfsm_mbuftouiolf_getblockusbd_add_dev_eventpciide_irqackisa_strayintrtcp_rttdfltcleanerprocpdc202xx_pci_intrfifo_reclaimsbappendstreamm_tag_copy_chainunion_check_pusbd_intr_transfer_cbusb_event_threadsowrite_filtopsstrncpyrevarp_in_progressdb_disasmisa_bs_allocsdreadicmp6errratelimsys_opipeupdatefatscue_memata_perrorvfs_getvfsaue_txeofffs_sync_vnodencr53c9x_senseproc_stopdb_history_lastusbd_set_port_featuredelaycountbpfilter_createsysctl_locklockfpoolahc_set_tagsvga_console_vccpu_switchtohtonluvm_km_kmemallocusb_find_descin6_mask2lenmrt6_ioctltcp_dooptionsdos2unixtimesys_sigactiondeupdat__negdi2in6_purgeaddrcpu_modelsii3114_read_regarm_dcache_align_maskuvm_tree_RB_FINDcttyreadcd9660_unlockpciide_dmactl_writeuserconf_cmdswsdisplaycloserpc_replyahc_tailqschedclockbpfioctlconfig_attachohci_alloc_sitdcue_rx_list_initfxp_write_eepromdisk_unbusysysctl_filesoisconnectedamap_clean_worksisa_intr_initusb_block_freememetherip_sysctlVOP_PATHCONFumass_fixup_sonydk_mountrootdb_run_modewsscreen_detach_syncsiop_script_syncvattr_nullrw_enter_waitsys_getsockoptuhidev_attachfrag6_nfragpacketsvr_mii_writeregdb_linewildcardpcscp_cdpckbc_consdatafxp_add_rfabufxl_encapin6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlite_chip_mapcpu_get_controlVOP_READLINKumass_cbi_methodsdb_ed_styleufs_seekahc_chip_initmii_submatchuvmexp_printohci_root_intr_transferwsdisplay_unset_cons_kbdmsdosfs_pathconftimeout_wheelbpf_m_xhalfaverunnablecd9660_getattrttyfreettysleepdp8390_initunp_disposerd_open_hookscsi_inquireufs_getattrVOP_GETEXTATTRvfs_exportiha_minphysuvm_km_pgremoveramdisk_ndevsex_region_plfscaleahc_reset_channelip_optcopyvfs_registersys_dupmcllowatmii_printbpfilterattachsd_atapibus_opstimeout_tododb_lccpu_read_cache_configwsemul_vt100_scrollupwdc_sii3114_vtblpanicget_pc_str_offsetcue_rxeofL_cksumdatamsdosfs_lockseltruewsdisplay_console_devicepci_subclass_systembpf_m_xwordsoftdep_initializexl_rxeofunp_shutdownahc_run_untagged_queueisa_bs_r_4ext2fs_sysctlgeneric_bs_wm_4cluster_callbackkthread_run_deferred_queuevop_lock_vp_offsetslc_cdwdreadlastdaycheck_execdb_max_linetcp_initpte_l2_s_cache_mode_ptdeferred_config_queuedp8390_getmcafahc_platform_allocem_wait_autonegipport_lastautowsmux_detach_scsis_setup_channelcd9660_fifoop_entriescom_raisedtrahc_unbusy_tcldb_last_commandwinSlotCntvn_kqfilterem_validate_mdi_settingfiq_getregsext2fs_syncpte_l2_s_prot_maskvga_40lscreenpciide_intr_flagcache_purgevfsfxp_mdi_writeem_led_offpostsigsys_pathconfcue_open_pipesin_addmultigetmicrotimebs_notimpl_bs_rm_8maxumass_clear_endpoint_stallohci_setup_isocaue_newbufscsi_probedeviha_data_over_runtcp_templatenfs_commitmsdosfs_readdb_object_print_cmdahc_pollohci_initcomopenusbd_setup_xfersata_setup_channelpiix_chip_mapbcopywdog_autofxp_read_eepromcue_detachusbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_opttcp_reasssys_getfhext2fs_vgetrt_timer_timercomcnputclemac_rxd_intrKERNEL_BASE_physwsemul_vt100_output_scs94generic_bs_rr_1defrouter_addreqin6_clearscopefifo_vnodeop_entriesusbd_set_addressne2000_readmemffs_setblockipsec_expire_acquirewsscreen_switchwaitkue_stopmemcmpwskbd_init_keymapmsdosfs_createcd9660_startdb_output_lineisa_fillwcomstartpool_allocator_kmemdb_examinecfroots_sizedb_end_linetickadjehci_pci_alldevssiop_clearfifovop_rmdir_vp_offsetssbreserveundefined_initvrecycleem_phy_hw_resetextent_printcrcopydb_symformatwdcloseundefined_handlerssys_revokeip6_setpktoptionssysctl_stringsys_rebootpmap_dump_allbufpoolMCFailwdccommandextpcdisplay_cursor_init_bus_dmamap_load_buffercpu_forkdb_print_ifattylistwdopenuvm_vslockxl_mii_send__bin2bcdttyoutputkue_caisa_bs_w_4sa110_cpufuncscd9660_tstamp_conv17wskbd_cawdc_atapi_intr_completeahc_pci_probern_mkfreelistfootbridge_bs_barriervop_bwrite_descVOP_READin6ifa_ifpforlinklocalufs_ioctlffs_freefilelastdtimeAscFindSignaturenfs_sndunlocksys_setuid_wdc_ata_bio_startxl_setcfgstart_updatesiop_common_attachusbd_clear_port_featureufs_quota_free_blocks2senditcluster_writernd_event_tailintr_enableduvm_setpagesizetcp_xmit_timerst_rewindin6_recoverscopevga_50lscreennfs_nullnsphy_serviceaue_ticktickmclpool_warnmsglemac_isa_attachdb_termscsi_preventmmclosenumfreepagescd9660_accessahc_search_untagged_queuesffs_statfsxdr_inaddr_encodeiha_msgout_sdtrwdcprobeudp_recvspacewdc_ioctl_strategyvr_probebus_space_copy_1syn_cache_unreachuserconf_histszsys_getrlimitbpf_attachdicmp6_ctloutputufs_dirremovecinitif_attachsetuppipe_writevop_symlink_descin_pcblookup_listensbappendm_copybacknextgennumberfxp_mc_setupuvm_swap_puticmpbmcastechofifo_advlockevcnt_attachdb_continue_cmdconfig_scannuidhash_maxpmap_copy_page_funcripsrciso_nchstatskue_txeofem_update_eeprom_checksumnfsm_srvwccscsidebug_targetsnlineswdb_restart_at_pcdb_sstep_printohci_rem_edether_ifattach__wdccommand_donesignal_initffs_updatedb_print_formatwsmuxclosenfs_checkexpdp8390_getunix2dosfnahc_search_qinfifovga_screenlist_monospec_advlockfragtblraw_sendspacenullopip6_ecn_ingressusb_discovercomdiagextralocfcomcnattachunsleepwdprobeX_db_lookupohci_alloc_std_chainipintrgetnanouptimeohci_pci_detachmaxdmapxl_watchdogusb_block_allocmemmainbus_bs_w_1ext2fs_symlinkdb_skip_to_eolinverse_charip6_savecontrolpciide_chan_candisableq_to_bmountrootnfsrv_setcredsyn_cache_resetdb_inputcharuhidev_opendb_boot_cmdsundefined_entryprocess_read_fpregsip_initreaddeohci_freexcd9660_rrip_getnameufs_check_exportsysctl_rdintpdc20268_setup_channellodirtypagesem_probefindwin95VOP_WRITEsys_nanosleepstart_init_execfootbridge_pci_bs_tag_initifa_ifwithaddrfootbridge_intr_initsiop_add_devdb_write_cmdif_clone_attachwsmoused_releasesys_getfsstatohci_abort_xferbpfopencdstrategyem_config_collision_distnatsemi_irqackapollo_sata_chip_mapahc_suspendkmemstatsnd6_slowtimo_chuvm_km_valloc_aligndb_max_widthmntvnode_slockstreadnfsd_headnv2tov_typecomwritemouse_copy_selectionwsdisplay_noemul_attachVOP_RENAMEcdclosesys_fchdiralleventsSetCPSRrandompidwd_cdfootbridge_intr_dispatchfilt_ttyrdetacharp_inuse_bus_dmamap_destroyvn_pollinet6swrouteswdosdirtemplatemainbus_cdspec_nfsv2nodeop_entriesdb_uvmexp_print_cmdsys_mincorene2000_test_memdc_tx_underrunlastsecondswdog_timeoutxl_mii_writeregvga_getcharusbd_error_strsusbd_sync_transferffs_vnodeop_entrieslun_switchtcp_maxpersistidledc_pnic_rx_bug_warspec_ioctlufs_initsync_vnodeop_entriesproc_reparentuvm_exitisa_irqdispatchfc_bmapcallspr_rmpageffs_initnfssvc_sockhead_flagcluster_wbuildbootsyncuvm_initaue_attachsys_ioctlnfs_renameitsys_xfspioctlif_free_sadldb_dotiha_state_6filt_bpfrdetachwsdisplay_emul_cast_loadquirksicmp6_initdisassemblebs_notimpl_bs_rm_1filt_ttywritepool_update_curpagesiop_script_readpcdisplay_cursorhid_end_parsein_setsockaddrcy82c693_readisaprintrandom_statenfs_advlockbpf_moveinpcscp_cawsemul_vt100_output_esc_spcostypevndbuf_poollastpiduvm_page_physloadreset_entrywdc_exec_xferwdcresetipintrqohci_noopxl_detachppb_camaxprocusb_frag_freelistip_slowtimordsizepcscp_dma_setupnfs_setattrip6_nexthdrrtdeletemsg__bss_startfootbridge_pci_intr_mapdc_setfilt_xircomsyscall_plainkue_rxeofpciide_via_productsisa_intr_disestablishsiop_attachrpc_mismatchVOP_KQFILTERukphy_funcssys_msyncvop_rmdir_descwskbdreadsbappendrecordevcount_detachsd_casoftdep_fsync_mountdevinitmsgbufpciide_intel_productsconfig_activatememsetpipe_free_kmemufs_getlbnsohci_strphysionfs_realign_testin6_selecthlimwdattachdb_symbol_is_ambiguoususbd_set_report_asyncmii_phy_delete_medianfs_cltpsockicmp_mtudisc_cloneread_seepromclass_cmp_spllowersodisconnectpool_allocator_oldnointrsys_setgroupsmainaue_csr_write_2asc_mcode_sizenfs_vfs_initohci_device_bulk_doneusbd_initdc_detachiha_reset_scsi_bussiop_lookup_productip_flushlemac_multicast_filterkue_startdp8390_confignfsspec_closesiop_scsicmduvm_unmap_removepmap_alloc_l1footbridge_pci_intr_stringicmp_errorinpcb_pool_initalizeddb_hangmanwsmuxdevsukbd_delayed_decodebs_notimpl_bs_sm_1uvm_swap_markbadkqueueopsvholdpciide_map_compat_intrdb_help_cmdwdc_atapi_in_data_phaseusbd_no_quirksis_hostbr_matchm_adjmld6_stop_listeningisa_bs_rm_2pmap_map_chunkppsratecheckscsi_free_xskmemlimitxl_pci_intr_ackamap_copyphysical_enduvm_rb_spacedevinlf_findoverlaplf_wakelockdb_sym_numargskue_attachhookdumpconfhpt_pci_intrfilt_rndwdetachwsdisplay_cons_kbd_pollcdead_badoppciide_dma_finishcalcrusys_unlinkdb_cmd_listmainbusmatchrt_setgateahc_find_syncratevr_setmultitcp_ack_on_pushpmap_growkernelext2fs_rmdirsysctl_intkqueue_closewsdisplaystoppte_l2_s_cache_modelemac_shutdownstrlcatifnet_addrssysctl_int_arrbs_notimpl_bs_wm_8softintr_dispatchfootbridge_bs_mapdisk_unlockpciide_cypress_productsufs_ihashremiha_maincttywrite_bus_dmamap_createsdmatchusb_freemempool_chk_pageproc0vga_pci_matchufs_renameext2gennumberusbd_get_hid_descriptorrt_ifannouncemsgsoo_readpciide_vendorsufs_openwsmuxdoclosepmap_modify_pvpcscp_dma_intrsplxm_catsa1_cache_syncIohci_pci_attachrtinitncr53c9x_variant_namescluster_collectbufsfcomcngetcsiop_handle_qtag_rejectumass_scsi_minphysuvm_swap_inittcp_nowttystatsaue_miibus_statchgdb_trace_until_matching_cmdproc_printitunp_gcsys_clock_gettimeiha_mark_busy_scbip6_hdrnestlimitpool_catchuppckbd_inputfrag6_initsiop_sdtr_negahc_attachbuf_replacevnodemsdosfs_vnodeop_opv_desclba2msftimeout_setrdread__subdi3wsdisplay_resetntohs_bus_dmamem_freeiha_set_ssiginet_ntoadb_boot_poweroff_cmdext2fs_mkdirohci_openext2fs_direntermii_pollstatwdgetdisklabelpciide_machdep_compat_intr_disestablishst_erasedupfdopenfxp_scb_waitlemac_ifstartifmedia_list_addpidhashvfs_mountrootuvm_totalencdebugdb_unread_charahc_pause_and_flushworktimestart_initelf32_olf_check_headeruhub_attachtcp_mssdfltuvm_swap_freetcp_rndiss_sboxwdc_atapi_update_statusdata_abort_handlerbs_notimpl_bs_r_1em_init_lockedrnd_wseldb_look_charuhidev_set_reportvr_setcfgin_pcbdetachmsdosfs_vfsopsaue_ifmedia_updcd_sizettycheckoutqiha_scsi_cmdread_multi_1icmp6_mtudisc_callback_registerdb_set_variableaue_carnd_event_spacepmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachdb_search_symbolcn_tabwdc_atapi_intr_commandip_forwardextent_createrdclosexl_stats_updatebpf_freeddisklistsys_fstatfskue_devsisa_io_initbs_notimpl_bs_sr_8m_injectem_mta_setvr_rxeofnd6_setdefaultifaceffs_isfreeblockuvm_map_lookup_entryhztovop_pathconf_descbs_notimpl_bs_w_4m_pullup2dead_strategypciide_dmacmd_readswi_handlerprocfs_domemspec_fsync__wdcwait_resetdc_cdip6_optlenpckbc_cmdresponseuvm_map_deallocateicmp_reflectmii_phy_activateext2fs_reclaimpciide_acer_productsffs_ballocsys_getgroupsuhub_cduvm_km_pages_freegeneric_bs_wm_1ip6_raw_ctloutputsoftdep_setup_allocdirectkernel_textpcscp_dma_stopufs_startohci_devd__end__fcomcons_bs_barrierkinfo_vdebugnsphy_resetuvm_rb_insertufs_bmaparrayfragtbl8nfsv2_typeuvn_sync_locksysctl_initwdc_get_logusb_needs_exploreufs_quota_alloc_blocks2fc_fileextendsdc_read_eepromvr_txeoffilt_sigattachVOP_FSYNCffs_sysctlipport_hilastautoarpinit_donespec_closecd9660_closeem_initialize_receive_unitsys_shutdowncngetcpckbdattachdc_delayrnd_statesm_gethdrem_dma_mallocconfig_rootfoundcue_cdputcsiop_resetsii3114_mapreg_dmasysctl_rdstruct__divsi3uhidev_cdumass_scsi_devem_config_fc_after_link_upfootbridge_pci_intr_establishschedcpupckbc_isa_catprintf_closevga_stdscreen_monosbappendcontrolwsdisplay_screenstateukbd_set_ledsem_get_cable_lengthnfs_lookitupsiop_update_scntl3pciide_nvidia_productssoftdep_flushfilesdb_access_und_spipv4_inputm_getclrpool_headncr53c9x_watchwsmuxioctlnfs_in_tobecommitted_rangewdc_atapi_send_cmdncr53c9x_msginusbd_interface2device_handleipforwardingdb_lexohci_device_isoc_transferusbd_open_pipe_ivalbufhashtblclock_scsyn_cache_lookuparc4random_stateprtactiveksym_upcaseufs_makeinodeip6_process_hopoptsufsfifo_readusbd_find_edescwsdisplay_set_cons_kbdfifo_writefilt_ttyreadsys_getpgidcom_common_putccache_lookuprdioctlisa_bs_vaddrfootbridge_intr_claimin6_purgeifdb_boot_crash_cmdbs_notimpl_bs_rr_1umass_scsi_sense_cbdp8390_intrwsemul_vt100_handle_dcsin6_ifawithifpncr53c9x_donewskbd_set_console_displaydumpsizeukbd_keydesctabpci_matchbyidextent_freeuvm_aiodone_daemonusb_cookie_nofcomcons_bs_allocaddupc_tasksched_syncahc_handle_brkadrintusbd_clear_hub_featuresc_err1comcloseem_clear_vftasetsigvecmountnfssys_sendmsgvn_marktextstrcmpwskbd_rem_muxvr_ticksys_quotactluhidev_matchvop_close_vp_offsetswdog_initrndread_filtopstcp_mtudisc_increaseulmaxin6_pcbconnectdehashkue_cdhook_disestablishexphy_funcscom_isa_attachbpf_catchpacketffs_isblockiha_reset_chipdb_stack_trace_printusbd_find_quirkuvm_aobj_pooldb_show_frame_cmdpci_camouse_copy_extenddb_examine_cmdqsphy_funcsicmp6_reflectsetrunqueueudv_attachsettimeuhub_intrpcibattachGetCPSRarm_pcache_typertable_initdp8390_detachata_set_modevop_access_descwsmux_setmaxmii_phy_auto_timeoutsyn_cache_getnetisrdb_clear_breakpointsttyrubrevarpwhoamivop_generic_islockedwsemul_vt100_output_stringwsscreen_attachbufcachepercentm_pulldownacer_pci_intrpmap_initufs_rmdirpsignal1minpmap_zero_page_funcarmv4_tlb_flushD_SEfxp_initip6_initconfig_detach_childrenrawcbukbd_cngetctcpcb_poolvga_selectfontipip_allowsys_polluvm_map_clip_endufs_makedirentryusbd_set_configem_write_pci_cfgvnode_hold_listlastdosdateahc_intr_enableufs_linksys_mkfifodb_cmd_searchifa_ifwithafiha_msgout_wdtrisa_cdin6_leavegroupiminem_reset_hwsddumpsys_chflagsdelaysdstartdb_machine_command_tableddb_regsvt100_outputuvm_km_putpagecom_enable_debugportpage0_dataext2fs_vnodeop_pusbd_get_port_statusstatcountperusecuvm_pageoutncr53c9x_timeoutpffindtypepdevnamespci_subclass_dockqsynctodclock_cdfcomcndetachfifo_opencd9660_vptofhusb_camii_phy_downuvmspace_forkraw_initknote_enqueueudpcksumtcp_sendspaceiha_msgout_rejectdb_maxoffpmap_zero_page_genericffs_oldfscompatnfs_rmdirwdcdetachmaxlocksperuidin6_matchlensys_madvisepcdisplay_copyrowsfootbridge_bs_unmapscsibusdetachxdr_string_encodedisk_attachwskbd_displayioctlncpusdb_cmd_loop_donearptfreesa1_tlb_flushID_SEipq_lockeddb_show_arptabcom_detachfifo_vnodeop_pvop_write_descvop_read_vp_offsetsbs_notimpl_bs_w_2dead_printinphy_servicemii_media_tablelemac_read_macaddrwdstrategytcp_rndiss_encryptxl_cdttyprintfsigcodedb_elf_search_symbolhpt_chip_mapipip_inputem_adapter_listdb_delete_watchpointcomttypcibmatchne2000_detectbuf_undirtysysctl_tstringnfs_unmountnfsrttdb_watchpoints_insertedxl_setmultiusbd_start_nextnfs_fsinfofilt_ttywdetachuvm_tree_RB_INSERT_COLORpool_allocator_nointrvop_unlock_descsys_sysarchigmp_initmii_phy_add_mediafxp_bundle_maxvga_free_screennfs_del_committed_rangeputphysbufcpu_reset_needs_v4_MMU_disablenfsv2_vnodeop_entriesvop_remove_vp_offsetsMD5Initqsbus_space_write_raw_multi_2cpu_info_storeffs_vfsopssysctl_mallocfootbridge_mem_bs_unmapsa1_cache_cleanDusb_dev_openfrag6_slowtimouvm_map_hintstatclockhandlerwant_reschedahc_num_pci_devspmap_bootstrap_pv_allocatorphtree_SPLAY_REMOVExl_miibus_statchgmsdosfs_mkdirkthread_create_deferredahc_run_untagged_queuesuhidevsubmatchnfs_xdrneg1scsidebug_busesscsibusactivatend6_timertcp_do_ecncomcnpollcvop_open_descqsphy_servicepckbd_accessops__cmpdi2cd_patternsraw_detachpmap_get_pdeisa_bs_rr_2booted_kernelfcom_cafcomconsbs_notimpl_bs_wr_1nsensorsdomainnamelenacard_pci_intrpciattachusbd_get_report_descriptornfs_sendip_rtaddrfiledesc_initload_dsard_server_looptag_switchvgaconsolecue_csr_read_1vreleohci_alloc_sedem_set_media_typeem_update_link_statusprtrealloccheck_consoleamap_freein6_domifattachwsdisplay_cnputcwdc_atapi_reset_2swreadusb_blk_nfreend6_prefix_lookupcddonesync_inactivespec_printlocleanpagesext2fs_lookupmsdosfs_openext2fs_linkcpu_switchvop_generic_revokeohci_hash_add_itdfifo_printusbd_get_bufferfilt_sigdetachtcp_do_sackext2fs_renameipsec_def_authmii_activateusbd_setup_isoc_xferttywflushcd9660_rrip_offsetfootbridge_bs_vaddrwskbd_default_keyrepeat_datacomcnmodeclosefvop_rename_desccomioctlumass_cbi_resetsoftdep_sync_metadataif_clone_lookupgetmicrouptimenfs_mount_disklessmii_tickip6_dad_countem_pci_clear_mwippbmatchuvm_pager_dropclusternfs_fhtovpfilt_generic_detachadv_pci_attachpool_print1nfsrv_fhtovpdb_breakpoint_listiha_cdcd_get_parmspmap_extractpckbc_is_consolend6_ifptomacamap_unaddxl_ifmedia_updvr_txeocbooted_devicecd9660_printohci_rhsc_enabledc_tickif_congestionnfilescd9660_islocked__bcd2binatapi_printin6if_do_dadrevarpwhoarewecue_txeofaue_detachpipe_kqfilternforce_pci_intrext2fs_openpmap_devmap_find_pasoftdep_setup_directory_addusb_insert_transferfootbridge_pci_bus_dma_tagmsdosfs_vnodeop_entriesukbd_keymapdatafxp_mediachangest_mode_sensestopprofclockdb_hangnullioctlukbd_is_consolepte_l2_l_cache_modeisohashparsediskncr53c9x_schedukbd_keydesc_itbreadem_intrdc_miibus_writeregamap_lookupnetaddr_matchne_pci_lookupnfsm_srvpostopattripctl_varsapollo_setup_channelpmap_page_removert_timer_remove_allwskbddevprintpckbc_console_attachedwdc_output_bytesdc_coalsoftdep_setup_allocindir_pagewsdisplay_closescreenisa_bs_wm_2em_read_reg_iopmap_set_pt_cache_modeisa_bs_rr_4sa1_cache_flushItcp_usrreqdb_playsnfs_getnickauthsd_interpret_senseudp_usrreqifmedia_initext2fs_vfsopsext2fs_inactivedead_bmapdb_guessessoo_kqfilterfifo_pathconfcpu_startupwsemul_vt100_output_dcs_dollaramap_reffilt_fifordetachdb_command_loopwdc_ioctlfilt_fiforeadfdexpandtickssrandomwdc_ata_presentpdc20262_dma_finishmsdosfs_closeext2fs_setattrxdr_inaddr_decodesysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intrusbd_get_device_descrw_exit_waiterswdc_default_write_raw_multi_2iha_append_done_scbuvm_pagedeactivatevop_write_vp_offsetscy82c693_initufs_unlockmainbus_bs_r_2tcp_ctloutputmono_timeukphy_statusMD5Updateblktochrvop_create_descifmedia_setpcscp_dma_isactiveem_setup_interfacepmap_createuvm_map_extractnfs_readdirrpcnfs_msgahc_adapter_req_set_xfer_modend6_prelist_addufs_removeboottimecd9660_readlinkwsdisplay_set_console_kbdVOP_ADVLOCKdb_watchpoint_cmdwdc_atapi_intrxl_rx_resyncfrag6_inputunpst_sendspacewsemul_vt100_output_escisa_bs_subregiontcp_rscalettwakeupuvmspace_freeext2fs_inode_poolswbufffs_ino_poolpmap_pageidlezeromii_phy_statusmsgwsdisplay_internal_ioctlcpufunc_domainsVOP_PRINTfdsharepci_subclass_memorybufclockhandlericmpv6ctl_varsinverse_regioncdstartsa1_cache_flushIDfilt_generic_readwriteuserconf_disablespechash_slockusb_detachpckbc_isa_attachipforward_rtdb_elf_forallohci_device_isoc_closevt100_ansimodeuhidev_activatefifo_nfsv2nodeop_opv_descdb_set_temp_breakpointdc_setfilt_21143ahc_probe_scbssys_nosysat_pollallproccdevswnfsm_uiotombufne2000_attachem_enable_vlanssys_mlockallgallant12x22wskbdcloseuvm_sysctlgetsn_bus_dmamem_unmapdisksortsys_fchflagsnamei_poolpckbd_ioctlrt_timer_