ELFa( 4=4 (  55((=]]Xg_DO! "&@00Q_: 0/=\@/ XX@0 6QQO @@( @0 <  B00 RVР -L `]3a]main() returned\$a   ),@@(LQ 0/Ln]$a - 0LP@pA`93`VZ -LM`P@p"@D0D 00`` @ -LM`p@P 0 0 0 00شҴ0  Ĵ㾴P@XP 0㰴㪴@TZ㢴X 0P -LM@P`p? 0X0 S 0N 0I 0D 0?ii -L M0 ||!\, 40 p@M ,*0ST1  , *W8E0E@(1 0S:P`劀0S0 0 0PU@ PU*00 ,*00" 4 ᄻx0Թ\ \0@D P gvp00 8 P 5 5 5 5 5 -4!L01 M, P@0 00eS4 Z0p , 0 Z 1!R,00 )  P,00  @0S0 0@` V $H0tP$ 0lP, 0 04崭 5 5 5 5 - L 0$ 0 $ -LM  0@ 0 0T p-QLM0@`  `gpQP* 0 P(U:p p-QLM0@`  `gpQP* 0PXU:p p-QLM0@`  `gpQP* 0P\U:p p-QLM0@`  `gpQP* 0 P,U:p -QLM@0 3 3 -QLM@z w83H3 -(L  -(L  0-" _  P0L @ 00hX p-LM@ 㺲P` 0㰲00PY YR` cUpp p-LMP@`V0 pd㊲p0H@ 0S' 000K  c  0H@ 0?' p-LM@` Pa?XP 0s UP(0Sp(00PS 0U 0 0 40P 0UPp -LM0pS 0S 00 87 0`%`K% [)0S ) %0K  0@P&PK& [)0S ) &0K {0VS UR Z   Z8,0X12hZ(1,@0X 0GP0 0000S 00  000 㝱000 0`P`PDH$ ,0K$H ,K+K*@K 12h1, VU000o00kI 5 p-LM@`bP[p -h2LM PRT2 J D ʽ0S4200h0S 22  .A^c 4$` ,p@dP,` 000S2022/`VOھ2p1  p,@`0,K  `VOZ`@0S2`VZ00,0K,pK 0(@ *pK+KV 0< P 202" 5P2022$00$0d0 \`000P |P] 5  5j 5 T3__ p-LM4@PU @$ `00  $ 0!2c1,0  0!2c16`,pXP $ p-LM@Pz`)@pp 0-LPi@0hb p-LM$ P0S 0 $p4 `  0DPT0T $0 0$0 0$0 0P$00$0p -LM8@6@ 00S<"Z -0LS0@0p- 0PP00P=WP`U L~    (t qn 5j\3T4|33 0-L@LP կ0( ͯ0( 0hį' -0LM@p 㴯00 ` 㣯00 PZpd3 <# R00Wڀ0?3S -1LMp@+p`0((0) %0K%[R%0K P )U d0 S pWR0++'0K 'K$0 ^0((0) &0K&[R &0KP ) -`0VLpP@ 0DPT dT0`0 0V D0PT -PL4p`V 4h$0( 00fc`$ 0  $00 $00 DPT$0 0$03|g43333ȑ3 -#LM08 ,0 p0 P 4 )3RR 0 A= 0 0   h3 ,0S \,b0S 00g 0S@0 ŕ0őSS000@0000&2R& $ ` @0S6`V@DZX 0@00  00 `~0S6V`VZ6 `0S61`VZ0S0 00S000 @0 00   p pR00B"0P0 00    ,  R00 0B$`000 0 @0S   60S0 ` 00`(1 wP0 0  0 S   50S0`00`0 \P0 VE00@p x0 KPk40Sh@@j0H 00OK ,P000/ꠚ_ܑ3 5 -08`P@L p0 T P0  0@e0 -08`P@L p0 T P0 0@e0 p-LM`P@2PUOp 0 @|P00 `0 0T2 <201$233T43$343 p-LM@8P@`4  00 00S p  0S > S 00p000 d`p 0 00  (000C0 H3x33 -LM0`10#0P8pdP@0 00 0000  0 0, 0 004 P֦`/0 0@ 0 0 @08 @ϴ0  @Ầ\$ & & 3 -LM0p ` P_㛬0ST  0 PE0 @ @00$00$0 00/A#bJi l i* e 0 P(0 0S  0 Ph ,000i? ATMb5 -LM0` @2c1RP,p 00 P 00 0 (0000  ~dW 0 p-LM(0 @ 0P<0(0`0@000+  00    0  0 w0 0Sph.000000 00 00 -LMh0 80 PD1< p4 4PKR0 P8_P&0KP<@40K&l P, /K3K2K1`K.K 0 !0 0 08 0< 0 0'0 ,0S ,%頚_3 M-L@M0 0@ 8H0 H `"(D %! %8X @68P0 < PL X%LDd ` d\ , \H &t4K`&4p"l PT0 8pK7K6K5K3PK2`K1K< 80K  @0Kh h  @ 0 0 0 0 0\ 0 0 0` 0< 0'0 ,0S ,唹頚_3 p-LMP0K`Pc @?_ "0  0'p0@- @ 0S  4000$0 0$0$@@ 0-L@イP(a@xT` լ0__ p-LM @00P e$0`0$0 @R 0$ 0 00  0 nphP\__ -LM4@0S @440S -L M$X @R0  l0@ $@ h33 - L -LM 3@ 0S@0 @__ -LM@ R000 h雓 0-LP,0@T 0U @Tգ0__ -L MPP@`x  %?`8@K 3KH5 03KP3[S,20,2 ,⿴> T*40%#K #KP#[? ?}O $4  0 0 ,2 ? ? s? J?  ဈ /H|,2@$0,2003($ 0Ҕ 0͔,2   0 0Ổ 0嵔,2 0t宔,2 0᧔ 0H墔,2   0ᖔ 0吔,2 0剔,2 0႔ 0},2 z 0qt 0k,2 0ld,2 0] 0bX,2 Q 0LK 0F,2 0?,2  083 0"2,2* 0+,2!1ϕ,\`0@ ,",2h1\,20,2X1QH1,P0À ,",2,1 P,20,2 1 1,"Q1}>@ 2Q,"420Q,2<,2,20,20 Q,2; ,3P3\3N4p3+ :B>FJNRVĀ T4(| #5_eNa'(j) -,"8 L#8  R2 d X -,"8 L#8  R4 h X -LM,2`0 4Z BR2 d 0X –R4 h 2Xz R2 d 0X 2R0 ` (– 0R4 h  X2Xo_  2R" D ( –R@4 h 0XH$2$HT@ 0  : –R4 h :X: –R2 d $1X0S : –R4 h 0XE: –R4 h 0X –R4 h 0X –R4 h 0Xp -:L 0R (  -iMLM0ܦ  ,0 p? R06 R 㷟@PᯟUE  !㪟h&`101ᣟ$0001``` `㚟@${$ᒟ$ R 1 0+10 (`,` R K:P }D 剫0 <0 < P  7 d<00 0 ꠚ_ P_4_(_p333:|3$3L3304;404d0`000d0`0 p-0LM`a0@l4K pL0,0P@@ӝT  phN5 3 -LMtA0P 00K  00"[80 (1R8 R 3[pCX#>mW`,•   20K: •R8 p (K#[0 R3K#[101pW. 0/08 h0L@0[> > 0    -4BL@DtpP — (0  @DFtTej —R8  #8X BR8  #8X 0RR8  #8X— 8#8 XA —R0 ` (0P@DtT7< 0 2R  (— 0R4 h  X0X  7  _Ᶎܖ33 p-L M?PS`0 PEu @0@0 0S PEⶢuU,20,2`\01K02K01K40 K p("p,2P 83 0-?LSP 2 "$@•<< "0Tu•@ "0T0hj0 -L M?@SP 2R 2R 200!P 80}Pz 2R8 p (0 hVt 2R8 p (0 Pd`\0  RL8 p V0? SF ?S 1R x1R |1R P P 0 00 0,1R 01R0ASO O O O O O O O O O O O O O O  0P 0S0SX (PK?2K02K^4 40(PK V *D:#(( -L8MP`? Q ϖ\ 2P Z2P7  80Pp. BR8 p 0X –R08 p X0\  RL8 p U@2 8p0P0 ""K0 2K"K %> R ?01R08? 1R? @ 1@10R 0R 0R00 0R0@? 0R} 0RB NJ-%*C:FRV3 -FMLMX˟0,0 L;@Pᗘ ,2 0`  0Pp ڈ冘: ,0S ,R:T :T: T :T ^:T:Tu*:Tn x:T ps pd:TJ \:T > = S( =@S ,: 8C8p0202  9 R 9( KEK)(0KA09A 02 9 R 9( KEKt)(0KA@ 404 0S 9 v9 1m* 4Ppb4@p]*G8T P8TvMK@D @Dl(CPpEX8(Kp \?D8( K<(Q* _08QU  Q2  Q W0Pp'<Pp!40  K@7Q7 Q7(K'Q$ l7Q t7Q `7Q `7Q D7Q(7(K R,2  ,2  ,2 ,2@ ,2 &(K ?p 6Q ʴ6Q 66Q 6Q?S Pp4 ??pS 6 5p$&06T 6TxMK@D @D%"CPp? 5. @RL0SL5T5T*5T 5T h5T `5TMK@D @D$BPpe4@ ?S  PpY$_CpRmK`F `Fx$BPpHd(K0 SjT4( K$QQ  Q 84Q 4 $(K/ 4岀(KⳀ> T +(0K3Q# 3Q P Dㅟ= D 3Q?SN  0(K0x#43岀(K (KⳀ (K?#0S0(K0}/ 0᫉ 3TU J2TPK! WBPpP [ Q20SO@K* ^P GnK@`F `F@&@'@l2@(K@`"`2(K T2( KA ၣ 4 0tO@K PP [ 1T 1T4 1 R1( K!̠(0KMK@D0 @D P0(K RP@K! { @Pp_ H0T 00VʕBꠚ__39i iii2i 1i i i :i -71%Ci i8i i 5i i:i i 81<i i 6i(i8A -LQM,2 `! 0ㅕd 4@7崧0 3K?3K#K<K ?;'K4K DK$K 0\7\4K04KLKK  =0 5K?5K%KTK 7/5K K%K\K 6&6K dK&K &K 6&6K 06K&KlK 6&7K 'KK 0tK,2 y@iZDvPK@&@@n 6@`@K KK;KK] 0@T 5 R" 0S R UAoK@@@&@֝@K@ `@ 04y0K 3K03K 4K,4 R 4 XX4( K-K00QK3 ,2E?PCP 0nK0  P*`!0$"  P,2`! ("kdT4@04$X3+$aΦ{(#3(K BSK R?K 0"2(K =UK >K 0 2"=#000Q 4?S Q W_KVoK %>0H0D2(K!0r/2RW_K1"VoK(K01(KOKN/K00 0MPK&@⽜@$1@K@ =KMKK 0D10K8KKK 01!8K 0(K8K 0K,200/K7K'K 0|K,2w> :FB J N: 5ė33 4FD*!V-R8 -LGMA0笑S`p!, 000X 1 Rt10 S<0K ; 8K71"0C4K0#K2K1p 0C8#8R#$0$#K@BK' 5[90K 5K ? B_.$[P4[lA04KD 0  0000 <  Q? BD@x0 p 0 @0 0C0x0  j4?S C`?/ 423 hQ03N483t3v'N$ -LM1`@$0Bp S> 0H S#  h  000@}_!|P ӂl ?pᲀP0 R   :F p-LM@!0! ?P` ?S x1  , RT BRP1   R p41 00S ꘁ   ( 4 ? 7 0 \ 0 ?Tp? ^0 V? ? ? ?  R  R40  R,2 0 0 :F  0-MLM@P700000? R1  & 0\!00SSS <1/K 0!0K$1AKA APA>K0C R00000000 K 0 K, 0AKA APA.K B00C S񟗽$ 4 @ L 000000000: D -ML M,2BKI0 I| 000CSu= D 0T p0S^XPpڴ7! #  1  P`C P`=04H7( K81BNK0!@@D(0K 1  P`# P`7 0(K 0$!  0  P`   P` 7L0  @ T .:P`@   p-LM,2=̀@& 4/ P @? 00s` 0S`V@PpR 0 Ss:P ppp阚_ -<0',0L0 JN 0 0  JN p-QLMPC  R,2`:,2 ,2!:,2`000 0P@ V p 0S`+s է 00b=C4`#hx0  1> 0P@7p, 0, ,2 `p 83 0-0LM P0 0> @P: ”R  ( P, 0B=C01,2 0000  R-L 䠚 0 0C SEꠊ h h h h h h ̊ ؊ h  h @ L h h h p 0 00 0 0 0 0 00 0 0 00 00 x0 0d 0\ 00 P00@ 00 < 0-LM0@PShP P D Ԍ p x P h1 \1! 00,1 @ 1111 @P !1@P0 @ @0 000 000 000 000 | 00t0d0`0 @ T 0@P@0,@P  p-LMP\` 0@S0\0S p鎙  d B 0000 0-P@0@@L u00000 0-LMP0!0 }0@ 0K@{0 K0 K@t00@i00@0 0S  0頚_3 0-7JLP@Δt0 R 0s? X0  @0p  R0Z0x0 20hE B:ܓ 3 -7o(@_yL`p"㙔00    밠 C{ؙ3 -7o(@_yL`p"m00 Ә  Ϙ ˘밠 {3 -LM7p{s/000Q, K `V( 7c@0S91!@P<@dDFA 02 S&h1b1 R0``00`$Y `0,2,o@ X 2@TZz @ @dPDFA@04 Sʄ1d|A R@0 @000@0 @@z,`  [~L_P_ش_85303 -LMZˊP@T # 1  00p , W00$ 0 !0*0!00 @@Z00W00S@ 1 @T 1  o闊00 1+ 7`  1R010000 0 !0*0!00 0@@" `z 7` 101! R00:`cz Ķ5T33 p-LM0@Z6 PR0000 0` !*!0S00@@@P2 ph0 Ca5gfff -LMC0ID`z@D⸜pD20u? @$ R00000   R 0 0 0 @0S(("@P@dDFA@04 S1d1 R0``00`ʉ10C1xyꔀ匠@@dP弉DFA@04 Sʄ1dXA R@0 @000@0 @ ᡉ@RyP_L_ش_ -LMp0! 1?2c!c2cp@jP0`P0L yUF Dd @0u?   P@0u? 02#u 0 @,?@0 0  0PP0@S0 0 0P 101 㘖 L幛H0– ปD UxP~H`_, 5-0  t0 a1a2cP  0Q P 0S!0S~H -SLMZ` 0 P ʴ7yi0N0  0A 0  pK0K@K @0 SK 0K@uPY Pp 3• ;Q Q: '2 p+_㖑00  yO   /0 0Zp$ Ӭ0 ڨ K0 KZ& ,'%> R\F \ 'pZ 'p@\ 0  @K!1@RTں1@"01@42P @dLDFA@04 Sʄ1dA R@0 @000@0 @10@0'p~@w@0S @9@0K@Tڴ' L唴'8AP0S@000 @0S  'w@%> R~0S1ᴠ01's? ' p:!0R ʴ7 ߇ @@pׇW'p%PR w 00I괚3533L_P_ش_83`_T3t3 -LDM`JS, P` d0 @+ھ00 S0 Lh `0 d dpK [K!`K 0GP\K`K  80K<Pp 7䢟\0[ R 72 ,0S ,JΆ 0\[ iP=PP 1 8K Poh  p0S#: 7-_3?0 yO`0 啔  㑔 ㍔`0h `K `0`0 p` 0`0 岐?`00`0 p& h噳7 0ᓳ4?S' h0 h  0S !ᴓ 7 0 12 }7pt!7 7 h 7pd\7vLULRR0 B`0 d ,ꠚ_33335@3d33М33 0-S@P L0P 7 v)03 0-S@P L0uP 1 07 v0@3 -7L`@P80   40 20" @ 40W1I H  !1"2!1"2 0L" R03S SV㜂唂% { ݐ  0T2ST12.P?   ,0 S ,: S @00P`*@D S : R#: ,Jc0 >@`p`B0 Xp0C$ 0P8 ,04 0 !P@ 0P0SPP`  0 0B@$B -LMxPW$`K 0P@);~p$ ,0#  0@0(0(?^ H&~%~H 0p8~040 0~ p-LMP@ ~`8 0Hph} -L Mp yd— hl2  d2h ,) B9 @P0  _TU  X0\20\2 0PPU$0Z0PPU&0Z> 0'(0 0P@ p2 x,[03mP @ 090cP @ 090YP@ 0P90O0E?0P! |0U90|"#P0>U 0 P2x"PUd—hl2  d2h , `G d—hl2  d2h ,d—hl2@  dR@h0 \Pd—hl2  d2h P,cUl墩dBhl2  d—h0 \d_dBPhl2 P d— 0h\dLd—hl2 P d2h4 ,dB ɠhl2 P,  d—h 0\,!, P ͂d—hl2  d2h ,P UL@ @P1|P>U hd—hl2  p2dB ,0 0h \d—hl2  dB$0h \d—hl2  dB$0h( \dRhl2  d—h 3\dBhl2  d—3h1 \dBhl2  d2h ,d—`hl2 o `dB`0h \d—hl2  d2h4 ,, dR00"N>C 0C@0l, A, Ȃhl2 A$ @ d—h04 \,0dR!h2hl2  d—A0h@ \dBhl2  d2hH ,d—`hl2  dBh:H \dRhl2  d—P 8h\dBhl2  d—h0H \Pd— hl2  d2hH ,P UP 0@T 004 PHLH~0 D80~>H loYPUJA|hPU@DZ@4(3N43ğ3h 53 3@%I$̈ 5 < #50  -LMHTe | H0S8T| 㪃pj@8.HS H0 0-LMdR@ hl2  d”h 0\0 -LMP`{UC Um{0d– 0P0 0hl2 P d2 h,L(pR dBhl2 P d–p0h \2: 00C 0d–Lxhl2P d2h ,P8"d–0p00hl2 p p2dB t–,0 0h \d–hl2 p dB$0h \d–hl2 p $dB0h( \P8SBL(Rp/ dBPhl2 P d–@p0 h\dBhl2 Pp d–0 h\2 0L0C0POd–hl2p d2h ,pd–hl2 p P(dB00h \=P 40 R(0 R0 R|P]= -PLMP x"RpW 0``00VdB hl2  d•a0h \3` T2X"0 T2X"XOI3@T2V0CT2dB hl2  d•h 0\303 U$Nh| Ft1@`F\>dB hl2  d•h 0\*~`T80T8`P`T(0T8d hl2  d2 h,x"`ad hl2   d2h ,`Q x"pL<3P 5X333 0- LMQP dB@hl2 d•h @0\0#dB@ # hl2  d•h 0-@L0y$PB0h%y -QpL@P`,8S  0 R`(8S 0$ $Rp0S`@` TP$p@p֣봠3 -LMT2p0T2x,H0(,8(8xT $PU 0SSdX@Y 4P$U  R00R\ Y T20CT23 `4 @0 0b@0 L @0 倠0 `#> 00Z 3Z 0L0x`x0S R000R!B6S0 !0^@P""Q 00c0 C20000#2Tx`Nx$0S` 4 00dB hl2  d—0h \Z0 000x`i*xU@W$0S  -LM`@(0 S4p8PP 0$01l00<@ ,0 00 00C 00$@202LP0080004 -LMhdBP l2`   d2hP ,V5 <0 @ȕ10C S1 !@# T 0 0 mTpd• hl2  d2 h,?> 0D <@0 Tp -LM`0Vp0P 0 QdBhl2 d2 h,3 `VZ00h:0S | -LMd@ hl2  d2 h,3 h -L$MP%% 0 0 < pD8`*P, @ $P@ $4D@08 8 <2 00 $0880, T4  ,K4 <0N,0P @, k4040<0<@   Y140<0,  0 0 4 0 22$p<P!,\H10L`0,0,0, ,0 , 02,0, $pv08 08dBhl2`  d˜0h \0S 0 R vP@]` $X0 P0 ,! ,(0= 5Mb0 0  Q-L 0S S 0SQ 0 0 Sܠ3-0#1?$ˀR 4   R 0 0 0 !1?0P 0SP-(0,#1?&̀R, 600, R000000 !1?0P (0S,P0@-@D 0 hPR 0@0x p0t0@B| 0-L@vP0hu -L M0"`@0TP, z10@  ,0Ri PpB Y4U P0 5 80 0$,S03( 00 0*  Y 8 4!<00  P u@"u00S  W 000o`000u, 0r00  o 8P 80(S"ˠ ʠ0S<0 S4000 |  555 5 5 5 -LM04`@P\up Ru4i? -LM@P0T14 RF80 TrW01 R$4u`P-u090 v $u`0uuL0$ `Rp 090Mo u0 #>WS @ $0S Z00+t`P⩇.t|_3 p-QLM@`Pp؁T 00 @DRT0  0 @DRTʃ0p -LM@wP 0h - L08 0 S`0V@ C00BK 0( <25(  `40@ ^000P@@0 <D0*Q@8p0!@ 0XP`$ @ 0A,(0"A 0 P `4@  D 00po(04 0,08`090o}o0  o|d30 0P | -LMP@0bo0pSS 004`090LP40S PoLop0( 90 i@o P40S :oi鹛ꀡ3 - 0p`L<0@@p*oP4#o 0-0L@P80h -`V`V` pP0UL`p` *^@wd 0⻛0S APP U jh^5__(`_33 -LM@Û0 00\ hy5 0- 8x 8#T0%PLT0AT 0S 0* 8R(0 4 (`___ - 8h LM8#0!P @0 A0T S  0S  (`___ -L M @ 6@_"! -L M@ 0@_"! -LMD0P#((0"tP1'ATN T0SKȀ<`(zP 04000@`;00En@i>n0S 0㰻P*0SSS <`00$0P$0S iA}40 <8dppC 88#0 pQС3ܡ3WEV! 0-@0P @L aP 0000P0F5 -LM0s@S* 00 0000 -LMq`PU @ 0@ {P6PU $00<0$0@T0 P:00 l@bl004;0000 `\ @1@!0 H P@00d@0 H E53 p-LMPK@` E10C T#J0QZ0V0T00S p -0LMSK"*K 0SB$:  -T LM@HT00  (0R 55k_3 005 -Lp`P7@T@ hј R(( `@ pp00 335 -l`L@PTp P 0S `@T$h騘0T0 h503 p-T0LM@PT` P 0S @Tpp5 -LM@h 0-pPL0S`0@T P@T00020#J55 0-XPL0S H0@T P@T000 .55 p-LMP60@`TL  (`0#p!p3 -LM@ h- -LMx@0Slhd@T BLP0 @@ 0 ,@T5<3P3(3X4l3p#T4 -LM@$h 0-rL@P@ 0hP P0 ,  0PQ 0QF50F5 -L] P00@-SP@  0P PR  0S0P 0P 0 -LM@Q儗  0S|3 -LM$0p@$0  P`y Pq P i $0S $T` PK PW PS  @T P 0@ \  0K0  D1D! <1 R41(1 !P! @KKP00  00`` P 00 0ZKPPKdx tp 0,0 `K ꠚ_33z_(k_$k_5 k_k_3333 fQusp#זТ3 fQsp# fQtp#0 R –_T!43m ݑp#Q0 {^ꘚ_p#p#0 8585 -0LP4M 0X 0T@K@źt0 Rh@" P`00T兖LL00 R 0X  x(k_0k_$k_ k_,k_5T443585 P-Lh0嚺0k_ p-LLMHKP@2 H` P TDK01@ T400 0 ,0( 0 $0 0 DK|9pDKP@@PK P  T@P P0%p$ P <3L3T3h33 - LC -LCI -I LC -LC H -LCH -LC X -`LQ 0R 0 PS00U@ h p P 000T@0@S 0U _a0 -LM| p# -LM@, p  • `;xP4` 0S !寕1(S! 0#!!0 V000 8` <` <P0SI <000r0S`30  4 8<0(0 Q8 <0 ZY  !Y *040S R:  0g p ,0 d] <000`rP0 `P 0 11` R0040  ꀤ333Ĥ3333 3 3L3 - ` 3p11#XLP@0XS (P#rP 3X0011 3 -LpPPP T*0 S@T:E P p@-PP\`@ *0S \:T p0Q:0cS*S @V V 0#2 0S "" T @ 0#2 0#2 @ p-RLM@`P uP000U00p -L MP_P T*`0 S ` 000CS<!|!!!+00 <0 @ @T:`*0&0/0] 0-L@\Px $t@ 0h4<5 -LMRP J0,0 @pT ,`ZZ2PP I0D1S3T!!,!!,!!,!!,!!,!!,!!,!!,!!,!!,!!,!!,!!,!!,!!,!!,!!,!!,!!,!!,!!,!!,!!,!!h!!$!!x!!!!,!!,!!,!!!!!!,!!,!!!!,!!,!!!!,!!"!"!8"!,!!x"!,!!,!!"!,!!"!pP@TPܓ 0@^SXXP  <PƓpp   p } v R 0BP ^S f x _ ` X H@ 7 8倓40PV$k_`3l3p3x333333p#3 k_ -0LS !!00a0CS#!#!#!#!#!#!#!#!#!#!#!#!#!#!$!#!#!$!#!#!$$!#!#!0$!#!@$! hC 0A^Sll= ` 8 P  D < 4 (5p#T4l3p3333333 -LM @ hp#3R- R 0S0 \R000Sa@\ 0-LMP* P@KP0@vP KqP00 ~P w0 0   0%0 K]PhiP TPPoPP 8<oPP (oP ĥ3إ333z_3 3h4 -L@PT`p@Dt @ P]P TP@Dt0P k_$k_ -LM@$P2 P0( P) P0" P0 P0 P P P  P p`S P 40,P {_ k_$k_k_3(k_z_3 -LM@P P hPP  P 00c03 -LMp KP0@ PS@6$`KzP. T $0   $PU! T T @Iq 0 0@ PS@ P  00 q  1q ^$PZ P 33 p-L M`KPpa0@S@ PKPT T K 0 K 0C0 N0@S@D00+3 p-L M`KPp60@S@ PKPh `RT002320 !0@S@00 33 0-@QLPJ@TZ0 0-@QLPJ@TZ0 Q-LPp`@00eT : 0c00e000}00eT:p00e0z_z_ p-LM<@<`04Pc0c000pz_z_z_ 0@-L~S /!.!4!H/!p/!/!4!l5!4!0!/!4!0!p1!4!2!4!3!4!4!x4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!l5!F&0S 00C0|V|f 0R 0 0CS0@6D&0Q3*V 0@R*0 0 0S0@:E5 Q* 005%0S*cUE 0Rtet# Qle deR00 PuP0 0 S0pP0  0 0 0dؤ^% 0S  0弄Rt00Q^ 0S 0^h4 0S00$T(d0 S D0 R 00Q300 S0QB ăs0 G0Qp3#0Qpcp dcd00 R 0 H P0 R 3 0c-Rs0b0CS5005@G200 050 ̂%@G"S 00CS0050005 0S RK0 dR 0 0DbR <p00 R 0  P0 R0a 0R С p A1Q`1 bp!hA0 0R:0RR0B Bo m 0Sj 0Sg Qa 0R0R S  0R0R S0 Q 0@^S}P0Q0Q0A Q 0 005 0c0c0 0QWuz_z_z_5554k_53k_43z_ -P@L@PpP`P0P @D@PPP P  000cz_z_z_z_ -LMP@ P  P@ T&# -8@LMxP00  0@d{_`{_z_0 00d{_z_`{_8 04S00 0 0S4055z_`{_0505 -$ L0S 00 5 -L 00055 -L!0@]S@t T !0@]S@00D SA Da0DSR\T_T3\TS( @SA @a0@SR@0@\T 3@U@t T_P Q:P00\P0S0p P@$0?SbL:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!T:!