countpowerhook_disestablishvga_loadcharsukphymatchuvm_pager_putohci_device_bulk_abortip6_ecn_egressin_canforwardremove_selectionwsdisplay_shutdownhookohci_device_intr_abortpmap_destroynfsfifo_writekernel_pt_listpowerhook_listetherbroadcastaddrsii3114_chip_mapvfs_getnewfsidaue_rxeofem_cdudp6_ctlinputitimerroundarm32_vector_initwdog_shutdownscsi_print_sensewskbd_update_layoutwdc_cdmmopenffs_inode_freeohci_device_intr_transferukbd_intrrtioctlkue_ctlwsdisplay_noemul_matchprofprocswdc_free_xferip6_inputfootbridge_intr_disestablishpagemovegeneric_armv4_bs_rm_2route_srcvr_resetspeedup_syncerigmp_sendpktAscAbortCCBloop_clone_destroywdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcm_getptrukbd_caufsvnode_filtopslemac_ifmedia_statusreadbuffersuvm_fault_unwireuserconf_common_attr_valext2fs_vnodeop_entriessys_getitimerhid_get_datadonicewdcstartfxp_statchgetherip_inputcpu_configureip6_freemoptionswsdisplay_common_attachpool_page_alloc_oldnointrpmap_fault_fixuprn_refinesgeneric_bs_rm_4sockargswsdisplay_getactivescreenhpt_setup_channelvop_generic_abortoplemac_init_adapmemstattachsetregsusbread_filtopsnfs_rcvunlocksobindvmcmd_map_zerodb_read_charnfs_asyncdaemonnfs_del_tobecommitted_rangevfsinitarcbroadcastaddrcnclosefxp_pci_matchnfsm_adjdb_tok_numbersddonetcp_do_rfc1323ip_fragsfilt_fifowdetachwdc_dmawaitmii_phy_setmedialo0ifphostidpool_chkusbd_free_bufferuvm_pagermapoutipqmaxlenext2fs_vptofhnfs_linklemac_ifmedia_changeip_maxqueuesysctl_ttyuhub_cain_socktrimwsmux_rem_muxrtallocsys_mprotectmsdosfs_reallocblksvop_readlink_vp_offsetsdequeue_randomnesscue_casyncer_maxdelaywsdisplay_getscreendeadprocdc_mii_syncstart_reaperuvmspace_unsharesys_fcntlnforce_setup_channelvfs_free_addrlistsys_setrlimitsys_sigpendingloop_clone_createem_hash_mc_addruvm_map_cleanicmp_redirtimeoutpool_allocator_drainttyclosewdrestartdisk_resetstaticmp6_nodeinfomaxvfsconftimeout_addcpu_cdpcscp_dma_isintrip6_forwarddb_fncallnumcachelemac_tne_intrcmd0643_9_setup_channelcpu_initclockscue_sendwskbdioctlmii_downdsrtcmatchkinfo_vgetfailedbrelseext2fs_unmountpsratiosdminphysfootbridge_pci_mem_bs_tagohci_device_isoc_methodswsdisplay_switch3ttyoutdevice_lookupDebuggercdminphysnumcleanpagesschedhzem_allocate_pci_resourcessa110_context_switchrip6_inputuvm_tree_RB_MINMAXtcp_totbackoffuserconf_basepci_subclass_displaylooutputcue_setmultisoisdisconnectedcpu_coredumprevbitsdvd_read_disckeypmap_clean_pageuvm_aio_aiodonefxp_pci_capmap_clearbitclrbitsdb_boot_dump_cmdlemac_ifioctlmii_phy_statusnfs_repheadcommajorscsidebug_levelgeneric_armv4_bs_r_2socloseinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemonisa_mem_bs_tagsys_nfssvcskpcrd_sleep_pridb_leohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8vop_read_descswitch_exitboard_startupcluster_newbufsys_socketpaircnreadpcimatchudp6_sendspacedounmountuvm_swap_allockthread_create_nowwskbd_pickfreetcp_ackdrop_ppslim_countdb_elf_line_at_pcfxp_autosize_eepromarm_picache_sizepool_cache_destroyahc_dump_card_statettspeedtabns_scx200_setup_channelkqueue_readcd_scsibus_setvolcd9660_mountst_mode_selectuserconf_maxdevcue_initfork_tfmratesiop_del_devacard_setup_channelvga_putcharpv_sizewskbd_activatewsdisplay_cons_pollmodend6_purgedb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdiszerodevxl_initvop_advlock_vp_offsetsumass_caem_hardware_initgeneric_bs_sr_4lf_freesys_fhstatst_unmountnullmodemohci_hash_find_itdahc_search_disc_listif_attachdomain1raw_recvspacediskerrcd_cdwsdisplay_screentype_pickwsdisplay_addscreen_printdb_machine_commands_installsys_preadem_media_statuskernel_pt_lookupkmem_mapcd9660_check_exportconfig_pending_decrqsphyattachsoqinsquediskstatsdc_decode_leaf_symavail_endudp_inputnchrtoblktblbooted_partitionihashrn_search_mresettodrufs_readdirgeneric_softclocksys_flockarc4random_initializedpvspec_badopmsdosfs_linkisa_bs_wr_1bs_notimpl_bs_c_1ohci_root_intr_methodsicmpctl_varsigmpstatvn_initialize_syncerdcd9660_quotactlicmp_sendsiop_morecbdcy693_chip_mapvop_bwrite_vp_offsetssiop_ppr_negfcom_cdwdc_ata_errtime_uptimekrpc_callsowakeupinsidebs_notimpl_bs_r_4db_putstringdc_encapprefetch_abort_entrymouse_copy_lineimensigactsunsharetimeout_hardclock_update__wdcdo_resetrdattach_edatattkqfilterm_tag_deletecd9660_ihashremip_fragmentusbd_endpoint_countsys_statfsfootbridge_ipendingrawin6pcbtablepmap_protectpool_cache_invalidatekprintfdevice_unrefscsi_startin_cksumvnode_poolvnode_free_listtcp_savetiuvm_pagereallocncr53c9x_reselectuvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadpool_printit_endpciide_attachsogetopthid_report_sizeuvm_unmaparc4maybeinitdb_deletewatch_cmdsoftdep_load_inodeblockwsemul_vt100_attachisa_bs_r_2arp_intimerpollscandomaininitsii3112_setup_channelvflushbuftime_secondacer_chip_mapip6_forward_rtwskbd_get_mapentryusbd_get_interfaceusbd_read_report_descsbcreatecontrolsys_mlockdvd_read_structvdevgonehtonsdb_show_callout_bucketahc_controller_infokqueue_writesys_syncbucketnfs_readdirplusrpccominitnfs_pathconfmb_mapnfsstatsenodevffs_mountfsin_delayed_cksumin6_is_addr_deprecatednfs_rcvlockiha_find_pend_scbwsemul_vt100_edukbd_keydesc_esicmperrppslim_lastrtstatttvtimeoutncr53c9x_intrabtstackspeclisthbdwriteVOP_INACTIVEpte_l1_c_prototcp_syn_cachewsemul_vt100_translatehaltpciide_sis_productsinphy_cakputcharsys_getsiddb_trace_until_call_cmdcue_csr_read_2fileheadusbd_alloc_xfernextvnodeidcttypollsys_swapctlbd_reqahc_resetst_patternsbs_notimpl_bs_rm_2isa_cain_selectsrcmsgscpu_exitwskbd_muxopswsmux_add_muxbpfilter_destroyunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamernd_rselusbd_nbusesfrag6_nfragsip6_log_timeem_devicesinphy_statusrtalloc_mpathiha_abort_xsvga_40lscreen_bfsii3114_chansetupdisasmufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnvga_console_typesbflushipsec_require_pfsswapdevsiop_devwd_cawsdisplayttykue_senddc_rx_resyncsysctl_intrcntvn_readbwriteleavepgrpqsphy_cdcd_scsibus_set_pa_immedarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closeiha_state_1em_write_vftastatminem_fill_descriptorswsfont_locktcp_timer_funcsipqent_poolpcib_cdbufq_default_addif_attachdomainucode_tableicmp_ratelimitinvalhashuvm_km_page_initrttimer_poolusbd_get_config_descvr_devicessosendukbd_keydesc_sgdosetrlimitrn_initcmd_channel_mapbufq_default_getloopattachusb_match_devicedp8390_watchdogwdc_input_bytesnfs_hashlocksa1_cache_flushDdb_listwatch_cmdusbd_do_request_flags_pipeprocess_read_regsnfsm_reqhchainlengthdc_miibus_readregvr_intrrn_lookupuvm_map_reservedc_resetallocate_copybufferuserconf_show_attrsys_execvedc_pci_caite_setup_channelamd756_chip_mapfdallocusb_pci_remwsdisplayreaddc_mii_sendscsi_donenfsspec_writechkvnlockhw_sysctldb_siftingdb_look_tokenpmap_alloc_l2_buckettcp_syn_cache_limitconsintrnumvnodescomreaduvm_pagefreeukbd_decodecd_scsibus_opslemac_ifattachext2fs_inode_allocwsdisplay_switch2fcomconsiohdb_examine_formatiha_pci_attachin6_ifindex2scopeidin6_pcbbindcluster_rbuildreapercoredumpfilt_kqueuepckbd_cnattachmalloc_rounduppipe_readifioctlsys_utimesdb_symformatsusbd_do_requestahc_set_namend6_storelladdrrip_initsocreateusbd_find_idescpmap_cache_stateureadcaue_startufs_setattrlogprimemhookdoclusterreadsys_exitnfs_decode_argsm_applyisa_bs_wr_2isa_bs_unmapem_disable_promiscwdc_exec_commandvga_stdscreen_bfdb_watchpoint_listwdcintrusb_seleventcd_playsys_clock_getressyn_cache_insertspec_bmapfootbridge_foundttystats_initpciprintne_cdem_allocate_receive_structurespool_cache_destruct_objectnd6_umaxtriesohci_device_intr_donefxp_mdi_readnd6_debugmainbus_bs_r_4stdumpdb_delete_temp_breakpointcpu_cpuspeedpciide_cmd_productscpufunc_idget_random_bytesesymfiqhandler_stackosreleaseVOP_RECLAIMspec_nfsv2nodeop_psiop_update_xfer_mode__modsi3tcpqe_poolpgrp0userconf_changecd_scsibus_getvolmakefstypedb_paniccddkdriveruvm_anon_adduserconf_helpufs_advlockicmp_initmouse_moverelsii3112_chip_mapuvm_growvfinddevE_ldsa_abs_reselected_Usedif_detached_initpciide_unmap_compat_intrnfs_falsedopowerhooksether_delmultivfs_op_initdb_history_currvga_screenlistmainbusattachrn_mpath_initheadrpc_auth_kerbexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutvr_miibus_writeregwdccommandshortvcleansplassert_ctlwdc_atapi_startsys_getresuidsys_fhopendos2unixfnscsibussubmatchrtentry_poolcdzerorefuvm_km_pgremove_intrsafeext2fs_sbupdatedefrtrlist_delsys_fchmodvop_strategy_descuvm_unmap_detachvop_islocked_desciha_msgin_ignore_wid_residuserconf_common_devstartskip_spc_leftusbd_devinfosiop_wdtr_negst_identify_drivevn_isdisksys_selectbadaddr_read_1vnode_free_list_slockzombprocdb_branch_takenpckbd_bell_fn_arglogreadrn_mpath_capabledead_lockusb_pci_addtcp_issphysical_freestartfc_largedistancenfs_add_tobecommitted_rangesys_setitimerisofntransnd_prefixwsemul_vt100_resetext2fs_specop_pvfs_unregisteriha_done_scbvt100_setnrcfootbridge_csr_tagselwakeupem_update_adaptiveffs_reloaddb_set_watchpointsem_initialize_transmit_unitcnwriteumass_bbb_get_max_lundb_show_panic_cmduipc_usrreqnd6_na_inputrtl80x9_mediastatusdb_next_free_watchpointvflush_vnodefilt_rndrdetachscsi_scsi_cmdiha_xpad_outem_media_changefootbridge_pci_conf_writerip6_usrreqin6mask96xl_eeprom_waitcolddb_clear_watchpointsbutton_eventunp_scansbappendaddrbpf_maxbufsize_vga_mapcharfcomcons_bs_subregionufs_islockedusb_detach_wakeupffs_unmountfifo_inactivene2000_detachsys_pwriteisohashtbluvmspace_allocrevarpinputpckbd_cnbellcd_pausesoftdep_setup_directory_changehashinitttstartumass_setup_transferrd_ioctl_kallocwdwritenfs_removerpcipsec_keep_invalidpciide_channel_dma_setupvga_pci_cnattachuao_detach_lockedpci_devinfosdopentcp_tracemii_phy_resetip_getmoptionsdp8390_mediastatusin6mask32__moddi3disk_countohci_confdpmap_page_protectdead_openkue_setworddb_list_watchpointsatapiscsi_matchuserconf_attrwdc_kill_pendingicmp6_redirect_outputroute_cbvop_revoke_vp_offsetsva_nullexphy_cdreadeppckbd_belltcp_slowtimocd_play_msfpmap_remove_pvtcp_newtcpcbsys_fhstatfself32_load_filesys_getpeernamevr_ioctlfcomopeniha_init_tulipdb_taken_bkptdb_eqnamescsi_strvisbpfwritedoingcachesys_getrusagemainbus_bs_mapaue_reset_pegasus_IInd6_prunecomconscflagm_getffs_truncateuhidevprintfootbridge_pci_make_tagmii_attachnfs_replyttylclosecmd680_chip_mapmd_diskconfpool_allocator_allocwdc_default_read_regin6_ifremloopchar_typeohci_free_sitdncr53c9x_debugusbctlprintvn_closexl_choose_xcvrxl_stopin6_createmkludgedoclusterwritewsdisplay_cfg_ioctlusbd_close_pipeffs_writebremfreefilt_sowdetachnd6_initip6_maxfragslimfreefxp_intrsoftdep_setup_freeblocksdb_show_regs__wdccommand_intretherip_outputuvm_km_free_wakeuprootvnodeifmedia_ioctlpmap_pmap_ctordc_mii_writebiticmperrpps_countuserconf_modify__one_cmpldi2atapi_mode_selectcpufunc_nullopcd9660_ihashgetmii_phy_detach__muldi3wskbd_add_muxmbtypesvga_copyrowsdb_qualify_ambiguous_namesuhidev_caip_mtudisc_timeoutvfs_opv_init_defaultrandomopenin6addr_linklocal_allnodesfxp_watchdogbufinitskip_char_leftpcscp_gluebootconfiginswds1687_readscsi_quirk_patternsisamatchuserconf_linesnfs_truelimit0E_abs_targ0_Useduniqdosnamedb_recoverusb_async_procext2fs_mknodvttoif_tabdb_delete_cmdfifo_nfsv2nodeop_entriesbgetvppgrp_poolucred_poolvga_doswitchnfs_startarp_maxtriescd9660_bmapaue_eeprom_getwordufs_dirbadentrylogioctl_bus_dmamap_load_uiogeneric_bs_wr_1strlendb_machine_initnfsv2_vnodeop_pvop_abortop_vp_offsetsfifo_kqfilterwsfont_initwsdisplayparamkue_activatepool_page_freewdactivatecopystrwdog_ctl_cb_argsys_pipeusb_detach_waitarm_pdcache_waysarp_rtrequestvr_initext2fs_reload_vnodeelf32_check_brandnfs_getset_niothreadsudp_initfootbridge_caproc_trampolinesys_rmdirdp8390_disableem_attachcd9660_vfsopspckbc_attach_slotem_get_bus_infofxp_cdAscResetDeviceallocbufsocantsendmoreproc_zapvop_revoke_descusb_rem_taskpte_l2_l_cache_masksiop_sdtr_msgcdactivatenfs_merge_commit_rangesether_inputuvm_vsunlock_splraiselockstatusquotaoffarpioctlffs_fifoop_pfs_posix_sysctlif_slowtimowd_shutdownudbtabledb_load_countahc_chip_nameswdcattachufs_printem_rar_setfatentryisa_bs_barrierncr53c9x_abortmf6ctablesiop_startusbd_printBCDsys_statvga_alloc_attrin_baddynamiclineswmsdosfs_symlinksys_symlinkicmp6_sysctlclfreeconfig_found_smusbd_interface2endpoint_descriptorrpc_autherrfdreleasedb_line_at_pcuvm_swapout_threadsknote_attachmax_keylenxl_pci_matchbus_space_copy_4dp8390_ioctlspec_nfsv2nodeop_opv_desc__assertif_congestion_cleardb_put_valuewsdisplay_emul_matchin6_prefixlen2maskudp6_outputcn_devvpcom_activatemaxfilesuvm_pageactivatein6_addr2scopeidip6_sourcecheckvop_access_vp_offsetsne_pci_attach_bus_dmamap_load_rawffs_mountrootrd_cdahc_donenfs_add_committed_rangetprintfuvm_map_pageable_alldofilewriteipqiha_sync_doneiha_push_sense_requestmsdosfs_strategytimeout_delem_ioctlwsemul_vt100_elif_delgroupspec_strategyuvm_pglistfreenfs_attrtimeonfs_bufqusbopenext2fs_readsoo_statwskbd_cnpollckue_newbufdisk_detachrusage_poolstrchrhid_clear_localahc_clear_critical_sectionscsi_sizelemac_multicast_oppci_mapreg_infomainbus_bs_barrierdb_deletegenericconfget_bootconf_optioniftovt_tabtcp_backoffvga_scrollbackmainbus_bs_w_2sys_chrootwdc_ioctl_freeavail_starticmp6_redirtimeoutsoisconnectingmtx_init1wsdisplay_pollcpci_subclass_processorvop_link_descaobj_pagerne_pci_caahc_compile_devinfostopenuvm_tree_RB_REMOVE_COLORgeneric_armv4_bs_w_2MD5Transformmld6_inputgeneric_armv4_bs_sr_2vop_link_vp_offsetspmap_copy_page_genericbpf_d_listsyn_cache_cleanupip_pcboptsfc_purgeiha_scsi__data_startem_detect_gig_phyvop_getextattr_descahc_cdifmedia_delete_instanceE_ldsa_abs_data_Usedsoftdep_update_inodeblockicmp6statdb_single_stepwsdisplaydevprintgeneric_bs_w_4wsevent_pollmap_backmergesys_profilvmcmd_map_pagedvnnfsm_disctin6_pcbhashlookupwsdisplay_cdvr_cabpf_detachdVOP_UNLOCKsyn_cache_initvop_readdir_vp_offsetscd9660_wchar2charip_ecn_egressether_ipmulticast_maxmouse_copy_extend_worduvm_init_limitsiha_waitukphy_cdsii3114_dmacmd_writein_pcbconnectdevoutahc_busy_tclem_free