\:!d:!l:!t:!:!:!|:!:!:!D:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!:!;! ;!    .P@ -働:<P@  >P@0T,1pP, a00/TU# 9T0pD UA DA Da0DSR `TWpD@T7pD0s" @00DR Sa0D_TS7ToPOPP tPTP P xPXPP@(0Pz_z_`{_83L3X35{_h3 -LM||`P0Ulp@rl0T UPe R PUP0U00 G P555 0-@PLP 9 0S& cP  P h 00C0\@P & 0SU00hc0 qPPꜦ353 0-L1L0@S8!0CQG!0D]S' T T T T 00h 00000P@l00 0 0 0hm p@x0 0 S 0CRL000 (00  x55555505 0 0 lQ [55T4 -LMS@ \00S SL L0L L0P 0^0?l 0厌 05̦3Ԧ3ܦ3333 p-LMP@PLU` ph48`10 ,$0(Pp]3 30q#N43 -L MP@0T(*$K(pK,`K!$0  $c , @Q h0( \$0T\ (0DS<ߋ0T:,0H׋HN]@M]<3T5H3L3T4$a -PL`m Hp>P@ 00CS 0} @TR@0Sq Sf SZ 0S 0S 00 q4 S 1!0S 2!8S  ^1Q- 2!8S( 1 RT T U h1Q 2\!8S UP!000@1@k,1@@DT$@DcTC ] 00CS0 00CS0ڸ0 RG)C00  0 00Sv h00S 0So P00S 0Sh Hpf{_{_{_{_T34T4{_h355 -LMp0@SSHP S 0S iX 0  rPxi T`0 Q00 28 6S Q 000{_{_ 0S00l{_P0pQr  8 80, ,0 0{_{_{_,k_{_{_{_D0<08 pQ(0 0{_{_{_,k_{_{_-L0H D0pQ, ,0 0{_{_{_,k_{_{_{_ 80cR   (0 0 0{_{_,k_{_{_ p-LMHP@ ' D T h0\ `` T` T0V D0\ P00pP 055 0-@@L08PS0S0000055 - 0L`x@\ lpPbXd0 4P 0S<00h p h3a5D5|_l3p33 0-\L@P 2S P(ډ0P2 0053 p-LM`P`@2S@T<ph齉fPT0"2 000p53 -LM@ K;40S0:00A0 R0  ] p-LM`@PfP  0S  pfP   -LM@ P0K  0 -0 SLP` :S0 `0SZ @ p2bS@TP t0`0`p0@2S @T:0T0 P0$QfP5{_3 -LMP`@V 0FS \oP oip0S  SiP33 -L M0PS` :S0 `0SY @0P , 0`K p R2S@TP܈ xW0`p0@2S @T:0T0 P0(UeP5 38L!3 -0LM pR K >TP@`2S@PT P Wp L55 -0L Mt`, p0 @–R\ ,0K@T00 ,0 S1051P5{_5 -PLPM`\p 0K@  0SV 000{_ -L1L`MD0 PP(0 `pl KpKt KpP 1l R*t0S@hK 0@@ (0S (|pl RW xK| K0P x| P@hK0@@ P5_T5\4 3,383 0-LM(P@ 0@?0{_-00 C{_ -L\ |_ - 0L0S |_ -L\   |_ -L\|_ -LM$@T|_ -L\ |_ -0L0S|_ -L@PMK!P 0Q0S]H 0 <0 RX:PTJPHHE@B<<0 4<$a{_<3L3(k__X33T43{_{_3 p-LM`P pP@0T:tPt@0T*d3dP 0 @T:@p0&dP 0 @T:P35X5HN]@M]z_ -LM@KP -LM KPK -0 SL 0  -L \   00 -L MdPhIKP \ PV@KFP TP,930P33d3 -T LM@HT 00  (0R 55D_p3 0 05 P-PL` @T pP 0S @TP@ 0P0`0 000 $mL0Sꈩ35533 -p`L@PTp eP 0S0W: ` @Th' 00h503 0-LMl@0S`0hXPU P@P@D ,, @ PU0533(3X4ܩ3 -LM@7h 0-LMPKP@@-' h0 0-pPL0S`00S @.0 . 0$ @T0'000550 5 -0LM@`TPp P 0.S 0U:R0>0>0Up1 @TW 0@55 -LM0PhS` /S+ bS` `$pK 0S 8@x $ h`$ IPX @ @0f0P,`lS3p#3 k_$k_3 0-LMQ@<00CS 0\!T\!\\!d\!l\!\!\!0 _0-0P0K0,0 _PT Q 0QP0 R000(P$05555$5_$55 -40LM @R ,g*d &dP] 00Cs0 -@L`0 SpP 00L S0 @0V0 0S0 S@P 0 a0CSa0RS-P@嫄a@0a S_R@ zTh韄 3T3$3(3 -L4M0 sS, `@HKTI   a0@S0a SR0S 0S0S\ + a AL00lL0 V L0SZ00V00S 0S + a0BS aB0SA o1 AV@xq +`0PS`LK0 PBTU@P !0001 ,0S ,l&pX T KT@ T0cP T K0T0 0X PQU0:S000 S 0a0CS0000S _0a0B`F~00C ZUSꠚ_H_D_,35@3d]! -p|`LP P @\t  0S $Ġ 1 0 @ L_P_[] -LMPp0P` 0@S$ KP $P0 $Ġ  <@0 A000L_P_[] -h0L`PX 0S 0S 0S  0 15L_[] -t0LlPd 0S 0S l 4080 00P 5L_[] p-LM^P`@ P  0S 0S l 40!t0 0pPp,@0S OP00pbt5L_[]H0HP< 0S0匣0S0S5L_ -0LPt  l 0S 0S l 40!D01$  (P 5L_[] -$0L0SL_ 0-HPL0@S P0 T 0 L_ 0-`0L @R LP0@0C000PS T0000L_5 -@0LM\0 @T L_ -MML1 Ḿ1, ^Pp P,0 S ,jBNK@D@D0d!ᗂFK0@P4  0 @tD L$ p4 Ht BP@0OK dA0P@ 4 @ SP@dF DP` @ TK@KOKNT NT D AP@L0 Le A0dP xt T |$ wP4@`0 5E___L3\3 -LMO, ,0VH !0[H!hHk!8k! -LMr@W41R2p U8`40< ?㳀Ϡ@4/00 000E  =PPpZ  b0 S0 0x0@0p0{4BE \墁;LE U? ? }!o!x!@l!"p3 -L2 S   -0L"R"0 02S 0-L@TP30hT -).0@r0<”PPL"0`@T<2@X"$$0 0<”L"@0Tp#00<”@d"$@ 06 -7).P@0JKKKX(S[兠[0[ 0#[冐[0 0 [ #p[0 [`[#0 [`#P[0 [P#@[0 @#[0  #[净[` P @ RK .KK KK哠K呐K`KPK@KXW0 0l 0 9D0SKR,0 S ,^頚___H3 -0!LCM0KoK,0 O1IK AT@#2 IA/0萟0C0 0p@P000sU   0 0 0 P0U 0|0`/@0P`0`  1I[PU0 ,0S ,c^頚__(__X3 -0 `R 0P0pLWt    HXPl0U >Rj@8PS(00P B  -LYM 0p! ,0 P0@fl1 |a HA `pla t 04A x1 @@< 0`@ @DA H@PLa \ X   <T0@  p!00CS<lp!P@8 ,0S ,]pQDAPpaX1dQ `Sha `  0=S tD!Q @T! lP@1,,0@@lP @alP0Pl0\@ 4p@0P! 0 S*T=K mK`0@@ 4P0MK@P@4!H0 @ 0TH1 DT`0 @/0 S:@a40S:\\ P!R@A B,0`PP! `4Ppa0 tPPul< g@L40ȟ\!S< D1@ PQL`P\D/U 4PMK@ 0TP@J41LTH  H! P!tQR %000|A70U00S @a,0| :@1<0S, \0   B )0l]_0_d]_43\3d3$_ -LtM☠K` p @p;PPP@0w  Qk @0(0$ ,pPP;@80SX|0! 0QN0 Q4@0* 0TP U@KY 0 ZaH0Y ZaH p DMH Q 0'P 0 0PP e ws  Kl] -L4M@`|0` D p@ 40 ,` 8` <` L` P` b P@ LPh5 WS0P  0PPP@D R 0P@0, KP,P HP ,0K+0P@$00HP HP0S S 0PcX0PL0S L0 DD QPD @0P<\ D R 0 V 9.01ꖾ 9ZL.Z`H@LP P04 80^ l0 4 Po ^PU \d*!lD2!X0  @00@04   00U \F*!l1!e@X0P @00@04 000  , 0 0 0>.0 N^@PT \*l,1 @e00  0000  \*!l0!X0  @00@04 00,00S0c,00,i0C|!d!! p-L$M@P0`   K0`P0Sp -LsM , `Dܡ  ! 1 儀 |` KpPPȁ ́ @80S P104 ,0S p,J0 0PPT0@ 0 0PP`@K 40PPoP  KPPC[B 0$D 0@xPP#[@P2S@ Tw С 0J0C p Dq@!TpAkK1 0 jK! . . R l>K! \33 5 Ƞ 1P!>Km kK1.0Q@ pb 00Cpp!@Dq1T#[@T; 20CS0!!!!!!ȑY: 01 bpnKoK  m?KPH\5 :0\*  b 0 0b$10#[1 @T0 0X $ܡ  1P Pk1pH0!>0kK1 ̑  c. . j?K!#[ ̑ -ꠚ_`3 -BML M 0`3S 0D4 , KD\|4(KD$4$  _P 1D RBB##p  0@kP@3 (K! !PP"0PS U3 410  3@ 4 @<P( Ph3(K R 0S2 B.K BBK0N\N  B 0C @P00T00ST2(K 0 2PU92 0C8$ @ < S)!!!!!!CKL C>KL N0C@4O 1s<$84!1 8!Q<4%000 0a00b 1551%2PU1(K0S@10$1# ,0 S ,"H  s"P n"@BK@+@@44@QD1D$(K 2 0" 1 008A 1s<$84 !1 8!Q<4%000 0a00b 155 1%"W D$  @V \*B>K0C  0CvP@ B.K B B kP ꠚ_5p35x3 -LLM@Q@D1U d0 ` 8d0K00ipW "",Pp@ `K p"m"0`0 0<X0 \ 0P0 T 0H0 L :D0 @ 080 04p < 00 0$p (p ,0 p0S -L MBpBP ,0 !` 0@P@"@2V*0S @T:@W "" 0 PP: !p  0P@0 S 0R , j;P -L$M (14 D @H `p 0S$ f? P 0 @S@R*0 S  R:R*0@ S S8  Q Q 0S< 4 # S S 40040 0S S SQ 00 Q Q Q Q Q @ 08S8 0!0;L0  H  0 00  L0 0Q0 R0S .,K P0 (1, 0(100,0@, $,0, (00(0,,00C,0,(0<0  (1B0(11 PR00 4 @1?  P< J@@0S 8?@  @ P<@? (10w+Pj00 00 P0D4!(10(1 DfW(1! 0(1,L0 001H  L0 100 0(10(19 00(1 0,4>WZ P% P ? 0S0 @P1 @dDFA 02 Sp1b1 R0000>0 ? 0 001H P]? X,?Bꌭ3*5_$_L_P_ش_3 p-LM@P0c0? Ad`A > 0P?p `p p-LMPU`% *@0 PR@ U: @0\0 ?R 00@pK -LM0PUp*` @0 0000 P00X0#02SP` -LM PR@0:#:S'0:#:S"j&jV WPp  @ Ȍ qΌP00` |+P@0  -L$M`@. .\0  , @ M+Pp@ 0P 0  00Pp ,0R   . . p1 -LMP. .\ 0@ p`P ȌqΌ + p-1!LM1! @00> 0>0Q`P 1.*!a!00`G/ 0B!0b0!P PPP0Q*!a!00` 10G?  B0 P P0Pp! -`5`L$MAKF HH[!JӃ[3뷒3!HWu ş00S 0 0$ 0 P8 R08 `<0 < D0夔0S0 4 @`D 0 l$l4, `$010 T }<pH A@ AP@' 0P*4 $0, 0O0`V000#3@p@A Q'@Q0@00 K30K@cFFPPp00 07TP@`0*`1880`5,3 >0,!C!EWx ~|0S P0S.@C. Y렂CŸ 0  rP@d\0S P0 @"@<0S,1$20SP Ÿ b @09@00 PP 000!A@0q0@00 P 0 @00@0 0t! P Z 0000ZM1 P_1 PW0 PO0 >__3T!4_h___|__Ě_53"#_ 5_`__4_&aT%a| 5__"3T_3#553$__̭3H_`_ _<_ ++333 "33 "3,3 "43@3,+L3_#5_P,404 P DXM@;0PK0K|30PK! s<0@@00@<P -@ LHM0, X 00 TK0P0 T ( #P0 S$ !ZZDM鄮333 -LPW 1 RP 1Q 1 0 R0c 0xx tARp1 a 0 R =)B -B 00040Q=)A -B 000 1 0H?Pp0 @Pt,0`S phl,000 0@@0 e,>0 S0S $`0>P>ꘚ_5_d_] _ _<_?B_H_`_\_8_ p-L M@ KN  0PQ@c=YB@DB ]BT00U00S p|0T t0d`@7PpD0`7T 0@7@c55 p-LM@ T00PU00S"d|0#b!T# d0@7 R!p<0 7T!0@7c55 -LM,0p  , 00S0 H0 R +404 @( (00h+P___T_]] 0-,0L d , 0TP0CS00 S0+,0, @00h~+P__]] p-LM0!0S`B 00CS0pp1 R!V 0P@ @! 00 041V d0 !0d00S !000phB00S V 000  0@ 000,0 p00CS0l0@0 P8 4 000000H\ꘚ_] R_$_]X_] p-\0LM`P0P PL0H @^ ,0K (P $@ ,` `3p55__ 5 -LM@ * 0h*<_ -L M@K00"c11  -L M@K0"c11  -L M@K0"c11  -L M@K0"c11  -L M@KN040 0 a0`=R C0 `_ -LM@ * 0h}*H_ 0-@MLLPLL0 0PYN400I P@PN0@0$5p34_x3h__@-A"@J1S RJ1S R2PP1S@P1S 0Q *0P (0   -L Mp @(`T& ,00,0, K(PU, ,0( 0C,0 U9 ,0P  -L M`0  P@C  0S<0S90 V5*Y/ ,0(p0,00V, K PP ,0( 0C,0 U W,8,0V0  0P00` T 53 -L,M@ @PpL PP`f ,00,0 RIL"|""""""d"|""0 S70S4,5 X0*(0P0 SD K tP P  ,0( 0C,0Pc,n8P   D0*PT,0( 0C,0 ,X8,0( 0C,0,L8 0000  00000 8C80C (0B8 H@K 0 0 00H0  0P0x@0H0  0P 0 00H 0  0S$0<   0H KH00c0S P0`0P $1    0 $< 0 @ 0 Dz0S u@K $Pm2[S 2[8SS C8S S_@  @0KPV@K @ K 0S40S00@0K@K 8Ks @K0S@0S@pK $dP(2[S "[R R0 ,0 0,0L 0 R0 0@@ K 0S40S00 8Ks 0S@PL  5~f}fwt@vt -L pq@P? 0aV,00,00000 ,0( 0C ,0'V 0V@ ,0T   1 2 1 1s 0T@1 21,6,0( 0C,0 ,6 -LM0 ! @ Q 1Psbp 1 81 U J0!'! -LM@!pPW. ,00,0 b 0Q 1s 1 01 U ,0Uid`   1 0 1  -PpL(`0S @ B@_ -LtM`p됀KP@  0 ,00,0,0( 0CP,0,U 00S@P p P<6 p-LMP`P@! ,0 0R,0 R0S<PP0,0( 0C,0p,6-P$ _P p -L M, p0 , 0! P!4  Y !Z PP0 b Vg0EEW  c03PP K5B@Dx8 X0  R@0SB4  c03P- 35B@ Dr0 R U  1 2 1 1s 0U 0PZ P00P1 2104 S@ Tp@ T @02020Tp@T 5 -L Mp 1Qぐ2 A' ~0a 3f9/`  3 f0/ RH02 0"2 SA' SV', Q0 00202a ,w3,0@f/00202c0 h300Pf.00202S,00000''' -LM@`p PK 0S Szpp1 Q300TJ0P.0(0 0 R 0S00PP 0 0Q 0V  000PW 00,00,0 0S00PP@  0^ R1s 1 11 ^ PnP)1 11_ 54__ 4 0-LPUJI@\.U(   @00@0 R @00@0v02L0020< 00 ,0 0h_5 202 -Lp<JP< 2 R@00@0 R@00@00\2f<0 `P0 20BT0Ҥ 0 ' :3' 4B `@]2B X2!CS2 O2,0s @` V 0S 0S ` V 0,04 0 8 ` V@ R 0s  ` V@`cVڌ Vڦ?`cVV'  0 h_ -pL2`0C(2P@U R ,00,0 ~PU@Z000Sl0202S_PZ PU0Q,8Q|hJp1p!@P@dj$DFA@04 S`ʄ1d8A R80 800080 8O$80 @P@dD$DFA@04 S`ʄ1dA R00 000000 0)$0ַԷ'''0h_L_P_ش_ -PLMP`= Q ,0 0SW ( M 00CS 0,00C,0,0 S( p,@0L!p1,0Sʸ0  0S 0S@ R000 _ 00C0I@p0K$8K @㲂Kp@ 0 㴂K0,0,0C,02p0K$8K@@㲂Kp@ 0 㴂Kꐯ3_4_ p-LM0@NP3 R.`P(0K$``0KaK`P`01K!K 090 0 p 0 0pp`aK0 90 0-p p (("\ -L`Pp@Pm P- P  00S# 0s 0 P 00 0101 1s 0V`1 21   p1 1  0q p 10 1 1s 0 V 0`U P 1s 1 2 1 U 1 211 21  p-LMP@` T0 @ Tp -PL(p`@0T 0@T  0-@MLDPD 0<PvF, (@0P@mF0$53_3ԡ_ -4 L014 s$ 08000"540$ 0S00 Q0 0 0S0040$ Q  p-LMPNP` 0@ 0\ P 14` 01! 0 00 10Q p,0  ꘚ_(04 1S01 Q0 0 0S00 p-LM,P"@000R R 0Spd,Kf 1:0$2K1,` 2K$P  P000(0!0 (0p0 0 -LM Kp$ K`PU0  0 00 0F@*P@ 0$@$  ,0S,P` (00(0 ,00C,0 (0,00_"5 -L$M`8 HP 0S ,00,0P^P$< B @ P !!@4 fPP?4p P" @0 :0GPUp  0<S< ' 90 P  0 0 B 0 4@ W 0l !S <Q8 P 0 4K 408P0,0( 0C,0,700@K PP@ -LM0pS,p @`PsJ ,3Y 0S4P 8 !4!0QU 8C(0Q PU 0v v UB 0,0 0 0$0 80` P (00(0*    (0  (0W  , (0` R0(0   (00(0  wEPP( W`4p8 ,0( 0C,00p,0 0 p p00gP,   ,/ 0,0  80  0Vq1RnU rmPp ,0 0 ,0 ,0R]*00QUY 0V PUR!0S "5ԡ_ -LlM Q$P  S& 4 P,/A#bl p p@K \0 0  % 1Pjp X4R P$002c2c30 xKo t0p $x0P 0p 0 =9@ =C  0p p\`YQ# 0#00F0-YAp0Sl0S x@K9xp0\0 p KK| 0cPl=9 A = | |0 2R"002c2c30  Z0  h0  !! l t0Sy #Y ` 0X\0  h0K0`0K0 @hK R 0 0 00  0T m (   ( 00C0X` R\0\0 00` \0 W1G 0`01 ' 0 (0 0(0 00C0ZH9 "  2Yp ` 00 0 @(  ( 00C0800 F p80 P(00(0  B  X, Z ⌐ p l MbQ5?B3 -LM0@$P`A@p 0 S  _000 p-LMP$`p'08O*0 H0p -LM,, X$p0 1@`T 0WP`/ U@,X4Q q 8 1@`T 0WP` U@40X:lD,0$80HDP4,00,08  4Q yDP_ԡ_ -LM0@  t h ^ b-0 0-@LTP 80 P (00(0 @T0 p-LM@`TP 80 K@Tp 0  -8 L0pS`( ,0Q@LT  , P!0K+,`&0P ,@0P00Q000p(0 4\ 08 #4# 0Q40 @ 48 0-80P@Q04#4#00 8 0!0LS0  Q0 0 0S00(080 R40hC40,  , 4ԡ_ 0-@L P00  0@(00(0   {0h 0-@L Pr R 0 0 00  0 (  ( 00C00h`P(0 0 (0!P -L$M`"0$0( PῪP@8pW@ W @4LPC̰0  0P@T0@0!0@;00 0P@1 I 0  0P@ E0  @p ,KP@., 0@0b 0(1 Y#q0S  p( 0TYT$1 !S@#@3R 1$ R: 0S* @T   0 X4`BP418 (1TP#2@0T00S D$_5p5 -LM,06t\L ,0D @0H" ? p1 1 A A A 匑 0l1 h! n?K l`1 \! >K/K KT1 l <` dA 0@ 8@ XA H@ PPp+H0P `: D@P R   R? 0`SDP;P+@P@dDDFA@04 Sp 1d1 R D0D0D00D  )H00H0 D2PUp H0#KPP@f7  42 Pp?KP 0"R{ 4"P42p` ?WpWKFH0f0Q=8QL" 0p  B9P'Zl? ,06,09)@P@dDFA@04 S`|1d1 R 808P08PP008  8r 9)@P@dDFA@04 S`1d1 R 00000000  0L 0@ H0 D"0PT2 U 7  42 Pp?KP{0"R T" T" 4"P42p`P2@f iG0 `R T< 0 P"0100b0P 0S42 pT !P0 "h0 P 0d0K>0#60`  \0>0#60P . "& X00T  Pp242OKcT2( 2 K P2<$P# = P ~ O '|1S0# 42 l(|42 0> Pp p@00@0, p0)0, p  R^ ,07,02 ,0<,00  0  ,0Y%P'M@L"p 0p y  <`,0S KP2<` H2 K( <P&,0 ?li 0S H R <`S <`@0S,06,0`K <`  l?E ,06,0 @9-0 00000 0  0\k =Pu ,0@7<,0L2` 0" 2 0 " 082 0S/KK 82 3SVPpH:  K❬PpD 0@ Pp#H@"D00D082帀8"82@"82$ 8(00(08",00C,08(0,`VŻ+)<A 8@崭@"*A0Q68Q @L"p 0'PZU1!@P@dDFA@04 S`ʘ1d1 R 808P08PP008  8y 414!@P@dDFA@04 S`1d1 R 00000000  0S < 80R 0R0R,070H,0(6|00C ?D- Kx_5P]L_P_ش_$_"5>*5 -LMp$K4 ,@P  `@ PT4(  01 B10R,0 P@( ,K Q'00K@8,^P4( 0,0 B0RP,0 ( 4K  P@"`V@J,K Q'00K@,9P0 ,0`V0P,0 Z  @P  -LM40pGH,0&B,6A$ BP____3 0-HP@L@d:08 S800$< @ " "` 3 -LM@YP fP80Q 40S $1 R Q鴻_ 0-0-LM@0lKP -@ @P@ 0 0,ό,@U00_ P0-L@4P_P04 x@ꘚ_3 -p0p`PVL   P@  $ p0P`@@>Ȣ_#5D3 0-XX0@ TL  P0 RP o@T0#5Ȣ_ -LM$P`p@0 00 00 00 p`pp 0- @L P 1S0PSP0  -LM p@P`]0|00`4` 07007008)4 R, y P0ES񟗕q"Lt"w"x"s"x"Xy"0 0S]  0 V6 00 00 * Q 5Q 0p0C 0-000 T80 S 0 0 0S 0S090,"0p W 00 0 0@ ! 0P0Cp 0 0 Mpp0000 0S H=1S 1 8C(0 11090 000 0S !0S0Su0= 0 0S  0 0SUl 00 00 * Q Q 0p0C 00U:00 00 00S0 * Q zQ 0p0C 0r0W:0B090 `1SL}013 110S0  00 0 0@X 0P0Cp 0 Mp0S0 0p W  00 0 0@8 0P0Cp 0 0 Mp@1S p0101 1S1 0SR0\ 0S0S00C0 0 0S0 :0:0 00 0 R Q Q 0p0C 00W:^0pS 00 0 0@ 0P0Cp 0 Mp0S0S0 0S  0S0  0p0Cr1S 0 0S 0  p<!1S0110C1!R0S0S00C00W 0S  0 z0Sw 0St  0  0S 0S R Q R pK090 `0p  P090 0@APp  0 0S 0SWMp0S 0S0S pp@ d3@33̰33303p33 -LM0@S0  !p(B(v=0XTo=0 0S 4he=(b= ]=̱33333(3 -1LMP`R P_PS PMPppQAgA, 0@S1 V0>0nÃ0g`ƃ. Bl!l00 0L PP 0à PP PP @P@ P P   P   P  P P   P  PPP 0-0L@0000P 10 ꘚ_ 0-0@ SL@P0000 0S ꘚ_ 0 0 c-  1 00*00 -RLM@ R`$p0 P0000< P00 0S` p9딲33 -L$M00 `0 P,3Q&Q8 , p0 < 00 @005000"@0000<0000D`40,pp0 40 S{ 04 a Ro 0007 0@ D0 D000$;T0 < 0H00<0S0q @ HR00 5P00;400",0H< 00   @0l!@K00  00<0004H 00C00   4Z< A 0l   0 l\Z 0S 400S40 < 00870Q00 00<  00500,0KP>ꘚ_3Ȳ3 -LM2t@ 00 _!Ce -LM\0@Sh3 _<0S8<0 p-L M`a\?XAP# PPD1)@@0?# @ 1)@@ ?# @0)@`@@ 0R @`t1 0H `l1 0P `d1 0 `\1 00 `T1p l0`PK1p5______غ__$53ܺ_3P_3_3_3 _̴38_ -0LM 0 !@PT` 0S! @T3 뀀p0S@00 ( 0S00@@`P )B@Tغ___ -LM@ 00S 07Դ3,00P 4 RHPᘚ_<0 40 P 40 S8Pᬻ__<0 40 P 0 SP__ -LPp@P`$ $1P   $@ RD0D0D0 $0S $a0S@0 @0D00PD0^4P P v1T` $1 000p00! R00!`00a 0 10PO1 0  ($1@ ,00,0 @긻___ _ -LM@ @RD0D0D0 $0S 0$1 -LM 0@ `R x0S0x0 R000 00CS0 h<2 :2 __ -H0P$LQ@p ` 0S T@T $Q 0S L@T100CSW00000CS0 R00000CS0 -LM@T  10S @@T@R     @@T -LM1`NP,@Kp0 @9,4 0> 0, h @ `2Ld p@000P<=8|343ص333@3Q\33 -LM0Sn0Hb0 R 0R  R RmPPw 2nP@g ^aPT T 10HPS 14 T *70nS& aS @0(T00S1@T,1 h 7wSl0S  P$$$1 1U4pP,0p0l R 0S΄ 0 e7 0]7wP 0d 0I7|F7xD7tB7pi?7긶3__3_ȶ3N4в3333,343X3h3333333ij3̳3г33(3L3x3400H400$00 0-LQ@P 40Q P $$1 R 000$ 0-LQ@P 40Q P $$1  Q 0 0P 40000$000,0700 000 0-L0\0P   0@\!:島P@0 p-LM$14@ Q ` @PU  p4J400p p-LMP`U6P1 40P. P@ Pp$$1  Q p,0  0 R U4P 40U phP $1  Q p$@p -0P` QL@p ApT  9`X  2WV  -LMPup@`S 0UP u 0U 0 U 0U P>v 0V 0 V 0V P-w 0W 0 W 0W Pu U ROPv 0V `w 0Wp,0<,0v 0 Vw 0W -0P`QL  @p pT  ⧵`X  WV  -LMPup@`D 0UA u 0U 0 U 0U fP/v 0V 0 V 0V UPw 0W 0 W 0W DP u Pv i`wp,0<,0v 0 Vw 0W -L M|   0\   Kq@ T00 0 T -L M|   0\   Kq@ T00 0 T p-LMP`@0S ( T 0T 0T P0T P T C@@@@,0<,0p R0Sp p-LMP@ `0S 0T 0T P @,0<,0p p-LMP`@0S ! T 0T 0T oP0T fP @@@,0<,0p R0Sp p-LMP@ `0S 0T 0T <P d@,0<,0p -Lp`@'PPUK!ᰳP P,0<,00 R*0SR:0 0S 000 >P -LM_,P@f00鄼_ 00CS0-ꄼ_ 0-0LSP P @000 0-L@P P000 0R0 $1 ⿳ 0-LP@P0 0$ 8?P,0  0"R   0-L0QP)@1 Q 0P P0@ )T 0D000 Q^0 0P |0 Q P 0T@P$ P ( 0@T@PP_ -LM0SP`p5 S P@ T  <@S0S0 0@T 0 0 S @TW pP$ @T   @@TpP갻_ 0-LP0@^ \ 0 0^ \0 0\0T@ T@@ TP 0$0 @N@H0 p-LM0(@KP `<P0  p0 -QLMp@G P0 S  0R`0S  0RwP,` Rڐ0V 0GSHL"L"T"T"T"`"t"L10S0S0P 0R W   Q0 PQ0ba>0>0  00ab0PP0<@0 /000B0 P0#58#55 50S   -L$M@ , 0 40 0 @@0K@K@0 0 @0@0 ,@4 00R000 001@K\1  0OH PKL 0S@#-Q QPn`3% . p0@R/ u"M2 0S @##mSPU`!q p0奎 @K3' s n,@  R4X 8< @K@KP à ]C@TPa`~ pà &J@K( E4@@K )@B_5 0-LP| 0\@ IH 0hZ00H@0@- @P0P=9@ =C 0 0P=9@ =C0 0 S  0 \00Z0?B p-L Mp`@PT 0X Lz)@ 0 0 pPp(00d] _3$5 00CS0* _0@-P@Q9 P7 SM ,0 4 ^-"""T"T"T"T"T"T""T"T"T"T"""T"""T"T"""T"T"T"T"T"T"T""" Q \ 0 Q \ 00 0Q Q \ \ 0 Q \ 0$!$ 0S -L M$$@ O 0@'3$5_ 0-LP ($O/@U0810_$0$0$ 81081 0-$0L8!PR @$@0$ 810CS810$0)_ -L M@PD^`$P T T,pKX* !, 0 $ (0 1 $ 1$00$0 1$00$0  1$0@0$0 T  0000 0PP ㈯P , $00$0 $0 0$0  -LMP0 A` p$@h01 0!000W8<0; 0110 010@ 1 10 0 10110 010110 01Q 0! Q 0W 00101 1 0 1i&1 01 R 100,0,000,040S 0 0S ,07,0,07@#5D- 1B#20R00S1 11R@#5 p-LM@ $PP `o @ 1 0 1! P1 01000 ! 1S0 1,07,0P RPp@#5 p-LM1@0P 0`S S `p0!8< !S08<1 1000 0-LM$@!1!010P8<1 J0PP 03 0-LM$@P1 10 1Q#P0 K iP0 1101  !00 S 101 !01  ! 01 K 0 ! 1 0 P 0-LM$@P1 10 1Q"P0 PK (P0 1101  !0 S1%Fτ"0#1%( 3(F ㊮P -@LQPp& RP` @ 0zPT r 0 R0 b0h -LMPS`p% ,1@T 40S@TX, Ġ T\08P  V R$@T 40S@@T,  0P V 10 0CSP갻_ P-Lp`P$ $` P @T U  0 V V 00V U U U @@TZP@ U 0 V V 00V U U U hh -PLM@I P h p-PLM`P @T U  ,0 E@@Tp -LM,A P` $@p 1 0q(,$am&0 <  < !p !101!  1V 0 1 0!1 0101@#5 -L M@,pZ, F t  y,| 0G a151 10  ("0S00ć $1 R P03800%700, 0Y0j ,0Sc10S; S 1 T1  ,0S0os,   W! U Z 000l0S  $5,0H{Y000Y l0S010.02S200ć,   20Y00S&10Y00S H0,0O/p0  Y 0 U 10S@#5_R_ -L@!,03P & ` 0@ , , !> S7 $0`! 1 S S  8f,0 0040S  $1 RHO?,  P0 O ,0P H,  P 0@!000*@#53 3, H*010,  -T1LMP@0 q$@  $1!S0, 00 ,!(4 01, 40 00 R`5 l1011  !1 1V 0 1 0!10101N0<  < $Q001$1(1,1400 ,0  0 oꘚ_@#5 0-P@L4 0(X*4 3+  0hU 383 0-LT, 0*00@0, !@P0hh$0$PP>@#5 -#LIM0,  ,0 ` @06:D R @0S hß,0 S X,0^ P 00Q D@K #01+0K- 0 @ ` zPp E괐JK  0{Pp80S p 0 :@*W \, $164d JK P@CK0 0 ᔯJK 0 \!,000R/ ,0 pK|p = $tp $1|@K\0 (!Tp X 06P0 &L  Ơ0H 屲Pp|0S'T@L0TJT@ P ,0  Ppp P`Pp L0T@&@,H0P !b 0 pp`Ԭp  0$Ppx, P@7[0  pP}Pp,,  (0 R$ꠚ_X3d3_>#5 - L 0N -LM@P`pT0EP@S""""""""""""""""""""""p $ 1 01410ᘚ_4 1S01 Q0 0 0S00 0S 00 0 P -QLp`0S @PU 0 0C W0SUP!P P 0 e00 0@epe0 S^P 0 0S ԩ Q 0-LM0PS- 0SC)@ 0R0 0S S 0 B0 0@0@ 00 K` 㙩P 00 P0-LP@T*@T:/P 0S* !0S:0D00'l3 -L@`p PP0 Vp P  00 00S0@ R0000 0 z p-LMP @T @Tpp@T ` R0000 0 V@TO 0- L@PP( 0 S600#5 $0R0000 0 +#5 -PL pUp ``@T @Th^(`@T @T#5 -@ML0(( I@ 0I@_3_3 -LDM0`SP\` p 0B Sz!XK*P@DX00C Sh"$","4"L"<"D"L"T"\"T0娡 S PF\  0P@`"X*\`0 \KA0TK 0 @Q X0 gT  Q  \@ \ 0P@  0H\K ǧP@`\XTP-D@P@x"_*#%#$ "-[!% -LMQP`p @ 0B6S6"""""""""""""""""""""""""""""""""""""""""""""""""""""""0BES񟗤" "","4"T"\"d"x""X"""""p""<"""""<"P"p"p"d"l"t"|""""""""""("@"X"`"p"""""""p"p"p"d"l"""""p"p"p""""" "P"p"x"5 1x5t5 L`5\ş 0@ş<ş 7$$K,0 PPX 0S( Q40S (qğ0 L@P00X00SP\4 pPD0,K , ,0P0 >*33 ß0 L@\P00X00SP 3 0t 0oX3bTßpPßnLßlH3 ̠4ßd 0Z 0U0O2Q 2 R 0F A 0p@b2 2 2"0*A 0pDO\"X"T",2^ 2R  0~A 0#A0K 00 !PP 0 0BSR A 0@x!t!p!l1 ϠIA 0tA 0pCA 0p 0 0PPSA 0p3- Pp3x3G̏355 5____a `__ _|3d(5h(5*5_#5_a0$___(_,$505 #5"5$5___4_$5)5 -L M@ \QP@@ 0L S"""""""0"X"""""1 -1!0 1!06!0 0b6 : PD10S<1P$1$!l0   A 0@@00S $KP $0-阀0S p0 pP0dSd00SV P]%a5Xn]`#5N4_$5__#5 p-LMP@`  0STRPPP  G0T0\00S p Ụp p -PLM0 @ 0 SR0 \K  0 @0@-RM@P 0-P\ \Ѝ0Ѝ0@ p-LMP@`  0STRPPP  0T0\00S p Yp p M-PL0@ 0 SR0 \  0 @ -LMP  -LMP -LPp` @ U  0S*T S 0Z030#WQ$U T 0S: r0W0P00S 0 00@SC \00@C -L@`pPT 0 S:U T  : p-LMP@`P  0S:T\P P  0T0R00Sp ᓣ p p 0-PL@P 0 S:R 0\  P -LMP@p`& V00P ڣP P`FU@ /V0 0`F ˣP0@PU0h00h  002y?__ -RMLMŸ8% <5 8, \80R L% H5 Qx Ru0SrD5 2@ PU 10S Vc" """""""40S! PU@\@ 2 8%R H 0b<%\0 1 ,0S , H5<;0L%R D X\H5 0H5 OK%Y 1%.# HPD%  BiD%  X*H5;RNK@D @DE R/1PR/+PH,0 $1 R$1 0S 40,0 $1 0Sl00 Q0 Q Q0SS`SppD ^0ꠚ___3 p-LMP$1`   @P 01 0BRSo0 @0S0c 0($0$!014,C/R T"00C0H0S40X2$1 &>\"$, ?  R; l0d2x0S0 1h2|0l20@S$1  Q020Q'0 @@? -@@ xB0 @0+.@P P0p0d2,0G@R$A,A0A4ACTBN4~w -LM%   0 @( 00@ 8 $0@ @$H 0PP@@1X@ ` (0@d0, h 40l0H0S40p0$1 0S40t0$1 |@x 0 @ 000 000400 -$11=, / $1 R* l00x0S00|0|0@`00 @ 00d ̊ h0B0 ^  .0@0 1!$!1(1 !,!10#03O/ M? 3  N$1 1 0BRS01111$ 0 R`00`0$ 0 R`00`0 R P  =100CS> @0.00S0t 00K z_!08 K0 G, 84001! 0nO 0rϊO 0vO 0~oO Ί 0O  $0冏O !(0O ,0O 00O 40O 80O <0O @0O D0O HP00 TL0L!0S,0 =9C =C0 ,0 , 00 2$"0 00C0,0   (41 !01 !0@ ,1@1  00 00 >!` `0X Ql0V/@. 003>6?B12 -QLTMPQ0DS.P U 100CS,0   f  000 1 80K`0 \ H D T P0K =p`KX @` < XKQP`T  40 T T4,0p p0 8 0px x tP 1p  0APd l 0wSu*dKt IP`rxP K0@@ h0K `0 `0KH \ X0 T D < XKP`[h0SS  PK: @ #: Zc`KX `p \P T HP D < XKP`@P@*0S @T:0l00S0*d P`* d0 T h0d 0h0   `P` pd0A0 d0 p x0t0Qx0 t lR:0l S: ` %0dKt d0 Ɵ`,0  TT070- -LM, @ ,0Pz0S} b PU ,PUPiPb2|"@`@  @&P2   P@U`@ p ,0"S0f ",0 @ `4 8  @ 0H $ P ,0X 4 ` <0h D p0L PTpUV00PC00,0 & W TT 0PU ` ,0 @`4 8 0@ 0H$0P ,0X40` <0hD0p0L PT`U_x_|_#5$5_N43 -LM@-QM @P\0 PЍD0\ 0S \ 0L Ѝ@$5$5 p-L M\@` Q 0 mppQ0 \"\ 0 1PU P P 80K00,0 !0080pp 0pp5l5 -LMDŸ,0 <2^`p@ 2PU  2  2.`pPl/0S0@@,0@S00^Y P ,0 0R,0S  10N PU@l0S   1 @00@0 1!, 0 ,0# =U,0 Y U  R ,0 10 kPU $ E00P#,0S pl0S010%Pp,P]____L_ 0-@L Ml0PS 10S ,0;,00h<l0-SL 2?\ 00S00 0Rl0_ -PL p2 ?`@T l0S @T m l 0pGS10S0S,0吀010 .4 4000Wp_R_O]_ 0-LM $1B1/AbP  PK0 R@@0P1 0P0 b:0 0  b$ 0cQ=9 B =$  0 0$ h0QL =9A =C 0Œ:00QMb~3_<_`_ط3`_?B 0-LM0PKS@ S 00 0-LM@P 0PK aPQ Q0u0 0-LM0PSX@ S0 D0  0QK 0 00鵜Pʚ;5 p-L,M `K@ )P p 81(PK 0@a(0 $ PA0S;P00P Pp0#PS 8KM4 ,08c00Pc0 A00 , 0 ,0  ,0 c00PcX0 A@ 0@ < <0 @0@KS@P T: ,`KP4@KP 0S#Pu<K3,0S(0S 8( 80, <0P=9@ =C, ( , (0 sŒ0$K $0 ^P?B -LMP `^0S@$pK0  0=BR L0 00$ S ,K ( 0,cP=9l A( =, (0 , O@Q 0R?BL0Q R 40RQ R 00R0 ?B50S0 0R050- R \b =9 = L 0 0 aS 00S 00S0S 0 000 aQ 0=)0C -0 p-LM@ KPB  0 `0nRC(0 ( =$ (0 $ S` ^P 0K ` p $0S -LM@,KP( ,0 `p0l=RC 40 0 4 0 \`P 40S00K p00Z`` V000000!0 Q00$_$_00  0-PL@0  0|0  0 c0cR 0 0 PP$0h/00 PP$5D_$_ -LM@<00 0 00000h$5 0-L  01 0P Q Q0!01 P01   N`1`"0 0R  0!01 P 0 0 0@420&0K 0R  0!01 P0 0 0@8 <1 0R  0!01 P01   @@T@0$5D_$_$_$_ -LMqT0SA ܁a 0 00cSZSO S1"001 000 0bS9 Sl1"001 0000cS$ S<1"00! 0 00cS  S1"00! 0So<S0&0"< Ѓ!S0&!<0 Ѓ!S0&р 0!< 0Ѓ1S`0&\ 0!< 0Ѓ10 P00$0@$_$5$_D_$_ -LM@PT 0倐0c/a"|,K0K  0H0\0  b,G$0s@T$_D_33 0-L0LDd@b<84PK@TP0hD_03@3$5$_$_ -$L  X 0h,_8##5# p-LM(`0PS@ p 0@P$5 $5 -P0LM D@R80(0 h)$5$$5 $55,_ -LM,@0(SI0$5,_ $5 -L M aPQ@ P$ P p0 pP@ $0S PQ ڴ00 p K00, 0oP@U4p 000$p-$5($5,_$$5 $55 -LM@P A -L d3 0-8P8@L , $0h'l]]## 0-l0P@LT  0 0 0404 00$0Ba0htꘚ_5R_gfffO] -1LM!p0Wダ1p1@T |10 0CS0 00 h Q5h0 @T($1 oA dWhPd0`  do `00h d0g` ^`I1Q 0 T 10S t0.,0 L 0#1!S Ϧ0 00约_`__,$5P_5_ p- LM0 P1R@0``00BP0 0CS0 kP 00CS0`ph` 0-H0L @E80P > { @00@0$0h5ꘚ_ 0- `0RL P*H0 >@1 ^ D00D00h똚_x3 p-L1 M PK`it 0PT 0  cR=9a  =  A 0  0!Q=9A =C 0P0 R0S @0S0S  000  Kh$p  0R 0R 0@ 0Sꘚ_ _?B`( 11 R00 T_D_ -LM10@S########o,0 1 0S,0  >0Sx x000hhᥥ),0  O?Q0A 10ꤸ3L_R_O]_D `0< 0 0S0#0(0 R0 L_R_O] 0-`0P0$S$0#`0L 0@*01S0 Շ Ň0@-@@@@@@0 00 00@0$5X_h_`_p_ -LM0@S`p>0S,0S00S7  0PS0U 0S PPp0Si0h R0TM0S <G4Dsp0<$53ܸ3@333 -QLMp0 4 ( ,  0  Q0$ ` V P0S 0 S 0B8S$P0S`V0 R ,Q $0S PP0,`@08JC8 1!Q4K 08SVX_<$5 343 Q-Lp 0  Q0`V @0S 0 S 0B8S$@0S`VP08JC8 1 !Q 08SZ00X_ -LM|P04 H0( 0 `00 ,0 $0 JPp0CHAA0P4K 08S,` 5@5 -@Pp L4`V 0 h$W  0X@$5 p-LM @`PU 0 ph?pL3 -PLMp 0 QP @@YP` Q0S00C $@@00 PW2  X  0P @0S S $@0SP e 0R0 S0 0R,0 S00`_l3X_x3 -LM`@/PpU gPPN &0 S0 (0 @00B 0\! P7$` 0\V@@Tʄ@T@ :P fAV 0 !R0,0  P0V|t 2S00S   1S Qꄹ33й3ع3333,3 -L P@p0`SZ 0S-QP V`0S S1 $0S R 0(10  0@ % 0A  T1S RR ;0000S Q0 0Q B 0 R00$P  D@5`_T3d3 0- 0L 0PS-(@ 0 0(0P (@ 0- 0L 0PS-(@ 00(0P (@ 0-$0@SPL @ BP4  0@ P0 0h'딺3h_Ⱥ3 -xpL@`T 0P$ R U@U00000 h_ 000T_0  B QT_ p-\0LM PR` $0S@ T  pP `_ p-p0LM PR` $0@S T pV V -P Z>`_ -QLM@0Q 0AT (00@T,00,0 -LM,0@0CS,0  0 0Sh -0LM@ (00  0@@p_-$ R$ $@@0^*$0S $@ @0S:$0S$$$@0^:T T0S$0S$0S$ $@0@ R:^:T T0R$0S82P *0P ": -LM@D 88#| , `0 aPDq <8q004!01`  ,0 0< T` R6Z `T<  B?+$X Z 2 8`0 0,8g,@`qP_ P< (0R00q#3 m#3433 3(3<340  0 _|_x_ P0-LP P0 RD0@T ,P @T000_|_ -LM@ @000000 -LM00@S(  eu  p0 Se Rd#* '`┹H00< @0 00 0@ ,L3|__x_ -LM@ LR 0@00  0 $0 BR  _|_x_3 400Sh40P -LM40@0CsP40B ,KBh(0, 0ahS00  `=94 = B4 00 p004 0pQ=9A =Cpp 000K Z UPX8@` p@0ʏ 40K*H0P@ ,!?B3 0 ꘚ_ 0 ꘚ_ -PLX`@08P@H p`ظ0p0t0hs -LgM∑ 0,0 v D!(0("4400@$04 T` 0($!@0A* p P0 200-K0P$0*K?K "R .K 2 S0 S |x0L0 ,0S \,SL00< 4 d]_3_[]3edA! 3B)<3H*L3x3 -LM Z P@Z/ Q0 00  3#3#3#3, R  00SS  0 R$0t$0\t-  0]_p3 -LM`@pPP   pP0D 000 0  0@L$5]8 0S00 R0 00  0 ]] -LM`Pp ^H QDP?1@ T 0S2 @T0NS 5#5#86#X6# 0 -T G0D0 PT 0 ^T 0S 0\]_@@ R4 000 S00 ]] -L M8@4^ 0 P00]_3 0-@0L@PT vP @T00] -(0LM@T @T] -L MV, 0 XP. ,PG@0U 0(p$`,` 0 S0 0PE U `, 0 0 X0000  0000t 0  #  P@ 0-@LTP  @T000@`T R000   00h -L\`P@p0 0+ 00S00C 0pQ  0S W 00CQ 00@@h#W 0R 0000 0Q 0 R  B 0S00@@P -LM Q @Pp`B: 0VP,  R 0S 0S * R 0~  0004 0P  # 3 -L 0R03:00S 00 0 0P000 0 0 p-LM0PS`  0R:0S00p@00@0@-,M@ 0P000^03:0S#\ 0^ *00  0S   @00 00 00 0000,Ѝ0\ 0^ : 00  0S   P0@-0(M @00 Q \ 00  0S  0000 00 0000(Ѝ \ 00  0S@0 p-LM0PS0`0C0D0< 0bD0 R000Q  0S00``80 0C 80 phh0p( @ 3] -LM `@|V`Pp0S:000 0`00@0 0WpUP@ 0  40 Ph 0 `0L 8,0d$pT`DH000P0 RS 0 /">CXh05|%03h05 5P%(PB2|P5p% f`(a`l0<0`fPlP t0RxPPPPPPPPPP 0PP00 X@@XP0\0 @X (0 Pc<<L 0 P[ U$5_]_`$533]Ľ3 -LMX @R\0T \0\00X \0 P 5PQ  Q4Q0 (00  0S00]`$5  0-Lh0P|0 P 0#@P] -LM`L HpP~ PU2CP@  PUT  L0HL 00T WP d0` 0 d0l0HL 000@Tg R0000 0 D H0 B0D H0 R00C0 R000  R 0PP0 00 S  R000 R 0P 0 P0b0D, 0Q0:.0S"0Sd0` 0 0S0P 4HL P*]`RT!43 0-L(MT0h @ |0Pp0 Spa\h 0 0S0PPP 00C0D00 HD0d0P A H 0d0 R000N0P!04 0S0T0  0 R000  R 000g<00CP 0 R000  R000<Kp 0 S:`3z -<@LAPP`@ P@  pWT  00V000`F400 R0"40%T  -LM0$(S00pP 0@`p `@ h0) xt 0Q0xxZ0@ 0j@<D00@pD0 0@0 p@@ 0@0 S80p0S800pE -D ,0LR@p:PP  `VU  0D, 0Q0:U p0S000 Q0-LP, <@@D ,0R0:0 Q0-PL <@@40 p-LMPH`Q`3:Qq 0L`` <@@4p -LM0`SU@0T80  @T,K 4PU 8 00R8 K @,0 d@4 $0pLc^=9 =4p 0 00 40S"PX8P P R000 h0p 8PU @DD0<,0lS:>h$5] -LM@@ R, 0 S0 00hm]`$5 -LP`pd@ h[ 0-LM@PT $ 0@T0 3 -LM0SPp` cSlSpS0`S(h@ $0`@T,L<D H0V 0Sh 0SL 0S00S7X h0( Z% X"  0,`V  @P PU@Z`VXXHH333333P3d3x33T43ȿ3333(3 -L MT@0`VP  h0 Q ` 0`pW 0`V R @` 00p`pW83@33 p-LM@PT`  P@T @T  P@T@T  P@Tp-$00 (0,04800  0-L@P R0000 0 0 p-LM@`P ,08 0 B8 ,00C ! \0 0pP 0SP00000PP 0Sp( P p -PLU`p 80080 0 1R p0 0PU 0S#PU@tPUhL 40 040 00 PP0SP] 0-$0LS@P0h( -PLU`p: 0S 800C80 0B! @P 00S$0S$0SZ 400C40 R000 0 0  R00A@(W:XP(] W# U# -LMRPp `R0(0 J BR 0X0QQ@ 1Q (00(0 P T QZ00T00SP P (K hP `0 S %`%!* RXQ@X00Q0S `$5 -LMT`p0S P 8@T0S P  p-LMTP@0` @T d0 X@T000phxd -pLP`@XX^\0\0\00X\ 0X0 \\ 0  k`\ VV000Lu0 L $#5`0$#50  F5`0F5 -LM@ 0@3 I3 --LMxP0Sp`A \LH0 R jw* 0S Zp頚_4`3 -p-LM Pz 0@``do,0 \0 p`Vx_ -1`PP1@p  T00SL h10SP@p00T00S@%10V00S VV 1 R 10  0\0P` P00 0R W 0V0Q00Shsd00 S0006(PW  0T00_5|__$5 --L0LM,  $!0 \ ꘚ_,0 $1  R000$!  P 00CS0 _ -p-LM@TP` 0S 0p _$P P` --LM 0 --00LM Q0r5 -p-LM@XXP 0`@^00@ R `>p$5$5_ p-LM@\PX`  0PP=00@ R Ppx$5$5_ --0 L M@T@ K ( T0   -L M@@T ( 0 K T0   -L\Mϟt  Y  0R p h P l , 0 h p H X H0 %PP p H0W0H0 X0 0  X0  pX00Y00S 0 H0 0%SSRO HT \  pH d ` H L H L  0BZS1|###|#######}#P}##8}#`}##}#~#~#~#~#~#~#~#~#~###########H~###########d#########p##########u##T~####8#T~###L##|#p#p###h########0 x P`\  \ \  h`d `0V`S`T`T| \ @fT@Dp PX0W0  X0 p X00Y00SP } T@D`Q X  X p X00Y00S` e |\r dh @bT@Dp 0PX0W00  X0 ` p X00Y00SP F T@DhAqh  p P0W P0 X0 0X0 > pX00Y00S & h  Brh T0 \ @fT@Dp PX0W0  X0  p X00Y00SP  T@Dʯ:X ,0S ,k20.\@fT@Dp 0PX0W00  X0  p X00Y00SP  T@Dm `  cT ` X0p 0W@0X0  p X00Y00S  XTX p X00Y00SL009L  D@Kx(0`x D0[ Sx  p X0W0  @X0 pX00Y00S v 0S ! x0@Tx0  D !0O0Y XPp <,WX L pX00Y00S O x 0@ TX0W0  X0 1 p X00Y00S@ 6 x0@ Tx x@Tx P X  >X p X00Y00S   OM  Ix 0 Sx0 Sx =D@K &bD@K&_`\H 0  H0 `0 HT T 0 0 SH\0 ܥ0c\0 H0T T H+0 H*QH L  L@00L S H L1H 0 L0 RL 0@C0Tpp0 @0Tpp000 HT0 0T0 @HL 10L 0 B0@C RH \@ }TT T  m 0`00 Vb WT0dp 0ãT0 d00Q0S-0KP0  R0 :R 3P0 h l% >P &B`PbP P(K 0a0Ch0 1!