_transmit_structurespciide_dmacmd_writeokaytocloneVOP_POLLVOP_IOCTLstatvarsafeprisys_rforkwdc_default_read_raw_multi_4uao_swap_offmachineVOP_CLOSEuvm_anallocin_pcbdisconnectuvm_vnp_terminatepool_cache_putsys_getpidnd6_defifindexunp_dropuvm_map_advicetcp_mtudisctimeout_startupcue_matchpckbc_enqueue_cmdrn_addroutesdactivatenfsrv_errmapem_cleanup_leddb_print_sadb_elf_sym_numargswsscrollbackdb_trapperukbd_cnpollcvr_ifmedia_updahc_handle_scsiintshmsegundstackdvd_read_manufactconfig_activate_childrenem_allocate_transmit_structuresnforce_chip_mapem_mc_addr_list_updateremrunqueuesoo_closesiop_handle_resetnfs_kqfiltertcp_recvspaceuvm_meteruhidev_maxrepidsubnetsarelocalpmap_needs_pte_synctcp_ackdrop_ppslimsii3114_write_regnfs_requestnd6_lookupfxp_shutdownpager_map_wantedsys_getppidmii_anarVOP_READDIRdomainsem_led_onsys___sysctlarm32_dma_range_intersectin4_cksumextent_alloc_subregiondb_putcharneedbufferwsemul_pickusbd_do_request_asyncin6_ifattachtcp_rst_ppslim_lastwsdisplaystartbs_notimpl_bs_rr_4uvm_rb_removeohci_root_intr_donetickfixisa_io_data_vaddrusbd_get_device_descriptorcd9660_initumass_fixup_yedataipsec_soft_bytesnselcollemul_elf32usbd_open_pipenumdirtypagesm_tag_unlinkohci_softintrbufhashvga_show_screenmsdosfs_lookupspec_pathconfmountroothook_listhook_establishtcptv_keep_initsys_chdirsensorsdb_unread_tokenext2fs_diremptymotion_eventuserconf_cntE_abs_msgin_Usedmouse_zaxisem_config_dsp_after_link_changeext2fs_inode_freedb_find_variablexl_txeof_90xBukbd_keydesc_swapctrlcapsip6_rr_prunevr_cdsbcompressukbd_keydesc_dkmsf2lbapmap_free_l1nd6_outputcdevsw_lookuplogsoftcsys_adjtimexl_pci_caohci_device_clear_togglepckbd_keymapdatavop_kqfilter_vp_offsetswsmuxreadwdstartamap_splitrefnclruheaduvm_aio_biodonern_initheadukbd_keydesc_deusbd_get_descem_start_lockednfsfifo_reclaimvop_generic_unlockuvmspace_sharert_timer_addpci_get_capabilityroute_usrreqdeextendem_receive_checksumnfs_readlinktcp_dropicmpstatnv3tov_typeudpctl_varsm_prependvop_advlock_descwsemul_vt100_output_scs96_percentcd9660_pathconfpckbcprintin_pcbrehashin_arpinputufs_accessin6_embedscopeif_alloc_sadlunix2winfnncr53c9x_get_ecbwsfont_unlockreassignbufsiop_minphysip_freemoptionsnetconsohasoutofbandspec_vnoperatevop_ioctl_descddb_initwsmux_attachbs_notimpl_bs_c_2nd6_dad_duplicatedsoftdep_change_linkcntfifo_vnodeop_opv_descwsmux_detach_bus_dmamap_unloadmsdosfs_fhtovpbs_notimpl_bs_wr_4nfs_inactivepim6_inputether_crc32_besiop_setuptablescpu_reset_addresspgfindxl_waitahc_scb_devinfopckbd_consdatavop_lock_descdsrtcattachtcp_ackdrop_ppslim_lastrqinitloadfirmwarecd9660_ihash_slockip4_inputtcp_inputsysctl_dumpentrydkcksumwsdisplay_cnattachpcib_caiha_msgout_abortnd6_gctimerncr53c9x_initdc_pci_matchcd_switchiptimerip_inputnd6_setmtuwdc_ata_ctrl_intrdb_last_non_spaceusbd_get_endpoint_descriptorudp_ctlinputmii_detachpool_sethardlimitpci_subclass_prehistoricn6expireip_freefdb_show_cmdswdc_default_write_regudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnd6_ns_inputdevice_refrd_root_imageffs_syncuvm_map_submapnfsm_srvfattrcnioctlufs_vinitem_set_d3_lplu_statepool_primepgrphashtblcomconsinitsddkdriversys_getpeereidifmedia_matchstatclocksiop_ppr_msgaue_activategetnewbufdvd_read_physicalrw_enter_writeukbd_keydesc_de_nodeaduvm_mlk_hintuserconf_argbufm_tag_copysiop_pci_attach_commonst_readpci_io_finddb_value_of_namepmap_l2ptp_ctordata_abort_entrylemac_port_checkhid_get_itemfootbridge_mem_bs_mapmsdosfs_getattrdb_find_breakpointwritedisklabelm_devgetmsdosfs_printkernel_pmap_storewsemul_vt100_opsem_write_eepromstartprofclockohci_device_isoc_enternsphymatchundefinedinstruction_bouncesys_getresgidprocinitmsdosfs_readdirdead_ebadfusbd_interface_countwddetachnfs_symlinkintr_calculatemaskssoo_ioctlforkstataue_miibus_writeregin6mask64db_lbuf_startohci_rhsc_ablesoftclockadv_attachupdate_modifierdb_breakpoints_insertedswdevtdisk_lockpcscp_matchsa1_cache_syncI_rngsa1_cache_cleanIDsbwaitufs_reclaimsdwriteohci_device_intr_startvga_common_probekernel_debugfilt_logreadsysctl_rdquaduvm_vnp_setsizevmcmdset_extenddefault_product_descip6_use_deprecatednfs_setattrrpcuserconf_hist_intextent_alloc_regionsys_mknodext2fs_mountfskill_vmcmdsufs_mknodsbinsertoobknotelf_advlockpffinddomainfreeem_phy_get_infoxl_miibus_readregswstrategyuserconf_pnumscsibusprintrtl80x9_init_cardsys_getpgrpukbd_ioctlwsemul_vt100_console_emuldatasonewconnisa_intr_establishdb_fetch_regufs_direnternfs_reqqgeneric_armv4_bs_c_2pffindprotobold8x16_iso1cluster_readtcp_saveti6wdctimeoutwsemul_vt100_initnchrdevundefinedinstructionaue_cdpciide_canatsemi_pci_intrpciide_chansetupqsphy_cashmmaxpgs