`PP0aP T  00S000aP V0 P00cP0 0 %`PV PP000lP  U- Pu`` TT @ 0 Po0  PoTT T  0` ` wT00   T@0 00  0 P`P`T00T0 T  0`  T T@ 0 P`0 0 P`Xl T   0`00 T 0 00S T TT @ 0 P`0  P`0DK P 0 h0 ` D KH0T @H lR H  TT0 0/T  0X0/ +ꠚ_h3p33x333533T 0X 0 T@ 0X 0 0 X0 0x0Px0L0 8 PuoL 30 T0P` l 0x T0 L 8H  V 0S# T   0`00 V0 S -Pu`` TT@ 0 Po0 0 PoR, T!x0 l L0  0` T000S T Vn-0Pu``0 iTT@ 0 Po0 0 PoL R D0KD KP0 h ` /t0Y00S00P0 P 2R W P  P PaPh hp ` PKh l  w -LT!4 -@LMl3 -LM @pT0T0P " @ 0` 0  00M00@- 0P^c: 2#80S$H*,0 9,00 0R_ -LM,0P20#0R0Sp` 0Qc : <"K#80S $H:@@y0S 2[02KHzP $E-Ƞ@0Sp0 p `P@ 0@s  0R0 s$0@S$P10 R$0 @$0@S 00C0@5%5%55%5 p-LMh`@qP T0T Q 0QUqU@@0pw0@P %5%5 303,0, 0$ Q 0÷%5%5%5_ -LM0(h h`B\@\ 0 0S<:780 /000l4_%5%5_000 Q 00%5%5_%5 0 S-L< 800( S $S h꘣4$5L4@3 -t0@LMA \s0Sꄋ#####,hf$dh`@5\44D3P3(3 -LMA0@Q!ڀ!0Qx @ ^d!00^G@HTHi80S ( $0$@S(p0S P @0+0S  $0$@S[O02P0S S2ḠSrı0#P0S S0Wp0P0S S0Z0Pp,%5%503@5P3p3355d 5` 53 -L M0P S S@` P P 0 S S S S `0 S S S Su 0S 0S  ] P1| R0 S SN0 S S S x@ 1 D B2R*̩#l#l#l#l#l#l#l##l#l#l#l#l#l#l#l#l#l#l#l#l#l#l#l#l#l#l#l#ԩ##X#Ȫ#X#ܫ#l#<#l#l#l#D#l#l#l#l#T#l#h##l#t#PH 0KP0 04  gP  0K* K,0K3P"[2[0CP 0KP0  RR R 3P 0PKP0* K,0K P"[2[0c0P 0PK3P0d  P0|* K,0KP"[2[0dVP 0PKP0e P0* K,0KP~"[2[0eP 0PKtP[k* K,0KPf"[2[0f\P\hXqMPOLPlQh$E0KFPB0S 004Q0 0B RS R  0B RSR P P P P Pt%#I0KP0000 R@@R@t0 Sd SeP %53%5333$5$3<35\3x3<$5,}4333 -Lz<84(0S JP h33_3N-  0`1Q] ! 01[]-T0 $\ <0 \ 00  Ƞ 0 Ƞq l]Hn]l]-l0 $ RT00QD1R  Q (04(l]Hn]l] -LM`@PpኙP  0 P  ,00,0 p-L,M`PV@0 @0K$P P 80 4  @<` (` P08 KPP(0 (0S pP #P  c 0 ,0( 0C,0p,P -LM`@Pp2P  0 P  ,00,0 -LdM` VpPㆁS VO o@0  40 , H@ D` 00 :oPP'P8 08  8 0@S,R*QH K08@PP8  8 R pP #P 0@b@Y 㼲,0( 0C,0,PPPV@K -LM`@PpᬘP  0 P  ,00,0 -L(M`PVD0 D0K(P p<0 $ @@` 8 ,` P0< KPP ,0S pP #P U  c 0 ,0( 0C,0,  ,0P -LM`@PpLP  0 P  ,00,0 -LdM` VpPㆁ[ VW ㉱@000 0  4 H@ D` ,0 SnPP(P8 08  8 0@S3R1Q0H K8@PP 8 R pP #P U 0@b@Y Ա,0( 0C,0,6  G8 PPPV@K -LMl#@0p,0 弗P` 0 P03U (3U %8II T9,0T0,000 嬐KU%?0T00S 002Ue D2U/  0 P%?0T00S,0( 0C,0 R _2 ,0S ,v,  n0S$ <0 0 00c01U 1U00 S00000 K 00D0 S00@0@0 0S 0Q0cҰ0 hP $1 $<0 @ 0 D 3sTo   ?mPj  _ U 000 00 xꠚ_f f |f{f@3wt@}f~fvt -LM0@P!0⣢  P\# ` d Q`p (@d 2  P` 00 ,S @c <3 8# 4C PP PPD H p,0`@04@#,0\C`3@P@B\0S>0S" 5^K:PH3\b 3 KKT#0XcPl=9 A =X X# T X#T3 T2RHL"002c2cs , P@ 0S @0,0"F0@T t@,0#T@@0T,0QQ Q4/KP)8d#lP@<d#lP@@d#l@bpD#L3SK YlP@KP@5K•D#L3H P3P=9@ =CH D H# D3 ],d# K?K/K03 j?K,# @3 J/K0KK<# 83 4 *(_Q53$_?B -L$M, 0 4   S0D0 0£28 D 1@ < @0 L L004 0ZH0 6H2aw0S0CpP8c% U#P@,  ,<0,0 R,  1D 1 D 1,0( 0C,0  Z<0L@ 0S<0 L 0D3E 0-04PLS@ SP0骲P l 0R0000$_ 0-@LP 00PP0 〿l x0@R ,0@@0,00hs10S 30(0  $_(_ -LpMW,0 P`*0 S0!P@  ,00,0 ,0( 0C,,0 0Sp`VP:,0pLp 00 -LLM0d @0dS0!ph WH0Kp0  Pl dl p kPP *p0 R0:z t2 PKBa2a11J"c11L0 P P_XK]L T0PX0"PP L =9@ =CP L0 ,0@0`,0 h0poh 0S>z" XPK9XP0\S 4PK`K\ 0`cPl=9 A =` ` \ ` \0 H1R9@!002c2c 㢾, P@ 0S @0,0 F0ዾY ,0#Y@0,0 y Yd pl jp0HKS & pL T0S0L0 P0  ㋭p O 5Mb?B(_Q53$_ -L M`(p:-PP@[%|P@Q,K0 KFP@J,0, 4K,00$P,00 K0003P@040 4 0040$4 000<W0SD00CSD0@0 (0+Q @0$Q0S WpW Q @@  81Pպt @0@0j@(0@0<@0 e Hp@ < @0^ <@0Y*0#p@@ 80Pt ㆝@00@0|| 0Pp@0 p@0@0@0@0<@0,_330Q$ 0Q |0Q 8000T0Q L0Q0800S@0@000@0}ff@ s@~fs -LM$@pA`|0 Q>x  0,0CS0 p||5 _ -LM`lPj0 p塸@#ᛸ  0@D  D `@0訠 $☀ ";p05  R @$ 0SU 0S  )U}P ^U~P\U; A0ES P  @ P P  PUpU p 0UZm0!0"p! MU W9 x µU W* 0xU U U{Ut 05 0  (0r05B UY   ^;8p09_k (0S-@ 20U0S 5    x0PD 0@$  $ __3[]_ - Lp0ß 0@d 0 d H P X X X X D a0HS H@ > 0; `0HS###############################'A0H\XS X X"@0`HP``d0\0d0 P "30 X00S =S  0@d 0 d Ha P!0?0S#######QA0 0(!)^  so 0@d 0 d  0=`H PPT JO  L-0c Z0 =㏵PH @ 0`0Od  d }-_3<4 -P\LlMUp` @89U49909U,955:$| 0S , x0\ 11F0S &(8@ P@ 8U 8U bh8UY p8U h8U 'p0;p0"p0;$8U 8Up   5,0p  $ 0S 0S||^ ^^ 00CS0 $ 000$! 0|0$!x $1 ,00,0|(P@ 7U1 6U 6Uh00ô6U 6U  $1| R PxPl,0H0㙴pm0!0&p! 6U c5U^ -5U 5UOy0Sp0p000p0i0 R i 0 R $1| R,0 h P52/4U' ,5U!$5P lU*h0U Bdh02 P@hP+ h0  *Qnx4U l4U d4U5$1| Ql,0i P 0Sx=40S30So0S`p 0   Q (0$0( R|P P?h3U ,<R R 20 0 0;; 0 0 2  `(p@q PKK020  Ͳ 0<p0 P@ZP@S 2U@  㝼PO  x GFP. q0S S p0(0(S" @0H0 |1P pKl p0 LP D` @P@,P `uc0 `0c@ `e`FT  0X ,  U0U 0U 000St{t rtzt ^t P_$&5t,@ot t t at nt _st@f@t@wt@ht@[]bt~f}f\&5t<'5gtetvtt,53 4 0-L@0AP@Ap`P .H0S`VW Uղ & "P`0 p0[] p- 40Lt 0M!@`1Ps sP<0 p80<`㢲00@坲0[]<&5L&5 0-= t0 1L@<P㈲0S00  Q0 0 0S000ht[] p-LM= |0 1`<Pd@L ]0 p0191p 0Sp[] 0-= t0 1L@<P>0S00  Q0 0 0S000h*[] -LM= 80 @1< H >P[] -LM0@  (0 P0SR0 p-LM@P`H0Spp% 0  0S H0Spp 0  0S p, ,0H PP ıp4&5 0-L@PP 0 p-LM@P᫱` (Q-Q'p0 >;-p0.-ph钱mp0!d <!p0HQHPHP([] ʾ&5 0-0(  SL@P* Up0@0  (0Sژ0  P HP 0 0S0Pp0@0p0p0@0p0p0@0p0 0-@L.p0P0p00h$ -0LS0 -L ^M -LMp@  0 Q   m ̌1 0p140S 0#`0S#V` #0V0V00S` 40S 4؟#`  pP@# 0T. 0T& ,廲P`,0S Z T 0T 0T 0T p@   T 0@S xT Z T @=  Sx 㱮W |!1 "P`N P 0SlS4Q < S4\< 0[44 Ԟ 4 &0S40S(0(SB80, * x0P' 811@0S  _H@ D0 @P`L`K ꘚ_5gfff,&5&5P_$&5# -LMp0@@  0  0HS 0S 0 0SPp0@0p0p0@0p0 -LM@`^8V0p 0pH RR)VHX  L0^ p040p0"H0S 阚_035 -L|Mp0p ` ,0 p P(0 %   <#<3; Q  002 ,0S ,Ю #00 ˮǮ"|0$ R  XR 0U00H0 S.Xf X!ڜ0PJH =P`00Ÿ=p0Od P d eʤ0H0 SXf XRH0C]のH0P Sڔ p!p1H m Ri00S#ag4!?0㐷PX]P0pHH0 SdR1d#pK ᣰP  ^, x x0Pu 0r p1m1Vj0S  L( H0PvP < 0Jꠚ_&5<3__4&53P_$&5 -LM 1P0S@ 50d -R" B?D0CSY@0?0S $$$$$$$]-0B= X? ^ 8CRaӭp0 :p0>%p(Km ==P@ ( P@0p 5*0p ᮭ-=`b0V``V=J1`VZ0@   p0  X:p0\3D3 Q0-L@PA   UPE0 -LMPP2 f(`$pKP@ $! P@`P@ $ P@p0:p0<0>0= 0-p0@ 0L50 "20#0 P0S @P 0P0PU00S P ^U?@0hU0 -LM@op0 t h鴎xΫ0s S0s-t0 A!`?̠0 S S \h\ !h3 3#2 11>gfffON -LM`{P,"0$"111;/"b111A |0St xQo @TPi zPP@@T10S4 S1 1R0 0l$K0, K HAN=0S 0 $00!0 $0 q?B6c$ (N=0S(0 ,0 0 ,0 ( (0?B6c, h01c1 @R  1P2;P 0 <0(/0"bT uD`Ql3|333333?BHh333 3P0@-0 1@1P0 SR0C BSRP 2P# 0DS00 ER  R R 0R0S,  ,00 4 40R0,0 R4 40R0P` `0RS p-LMP@p0`(0(S U  Bᯫp;ꪫp 0-LMP  0N᩹P>T00   __ p-LMㆫ`P0> S@0 0" yf ( H P00 D @000 0@۽p邚@꘶_ __X# - `0L0C0 R 000  0 (H0 @P4@dDFA 02b Sp>L 0 S0``00`h͚_ _L_P_ش_ -0  L30 Q l00  (00H >1>1=1p00|  x0S0 0h0$0(Q_ _(_ -LMQP`/00CS $$ $($0$000 Pit-p0l0h0PpT0T@ 0 # p______(_ -P@pL >㾙倳0E/>1 `W>p 0 0P0  饙g -LM0@S0S000A?P>J> p-LM@P0`SC 0^P` a/.!0AS1l0PU00\ 0p -LP`'Vp&0S 0\@l0% @l T@ o00S 00`d d0Vp 0SS 0 0h0 -L@P`\p U/ 0 ` \L ?>1A 0S>0`QЩ\L0 Q` \L0 0H`F V0`b 0-@LP᭩ U000 0 UR 0 S cc Q0S00 aPa 0U  RR  0h醩 p-LMP@ `R8 R0S* 0 0 0P 0 @\    ?>1 @  0 0Q00  0Tp?>1 @ , P0 ?p,3Rp@-@) 0/.PaCPL  10C00&0b 0R000 Rp0a # B0!00p?>1 A! p -QLM`PpF R- R0S1 0 0V$ R! 0 @cR@cT@ 9`dPp  00S 00 0V  RŨ 0 A(> P0D3@-0@S 0 00\S Ch0P 0\Q 0 0c/.!1CQ<0 T]@- `0R   00\ La/.!0AS1@ T] p-LM@b`PP 0 S0 0 0  l?>@1^!BP 0S2\0S0 0>p -L Mp50S# 0S 0R 'p @@`KP@K  -`,0p$1P LP@U @ $X 0X @/Z -LM`,0p$1P HP@U X 0X @Z -LM`,0p$1P HP@U W 0X @Y 0-LM@,P$1 P \0Q T0Q  0PX0$1 Q 0,0000at qt @-,0@$1 00S   @X@ 0-1!LPS 0 0S-@ T* 04@S!T:PU R0 0Ո0@0@d@ ẹll ᶹL㸹P0h鴹 ,_\:5(5D=5I]$_ _X]0_%$_p]<%$,0 P 0SP,_ -LM@P  P*0S S 4P: p-PLMP@` P P* R T 4P:p0SRV`0Sp -LMQP@!P P P U \*0S 4\:*00S E 00*Am+ -h0LPpU` @ T*0S4@  T:PU,_ p-t0LMP`U @ T*(04@S T:PU(0ph ,_5 p-|0LMP`U @ T*$04@S T:PU00(0aph龸 ,_5gfff -PM@L` 0|p@@ p0 @  00$0hP_3(_P'$3(5,50 <0$5`'5(_ p-LMl0`PU @ T*,04@S T:PUۥ 000p ,_4_ p-LM@`ɥT"@@PX@ᾥT aấ4 101᳥ 00!  pP_4_ p-LM@`ᢥT"@@Pd@ᗥT aᓥ@ 101ጥ$0 00  1 pP_4_ p-LM@`xT"@@PhV@mT0 ah@ 101a 㻭0pP_4_ 0-@LO P 10C1( 8P<0<0< 8 0 10 |@N10 (0S $0, $4Ք$ 7 4_P_(_ P-LP! p !` 10C1* 8P<0<0< 8 0 10 @ TP (0S $0, $4吔$ 4_P_(_ -LM`@pƤT"@@P@ỤT) 11ᵤ $P 101ᬤ1 g) 10P1W00`0 pyP_4_ -LM -LM -LM40 00 p`80 JQ18 W V8 0W:pcW`0X,0 ,KUV P4 @R".PEU 11@" 101800岑UP 8\s 0!0gS0! 0f \,0$00$80!8018P 80<`1 0S 5`1P1l0:唡 00c|0 S01W01R@1@! ï 00 0 d dR0 0pd0 UX XP7 000PX?@ `7V 112 p 1@01(q1p p@ p =)01$p1 010__P_4_ Q-LpP1; 0+0S6* R3 0S 5`1P1pl0: 0S@1@! F 00 0 pd dR0 00 UW WP}D!000tP Wġ@ `ἡV 11ᷡ 101᭡鲁㩡@$ᡡ$ R 1 0+10 (,<`8`1 1  =)0 011 01m_P_4_(_Q 0S cP QQ 0 -LQRMQp`PP 0\P cUz 0\Uu 0 SiQ 1[  80S0$ 0bP XA2V"@|`(V/ 01#T!10101!000 00 0Z0i 0  0 S  0S0S  0S00`Z  0!0 000000h0S000a0a$0C0C  0RP P_4_ -L MPP, ` 0QP`cU 0VU 1  f0 Q00Sp0㦠,0@S"PpᛠW ᖠ$" 101Ꭰ00岡 c 00!0 0 ٭0 0  `0$$m80!8018p 801 `UP_4_(_ _ -L`4M, H Q @ , 0P L0 0 PP0S0040 4 0 44 4 R0  0S707 4 ɘ8 `P U 4L R*\0R:4 @ P0Q 0S@03S U 0S 80080@04p 4pL ) , R 0 ,0PU 1SZW  R 0 0P0SL U 1SZ U WXhPQ4 H  4 1 4̌4  4 4 U< D  Z00R00S 1Sb H0S 0H @00@Rp <0lT@! 0D0P 0`T@!QR9 0d0 D0`T 4 pD00D0 0\  00 0 d00 L00dL0H0S W0dSH00@00> 40#s:0U00SL( 0S% 00#0X00S 3S0 @P`PU70778җ07xUi  Z00R00SxU^ @04 p< 4p4 5 L 0P0P00S 40  70778圗0x7ḦP 0RS04 0070778儗 0x7៦LWU @0 0S 40X`hd 0Sh4p<  R< V14  4 40pPD @T L0,B0aT L01000cT00P P0P P`P0pU XhP%X`dh +T & 10C1) 8Q<0<0< 8 0 10 0`0)T `P (0S $0, $4将$\8D0 JP P8 \ H R WX`dh T L0,B0aT L01000cT0\ @0 Q 0 R  P0`0 `P>@ 0Q 0 R9 㧖$@ 10C1( 8Q<0<0< 8 0 10 0`0᥼ሖ (0S $0, $4-$P叼d T L0,B0aT L01000cT0,\ P0`0L`PS"@ 10C1( 8Q<0<0< 8 0 10 0\`0Q4 (0S $0, $4م$;L4S  UiU 1S, 1)PU 0 9p0 SRk  407077L8Z 0x7#PP4L  0@P4 0   @Pp Q! _pZ00W00SP PU 4_P_(_ -LM@`P p  0 ` -L0ML@2 p@022P021t`2022!LPK0N2[02(0$0V0 00S80,2e -LMX`p,0 P \ 0 S*U ,0K0 0R ,R "R RU 0S0 R00000 \ 0S ,0K0 0 P R R@R1R7 R R  RU 0S :G@0CT@Sk$l$0l$Dl$d1P| 7lP01}PL0T@0P0T\@\00RU 0S@000 00v04  ` oQ!l401#8S#00Sl0W  P0WS 0S 0S S e(5(555 -LM^P@p \ 0S*p 00 T` 0 &T T T 0 00`T@T  TT  T 0 0000T2 0T 0T 0 P 0T 0T 0T0tP 0ԟ@ᷟP0 3 003\ 55 -LM@@ D0<`l@hF 0-!40r@L$ r 00LP<0<080ē$  2$@02ἓ 0|P4(5D(5T(5 0-40@$PL㭓p0S0p0  Q0 0 0S00p0S7070h锓40$ L 0  191# 3S,000\0Q 0-40@$PLr0S00  Q0 0 0S000S:0:0hY40$0  C0LS 0 Ŷ  191# 3S 0 ,0 0 0S 0R40$# P0 00   0-0P; 00  UL@  0S 6$La0S |0hXLP0S 60hš -LM0@00 68 |3L00S  -LM0@00 6. ١|L0S  -L ML0H 2cC0Q0^,0 j3#0 ScʘrPB w0@0@@ P00 <@`@DpC P0P(1 C<@` Dp"P@`PP@P@ @ , . @ 0PY L0S6^0 00 , # H(_Q_(5(5R33  00330(0 (, 0 Q 0\30C3( Q,0,0,00(,0   0\30C3 | F -LM0@ 00L<0S  -LM"2 " @FП3 p-LM2@  ,P`02@ @F0`帟P2 02p3 00-@LP202"00 $t$ 0hDs0< 2ហ p-LM|`@PP LP \0 S0\00S;0S p$7pQ@-L  0@Q  0$R @ Sl(5P0H L07R(_ -LM@00 0Q R 10S (  -LM @00Q  0,0 0100000S0Q0 ! !101 Q-Q 1S( S  0,0 01000000 0R0Q ! !101 0Q -LMRp`  10` PX 0RP B 0CS0Q\㕐@ vፐY> 01㈐ 202႐01000 0 ӝUpX P  0,0 010000P0S  0,0 0100000SP 0P_4_3 R0-L@A 0R PQ 0\  C 0LS0^00S  0,0 0100000S  0,0 0100000S@@@0$3 Q-L@`Pp 1 0\pW0S00@TW U 101hhU0SP !1R U. 1 \  00c<;  80S/ \!1R U@ @ 0   1P00001010@0@0   0  0 00$00 00a\U043 -LM0@S0S -@LTP` V1T Q 0,B0a 0100`a0c0L딂!p 10C1 8P<0<0< 8h 0 10 <@K.VT? Q. 0,B0a 01000c0!` 10C1; 8P<0<0< 8 0 10 t@T Q T@ @T 0S@@@ (0S $0, $4~$ (0S $0, $4u~$h״t0 f0 0  f Z @zE 匹4_P_(_L3 -LM0`SP3 040  0,B0a 01000c0!p 10C10 8P<0<0< 8 0 10 @凴jTP0S 00 (0S $0, $4~$ h=4_P_(_ -pL @M T`1cPP& T.@$&$ R 1 0 +10 ,(60 SP`V00@T0SX0 `c@@ 0-LMP KP@ 00$ @,00C,0(0, -LM` KPPp*0 SP 0S 0pS$W  l5PP 0 0 0 $0pPWE 0,  B, (0,n7PI@P*$A$ R 1 0+10 ,P(P0C& 0S0 0000@00!Q 0 0SlP L1\!0Q 00ph400500P0@ 0G00 000t00 .0 B600 h08 . XB000000 @@08 . 0__________ __-h0`0"#X0 P P0 S P\0S00 䝂S__ -`LMđP,Å , 4 0 !ƃ#30AT P0S% @T,Q, K P,4@00S04@TPPPp}0T\0St00p00  k000000cT , R 00000,005008  0]@KT 靂S__3 -LM@ KD00:00 0R 0000_ ->0n`LMVPb80S5 2*|q,K \, 00:00,0Q ,00,00p, 880H@lHT@! d X8 , 8 800d80,<08 S< ,U80S:S<~0@0S,0  l, 00000~,0H8 H fW80, 0f80,0<, 8`00:00,)~圩__ 3 -0LM0 , 040 ~ 0PR`\1倡|1|!  ^ ,0dd@ T TTqT @@4 @劌@x~T @T @`4` {@i~T 00\ 0R00[~0\h0P0T0X040@0<0d0`0l00 000 D40@_ ______<3_ ____ -1LM 1qa 0K@K 0Re S~@PT 00000~00 Pp0S 00d1\ @P\ 0R8KnS 408b00Pc=9 = A@ @ 0@0S}P@T00300}80> 0C& 80 >0C&   0P@00000  *00 , 0‹ꘚ__ _______3 p-LM@}00`< P0X P奋00  }00 00  40Sp00;00pH3 -LM00@ +00p <R00 00S00 00@ 00 h00500h}00@000X00\4002_P3 -d4L MpP4PQ` 0SP A2q4$00 AT 0S @T#000 P0R 0!Q PT   Y@0 S00 H#000\ 0, 0 0 0 @"000\ 0 0 00 0 R000  0S0 20  0 @  , P0RT" 00 0Y@00@0 0 b  .0 60 P@0!0 R? Z8P0, R -! 00 00Z0Y0S0!0 R  ,P060@PWP 0W/ W- pPT 00 -U Y00  006000lU <ɆP0T00C0 F TP-,8D S< RX00S 0K4  ,0K-P,~ 0\  X0Z00S03 0Q0 \xZ 04  00P@000, T UP U 02 ,00,0D0 T0 8S{<Rw4 Pr 0K,0K4 ,Ph,~e 0\  0Z'00S03 0Q0 @\@  DP@0KP P@40PFP 04D @00P 0 \0W R0 0 S 0!0 @0K@P 40DP Qv0Wp R0 0S0!0 g000 6000 ,00,0_h3 -LM` LUpT`FVW 0 p.T00 p0000  c00p M +i0 @0L0$^, 0 P0L0, @\ 0 (80@S  HQ RT0 ,00 ,, 0 00^ 06000 0A ڛ00:00,^^ ,` 00L @0 00X +0i -LMPQ@p`0  0C008 0@0TpX 00@00@ Tp$ -LMpL00  L H0AP4q ` @ HMR80Y080004;00 r07 SRX 00S*0S$R"*r X00St0 0 0SRr sus0suu0sXR0S0 uq000 0scg3 -LM 0R ) 0 `R 0 4 P*p`0@  ( P0S@ 0R 0@ 0 R@0  0-L @\ P( ^,0,0,00(, 00g \0 -L,M,0$ 000 `P 0S 0+x!P@ R@@T {000 0pCW :0S/S W0g 0c #0% %0 0 R2  0 /R @00@0T0S P@s f 020("S\ 0S0 0U0SpLP0K P@KH0 @00HK00 4 ,P Pp L D 8 #P@380[c  R?@# *\0× 0000/S @0 DpR s00 㳖p>@ $ ;0 p֗dҗPΗpGWc:0/S Y0+ 6 ㇖)$__ -LM$P$ 0` 0#40 @` Rp8  Q R 4` 00  ( @d0 < !, 0 /S k  , $6R  /R  2R0 /R, KR, ,0 lR ?`i00b0 /R076 00S09940S009900900S 0:00  0T (5 T <0 0  0@ T0@@00@0 A!00@060 q!P`8 P<0 T0@  0@ 0T @ 0@00< @0!0v 00`<QT0@  ` @00@0< R R0 i7ã000b0 0 i00 `0 R090@8 R^ RL R ` 00W100CS6< R5T0@ 180S, T0@  `2"0S ;@0S 6 "P  @00@08Q   "20S 0 0 i 0 ( |X   0 0S  8 R|X   x"00K `V0@@ @ @@@00@0q 0.S0.S0:, 0/S  0b0i007, 0/S 0 b0b080S` 0S8 0Q0R00S`@090?_ @ -LM80@0 p,0   `0SdV 0 R % PP p P00ZT0@  P0  @00@00`0CS ZT0@ ,0S T0@ 0 @00@0,0S 0  !20@ < RP ( ! U33 -@ MLll 0dPGX0X @T0@P@LLL L0@@@@h $53@_,_ _]0_ _$_8__ Q-L Q ^ Ȍ [P0 [[ -1LM` 1V@p xP $`VV }/^P@}w0 PE[0 P ` 0@0 P0 00@0$(0@0 mw/Y 0@8)5_3 -|0LM0Sh0@T 0S$@TP0 $ 9]8)53H- P h0S Pl 0R$_ p-L M 0@004h0l0 S000t ` 044 P 0  PK P 0 0 0 0h0pl]]$_0S  0"S  L00 \ @0D0<0804000,0(0H0$0000 00 -L MaqQ@1\.0, 00 )n 0@S q R+q R 0S$ nlPw 000@8@p@0!0@KZ,0400F0P@0@@PR <0  EP XPUmƘPU @0SX R\0\0\00X \0 H  H m80S 0|0<00(妘_5]_ _0_@_,343<3H3T0S ` Rd0d0d0 QT0` S`00d d  -PL`Mu 0Kp d G P0@0  P8p 0P 0 P  P,_ -LM800CS1!p2?0P`e@T | 0V, @TRmpp R| 00 Gm|0p `| T0|0| p|0pP < +< <0;<0V\|8 80S@0S&  -PT Y80S  P  e⨐ 0T PY40 840 I阚_0__,3 -LM@<0PX `   <<00!zH @p00Q00S0@0 PP @ 0W0 BR00S@ lL0S X R\ L0 \0\0\0 H00H0l@ X X R\ 0\30_ _ -LM@lLH8t t0P\HX 0X0 \ 0@hsl0XSX00X \ @\ _0_ -LM@0H 0CS@@0  h f@0S hꘚ_ 0-l0@ P BR@ L@P 0h0S8 0hE@0S0hꘚ_d3-H0 L R@0SXP^\0\ D0\0 X\ 0X0 X\ 0L 0L00_ _ -`LPp @T T0S`@P T -LM 0P@  <0 D0S 80S @0S 000 800CS0 4 ꘚ_,_ -L M@0 K  0 @ Pp% -L M@P@U0@0<0`p48<,<0ɓ`<U5 V-P#U @00CS@0L0S0t 4  @,M<0, 0< <<0iz\E 0  0x33$_3 -L@\ 0ꘚ_ -LM<0`L <<0|"04y zT0S800CSU|\ Q 0S00 S | 0S S0Q0 <@ | |P0Qa | 0S^ QUW Q<0;<0<@;<0|1|!@P @djDFA@04 Sp=ʄ1dDA R|0 |000|0 |j0|0@0 S8 H0jL0S0S X R\0\0\00\0X  RX 0X0X \0 `\hj`|LZL8 80RUPi33L_P_ش_ _33@-2@H?0\ | 0T \80Q0_ -QLMp@`P$K40 P@T$ -LM@<0  | 0P |0  R Q8 80R@ 0P0R00S @ 0-LHMQ0P0 @ t喖8l1L@ D0\卖< 0X0KG?7 / (H0 <0 X0[S0S r 0S ~0hGWKbXK@ vXK@ vXK@ v@ XK|v< @ XKhv< @ XKTv< @ XK@v< ꠚ_83*5<3T4p3x3|33333333 -LMQpp5^ 0\ 0S $\-\ Ap0,0S SQ|0\ 0S $\\  0( hq- 0 hp8)54)5 -PLM0 `S 0 0`!080 X L! 0 P@ (!T0 0i04` \,  T0S ,KP%80`pUP@ ` ,P@W,p  @ 0 0i0  D0 R4`0僕( 0111}>0$_ _,*53_-|0S<0  0 R | 0 S  R8 80R0S -LM\P\@@0  0`004P v 4 @0 <@0\fd010@ W`pqX\ P@( \0R\0ń0d R>@!T@ 0\ 0   0V0P@@T@ 0004P u0401)X0 R 0S  R 0\7@ \ $ \` WP@d0 Rd00Dz,_ -LM@0  01W p-LMP!`@4T  (W00`VPZp% p-LM0`@P  0p80P@0<@0@0<@00 0-@0L @P R  01 R P 0\ 0@0  0-LP@P P 0S  (`P @  0S 0@ 0S 0 @  -LM⨠`p@T  0P\ R0 U@X LY @  pP  ꘚ_$_333 -Lsg@<0< R  0S h@3__T3`3 -81LM (1R ,   q !0`!c1QtPEU:0 00S00`0tPEU*V , R"m'Y@|ᢓg@00000grW`pG,0S 勓ꘚ__'__P] h3l30@-QMP0 @-PT \ ,P^Ѝ0Ѝ0@n_*5 -LMA\-P   -LM@pPp `pPH00H0 0tPp0S P- L p00Csp0 H Sp Hhu傑x3 -LMPp@`g`fhP : V P0SSR3 @R VP P0S00 000000  X00:00U@ _fK00500H!0atP@ MflQ  V P0S RVQP 6f R P0S R P0S%f0p Nl0S f0 xP@fp0Sl0S  ft333 -L`pel@PT 00  @RW 0 l0S ephe00 o00000e\0WS '宐333 0-\0LSP@\@800CS|00 D0D h0h S0h0 hP 0卐3 -L\\8  R R 0 0 0 H  l0St0QH0x0x0x00\0L H0 BL  R@0SXPP\0\ D0\0 X\ 0X0 X\ 0 K!Ce _0_3 p-LM\`@VP0 P00S  R 0 0 0   pp00p0!Ce 0- @RL\ R 0 0 0 00H hP l0St0QH0x0x0x00S0 0 0@ P0H0lP80SP 0? S 40{|0 R 0 C!Ce4*5VUUU p- LM@`T PvnP$  $@TL0@Q$@`0(0Spp8)54)5 -pL@`T PNnP $`$@TT  R$00@T 0$@R T0 8)54)58@P 0-0P0@ 0L}g0 0000*5]] 0-0 L0@L Q@ @P@wdH0pt t Rx0x0x0 H00H0 1t0S0!x Q01x00hZd0*5@*5]] -1LM 1倡 `x!Idl1 p0\S 0 PU  _@T @TP(d 0S0C00 S0( 0'rd 0 s K d@pTl0S80SX0LTQ<ێ4rꘚ_ _@*5`_0*5]8*5(3P_4*5<303L3 -LM ch0@P l T0R cD0D [P@0 R   0000 0P@ R 0@00@0@4@0(4($0@0 0@0 Q?KpP3@ @0| h! @@0@07T8@0@@0 0S Q@P004|P T.H!40 0000 R0PPP  @0 %H 0 P@ ~0|` Qt + -' #0K 0P@_ 0R }ZP@S0 R  00T @000 0]P@880SN a80S@ 0 @0P@|PU  00S(K T|PUT M`0 @T(`,n 0-LHM D040 X \ 8 0 \KP7P@ 0L00 -LHM`Pp>W@TdK   D0`@ @@ d <0 8P P@  0ST0 0jhT@00@0T  p-LM`P"P@ P@8 0R@ 3p P@P  -LM@(p qO KK8 PP 6 00 `  @0 0 P \ P p  000 kK  PP PP \ R0 P;PP 6uP1:RO*:0@0 \܀ 000 $#  0K⤐K0 )K9KK  @0@T 0 @PP' P2 090@T4 0 0 0  P T0@ P80SP _ PP  # 6@Kd 8k p0K 0PP  0 (00(0 ,00C,0(0v ,ls *5_ -LlMp0`$0 @VPUK $0 S $nr D0P dP `0 \@ P@KUx@wfT0h0T 8K0$PU  ꠚ_3 -LMC0,0 pPUP@ 00  l( >NK KZ7P@` H`K D P@pPF@ 0@K K P@p 80S-@ 20S 80S@  P@ 0 P@   L0 @Kl - `d ^jp`K 0 P@i 0 P@` D0p0D000 p0! 0$3  X0K``K0 $K4K DK @0@0 @>P@ 48a,0 S ,q  090  @ (00(0 ,00C,0(0M,k0SM 4l8P  0- P@Dꠚ__*53 -LMԀ0p$0 `TP@ $0 S $%q@PK MP@PF 08K K P@PK  @Tp ꠚ_3 -LsMp0`$0 PTP $0 S $pzOK P[P@F 0K{/K PsKT@0 P@048j/1 lꠚ_3 -LMP`JTP@0 R`0K@ 0 尠 嬐 ` IP@pW@ K P YWpld Ki 20:#: Q0 D - % Q @T0 0 X PK 7P@( K K0K @00  Q   Q㌐ 0_ p-LM0P@0  0K 0  @ P0|`KSd h 0|0 00:#:x0 0Z K K0 pKD 0R p_ -LHMd@Kp `@0<0 ` d @ 8` PU%T@80Q0 `P @ <0 d 8` PPT R0P  0 0 @ KP P@KP P T0R TP -LMP`p0+ @TK&0 @  ` 0 DP@0@KSd h 20;;|0 0 0K Kpw @LÀK 0R 5@LJ$__ p-LLM0P `K`80 \ ` <` 4P P@'P0S80L<K{ LP0P PPp 0 L0 LP< K pL* L0S p -LhM`0@/PPJ 0SE$8 RA 0RppS, S W0SSK 0 PWlKlK0@T0@W0@T  -LLM0 `pP/00  0pK0 D0H0 l p L Dp P@`Q `l`@` P@0 E @  -LM` PD0K0  P pKP@ 0 @T0Q0S<@ p 0 -LM` P0K0  P pKP@ 0 @T0Q0S<@ p 0 p-LLMD0``K@80 \ ` 4 < PP  pP PP -LtM`0Kh0  l d` vPP pHK80SP 08 0b00K @@KH0 D 0 4P 0P ,` 8 P -LM` P@0K0  P ?P@ p0 0  T0@ @0s# QP㄀K|d f0@0 0w @00儀K 0[ P@00CS@_ -LlMP` KpP@  0$p 0}  T0S @0@0s/ PP㄀Kd e0@0 0* @  0,  B, (0 ,_g0儀K 0 P@00CS@_ -LM0P#Q` K  @00   ` P@0  p  p 0T0儀K@@Pd   We0:#:0 0@_ -LhM0`#88SP; KP@  0$p 0 T0S @0@@Kd e0:#:|0 0@  0,  B, (0,f_ -LM` P@0K0  P P@ p0 0 T0@ @)0s, OP0 R 0儀K 02P@0KT@hd d 0x0 @ t 0-@@㄀K0s*5_ -LM 0PK`0 0 0 P P@ p0 07 NT0@ @)0s, OP0 R 0儀K 0P@0KT@hd `d 0x0 @ t 0@@㄀K0s*5_ -LlMP` KP@ 0$p 0 T0@ @)0s8 ,OP0 R, 0儀K 0P@0KT@d  d 0x0 @ t 0{@ 0,  B, (0 ,e@㄀K0s*5_ -LMpKP`Td cP@,@K(\ 0K40040  @0K0  ` P@ P0 0g ~T0@ @ (0 "c1, ah $ 1d0 \ ` 0@,K 5P@,0s0,0 $0s0$0 _ -LxMpK`Ptd ycPH,@K[ 0K40040  KP@  0$` 0  #T0S @0@(0 "c1, ah $ 1d0 \ ` 0@ 0,  B, (0 ,d,K P@,0s0,0 $0s0$0 _ -LMpP @0K0  P 'P@0 `  80@S @T0 '匀K D@T@d b p0K 0U@_ -LlM`P K`P@,0  X "00  @$P0 0c z80S@ P@  ,00C,0(0,Wd@K4d bh0K0 0@_ -LM` KPPx p  0$@: 0 m PD ,00C,0 (0, d -LM0"P`D0 hK0@ d0 h <` bP@AX18!Q K0@ 0 ` PP@]PpU 80SQ 80S@ X@X@T$ KW SUPDKTTeca |z`P4ztSP0 0TP 0 0U 0 0@KTXD K0@@80S@DKTtT" ,,$_ p-LM0 `P0 K0 0  P P@@T|@Kd a0|0   ++x N0K KP@ pK1P p_ -LHM0`@0 0dK< `0 d 8` P@ TP8pWP@ @K PP PP@ <0@@T0 00 0PT@ K@ -L`M0pSH KP\ gH0 Y $0X0 X80SHQPPP0K P @ 4 L D0 ,P 0P ( H<`K `0  T0KDKXPPH0\ 0X \P6 40R4 P0 40RX<0 T @0   X @00@0XH $H0 0- `K04 H0b0\ ,00C,0H(0\,bH\0PU @K \@K@XKD0H P\*50<2 p-LMP @0K0 P P@|K0 p` P@ 0p \ KP@@0S<0  a -LM@(P  0S$ 80S,00,0 -LMp@`(P  0  0S$ 80$PKS %,00,0  -LM`@P(P  0  0S$ 80$KSp ,00,000.PE -LM`@PT(P  0  0S$ 80$KSp ,00,000.P埏 -LM`@P((P  0  0S$ 80$KSp ,00,000.Pӏ -LlM,p0P0`0 20 S ,  0(0L0(0$P@0Ss@KDd {_ 0㌠ 刀 $$ 0P@Pk 80S-@, S@)  H 80S@ kP@ 0P@  80S 0zP@D00D0o 0 @K d "_ pK0P@  0kP@ $0P = 00@PlN 0D0$ (0P@P_ -T0L@  80 STy%hy%hy%Ty%Ty%hy%Ty%Ty%Ty%<0 }P <00<0 0-LDPLD@ 0 -L,MpP`@3 @0K0D0 0P KUH P` 8@ 40 L@ 0P , HK 0# @R800 Y   g8 P00R00S@HK 0 = -LM$Pp@`0  (08 R 0,    ,  l P` ` , -LM$`@8 RpP. PT0S @0 P0    0 p,   ,000c P$ -LtM0 K@ZP@x0t 0 800C S6<}%~%~%$~%4~%@~%L~% ) @ K@$;DL  p@K8P|`DphHd K \0K(T K0@ P@`pHL P  090 @J@   *09@J -LpM$@P8`ApQ~%~%H%H%~%~%H%1U 1U 00S 0 p(0 K0P l00b0 0 pT0PU $! 0P @@00@0$!f@zfat $  -LM@`@@p< H 0X <p]H P3-$ 0 C$ -$ LM  40K*5 -L(M    40 K+5 -L,M   0 40 KD+5 -L,M   0 40 Kp+5 -L,M   0 40 K+5 -L,M   0 40 K+5 -L,M   0 40 K+5 -L,M   0 40 K ,5 -L,M   0 40 KL,5 -L,M   0 40 Kx,5 -L,M   0 40 K,5 -L,M   0 40 K,5 -L M8 0  0 $  0 ( 40 (K,5 -L(M    40 K(-5 -L$M   40 KT-5 -L$M   40 K-5 -L,M   0 40 K-5 -L(M    40 K-5 -L(M    40 K .5 -L M8 0  0 $  0 ( 40 (KD.5 -L,M   0 40 Kp.5 -L(M    40 K.5 -LM00 0  0 $ 40 $K.5 -L M8 0  0 $  0 ( 40 (K.5 -L(M    40 K$/5 -L$M   40 KP/5 -L$M   40 K|/5 -L$M   40 K/5 -L(M    40 K/5 -L(M    40 K05 -LM00 0  0 $ 40 $K,05 -$ LM  40KX05 -L(M    40 K05 -LM00 0  0 $ 40 $K05 -L$M   40 K05 -L(M    40 K15 -L M0 08 0  0 ( $ 0 , 40 ,K415 -L M8 0  0 $  0 ( 40 (K`15 -LM \  40K15 -LM \  40K15 00 -LM@P0< w3 -LrPw 3 -LM@dP 0 04 0,5 0- P\0LS KP  00;00L@1L00h 0-0@(P0 L 0)0S 04 0/5 -LM@P  - Lx43  -LZwL3 p-LM<0@ ` P`<<00 PmZ<0 p`3 -0 L (_ 00 -L Mp`|@Td  00S0R  00 0 0SP" 0S8   PU  PU  T0("F PZ P4U 0  <0!FPZP U0 Q[0  Q ZKDP0S@00A K|@,K 0*PP u;0|0,000K0 PP ,үa;|0000,PP  00, ,0 00X0帯,嶯E;| :@l3t3_ -LMP@0| S`p 0 0<0  0d PL 0 0#U<0 00| R#PP -LM 0| `P0<p0  y  0K @ W 00<0 -L4M0@^ 0 0| @K .P0 |0@K "P0~f p-L4M@P A|0HK0 `|0 R$ |0 `A 0HK| \$ p bP ]P - L  Q00Q00 -LMp|`@VI 0 00CS0> 0 00CS 03 0S 0S X寮嬮0 p@PJ@dDFA 02 St1b1 R0``00` kJ0|0:|tL_P_ش_ -LMp|`V$ rp0 @PHJ@dDFA 02b SP0 S0``00`.J0|09L_P_ش_ -LM@v v|3T4|0 v30S S  (00S 0 < - -Lt3@-| q  qL@H0 800@< $  2 02$ 0|4545;T!52c~HaȀ2ca10 0\რ+ <@4TP *[O[O @@R: 0``( AP*0 P@:00@C "b"b0#l00X d2111H"c#b1 `130$/qQD_@_335X3@-0PSpU0 0 000@ S  p`U 0 0R0@0 Sb0 S .000@ S  LpL`U 0 0R0@0 S0033E-` M@p 0 0 \0 0.\T.0V0 Ѝ.\ D\ 0 S.S\Z\RP J0 S .S RP \ZUv R0`@e@c\ 0  0S Wpp0S 00Np ^\\pPEP*0  0S Wpp0S 00Np^00P0#02SPp3^_000S00W V @V^P 6!10F000nR^`VL 0 S 0n0 lS0d~0^ 0*0^ 0:bP0u S .S PR y0.STWVM30@-P| U@B .U@ 01 c0 C  0 R0Z  0  01 PJ0 R0Z PJ0 R0Z P J0 R0ZP0@0000  0@000|@ S .S A-@pP@  0Xx= ?0 1 C@nT0 7#30 T00SP-@T`,J 0P$0S!^Z@TJ 0P0S^Z@TJ 0P0S^Z0S0S 3p@-@?\00\0AS`P?@01 P0 0RPu2 0?0 1#0C0 R0; /R0 0S"QZ0 R0( /R" ^ 0SQZ@0 R0 /R 0SQZpp@Np00a0C0p00Np00a0C00a 0C 03  QZQ p R .RAQQ 0Ғ?AcON -,0L;0 AE05L_H_ -0LM0吐pP`,0 ࢂx 0  AT 0U @ 0V0W,0S  , 5P阚_H_L_@- @  0 201 R 0\ R R  0^0T,0S L_H_0S R00  -LMpt<0 3Qp`<` PUp,0Kd @TA0 SP0@=0 A@J08"@-,0P, @ @4@00`  ,P@ ,2T 0p 0V ,0t t0sn 4K 00K P@ \4 N40 h 40 i 4 0464 0464 0464 0474 0474 0t4 04 84K,0 0P140PH@ `0T*^ 0p ^ >0S 0P4 H0 @0T `: ״>P40P 4δʴ4ƴP33 -L M$ ( h0 pe h0b t t0RpF R` 0`t0sY h0S t@\ T0D0bD` $K0堳Pp,$H0 P >  @>P7t0 qD0 4Ht0T$p T q! (0$n (0K$p Pp( $\ W (0SDga R<0T$p<0R33 -LMQ@p``#T\P 0@30e^X05< 070 0`2PP X 0X H 00\T D a0N 0-LM P0@0  @0 -LM,0$P0C0`p,0 P(K,KT PE5 0P@40K(, 0P@-0X0H0 R $0U  P 0 PE AX0 0S 0.P@ 0X 00U00S鮳0嫳 -LM00<0 8 @ 80 @0PG 0K , K0uPp9<04K,0 0史Pp*40H@ `0T*PU  0 @ H0 `0T: hW@ =P 404pW4SP@\ -LM0p`P(K,K 0 P@(0K(, 0;P00,H 0R *@T T 0S H0 0R:P  -LM⤐Kp  | PP@@  0S   @T8@0@-@T2PQ @0(0$ ,P@|`80S|0" 0Q}0 Q @0 LMt0  0P@  x@0U 0V@ T40 08  0,0000 05t0s/ KP@  0@*P000@KY 0Za;0Y Za; | @@00 03@ KZ 0 Q10R`\ 0  0qP@  o l] -LDM|` p< PPH FP8 V5 0@ 0@@P U @00D0  0PPx04 8 5 @0 K0p~PP0 ,0(H  P 0崠 OP|0@@4PD 0R 80S P8;!A<!꣱ ZS4K,0夰PP4 00;00040H@F!8 ;8 P0 $@ ! 041   042 0 $" 04400 $" 042 $ x0 1QS 2S2?S8 "QL  0488<,0 0$(,0 8Q8P 020%L Rc840S_0 4SZ82 t0  048<840 048 00020x08 t \ 6 8tp\ 5 @Q? 0A<8 H0P70@40\T 0 HS=@T,0X P&@8,0!4@  8L0HX,024 80\p8 84 0@` $QP08<@@=8@D@@8 @D00c=`08 p0HL x0 3P Z Z 83 \0 8 t0h3\@Q8 808h0h08h<8 l?8@ 1@\0BX0` ?8@` 0RT4u08 40 xQ 4K+0uPP40H@ :P2 80x04Y040 8 <L  80<`8PP@08010DQ8 80010d08 0<h l |0y 9P 9P 9P{/l0h!d 4 88<|020C8Sa81 \0 t0a\0S^1R80 \0 t0R80  t0\0 I8" 4!0` 4` #,$ 88<<0D& %0Q4x0P 0 840,0_hd33300 -@L pP`0 A|`PQ`<;@0 :@0! -LM0K"@%P0   p-LM@`0P0` ` H0 0P T P0Z 0H0T` H=Z D=B| @= D k8p p-LM80@SP0 0<l0S 0\S `V p 0!0S0 g -LMQ`0(  $0 ,` d0@Sph, K 0STL  0P$  $oZ%3 -LM0@ 0KP0 00  0000   0-@P L@[P00 4 0 0 -LM䑟0 ,0 @`t0 pS$ x0RP#N*K +8\ KPPC00 K0 !P0 PK  DP @P U0  < 0 0/&00  K0]PP0  0  ,0 S ,C UpULKN KO0KVJK0P0FKH KIP0[ 0P0Kꠚ_(3$_ -LM 0@T^$_ p-L M@0@Sp PP `K0 000 0  0 00lj i000n00rp h0 0h0 -LM 0hh0`0  0 $  10 !   0m -L M00PKp00 000 0 00000h t` Pt0s<h0($200 h0 0 !1@00#!  "  000 ` 000 0PH` x0 @000 (8 Dh0@ 8D000L` $ 0x0X 00@ 800(0 i 80x0S1\T \D<0L aP` 1 E,$P`( lj i0+0r0n%0j0rp h0 0h0Zm -LMP@0S` p0s 0s0s$0sH0sL0L s0s@0s 0s0s80St 0ql  0+P(0s] 0 0R %P \00 P 00 (0s (n000s 0rp 0h0 0 h0 p 00 Q %Ph0h000h00 00Dp 00 Q %PDh0h0 0 0h00 00h00s0s -L,M@D 0尀S0`e 0Sh0إ0<0 x0 R0S}*T 9, P@X0` 0@0 @ lx0Q1!< 0`Z!RR\ T00b380   RT2 \` a4KD00,0@04`0@ 0b SP1 P!T@0H /@4T0SU<\D T0@  000Tx0 S\` a` 4KD80K 0K, K0P@4K,0 0@ -L P.\ K P'@ PK K 0@ PKD @ P PP0  卻0  0 ,0S ,<M Mr;[0 [ 740w 5 <0QLKN KO0K70O0 JK00F0FKH K)P0[ 0P0K6ꠚ_d653$_ -LMP` V$ P 0@ B`T31P`% 0 E@`1 -LM@ u - -LWMH 0 ,0 `! `A L! h0\! 0d h! l! p  KKA0d!0t1 P 0@ 0 7 ,0S ,<dA `H0T S! 20Q Ul1 U U&U80B``!' pRh! 00} 'H!hA0@Hl `1t 1R2X1  t0s dpW \=K/=KT X4`\A`PXd`0x a0`Wp!\P E\ p1K`N/KO?K5PL 9QK8@!0PPL D@1@ H0bP!S0!Px1 0U*0S S0p1  Q @pA 8 H Px1  @ 0 PU:dA0SpHA R0l0l0t!d0TA00`MKx XxQH0 0L@PH0 t0 pĂ0 4ȌD \p<3 (K 4 p\- KK A?(KA/(@K0K0000d0 Sp! :MK (PL h1S lAh@D 0lA T0h DD夥A?( K K?K 0 48<S<1ST \D a0C<X1`p 1HF,`$`sD2 (@K 0Kp!MKp Dir\/=KQ<0R0@ @@ S\A RrWnKA_t0 s<041 14 (KW 3 W) (K00000d!0S:MK((PL @ 0h1S lA@DlA Th1 pWڬ @0@ MK 0(KKK,0s4@(0KKK,@h | @Um Ut  Uhl  Ue U UT  U^L  U[U< UV4 USꠚ_3_0H4 4`_ж_@__ ___ 08   08 08 0-LM0 P\0@ 0  ^ \  \ T bQ P 0 -LMPp\8@PT 0`/T@PT t |0 0D 4  %@ሧ%0\TnTUP0T0T@tH<-T@@O153 0-0L@Pt 0@dQ9 0"P  0 0.$VQ03\3N43 0-LM 0Px @ 4000  B00R,&,&,&t,&,&,&,&,&0     ;0 0 0-預@0 @$0 @ M! "Y lpb"`0%&&/@&0O% & "!! @!0P @`! ЍCCX8^n좙N -LMQ|/&/&/&/&/&/&/&/&-&/&/&/&/&/&/&0, 0` VfF$"@'IP>$U 019$!1013$ $00   , p0bV0p"$"@@I$$$ R 1 0+10 ,p(p@o#0PSmc#0 - 88LM#"0PS  0RL#X0 0rpX0 $0S1 $  0$00S\!U :0S \F | 0: 51`vV- #V 0S # x%`#0 p 0   #@TQ 0 0 @@""$@L\#`*0  0  Q 0 0 "D_3 -LM@1D0S H0S \%c0`t`\0 hoL /! -LCM q 8 8#$ Pj @R `42 P$0 S $^7,IK J/K0PP(L 0S@0SP0  K q"0@ (Pf"O}(ꠚ_30 S 0 4   0  - 8L8M#@`p;0SP 5T  z5Tu ?4T0;0 #4T 4T 0S ("80@S !"0;P080"@X4T L4T0084T000P 0 4T' 4T 3T<0@03T 3TL03T0004  C - -3 !0@S0@!@H0P3T .D3T& 83T0:0 (3TQH 3T 3Tx00S0<0t2T0D00Sk g00S0@0b2TO *2T" 2TV0L0 0P0 0TMX2TI2 2C-@T @>0S0: 08 1T 1T+1T$0S! R0S1 0R R   Q  0P P 0T 0T 0T 00T x0T 0%:0S80T X0T :0x0T L0t0kB @sB@vB hB iB jB@fB@qB@f@tB@xB@nB@wt@oB@55~fuBpBrBzByB}fwBgBvtmBfBlB {B75 -LMP0R,(Sp@T ZP,@(f Y s` VA  P%PX ZP,( -0L@pTP`/ 0S *PV 0R`@TV 0SaPt 0@V S f _  - -APL` 88#@K  pR:0S 0S  0Ps $0S 0 $ \`2 D_ p- 88LM@#P1`s  p 0<@80 `00`P  75 0-@<L 88#P `0S0`0  Q0 0 0S000h -LM@< 88# :0S00 0 P -LM@`TPp 00000 0(\0 @TM<0Sp2 R-L`Pp U @V@1 ,`VPpJ3 -QLMp`P " 0 PR@T 00000 0(;\0 @T<0SpT@& -L M Y pp0Wp`XP4  R400400@0 @ @`0K@$000,0 j0  尡 4:0S$P X 00S* P0  $  TQD_ -LM@ 7P 70  /0P00  70 -LMX0@0CSX0P(P,PhP P  -LP`p @ 00P, d 0 `0I_3 -L@T 0` S V@0400`PU ,0S PUQ dp0S S l0SQ /h 0 _l]0&[]_ 0-LMQP-P P@K00, 0w%P0S000-0T@K00, 0b%PQ0 Q07575,0 P h0SlP_ 0-LP@T t 0A P@t '( hP@0lSl00p@p _l \p0p0p0 -0 @LT`P p 0S @T p0 S 2! 0W*]Pp _ p-LM ` 0S 0 PU 0S PUp 0SU @Ppp_0@- P Q:lP7 Q*@0\ : 08 <40P 0 00aS a00R R 08 08 08 000- Q:lP Q*0\:00 0P00 000 -PLTM@`P p@@ @0S񟗱(M&0M&8M&HM&XM&dM&pM&xM& M& M& M& M&M& M& M& M& M& M& M& M&M&M&M& M& M& M& M& M&M&M& M& M&M& M& M& M&HN&TN& M& M&dN& M& M& M&N&N& M& M&N& M& M& M&O&(O& M& M& M& M& M& M&8O&PO& M& M&\O& M& M& M&O&O& M& M&O& M& M& M&O&O& M& M&O& M& M& M& `0Kq:070A4 p0.0 c+0\ 0@$0  g\ 000S 08< 4 Ud Kd0S 0 0\0S0 āUh K \P*U 0 P: cR 0P*0 '0\*W \*0 RUil K>l000} 0 RUUp Klp0w x0P:UD 0 P: cR 0P:0 ~ | `0Kx `0Kqt0àqǠo0<àl<ǠjhpfldbP07*0q[U 0 P: cR 0P* 00A S@-@**\ *!00S |Q&|Q&Q&Q&R&R&Q&Q&00@S S SX!0S * R:!0R0SS `S0SS 0@S S S 0SP `S PSpS S0  Q Q Q00S*00S:00*S:0Q @Q75 - @LM -h]|g& -LM│"Q0划,0 0Px0 hh 0 R1S D2 R 0 R0!R0r40S 0S 0R+ȑ\ 000R00R00 A  `#PId1 `1A`  `#P31`00 00 B R0 000C S<@K  R)0Q R0 0  R !0 ,0S ,=/ '   '  0\0w $7E85_75757575,_33 -LM,1SA P4'I0Z0J0@(@`  V p(@#000 (|'0I$H00` q l0R0 000  0,AV@ @@ p `F0V 75e& p-P0LM`$QU @ 0,1php75 0-L,0P@T @T0h_ -L`p"H0PU ,0SPUh@A0,_ p-0LM0`PS@ P00  `PP  0`S00@ ph iD75__3 p-0LM0`PS@ 00P  `0SD0 `0`00 @ph[ PgU; 0S8 U0S6 0@T %0S  @T@%PT UP\ x 1`?Bc00L` S g0 U R0PC\XP0S 75gfff, ,00S0 00075_ Q00 00C0_ -LMЀ`0 V$0  " P0 @PPPTU 4pK h& P`PU@00T00S$0 S $T,頚__753 -LM0@S  P, ) 00ah)a&5Q 00  p-0LM`PV @T 0  R @T`Vp a P 4 0S 0 S S Pp_ p-0LM`PV 4 @T 0 R @T`Vp0S , Pp_ -LMX- 0pW @T 0S @TpW PU 0`\ *0 0#\:Z  P  P 00 P$0  Q 0 _758575H0Q P 0 RPQ_ -pL W`4 @T 0S @T XR 4 P Q P0PP*0 0#P:P P-L`Pp @@T Q P P@ @ 0S0C 0 @@ 00\ 0 $0\   e& 0-4P0L4 @T o@TQ 0 S00 00C0p0h -LM4@04hR 0-@PTL @pT00000 p-LM`p0P@T $4R0C @T80phU((40S _5 0-@0L@PT FP @T00_ -LPTM,(, Up`> 5U; 5U:DU'4U! P) 4$Ut s 4U 4U4y4Ug*4U1 4U% \  0 $t0"  4 ,0S 4,0*Y@ RS- P0P0  P4%   #q< 00\4   )@ #4@ 4 | P0S  U2U0 *2U 2U` P OPT PlPKp0K@ Pq@@ :@ #g2U26 Pd tL@+ PY0Sg  L0SE ႒B1U1U*1U t1U*!3d1U`1D H)P00'<1U 01U (1Ul@K@ T#p0K@ L00Uj 0Uf Z  PU  ꠚ_i$iyi zi xi Jii 2i Ii 1i i i ,3qi$i i$Fi@FixHi Gi i i i 5i i$~i i 6i(Ki -L,M!P P0U,0  1 X 0S P @0@ 0RPCT PXP0Pl1 ,0S `,(P0pD1XU.LK  _! 0S7 U@` 0S<Kc$ PU oZ 00pZ@ PETUXUP0 0eP  0 S/! pK<K BP PE p ꠚ__43 -LM@Q 0 S00 00C0n -LMPU` !P4 PU  PP/ p@T  P( @T P@  @"000  0@0000  P   T_ p-LM@`TP P @TpT  R0000 0 00CS00 R 0000  0p_ -LM⼀ 0R$0 0@T 00@T$0 S p$'@`TP 4pKV `F! jPP@Tꠚ_<3 -L$M@0Q0  $2 000S00 0 S h'<44P2K4 K 000CS00ʴ4<44 ꠚ_H3i  -L$MpA@ATDp Hp @ P2p Z m`S 40W 40 \0SH `40A  TQ L5 R*VAp@p@ R x&y&u&y&y&y&y&y&y&y&Hx&y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&y&4PK  @0PBP 1  4 s "KH R 0@  P1^  80S $00cN  ZmZE 1000@*K  x tD0 S<KmlQ@  0`R000pSp0蠉00 p0x0 0x04  젉    l00077pF S 0 B0 0   0h0h$0C0C  tPt"09mH ~@@4PK @BK~0 R 0S0S 4PK 4p  40[1#$0$Y!0 mPH 1(  80S $00c H lH H R 1000H0 @m  SH B 0 0 0H0H  0c0a$0C0C@04PK  PP02K  =/p@0D0 @0 <K@ `0i \`PAp 40@` P80`0CP80p`_ʚ;T3 p-LM@`P>n ph -LMp`@ 0$   R \ 0S  R\  Po  P11<<1t00t0 l000l0!!48< #X4 3U  UO 3U00SF0SA0S> L3R: R1 00C B 0 !  80S$00c  k@T 1000  S0 0C 0 0d0d$0C0Cbm iikL2  42 P`r0pS! k Ri 0`R 000S@0@0@0iV000=k0S000 0PP0 Dd1U! \1Ul@1 $ z(1 P`/0pS ( Q000 0PP0 4i_C40 ' R0 P`0pS pP000 0PP0 m P k850a0a`5݆a;5@-@@:@0\#" 00  @Z00] 85 0-m/0LP@0 IL0 HJPs,I 0m0140 0h00@0  8000E  /n?O0t& -LM!@R \07006!R\@-@ *,  0!\ "0! ":83@-^p`*#!^ ",!1 #: 3x3 0-0LSP@/ S /0  0S0S 0S0S0S 3000  00 00l sd0ST kL 0^ 0 000  0 )85/8585#85 -LM@p@,`K4K P@I,0[ 40[A T  0S  @PP0 007 P@   00 p1 0S!00o/A 1014 7  -LM@@,`K4pK 9P@A.T % 0S  @PP00CS0 k R0700 10C1[4WS -@LMhr885 -Lp@`P0S@0 m0. 2Tm 0"  0 :0 L0$0 0 0 WH0J I \0@e0 4>0/@ж_l3ȁ &&_ -<0LM @P0 A0_ -LCMHp, P@` 4P 4sTP 4 10Sb`0p0`0 p QU QaJ@  0R9000!Sp0p00p040T1 @` 0S  X0l 0X0  l ,0 S ,Z"000 @@ ~ 000ah s 7  9Wh/|`Qh40 3A0KK<01 t1 R p4@0T0V00S$ W1%S,000 S000 S000 S 00 00 0   i0@00 )p,  0XP0@0 @ @4__:5_ --\L|M 0,  `PSp` `   0S1 @KT0 TF 0p0 0@7 R3ڜ0X0S 7 V 0 %Y0Q(U TT'T7X,7 ,0S ,,5aYEWPV P㔐p80080 00 0 00 D 6S? x | 00 <0S0  0 | @0x 40@0p0  p  $ 0K0@P  P@ N`K 040L0$0 0O7pMP@K"u"0P0KP NK K d@ -p;3 AT/p4   P  0 p( P 0S P 80080Q 0 S00R0#S0Sm SKSPp Ro|PXxPP RDZ @ P P 0S3 0S0C 0, @ 00 0 < $L @0S 0S0SD0d@T  0L  L  0 L @& K   K@4 P  PP 0S0 xP0S P*  PEp SQe _ 2P@'  0 S!:P 00 XPP74 %렚_4_$:5:5:53__300 00 0-@PL(s00  0 0 $ 0 p-0LM@`,P_T*\0 T0#03 P00Sp@ 0B00R@@ 0@-L`SY & &l&t&pTPWP/U+ @ pp@$1P 0$ 0A0Q0  pV@ T0S0p0T @x$$ R 1 0 +10 ,(1`V  R 4R `V @T 0 T K0 SpT  X 0S8@T Z  0Z @T0P0 H0 \0 P 0 \0 0 H #0pS P 0 S 040$00hwP0004H04D 0Hh00 cP000_ -L$M@`Pp QPDK P0a80 D @ 0p < D0H SS`@%S H,P8K W8  000gS0:  10 ?A1c0I 71S UH  U @!T(P _gfffp& -`LM m0i 7 ,&-0O00pP@0S(PU@lA&= `1R!  :1  1E# = S000 0S000 0S000 "=" S000 >S0 00 t :53 -LM@!a!R111 'h@ 0P 0P>@0C !p @#2  N=@0C40P ,0P(0PN=@ 0C! ̇ -?0LM-S@ 0`?C0CQC@0T T , 0 P K33 P P111< 1N P PP1N  -LLMß0噎P@ `,0 0 h 0dKh yhP&-0S5UPUd0[pWTK~8Lh R2b3c13T0<3 ,0S ,, dK0  @T@p0d0[W|ɖ 0  0 0  B0 |ɖ|ɖ|ɖ@2 1l0 0|ɖ|rh _U 0pWp p00  t0 ]P@pp0Wl @ 0|ɖ5,# d[t0Qd K0 R QQd K00 Ðh0 d K S 0h0 B0} 0w|ɖ 0p|ɖ 0i|ɖl B0al0 0Z|ɖl 0R|ɖl0 0J|ɖzꠚ_33y Q00S Q -LM⤩P8S wSp S p  Wp&-0S7 @ `<` ` ``VW &= @R4p@TH1 R P49 S9ę4S iV &|&&|&&&|&&|&x91 -Q L00L\Q7?>1 - 1LQ 1?09\Q '1=0@ T@Vx98 x90`|9x98 1=0@T@00 0-S L0100S~03@ 3D3 d0 `0Q00R0S>S "=" S  R&&&&&&T 1S1 RP 9S X 30 1 SR0 3 --LM 83 -LM;@S0; -L4MH  \ 0P,0 L P T  L@pWL L P& 101 00!  0WT0 j L T1=)01T00LTVTP$0P0T 0000C000I S ,L0P  P^ I` 0H@0 [0H P  85P050 S H 0; 00S3 `0@@K H:=K 0P+ \ >YX  0 PSnYX P QX `P`H D 0 S %: \ DK0DLTMT4 ,0S ,4 `\@=T R H;0;L7MT5M11D|# 101<0 R000p 0` 0Pf0jUP!D KU \`0 ~VD0XPH;0; 00fUPS  U P  \0~P P XX`X er@, R5 ! 1010P 0R0PQ! 0Yp 0`K@$$ R 1 0+10 ,P(PK`0C`s 8R 8RlB>K0CǟB>K0C*:0?0BK@ PB>K0C7RQ #ʀ7R t7R?h7R `7R8X'B>K`0C` 1x9#5B.K0 B0('B>K0C 7R$ 6R 6RB>K0C@x9B.K#40 B06R 6R)B>K#0C 00B>K0CB>K0Chh&XB>K 0CD 46Rr,6R$6RV 6R 6 6R 6R%B>K`0C`x%Nx945R 5R54B.K#40 B05R5%B>K`0C`D %x5*P@`u0 110"00*+ 04X4"(K0  ڇ pB>K0C@ $020y? B>K  0C 4 (K q4R eʘ4Rj 3ʌ4ReBKI +9S0 0D 0XV?>1 - q1N Q@L 0 >D# 0(0K0X0 53R 3R.9S BK@ 2(K"BK# @9SB>K0C@ B>K6 0C 6 7)60003Ru 3R00X 00 B>K 0C 2R 2R9l^B>K0C9S 9SM yW0 BKH4 >( KQ4 -lDᲐ0# =37060 132X /W0 S0 •00X =< 044004 pW04BK  KA2c"@0A0 0K(KN0x9 |9B>K  0C \ (KB>K0C@B.K B0(K@ >C8171   t  * %-3_ F _ C ABODy Q00S Q p-LM]Q`P*?>1 1AR#Qp1?09)0lQ |9 lAvT@)9l044pi0AdT@ -ML MTR^K0PEPE@(p, P$8(K0( KS0@C 8@(Q 57Q" 7Q  Q2  Q ,0 S ,? QT'(K0S<,'H,'+'h,'+'+','|9 T7(K)0S499S|9|99S @DKK ,9PS``V?>?>1RKA SF!EA`P0S2V ,1@6(KL&Q P 40S> 5( K% Q0S> 0 > 05Q# 5QtT5(K oRn lTj|5( K`Ve1 - 1FQ\ 1x)?09V $e(K0T SLN (K  *v4QA )4Q 44Q2T04(K R |9( x9 ;%4x9"x9 ;QTx90$(K  @4 84Q ,4Q T3(K R4QT3(K T3(K R |9 x9 <x9  <Td3(K@3W/D BRx3Tt34@gh3Q \3Qy 4P3Q* D3QT2(K R |9 x) 9,Sx)9Sx9  P @78P  # -LBM✢4 `(  x9"|2| x9)0Rx9YQ U@0 0S p< S 7WPT  00)R   9W R  (0S ()Rx9  :SNPPT@ 0 R@U JKlplA 0 WP JK?> - 0!LS2 0S2 \\ 0?>1 - 1LQ @p \ꠚ_3P3339)sX 9S0 p-LMgT`P0S@0 0 YT p|@꘶_ -`LQ0 @P@d@DFA 02p Sb` 0 S0 0 000 $00L_P_ش_ -L`0 @P@dDFA 02b SpD 0 S0``00`hL_P_ش_ 0-P@L G000 0-pL`P 70@09@S΁  9S0:0090)`i90S9 i h p-LM`@PUd;0 d;p p-LM`@PUd; 0d;  ##9l l p p-LM0P01I`T  {P @Tp R0009 0 9@Ip 0-@LPZ P R0 p-LM9@SP 0 IB000=p: ` 2V /000*p9SS}P` WW y1S  p p-LM K@PP9  ` sP U 000p9S" FPP 0Q #@WW ;1S000p I000p] -LMp@`@ AI0T,0   P @T ,l0 SPP\ 60SP U,@ \7 P -LM0KK 0-9LQP@< 9ɐ9!2C#! R00090   R 0 0 0 ) B)0S xQ 0 Sx0|0 00C0761S9S:0 3 p-LMP`/@@D@*T0S p#  ph -LM@ Q Q Qh -iP0L9I T )9pR 0S 0`S W@ h9S ^;0;  0 ` -pL`PI T @T h -LM9PS@!00S.ip9"Ƞ2C3 ,^0 R))9ɔ9!2C#!1S0 00  0i -LM9@S)9 RC  10 1 0 963 p-LMP9ɐP@ S`` 0SF S p 0PQ Q 9S # +PP #PS00SV'W'0W'0W' 9SS#  PPP00)R# 00)RPPV 0Sp85 -QLM`pPx 001k  80S $00c[  5PUR 1000@ `  921)  )   #1!S(4 9S PX l@(!0^00L9SPP9HY0P90LY40S)!0@00 S 0 B0 0  0e0e$0C0CQ:53T3 -LM 0P S`p6PP 4K P;p0;o @@e60U  @@@"[ 1t  80S $00cd  Y4PUY 1@0000000921) )9S\['['<['\['<['<['['<['['0#0 b.K  ^ Zx9 0@00p00 L.K  H#00 >#  :.KU3W 00;0;S 0 B0 0  0e0e$0C0C -LpPB00ʠjz`^P 0`/">C20`0E*S=p]']'p]']']']']']']']']']']']']']']']']']']']']']']']']']']']']']']']']']']']']']']']']'PX`@ 7@3@P -L4M, PPi `p p@ 0 T40 8 0  P< @< S@TPPR"0`0 0`S`4  00^p T<800 oQ84 e,0<(0 0` pu<3 3 0-0@0PLUPP C@0 0-0LPCS  @0200P/@ 0-0@0 LP#@0 - RLM`p<X"@PU q 101$0 00  1 UVX"@\q$$0S !0 ;00,(P40;40 R 0`1`@T < 0S <@T 0H RT 0T0< m 1@ Rt1 < T 0S0C 0 00 0@@4 00<0 F !< 0pH00< 0$ <T H0ScL0`P0 SeS[L0_ Tt VT l 00C0Q00 40H;40 Ph鄿*0;5`_]{'53X_L_H_d`,;5_ 3@;5 -LM@ p, D *0P`. P 0@0@:K 02K<<04K   PD 0 ;0K< K< K@0,0 S ,H頚_85,3 -L`!P@ ]   ^00 000  00QHpS TWJ T0Q P!0Q0S5 4P  P+ `TQ 40040 R  0Q T 0 000Q 40 040T00T0P@0  m?L) R ]@-) P@p85`_(;5 ;583 -4aL0S$ p@T 0 S00 00C0T5 12 0 S':P "48<S )0S 0 00 Q : "48<#8 S  S,P@,P@;5\3 -|%L(L3 ,0S D,  WT0S 3 0 T 40P040 PQLP0S@H P< P P `<0H R,   /0P (T X$@KX 0,0 :K  L4K 2 2K0; K<0K< K 00H R  L 0  P<0 SqP 40 <0 S Dួ<08hD\ ᖽ 0\ 0T0kDPᇽ 0 SPz 0H0@0 i yPD y9Q 0R\ 0R\ꠚ_d`d33`_;533 3L3853 0-LM@Q  80S0\ 0PS 0 0PP4004003 -PLM R 0p0 p`"P@% 40 8 A R800 R VlT  80S4 0 0 H]3- -@LMHm? 0 <0 h|'- ^ "48<S '0 000^: "48<#8 S  S p-LMP@ "48<#80CS ' '('4'phphh'|0 R p0 h`Q0mS 0S< ( 00}8;5<;54;5P_T_ -LM0m,0 &0P`, P 0@0@-:K =2K00<0<<004K  P }0 ;0K< K< K0 ,0S ,頚_853 -0LM`P'0 p` P@0?0| P#P@DtD P0S D = , 934;58;5<;55T_3P_ -LM K P0-LL @P<-T,(@T$ $T0h33443 -@LMTD 4 ( h3 3,383 R \3 -LM@TX048 0<|<0tS  @`@TD\H @H,333333d33333 -<0LM@0T((  _303' -LM@, `pPD@ ( Rx 0S@K8#8#$0$#K7K0[ D[4 3[ @[@[@3[@[0 @#[ @[@2[@@VW 0S`pcVWVX  Q`VXXu<8#H$(8#HTT2LD@D ,0S  8,,D0uPgs UP0 U00Spe $(8#HT LD0@D0DPED0 PU"J0 @@0 @@0@@ @@1!@@1@@!@1@@ PU@ ZP J0 @0@@PU@ZDP $(8#HTLD@DPUJ0PU@ZD0S $(8#HTLD@DD u0,$D!HPPlu 0g0,$g8#HPAH#렚_D3`3l33 000,]`_ 0-P@LP  0S P 8EP  0  00 0 0 0S  ,] 0-lP@LP 0S P8 P 00@ 0 00,]< P0S  P 008㉹,] --L MTP000, @"48<#hdV000Aڲ1 0S*'P0P00 0p0d 00 ,jP0000! 0`d0 0`0S S M$ 0,0 0$,u@ RQ 00S 000a$4ppY t@<TYT 0, S Z @ TY t@<TY4S  L4R R00CS8'D'D'h'D'0Sz300$P 0 3R3Y t@<TYT `0, S Z @ TzY t@<TY0S04S `z##211@2`S[000,0$S 0S 000`0R 0Sh` R 0,S < R 0,SR00 0 R. 0,S < R' 0,SR! t@T  0S @T 0ST 00   00CS'''''000L00,0$ 0S0R 0S R 0,S < R 0,SR00 0 R 0,S < R 0,SR t@T  0S @T 0ST  0000S :S0 0 Rd_d``_Q -@L-0 4S`   4P 00h0sp py$ #211@0pQ`_00CSH'H''''04S0$ 0 \g -LM q0P@S0 @TP  t`<@VPTV  R BQ000S U` PViT t`<@VT 0 R  00`_d` -LH0 R <0S Rh00S0,] -L`M`x@@YppWPG Qk!202e $1  Q 0 00;V P  0 0`0 0P@0C 0@P00Pg0 0C 0  0xK|K| wPKP} ` 00 0P_4_$_d_|0 R p0Q ,0( 0S <Q00Q 400 0S <QT;5d`0S  S  0 S   0 R010`0 BS RA* 0S RR0Q 0Sڂ 0-@LP>1P P .  b5h>5l>5p>5<3 -LM0@,0 @P0p 3R000 ,0`4p  3 R{ 3(80" S 0 4 ^' 0@Sp0S PW '48 #<#R*0SP40, P @0  0W804h08p 24a 0 0p彼 -LMH0@SO0H0 -L M` ( A"(4 P 0, 00 Tp 3S @T, m h0  ,0S00S40S80SQ 0S0S0S 0SC , P0S 0S$0S(0S$ 0S0S0S 0S  yP34 SX 0 0 XX0 ,@ 0S0S0S 0S 0S0S0S 0S h0 (0S Z S}34 Sy80S Y SYZ 0-H0LS@HP 0 @0 Q Q0S 0S$0S(0S  00  (0S 00(  -@LQPp`  0R` T 80S0C80M00VQ <0S  0 000忹 Q" <0$@pW 00S DX R 0pW 0S T 0@ T@d @T 00 0 "4 40i8#8#$ 0$  0!0i 00 0i0  BDK1 <1.X0 ,0S ,0 5 00 0(P  0 0@f, T00T0Tz`ꠚ_d`3l` -L M 0@p@A`0d` 0p0#!dP0X0 0d0  0pp  -LMKCX? B8c0@ 2c2c@2`ϠAl  8 #, E.Mb -L MQ@`*0S S 0`Ǿ*xp0 pt``P PU\PUP)=5=5=5 p-L M@_PP 40`00 @K@"0SL LᴳP808 吸Pp騳p饳p`>5' 0- L"48<P#HP1 T P"48<#HTQ00ADT@Q<0L@| 00 T@ RL 0hrJT:<0L T0L0P0SSP@0=5=5 -LMp0P4`K$0 ) 4P0S L00P0 $0S $~ 0@P  0圴D0<0. 10 S s렚_3P_p;53 - 0L P=5=5_ - LMR 40 S 0 0 cH3 -(!XL"x H` P  hU H -Lg!!Q#7011A!1 Ƞg1 g0A0 x!0hp00 cT1(0000 c( g ! a c0#7%c!c1c X@008 #HT 00 0 R 900T| ?A7c%c!c1cW XEن@]2]0]4]8]y6]&D3`_>5:]>5<] 0-P0 LR0 0Qc@0 0 0? B7c011@x0 l000!T 0)L0L " 0>5/u`_<]0]6]8]Eن4]:]2]>5 0-LM0P [[@[0[ P@&0D]3 -L$M0pK@ 8K0 @ Ÿ  0@2 LPw Q eB!2b2c621b1c \ڸ0P*0 RO 04P:1!1!@P @@7dQ3[S@ ` B1 2P13[ S @,@"!@00Q@0   0ŵ0\ eB!2b2c621b1c1\ 0TJ3Z33@`p;5P_D=5T>5>5d`` `_$3`(3`43P`X>5`>5<3 p-X`LMP㪴@T 0 S00 00C0圴T p` -LMu0@S e000 RiP 0@SX00X0 og0X000 0XI0S> 0S; 2 t 0 00t TP000 "48<#Q000 R000 0S  ba4X P&P 0$0S q Q <4 R(00(0 o00S 1 {P@P #0S#003pW 0Q pWp0#$0$ h("( "4 4Z0 "48<#8  `00`0׳#00ҳR!$)-"("4 4Z00SY Ȓ2  Q IʨP: 000 @PP@) H"@00@0P "4 408#8#$0$ 㕳"00吳40"040 0 10 ~!@oy!d00d0t|1d00d0W C 0Sh 0Sd 0S`c 00 0 R0 0S < R) 0SR$ t R! 0S  R 0SR  t00t00$p00p0P@P000P@d`l`>5D>5` `x>5t>5@`P_p;5@-0@P H0^ 0$0S" 0 R T 0\ <P4 X0^ 80^ 00^ (0^T 1<1400 0Rd` \>5 -L M p0 01 cQ c 0  0 RT 0Q0R  R> @, T  "48<#0!$(,"P:,@ @T, R3 0 "48 <,$#8(!8 ,"hCV ڲ "48<#V   "4 408#8#$0$  "4 40f8#8#$0$ TA 0P $(,.4,8 <"(!(#8R`c-ڲ0#$04V `, R0@00@ Q,$00C00f8#8#$0$  "4 408#8#$0$ >,0S , 0S00,00 @ T,  ,@ "48<#Z @"48<T#, `V}0@00 001Sm pP``0V0C0@  P`00C0V@ 8#8#$0$00 0 0 000  R000 @"@2@P嶱 @dDFA 02 S`(1b1 R000ឱ0 0 0! 0 0 0!B W P 0P U  5`! h00h0V 0S0 0 0 0\!000R ~ 00C0Q Q00VP@P00 KY 00S0<0 0 0 0 0 0  00 00 W@`x>5L_P_ش_l`_ ` - @LTp ` P R000@ (0U0C0 R000 0@P@dDFA 02 S`T1b1 R0pp00ph㖠x>5@`L_P_ش_ -Lװ`pӰ0S00Ͱ0 R P00C0@ T h@弰00帰P 80S0C8000h髰G 00 0` `l`,` p-LMt`㚰0S pX@00吰0S㌰00ph釰(P000^0S` `l` -LM|P0S ppp00/"?CQT`1@000?0S 00/"?CQ@T `t>5x>5l` -4L5D3>5?5l`L>5T3 p-|@LMPP`D 0U`D 80S0C80 <`000 (P0 P@p雫0`,` p-LM@0`+TP pJ0D #10PY]>5 p-0LM $0 (K0( K'K1KPP+ 4 10 S 80S0C80pd00 R0`V @T 00 Q @T`V80S0C80pBƷP80S0C80p/_ -PLP& P` 0@10 0 pD00 Pʻ@PE0U :0U0*00>5X] p-LM` 001PC@ cૻ 0!0e 000e00 000p -LM1` P@,`  #(00(0o /P 0SpW  0R 80S0C80ds000 0 0D0*\ p 0#$(,"(DRD 0v P g 00C0< 0Rv "0 S0!0" 8P"(00(0l"Y$00$0Y ,00,0XM APA(((((((((((((((((((((((((((((((((((((((( (((((((((((((((, (((((((((((`  ,0kL00`L0X I400 0P Z00Q00Sw Pt@Qq 4 000Sk4000P0,P ,0 `a 0 3.pH/,  0 l`0`,`\>5H>5 p-L MQ@`z 0BS( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (D (h (t ( (@ (U l1 Rp T 0ph$R 0,`ep-p  0Pphƴ @ 0 @0PS `0S @T`Ppㄜ@x0崭d@ 0 @D0PP ˭ (p_L>5|>5``T>5`>5X>5P` --)L4M0 ,0 X 0 QL X`H0 P p D KD `H @001H0 0 0S+ \ @+\ 0 WP  P 40  0R 80S0C80 00P0 0 00 0S r P P T  0h#(X$(|$($( &(T 0S p@T 3R ,0 S ,寻5㋖@0 R  3Q H0S <Q H0SQ P U 4SP1pP-pT 0S0  T 0S0 R ƕT 0S00S R; 2Q5 H0S <Q/ H0SQ P) U 4S@ T  0S @T T0pT;p 1P7pw 000s 0RP@ 0 <0K; K0@K80 h@Q (J(J(J( G( G(J( G(=( 00 0d%00 p0 6S S0lSAT(6S1 !S! & 10cSǟ0007 Plv7 l Pot ǟR` l R ,!R 010cSڔ7b1P 00 A 1ToQ? 72S1X xP h0  HP| 0S0|@0b0|%P: 0 0bS6 0CS 8A(F(G(TA(G(U 0 P  R  0bS$Q < R  P 6 S %L00S Ƀǁ 0 0cS L0 b00CSH00 @00[ -0008[P0  0S 6 S^ 6S SI8C80CSB(B(TC(B(B(`C(C(0 `1S S \p0T  @4A 0@4 nT4Lak  (4La` p0 0 p0 Ξp07p0Ȟ 0R  0K㺞p07p0嵞p00p00S6S㪞p07p0奞p 3 R= ; 0p0 0Ÿ0"00| @_|2X|0 xP h0  HP0  eL@ 0SF   @L@F  0"p0|ް 0 0A S 0\0S 0R < 000 S <1 0P000 0`S ] ,!0 ?0L⠰U 0Laᑰ C U 0LaႰ Y k|@0P0l0^<`_3 ?5`?5l(5`x?5`H?``GFE?5 ``?5`5`I]`(```?5`?5<`` ;+H 0?0 Dq PU  0R< <1 0c0cS0003? P V.0 R )*000  6@!06 8CR 6S1&01f 0FP!>P 1`+,Q0&p0!\@0< <C  !0, 0cS` 0006 "0$"?04ͯp0`0`S Bp07p0<0K F6p07p0100C0-2""Q?60  000cS0#HH10P183@_0_  00 0 R000 0 0 =0 0G0O##P!040bSHD00/$O R00cS10cS 0 0  1 01 Q @  00cS10cS  Œ0S* \  0 0bS =00[/6p S6 10T01p 0c 0 0bS^x|0 00M  &%0%?04p0`0`S? Yp07p0S 0K]Mp07p0H,!R$1&010000S00C0 `afS|0O&0 0 6br7' 'Q? R =7 70 S\ H!p00bS P0Q0R00S 0S P@0S\ T10cS0P1p H!Հ`Vj 00cS0nS1S:6S t 0R00 l Rl8 ,!R 010cSژb | l 8 X  xP h0  HP%|@* 00| 1R 00 :|0S { h)0?0 )  0R}\ yLP a0lS0Va   0000|  @_X| 0 xP h0  HP40 ' )L@ 0Sp: R  0p00*p0|⥭p   0L@4  ~<+<0 ?04↭HPKd`K0S S  D0@ @KG0KH@KG0\K 4Kd@KcK=K0 &Q Qw ! 0 S- 00 %0 S   0P p  DX P 101 ; T6 R <@T2 0R #3R'ʌ tK 0 P P P  㝣Pl1010 S1010P 0 ( 㱧 㭧0} 㧧0H0KGK D d0K$KcK0`0 06K]`>` drP  +| 0R00 R Q.101 $0P0 e 0 0S00 40  0`F `0t0 0<4(<"4!5 p-LMx0V@@`P! 0\0C:`p0 |\! :P\@ Q40 L\! ph)p  P.l(5Q  Q  cp0 BP1P 0 RL LR:0 R R: (0PL 0?5 -d0L M0Q H 0Q0 @$ 0@)?5<`3` -LMX0`S  U0S S 0H0(THآ0DA 4, p RP@0  9R09D0 001 0 0@ 0Q000 D001  B ᥩ00C0PQ P 80S0C80G ^`0#90000S00S000@' "0?0 EX1R0SX!00V/0Xa 0  0`@0, `o韖@ 5A"0S:@0 \ @ 0 01R ! @TR@ 9R09D0 001 0 0P 0Q000 D001  B 00C0P P 80S0C80 Ǩg0 \h@W  !1x0x X0 0#!H G@0G80`?5<`?5`,i(?55`f(?5``` -LMp 919 S6 0!0S.*!@0` P``k9!09100S00S000P T!0?0 YiЕP$ L P0@)QD0 )0 01 000Q000 D001  B W| 00C0P P 80S0C80D '3|?5`?55f(`<``,i( 0-L@yP 叻0hq` -LMjXAT: q 9R09D0 0010`  0P 0Q000 D001  B 00C0P P 80S0C80 Hᱧ㳧V@0 X1o%<``,i( -0LSp; S* ` 1 Q@A00@T H0TS @T 0Sp  Pl0l P@  !a000 0 0#!?5<``` -LMPp 忔, K@P`[ 0 0R *ᬔ  0bS@000c0CS 9R09D0ş 001 0 0ğ 0Q000 040 D0401 0  B 0$00C0t0P 00@h @,h00 h0s0s0030S S,0S H0 0wPp 0 0 ᛡP P 00D@D0p p0S \#!0P00 Q?"" 43` p 9p0=p07Ptg P0RL1 0 0062 ! (!0"?04}"000:S?9 S6 100! 00&?0]@Q  10cS1T!P@ P P 80S0C80ڰ 4749 MY7 P P 80S0C80 ,44@0 &2QPF * 04Z h0 h H00080P00X<``GFE5?5|?5<``,i(` -LMP@`Bp KPPJ 0 0bSE 9R09D0 001 0 0 0Q00`0 D001  B ȥ 00C0  0@P P 80S0C80< wy鎏<```,i( -LMP@`ߒp KPP <4<("4!<S ʒ) 9S090Q9D00 01 000Q00`0 D001  B U 00C0噒x 0@P P 80S0C800 '<```,i( -LgM PX@LP@@N@\ pß X ! Up`D@ `H#D 0SiK 14 @P 0S j/K!PP` b@0a Y P\0L0Pd @0 0@0d PPP  !  Th1p ci᠐00  U *1w@ \0L04= S9094`0`S5 000  @[P P P 80S0C80 (OQ1P@ ^j0d@  @ d]0[ 0 " 000  QlP0S0 000  QP0SY ;F4Q @?5<``,i(` -LMU0Sp`0 J S(  04 ,0 ?0)0S4 0VPc@D`[V V$P101O$0 0PP!P P0 0SV `0  ᗙU0S S P <4(<"4!<0<4(<"4!<  0 4#$0$ 0 0 :#40  0 R t30(,!$#, 9nU 0S[ SE 0S; S& 0Sx0S S /, Q< ,  0"0S;0, P4 | 0`  !4 8<#` #8 0U 0 44"0004  0b!$(," "( 4 U 40! c 0"4 40 11@0"B1P <45P>5 ?5(_ -L\Mp`px 0,0 @ \ p 1S 6p0&>n 0 Q1 !P0n@\`0 t@ | Zz\P| S2` Z h hX]\@0` 0^1!XP\0\@tP P0  CX@0D P\P3S0XP@x0  X4 pQp` P:\ 0 ( n0S%<1X:S 0!0bSx0S<=!0=xP0 aS0b0bS T p`0 0bS`1Sh   S(l p` p`00 0S I? hlP lX Pt ɃXlP  n X00R00S4h00h00!0bS L\HD0ODP@ 1`HV8 C+P202<$00PPP P0l 0SV \; 0l@ @lP00c<  80S X\ `0 P~ \0`@| 0Ss l0P0Pt0S Xt 0 0| @C p0 1R0B0X001 0,$,!$#, 0h,$Q,!$#, / \xP0#Q6Q9ɟ 2Z`ZZ"("("4 40 0CS0՜0 S 0!8#8 #$0$ ! `1S S n0S 00 00| \p0 0p0 1 0cS ,1!S8 0,!0000@ 0R l(0?0 00\0`1SR pSO dP*G@00@0p` 00 0p`Z1 0cS0Tp0 tPU3tǟ,0 S ,0|p07P d(Q d 2RAR6S<7ó p0d7|噠xxp!"4 40x tx0m  \P0 x@S;0 0H @@d S@(A!4 0 Px\x 00H PP0 g{F_ 1 0cS!X 0hP0 0 8#8#$(,"8S5(_ F3 -LMM? @0A9N?d 1\  Q xQx< 0?0ઞ&6 R06 6?553 -@ ML_ 0@ 0@t0 d0`0`XX0 ;Q<0< 0R<h$(ж3p`$3`?5?5`0_$_Ԡ(,3 -LMtpPWxV `P6 P # 0 0㼃 0 0 P 㲀1 00 00@,  l0P:0`0#$##   0 P0(`Q@ ᆔ0+ 0 8 "8((<"8 8!("(!0QA"`A"Pp `1S) +S& 0 0 00(0Sg@H$_$ R 1 0 +10 ,(5T>5$_ -LM<P`J _@ 1@0I/@|6 ᛜqP@ PⓜU@ Y⌜ 0M/S00p00x " 08C96&N?RڀR0ø6d  !!h0 00`1h0 <0<0  s t D`p`?5(`3H(?5?56?I]P>5 p-LM6pS0x 0@`@P0 <U Sph40 RPp0'p 70S @0 +p07p0&`V``44 0\0!0000 SQF -LMD@@6S S6St0 R`06LV0S|hO 3QAQ @QB -L$M0@S`P r 0S R 0S0S0S R 0S0s VVq 0FSqdV V` 1 R U R \F  0R:<K㎑  <0K[#[0$&V+ P 8@<4(<"4\!, DQ 00cS10cS00 R 03PAP @P < K|P| 0<` pϷ}(P((4'TK]``H3 -LMtŸ0pS, @`XR;0S8 P6@2P8R 0@S,RWP[ TRR TP X$ VL 00 0iP" @<4<("4\!L D R 00cS10cS \1 ,0S `,ɜD1 R 3PAP @P<@KА0 P<0K;K` cK8P  00 RV @P Ġ̌.Č 0h$LP P D R 00cS10cSF(Pꠚ_( ?5(4'D(`D3`T>5(D R61 -L0Mp0<`K@ 0 x4KP5l3B -@L㵅p0`0p h骅, M? , N?Ɍ LQUP1 Q O0n0t0n0P0(H0l <^*40  ^:00000<`6?5`@5 p-L M@pp0`V140040P,x0@ . P,ʼ0^ڰ0 (0`0Q*80 080t0LP` `0 ?04ph7<00<<0` <``?5`5` 0-@L"p0P6 S \0L\ L0(  a R 8 80 ?0዗0hU`?55`MЍ -LM Q`Ppn \ 0Sd, @0V0T00SNTD0@ 0 Vf((((((((((8(d(|((p((( ((((T8 Y 0,帄00A 0@jP0 0Sx000Dh0    Qh0< Pp0SK S. Pt% 0:0p P JF#04000#60 ?0n 35L7P 0S KPQ+Px 2Pro0 S0S0S 0S 0S 0SQ0s QᙱPN ٲ 0S 0S  P E;08 [P50- *| 50,H0ރH0S0@ 0 ͠ 0# 0 01  00# 0 B 0CS0 sg|| 0 0 0n 0n0h0    ah0    i-ꌃU V V o lU 0 Q  0oƼ 0oS<`|?55A|3 -L M`@pP\, 0 S_ UD 0 R R/ ,I  0 0V, V ,2 W W *P P 0S0 Rڼ6R&P 0S0 Rp0p000p0 50W 0 W* 60p0 0V 6 P p-LM0PS P0S0 _P@|P@ p`P Fh0 00`1@00J0@070p@5 @5` 0-6x SL@@Pڲ0 0S L* P@0@ -LM6@S (((l(l(x(06@T 6Sx0@6L S000 0ό0605` -LM⬒X`, P P0SR9 Q㍯K"!: /N.P@/D2(K0S S| K 0~P@t 0KMKvP@l01X ( K0SZ SM X W DP @0  @X,0 S x,5=W @ 0  000 @ 040 X/ |.040 00 0(K 0 S S W@5,` -L --L|tMx 0 0p, 0  @0#2SH S P ,0 S  ,0G0K` 0S 0% :X000 0S000 V"48<#X 0 dR U00U0Sb V xK000 S  0S 0S0s 0S0S 0s R 00 0 0 (000G[Yz Y\ P 0S V 0S 宽P 8P@ T5 Q h0 3@ TU* 0Q0  h 60SL@HK0 P 0SV  R 00 0IK 09000?#0R Rt ,0S00S40S80S 0, uPPX 0S 0S$0S(0S  _P#0RU& l%0P  0S00  h 050S'533 0-LP{@l0h{ -L MQ@P`\ 0 \8 0*- @Pip@5_ -X0L \<1  %( 00 0@5H` --H0L Q 1(   00 0r@5H` -LEMhh5KoK@`F8! 0 , P,5(K ""R? R (00(0L4 ,0S ,-( 0S%:4(K p""R 4(K  R 0 $(,<45``-QM 0*\ЍfЍ@5 --x2LtTMp 0 Q,0  pP1  00 0 0@S0510205 :x0K x [0S 000 ,0S ,w0[S 0S*mP0p00 HKdK0 "bV? V 000@@0K HKdKc@KG@KP\0K K tKPo 0 `<1/<1t [000x  ހP11<<1@D0K GKd@KH@KcK `0K@5x`_3`85 -3LM0SS` S"2QQ2 QQ Q(!08# sw@tTPkwU 01fwL"p1$@01^w01p1@=)01pp pp!0 00!@` 0$00  j0O!0S- S @J,0K ,K+@KP@a0` 0p pp!( B("("48<##801   @mK i@00@00  1#$0$0 a ppp:  440(! 10D 0007$ 000X%x` P_4_P>5-QM 0*\Ѝ}Ѝ@500@- 0@00 00 vT2#Egܺ -LM1^0@!N?P1p@`eZp:U?ZZ o݃ @Jy?Z@p Ѓ m fpP -L?0@0c80 !<\ P!TP 8PtU"\@P P<}VXPK0K  P0K KP0S Ppp 0  0`S 0K!0 Sf @} Ÿ  0JPM ` V!P0V P`80 VPW- Q0S& L T0S E` V Pd00 TQ0 d03T0`80 VP P000Q 0 TWRN  @`0 0K@PP0H00 @A 0 K0AP @D 0 PHp f)@5)@5 -L M0p,0 00 P0SM j V@X 0,T@#Z| VH L#0S 0C0D 0P`/ ,0T 0P@0@yW21S1pS 0S1"10S01 q y\  T_L#0S0@ 0%)L3l3|333 -LM P@,`{0 {4 {0<  D {D@/">C2"/P!008BS@ C{?#404p$@WDtCY8 ,0 <  004,  `{T@,{P@1@#W<{P@1T@XP2@p"S 0 S08 SL3 R2PPP2@p"S 0 S08 SL3 RPX P"00 SPPP#00@ SPDp4!,@G{PD `P"‘\00pS04pS ࠡ`P PP ‘\00@S04pS ࠡ`P  - PL\`@p{P 10SBt0 0Z {8 0 T 1P-z@ {`,@z`{VP3"0 SPPP#0 SP8 0z`X8 T`0l!`!R @ R D0| 2a z@z`& -LMPp  P,P ,@`VPUPa 0 P` ,@V,0z`VP 0 PP`,0UPV -LM @PP4  T 0cSP\q8 0 B0C0 Y0 0 0! d ,K0P`,8"HPQ@ 8  3S 2  %z0 T0XP<0 0!8?\>`0 0/ ?> 00cR#`[ P80iW00\!8?\>`0 0/ ?> 00cR#i P<PX!@!400C40 g!40040T0XP%0 @?Q>`0 0?>0 0c$00C$0 P B 40P 00C 00@0 00," ,|,_XU `_ -LM @Pp4 PP0 00Uz 0 0 ! 0d 0,KDPh,"H`0S 3S ,Y00U 2  00U T08 UZ P !40 SPUUA 0 0GPp7 ^!?Q>`0 0ς?>00c  ^$00j$0 P j 40  0Z0j 0 40 j0C40!400400,x$,Y, 0 ,?py0 8 Z00 ?Q>`0 0ς?>0 0c8 ^$0j0$0 P 4  00 0 40040,H0 ,pU `_ -LMR pH @x 0Pd ( 80P(X`0ZC 4R`0  0*00C0 P B 00C0| P xx@Px0 x0` }xPEx3 RX0  200000C0 l3 RT000T0 0C0 0員 800c Px3 R`0` Z"J PXQ0 P%R4 |080 < Lx 2@ @!QT000T000Sj \28Q4 X0 20 0<,0 , x@P*x0  x0` x4 x40@P`,P0S4 @T40TX P, 0S30 w` 0`<`80wLq4 T52000?00s2 q4 T52000@0@ PR`0  0PV.L5sX50 0S`0 RQ0@@0 0 lnhҖ`00 DdD@T,P0S@TPU 33$3 -LM `Tp 1S0 0 ! 0d 0,K*P, 8 80"H@0S 3S 8h$% 0WP0SPU 0PG0UC0SPEUT3 Q, 8 Uʼ000 Iw P@ l?p >14 PHX P0 ^ 0 S40\4 \` 0n0rP02U8(@8  /P80PU,080 , 8 8b80`v`0P,080 U L3 -LM P`P@P00 0 0 0! d ,K0P, ,倂HpZ4  3S e 0S H2T  080  8 v@>Z!\000/ > 00cR#= 081 a4 ^Ϡ\0.A00/ sP  l1@R\0/ sPI <1 Z\0`000?0A0@ P@|0.Z\0!00> 00c# 00 0C 0  P B 0 P0C0 ,0F Y0 00 P 2 020 0U `_T3l333 -LM p`0PR 0O0  0d\%8T 0A0U2Sʼ@v0 $0X: 嬖%00 00 ! 0d  ,K0P,,$H@T 3S v4  u00U 80A040 ?80 <448T`0.!48000?.a 0 bS1P4 0< b T0USZ% #@?T>`0 0/ ?>1LQ l3T`0 0?>0 0cZ$00 0$0 P R  0 0 0480 24R`008008?.a 0 bS1P< 0 2 `R4 `0RA ; P00,$08 0a$08Pl 0l  000 P 000| 4@P#uu@Pu0 t0` tPE uX1 RX0  2000000 1 RT000T000 0圕0` T`0PB [ P 0 R`0 "  0A000 P 0 000| P0 k 33303U `_<3`33 -LM @p,0 Ws*t4 0 0 4 ! 0d 0,K6P`, ,x!HPX 3S L1  Wt01aY\000?0p0S9. 0X\000/ 0900 0W0p500 0   P4  P000 ,00C0 P B 4 20C20< =S0 ?=U `_333 -RLM`, p{ @s?Q1 Q`000.,0Ae8崁/.  b  B020!YqPp1 @R, `08P/.  b  B020!@qP5 00`,,08P0 eS0Y`0.!00/ > 00cR#0@g0P 0 S P Q,0` YX归, 0@ O8,0, @/>QU @5p333,3L3l3G-M$PP0gl0h `Qpb?>1 E   @$?p > 1^ࠡD T! 0  S \ d@E? >j1^࠱D T!@  LP \l0 \ 1 Q0 110b1X10l1$5S!0SL\ T3Ѝ?>1 E -0LM 0 e3 -LM pP@P 0t8500  Y b R00ZZ00 PP o P P@ P ʤ0 5R5=:\9:0 PU00 U00S Z 10 0@TPP`S PP` u0S:0S: P0   0KPP 7T/ 8%0@0L 0@PT R   0  H  0 xK@ PP 0x 0 0 0u 0S:20S/*@5L 0@0   xK 0rPP P  0P 0d x02T0 0<HLo 0@P0@ |0Kd KPP |0` 0C!|0 @t KT   0 0 dI0 K0PPR``KH|0  \A T Q xK00  PP4x@0dI@ 0 PF d03 T0 d0KH<`n0@PPP ?P00SA 0 B   K0t@KT` *0 y00 T`:P00 ViD 0^!0 d00!Q0Ad0D0 K0$P `0KH  z  0/ r PT@ 0!0xK 00 uPP x@P@ 0 0 P d0 3T00 00!0A 2~0<H~85@0L 0 @0Kd 4@KK1" 4K1@T S0   000@ 0 EV%$@P loP@ 0K 00PP@^ U P0 #0?Q5:^:P0@ ፎ80S 0` Hk 85@0L 0@T0@D 0OR:Q:P1Sj0P@00T 0S ܌똚_3 -L4M0 `0 80 P T 4 0\ D H0 t0PHPU H 8XHm00@ 04D@ L@ < 00 ]3 ,00,0<0<0 <80&Q0 < T`<P@8<|H, 0P UU Ud#U80B``apQD 00 a0 DnthAsj@ T0@ @<ZP@T Dt H0PB4U 0cpaPEVXHUp 80SRHmaV3D0S) P2P"@DP @dQaDFA 02 S`1b1 RD 0D D 00 7aP  TDP<00 :00d "L0,K0)P @,0TT T P  0R0d ",KT0P0PT0 ,0@P P0L0 00P0 <Nu PD X @UI U  UD  UA U Up  U:h  U7UX U2P U/<:0P0嬋똚__L_P_ش_`_ж_@__ ___3 -L M `PP@p m P 04 OR5:P:0 00 ,K0 P@ Z,85H 0,  ,85@0L 0 A-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018Ġ@5p33 -80L0CS%|>)>)>)>)>)>)>)h>)0S0 #Q00 L0 R0S43 -80L0CS!`K@ 0P K Q0O`0@\4 O PKP@05SP KL0S@@@0 0 @0@0000< 0%P@P PQJLNJ@ ,L I@@,Lc@P@04 _hdTTx3c33E-0 LS03R %5p00P5,5S ڬ4S9Ӭ4հ4S@0Ӱ400tA/SpPo5@"p%$\ZH0L0SO/͎ -L M@0Qp `: P@ҍ X 00#00 P@р LI|  0n 0Q  @PIII@0:@0  -@0L Pp  %P@`@0 S@`V P@P @  0 0 @  ]  -p`P\LP0d -40( 8$@<( b@`@, T0C0H0VZ  fZ fBl f D b^T3 p-LM0@SP  80S 0hl0S  m`V p  0 0S0  -LMq@@ -R`P =S@ 8 K8 4` , 0@ '8@0<K#=0T00 \ P S  <0 PP ST 0@ @ ;  0o 0S  PD  @ =SPPu كTY)T33 -LM4 qP8 +8 Z4,0K<Ÿ @T,}G`a0T"0E p@00@0, `,001 1P)P@ ,dT P kd0 0 0$ @Rdx^d`0dCA0 0K0 P@ ,%08  x 6d00 H e9000 ,0K4P@1S ,5S9Ѿ)1 !,080 0S01,0T @000,80t``3A5p`x`@-@1T0, T:F@ 0000!  -L MP, 40@c0 PPp#8  R4 g0@d 0 D H`\e,QE X80p W 0\'d0T   cd@000h 0#`00h H6eL5H sP5,5S,>QS. (00P0 SHŒp011pGW00P000 `_ 0-LMT@PTGD 0 0((@{0hj ]`3$5@-QM@ 00CS 0a)`a)pa)a) P0 Ѝ@^-@Ѝ $  hC5lC5@5@5 -L0-0<`L0 h0ckPl T l 33lC53 -LMp80S 0S T`lP@ 00300@TlP@ 0 1P0S+ U@Zl 0S!  0TPTl0`S YIT 0S00 00? Z P0S 0S p0S 00 00SP00300.003000TYTlP` 0S`P  |00Sz @0w It V3_3 0-PLn@T 0 0uz@0` -LM@ h -L M @^ 0    Q -LDMT@d ` d0 h P`P尀 P_@h pTXpKU\PK  0P@q R\ "1 (`!R0 0  R` V` 0h S0, 0Q0 0 B1RP\ p; X@i T3 UH00d0P  0 00P @  H\@0X0T00S 0S $0`V * h0^1 ,1 S 0DS\0 pU(0` 30000$ `V*h SH,!0 0Q (00 3&T00 aL0 ,00,0P@  Pꘚ_ -LM00 T0, 01P<0 00 \b0 \8 D0 Dp@ L@  ɯRe <$0@' "p X Q@  g B@ 80SG@0l0`  c4 @ ,0bR 0 4 0 D0 , .@ 40 @ 8 S% <0D $@ PD 0 \p0  \0 [0OW@ Rc",0'&4 Pe P 04P ,0 00SD8@ 0`0l0bc4  -,0 L 0U0 0 5``|`-X0X  00P0\ P0^P`` -0LMxxpP@`0 0P 0T P0U$  P 阚_`` -0LMTp@ 0`P>0 0!R 0U R00 R 0@@0V0 >阚_``0S R00  -@1LM PR`@ @0S@9S 9S0  nQ   0T @0pP 0 0000)0yp1   *53 0-h0L PR @0SH@K 0P0*5(3 -LTM4 0d @t h d l ,0 p 0400@ 80 `\ 9 : S` 08@h fPP  8T0@  00CS8d PPPl 0QQD <0 L H t 0<  00L0 8 l0TS1 PAx Q x  x 0@_So0Skp0P0 px0?T  $4K TX Q0\ @,PJ,0K/00PPp<0S;;S<@ H ,0H @0S" 2 R< R P  8 T0D R00000cCQL0Q @ D < P 8T0D 0R  R T 000 XRX p Q0PQP 0〠 BP 0,Pml0SS S 0l#70P00Sd 8 4 08St  0S 0h 8xPP#< R'xxP0@;DX X ?0/;?0|0 \0+S  8\p 060lQ @ DX0QX x@ ;;S @Tx0ax0pC5D3\3_YPe8T0D R0S@D@ @ @40P X 0A8< P 0\ P0 S0 00800T D0xS00000 0 S:0 S*!J8xT D0S00000 000,tl 70R00S0?00l0S `l0P0Q00S t  et  /0S$ 8 T0 K0PP \0S t p 8%06000d00 Cd 8 8@00@0dp 8 00 K6080T0PP\P t 00d 0p 8P0P60 0?<8p P0600h 8PPP0S 800 KT0PP0 d\ 0P;08p 06t c 08h &PP ;;STx0ax00S+ 8 T0 K0PP9  h0Q 1Q 00!R \d Q 8\p v06008 @00@0d0 <0SH0@ 0rH0 H L0@ R 0@  00b< D0 8 @P %$; ;0000@ -LDM0YH L @pK`P>L@DK 0 `@P*D0S'\ P P`YX0T DQ  R 0.SR 0.SH0P 0PX -L8M0`\@ p@: \@7 P@0< K8\08 pPP<P@@T0D R)0[*0[S""[0R0 0R@ R @00T@ K0P@ @P T @Px@..3- -LM@ KP 0 0 0-@DP L@0P00 4 0 0 -( L0S 007] p-LMP` KP0@0 9S !0R F@ p 0- D0@L PP0s-0)5 -p0 @LB 0  PP0s- 000H r X08PP)50D 0  R  0S  000  0-LM0@ PR0K 0 R 0 0000 H@0 t0  000 0000 H@0 0  `_ -LMDpP@ 80S,) ) ),),) ),),),)T0@ PW 800S  ! 0Q -LMp0P$K`: 0 RY 0T 00$00H H 0$@p1  0000  9:0  1 0 ! 0H0 0(0 , 000 4 080 < 0D0!@ 80S; ST0P $  1LO$K48 T0 8$0H0 00$00H H 0$@0  `_ -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s$ T0@  1R BP R0 2 RD00000D Q  20S q T0@ q 0Ph0s4 s 8 00KRj gR` 40pPN4, 0S:00 S*(qC T0@ = 1R BP \0  0P(q00000(s00 000Pq T0@   0.u + 00sT0@  R0s0ss~YD 8#8ST!880$0Q_ -@P1 LRp` #BP! R 80S   AP  9:9): )<0 9  uO -L M`0q00 AA0ppx Sn APP A 00T000 1Y,0 00000 PP 00,  0  qPP,, 00PP$ 0 PPP<YT000T 0S9;9Y 0S9;9, 00 AP 00,J0   W X  RAPs3E p-LM080S 00S 0 \ `T hfp| 0 05u` }*t x* -"LEM0`,0 8 Rpq T T0RhW  P[P1 PQ0QG0 0 0   0P' 0 0CA  0nv .*w )*W  0 ,0S ,-]MOK  0P HC>:5ꠚ_$_03 -LMq 0R 0 P@`' R sT0D R- 0 S \R ' 0u0` pn0;0(!  A?K  K HU4PK J/K0`dꠚ_<3X3$_ -TLOM`0 P,0 KP`P1 p 1! 1P` P` k 1 P \,0 S P,Y0I00P1 8  )0)0000 00) 0P`XT0D 1RSK@0L1  U?K@! 0@ <P`90 0 0 P qT1SKH Q 0P`1TP`MOK TP 0`V y <& P10`jy000)0A B0)0 PTOꠚ_$_3C5tC5 -LMPp@` Vf |0S 00S Bu % &P 10S 10S 00C0  B  0P#w %u)0 B00)9 0C 9 T0 @ @00 Y000    -LM0P@ 0  Pp0s%PT0D`P 0 @Q  0 M    ppNp -LLMP0 0;\ ; PU\06 0PP eX T0D R 0 qT T0SZ0SW 0S0S p\n0 \0T 0f ch Pp Kh~ڴ 0R `pP\\  AX  0f  TX WTM TH#T80B``GC pR0P05 =C0p K hP\ 0S#ڴ0``\ p0 S0S\ 0X 00  0S 0RT0S12P"@T T" T" T T T" Tx" TTh"T`"T\}HK UP0KH0 4 D LP hU^ UY!U80B@@B` P00E `B 0HK P PT 80 c@Z * 0^0 ( \:  ET L1L!@PB @dDFAd 02 S1b1 R000dB 82 \T : 1| @U Ul  Ud  U U UL  UD  UU4 U, U3_`_ж_@__ ___L_P_ش_ -LM@T0D0Q S1S 0h" D 0T .  0T .0T. -LM@p\P8T0AQ `7TP ^ ~ |0 0D 4 APqAp<pWT~H<JT@p004p;00APVAl15 3 -LM@P0#Ƞ Ƞ0,4 Bn 9T=n 1!<5n80S T0-n43X3|3T4 - L 0000 x,5,_ - L 0000 ,5,_ p-L M0`@ PR1!0p K0 R 0 00 00 H@0 |0  000 00 00 H@0 0  +5,_`_ - L 0000 x,5(_ - L 0000 ,5(_ p-L M0`@ PR1!0p K0 R 0 00 00 H@0 |0  000 00 00 H@0 0  +5(_`_00CS T)h)h)p)|)))) @00 0 ; < 0 0-LM 0P@ P00 -LMPp@9#68Q꨽)))T)T)))))4 `V 0 | 0040'P`0$KS<00<0H$@  0P4 )5,_ -LEMXŸ` , @00i N?KPP Df 1 ,0S ,T81 p  01PP PP x"f 1 80i00D1*"818)  80000 0PPMOK B 8 0PWPP 0  f810tede Y0 00 )818 8  8P )8P9;9ꠚ_$_3)5 1s s 0080<00 s00C5C5C5< 0S00 Q0 0 0S00<0@Q` 1  40  aR ,0000 0S@Q1 0 ! 0,00 00@Q191 0 S  -LM @` PRp$ Q 0R 0V`#V($@`Jl6 P  0$00  k)33 -L0M0 `P0Sp9 : S? (@@J  0P@& T0 Pp0@Q +R"G0 0S0050500 L Dj(@0ˆ )ki)``_l3|333 0-FLPXJ\ ,0Sq 0 S R 00 -LMP @ 00Q ^ 0RP 0SZ(@$J 0" -LMPp  P,P F`VPUPa 0 P` FV,0I`VP 0 PP`6UPV -L M @p,凒0PP 0Ɣ&0,K偼PV$,0jH`IPPUI jI?>1 1@R#P P; jI!0bR0S- PP0S$ P ]PP?>1!E , B 0H 0C0,$0"Q , -L M P,劂@BP00  0ƕ&0,K P^,0TH(` (`6I>1 1@R#@  d> aq EP/ 0lA0 P@iDh.!1D0,0C000*  R0C 0,& 101,n(0J"p `EP;  $i ,囼T33(3H3 -L M @`P`$H U0: i , &$K}P$0$`HpH?> 1@PR#  0,0 00D 00$$N; Zigl303<33 -L M @PA \00\0SC(H,6倢0 Ɣ&0,K,0S-,0(H`\HQp Q ;  ' 0,&0 00 00 Q,& 10C1X0,崻i< R,; ^g \g333 -RLp`$P@ $P`HA0Qd DP 0l1 P0PhL0gP @DP; h T33L33 -0LM ; Vg03 -L|M0   0 Q0p  0 Q0 Aa@T &xK0偺PPx00xk 0x|K 0PP 0| 00 p &0P0x &|02T0 x0<HDx0@P0Kd K\PP0` 0C0 !@tKT P   0dJ& xK0+PPNx``K H0QA T   0|K 0NPP/ |@dJ@ |   0&P徻 6d K3T0` H<dD0@PNPP0SL 0A x?x勺x˺0t@KTpJ:Q! (0P ʀ0dKA`0&0`~x 00: 00x妺0 @PW 0$B00 :0Ad0D& xK0嗹Px `0KH xx96Tp:T=0! 0{|K 0PP |@@0| 0 pA x徹0P&0P 63T00 00<HC0@Px00 &K01PPT& 0 63T0 0|K 0TPP|@X@0t@ &0PȺx &|0pK2 T0x H<mCx0@PxWPP`|  00 0 Ne3 -L M @^ 0    Q -LDMT@d ` d0 h P`P尀 PE@h pTXpKU\PK  0P@q R\ "1 (`!R0 0  R` V` 0h S0, 0Q0 0 B1RP\ p; X@i T3 U`00d0P  0 %00P @  H\@0X0T00S 0S $0`V * h0^1 ,1 S 0DS\0 pU,(0` 30000$ `V*h SH,!0 0Q (00 3&T00 yL0 ,00,0P@  ᧹Pꘚ_ -,1LM PR`@p @0S;9S R;pST0@  0S!$K$0)00  0S  00 zp *5D3 -LM@T`@  0pKVP 00 T00 P HV@0 1 0 0P 00@(` 0@DpD,V0RD$D6&4K0[P@ 4J000$@D40 H *FY 4夷4 `_ -LpM0 X` M8 P 0@S@@T P- 0@S  0@K X 3W1ƙ&0G PE000 @K 0 @\P  pdd O000  05ķ6Pp( &hE0 @@K  0@ @+P pFdd0eH0A ƙ@0 &:E @4 6P@#!B0 6#1 |K a, 6< 4@D0 @ PwE 4@K1S4KPU BZ PU ,0@PEU 0C00 0 0K< OE|K< KEXa"0 H @ 6 #1 c< 6P35@ a B8 ` V&4K1@DSPUZ PU ,@` VPE 0@DU@ 0 d00p 0006 $ &@0K4K"1K ;4K1P  S0  00  eWHT000  0 T0D0Q:S0S[@000@阚_ -L,MH L 0 40 8 \`8 < @ p PFF$1@P U@ 4X@C0  0 s00D ]D@ 3 ,00,00 <80&Q0 T` tP@4H\-8F TT TX#T80BPP7 `R< 00 68 &<YD80&"!h! BR? ̵LP<@L 8@ 6#1PCU bpaPEVX@Up4 RP@BaV2< R) @2@"@<0@dP6DFA 02 S`1b1 R0<<< 00 6H0L<S&00 :0080&L0,K"0(PL@,0HL H  0R08&",KH @,0LT L H H0D 00H0 =%< [ @TL T  TG  TD T Tp  T=h  T:TX T5P T2 ᭵0P0a똚__L_P_ش_`_ж_@__ ___d3 0-@PLB/>  0000 >000000 -LUM` `0 ,0 `180Qp h 0l t &@0 B00@T UK TW?KT1 @ P XA DA T TP#T80BPP5pP0`0 5`0S &>`!UK 0 \a Pd -D1P0c0Vx1 $*@MKT Pd!  ~>K0\  8Pd l1ğS t@t Pl1 xU:h!2"@P5@dDFA 02 Sp@1b1 R0``00`o5`h!0 0 @PQ0S: `1 R dPpt0a0 d 1 ,0S ,J0$` `!0$$t  ]$`!l 0tlp a Q$`U @TF Tt  TAl  T> T TT  T7L  T4T< T/4 T,ꠚ__L_P_ش_3`_ж_@__ ___ -LTM0 \ 06p0  d 0`0 \0h  , l @4 0` Pd@Pd8 T X d )t  4T0@  00CS4\ vP@hPP< D @ t R0 00D0 40hT\1 PAQ Q`H `p0@U@ppL P Q0^@ ,P0,K/P@D`Yp0A 8 @ ,0H @0S 7 RY#  Q00 000cSDS080 < Y@8|@ 0@D80 \008 0b<0 Q  0R| 0L0 0L00 PRP `Q0HQH 0p BH 0,P[h0SSFt\C ;S@ 4T0@ 90` 4P@HY%p@?p0x@P0 0p P@?p 00| 0 T0+S  4Tl !0608< P0\P x 0h#70\00S\ 4圷/BP}00 ,#0 000Sdh 70R00Sp0 l00hP Xh0\0P00S tQed /0S$ 4 T0 K0P@ T0S t\l 406000\00 \ 4 @4@00@0\l 400 K604T0P@T R t0S00\0l 4iP0@60 04l 0600` 4P@e0S 4 T0 K0P@X0 \T0 S0;04l H06tQc 04` P@;p 0LL0`x00xS+ 400 KT0P@&9  `Q 9Q 00)R lT\ Q 4Tl 06004@00@0\  0 000 0 4 (P< p 0L0 0c ` i` H ,K/h0P@pC53\3 0-LM0 \P&@tl  00\\ 0SP 0S<P00 $@^;]3333$3833 -LSMh! H#hA0  ,0 ,3(@K 4 L0pS㰀 `0 9#60C S񟗯) )4))4))4)$)4),)4)<) A?(K h1KK  v?hAx 0R 00l1 :@0J`4h_ 0KSK0谠lAMK`UK \ WKXA DA T @a 8 Pa K)P@`ax0 0R@Ppd0S0@ 0`p@d P p?x0U`0MKS >K>Kp @`l!>d0P0@0|Q 0Q*h1/ 0@ d b ` ^ \ Z X A?(K Vꠚ_333 -L M@0Kx RK/P 0F000Kb0K/P(0001000 -LM@$K_` 0K pP#0 0 L0S+ `0( 9 #60C S))$))$) )$))$))$),)00$0000000000 0  -Lᕹ P $_ -L\MP@H D T0T `R0pX0 \ `  H0T RHP dDbE\ Q T0R0 0 0 P X PDx8L T +RL00T 0 0d0  X L9: S (H0P T S0L P0 ; L0 ; L 0,Ph 0 DhX DT\0` P ` R  R XCPQHٸ TLP?0  HK TP4H0P ST  0P0 P0S  PT 0RL0R OP0L 0R T9 + 0 R' 9R$ P9S PQT 咸YL000X DP L+0 B00+D~D唸P9: S YTL P`Q00 S T0T+0 B00+ZPY;0C; ;0C(; P 0P000H@00 0 0u DK  DPYI yL P PT YT0S PPD`P00 S PP; 0C ; P 000T@; 0C; 0 00 @ @K D 0P.0[S L `#`"[T3R`040 0 0@ D 0 ᕨT P +P P;SBY ဨ=TL 0R` R00 S T0+P2RT 0+00PT 0PL PE `Q00 S T T; 0C ; T 0DX 0 H0P0X00S+X#0S T L0R 0 0 L0 X DTL 0\ 0/0 .RdDX  0SX 80S "H 8D600 0 0Q 0DK 0 ᚳ D 4334484..T4 -L  P 0 00 #P+0 B00+;0C; 0 P'  -LM0P@ 0  YP` U/T0DpP 0 @/0p00    ``` -LM@T0D0Q S0S 0h  ~$ 0-LM 0P @ P040 -LM 㰀p0`0i,0K PPL,0尋@ Ⰻ 0 00 1i) , 89  ++ 0PP  PP 0  d,00GG W0 00+,08 ,N  P &P9;9G ;)5$_ -LM @Q咻 0S00 hU -0L `R @0S3@' 0P(0@ 0@bPn!DFA 02 Spʂ1b| R0 0000 S!H%*5L_P_ش_4 -LM@hN -L0!&R 0L4 -LM@!00CS  hu.K4 p-LM@!VU`"S Px P 0apx 0!R  0! Q0 00K4484 -L0!Qh 1S 01 0@^ 1 ! 10@0KP4p4 -P@0L`$ 00Rp0V $ Rr   0h -L@\p`P 0LS0 $ RU0V $ Rr U  0h000hT -L M$$@ ( 0@CD4$5h` -LM! MP@ !( -LM@bb b$bPphGFh` -LM$0  CLPH0"v!&`Q $0Ss0K 0S$Pp W a\0!011` g01$$0 Ss, , 0 Ab b  b Y00X0S@0 bP` 0 40 ,@! @d$- 0 <0 !< -A@ ( 8 !8 - @ (0 $R  !0,00@ '0W$aP0000 !0011, ` 4b88b5<b2Xxb* g0X bY bZ b Ab P0 l$b0$0f -LML`$ 0C#6PH SpP@ 01@ST0S @ T0!@R00R0S TH 0!P  0-0PUL@0 !P!R 0SC Q 0U0000hI4 -LML`\p0+S# $ 0l#6S <$HH0#X TXU:U : lH sPL 40040 $  t$ 0S $ 0C#vP@ LP0SB \ H0  0! ! !R&\  l!&00CS0 $0Ss40 040H L@$0  CH"&0000000 0 ! 0 0040040  B i -LMLX30 1,0 Q@T< 0S%0 R"2`)pW0  ```3YW  /0 0C0,0 q2A02O/XW88020 ,H444 p-LM"V@``  00b0eS $0S 000  pH44 -LM@ b  P$ !4&0 $R01 0$0 -L@ MT, p$PnP1``0@Sd\0!10 l1R0011  0S@SM !R1 B 0 0 T@T+Q1``0ASdQ00!a11\00!11`  J 0T V00!11`Q @T, 00QP00!111H000 D4d4 -0LR@@``TPp X$ !@RT01 0@\ 1  ! 1 @ 00CS0  Q00Q0S@ `FR00 -p@L`A@PAU0$  A0 0$bp  0S b0 0S0 b P0 b x bu B0h`$  ?#>C@0``] -0qLM|0x 0PbU|07 1  PP`5 䠟 R0@0&  P `0S00@@ $x 0 0Q0x h p0Q0p  b @HDG`F5_]`44 |00`|0`-8p0P0 0Cp  0  `` 0-@LTP 00ST 0S 00 0C 00TTp  0pP0002 02022@`` -LM 0@S A0 S p00Cp0`P0 R0S2B "0 -0L@pT` PU  PR00R00SU@TP] p-LMP P` P p@ @ `202K', -(0AL0$1@TPop 0S @TP \l@0@S000@`p@ #0S4` p-LM0P@ R*p0@S 0a!p R P 01U`P V000V00C00S R000 TA GF4`44 -LM @R)(0 Z$$ aV p@P0S@PUZ0`*AV$ Zc |oA @p00Cp0@T  8 440P@F>]$54`]]44`0 0S  p-LM P0S* BR &,`Q000000@T  0`2 @TVph000p 0!660p M-LM0 00@K, @ K ,@00 K6pǏ8  r 8 R,0Po `80U00S <8X 0!@@W Y 8\B $ 0`RP 04S:R 0S* @ 00CS4X*4X*Z*Z*`X*4X*00SQ7*,0S00S2S2 02# 0,!6o/@ K@:XW@0K,)`U0@K0@K0@PK,)P0,P0 @0K&0p?@PX0 WE,06pǏ0K,P0W@#&: DFɯ#oZQ8 NYK8 H(D44 -L$M0@a p W`P8 ,p 1s@:Pp` W80,S  )P@ 2! 0W  8 02A,  , 0%& < %0@S 0< ^0  P-P@ 2"A0 2"T 3P<01 \ p`P 1S @:Pp` W W 0 %&:40   $)P@0  !L!0Q & @@@u-@T= 2 02Q0 0@S 04$P)2@02 A =P0 2  4 `=202}.0{' 4P40 130484 p-LM@`P 0!6V00W.0  @T  p - LPh'= -d0L@pT`  PU,0@T] -L@@\p`#(^$PP 1Q  Q R \P^Z0P P U 0!R00R0SP UP 0-L MP@0K K/@@ @ @@mP0  S /< 2I02:(0 000]] -L MŸA p, WP@` T2W L2W UV   ,0p @ PjVqPU 0ZV PUSQ@ R0`0D HPU 0Z PU1 00PP 0PP0PS 0  0$0`$U ,1,!@P"@dDFA 02 S1b1 R0``00` (-`U  0 00 000&0H0< 0$[]##](_HF5L_P_ش_]D4000 -LM`\ 06 $ R$0$0$0  !0 @P@dDFA 02 Spl1b1 R0``00`hG%0L0P4]L_P_ش_M0Ѝ -LM4, 00 (pb ,00!` 0`P14 1 00<0 p ^8p p0#20#W@@ T @:0Pp`WZ ! 0 0r4,  08|  < p& 08 0 P Z l 0 0KH04 P 0 []_\4 0-LMP# P0 4 U 0 0t 0 0hd@ 40 U 0   00Mꘚ_h4 -L⠣M0p00 0RP,0 t0,0! 0!@T 00ST "!  "000\ U 0 "0#U` 0    0R0`00 0 `X "KC "2 2,0S&V U  0Hc$P000 0  F:0 0d+V U 0 V U 0 000D$"U 0  ~` 0```)P@ U 0 000  ':, cU 0 n0H00/U@50,4! 4!'`_t444 -LMϟ@ϟ R   *0 P0@ < D 0 > DKP* 0@8P0 S*80! D0P  4S R0 0 0  (0S  .0 DKΟ000( LQ00YPd.0  R`@pP @ $0 0l ` #6P`1`!0CS00L0p0 Y  KH a 0 &0@P0S Q P@T3 D0 KP0 K1) @TZ0.P00S  0S 0,^00S0 5 0@000̀ ,0 0K@40 b 000P0@ `K 0 0 0S  P@ P1sS@TZD0 R 0 aDK P@ P00 0R 0 P P  0S U 0SDx000 R  04 D0 Œ0@IP +80 %:p h0R  P. \ $*8@0 D0 $202sdʟ@101*P` 0Q( ^VV)*80 V h0p R0 00 000$ 2 A020@ 0Hc0*00C0~ 0(P  $P 000C000@ 2022"0A 2"`H(80 |j TG P`  ` 004 ``@T! 4x0,0! 0!Vȟ0 10140  00S    PD00 4 Œ@0eP 2 C0280 ;P7p h0R,!2\ #2 C028@0 D0!2,#2  0!6[ 0````'P " #2H0222020 @ (P0 ( z!2202|#80 şp000b!P` @| 0@@' Q00V@@T( p 2K# 20280 V 4Dp h0R 0x00dtğ 000!pH 10 1 4101b#022@ 02#0@ 0 cH0 Us ,4104180Ex#00000 P0K ,4 @0 0a0000P0 0 0K P@ P 0"280  840 S000 0  0Y0P00 @%ST~22  0000 $" 202u 0@ 0HcP T@80 T0 I h"L0 00040 D04 0Q 00!202, @0p  K0DK P@tY 1S0K1T0K1  aP 00S2! D0#F5pF54444444P_`_`"000D0 00RD4 \ 00gY PUPPUPv 00v , a@P 0PY fpU@T 200S2S!h!0 |!80 t ~1D@KPU @ L0R:P0R:PUmU  P Q-Lp@`: 0~PPJT: T    -LMHp0@P`  0 iꘚ_ -L M, K@ P F TP8*0K uP; , $0U %, %D0S/ 00 "Q4pK` @/1l1 0^:0A^`:?0sd c!401P Z U:W0b0 0 :4F5`4 -LM0 P 0 X` @㌡p`?  ~ P$ 0$  cR 540 X(@ 0 (0 @% 0 00U X 0 0  0 p 0 0d P000 `y 0 ꘚ_(3" -`LMPΌ@pTn@@0 `0 ,@0 P 0T0Q00S 00X$ 08V@3F5_F5 Z_P]- ^  0>0>0 S   -L MRP,A`  |*00΄S ID B 0o0 09F5L4 p-LM@ ,Q,00`0,0*z*'0,1pF50 00@- @58 0  0 @2(  0P 6@` p-LM@ ,0$ ph, ,0*0PU 10`S ,004,0u( P000pR9F5`p4 0-LM@P Q 10S Q\ 0Sl) 0P PS,0 0 1C0S갻_`44_ -0P@LT`p , 00S @TV 0 R@W m!@U0S10S SL0 Q* Qp `0SP갻_"`F5 0-@L ,0P  10S,   L 000,,0* 00h[0h `F5 -|0LM\ d \0+ KKQ>1%D!B 8```4 -LM8 04 S8 p0CP}:wp 0`ZC%Z0>0>0S1#~0Zp<0  40,K P<   X00 P00S 0 X3ZP<@e, T @!8 !< P d0p` @000 `I00  P0000,l 00K l X00 0P<\  $ 0 F5(3_" -1LM ,0 0`p,@p夐PLA P 0M,l^,K 0  n PP@ 0 P00(7```]]]`&a'F54 -LM>\0ǠȠŇ@`P'0 ` p P`P000U 0 0 00 0P(q7 PP 444`4 -0ap #6RL`QP: P@ 2% " ZU:1y"@T  P PU@  0S:P 0S*2 "!6 R" -0a #6RLP Q@: PJ<" T: R p$`QV  @P 0S:Q 0S*" -LM.0 L (0K^ #̌P#@ 0p` @!PC ,1, UL0`pc!  0  @T  ~0 04 SjzZEU`,4sD0 h p0S T&,0 7F54&a` 0.  * -L M0@ࠟ`p P000 `00 P0000 . .,0K  ~0 ,P1  0 ꘚ_(3" -LM>L0‡~(K0p!l0 @ `P `@oPJ<1, WL04 c P` 0P@  4 `!WA00S,,4P `f0 @@@@Th40 44 4 zG%5`'F5444 0-LM΁LL0K! (P@ 0P0`' -LMPNPA@Tp`Ll,K, T0   \$ 0,L`'40 -L`@P T@@0p*y@u  p-LM@Pl `*phc  -`L0S0 !,B$R0 00@T \p\P 0@0 T0,  S(<@0hD`Xn]F5``\*0 x*4 -LM✠圐圀 0RP UP`@pU``  0@00  '0 0``F5`4 -LMP x`xp@0Th `U @ D 0S0 0C 0``X4` -LM@   0@00h `` -LM@p@ X`P0S@ 00   0@꘶_ p-`@LM,P00LP (@DH@@P@T 0@ @@@ps ( 00S0` phg 4` -L M0@Ā`p P000 `\00 P0000 ,0K 0 ,P 0 ꘚ_(3"000 -0L0CS`0LP 0 @P @dDFA 02b SpD 0 S0``00`hL_P_ش_ -LMPU 0S 0 0`0UpU @S 0SK 0S' @0 R 0` 0S0@  0V@@@`vPUPU 0S i0SP0a0S0  0UPR@T@PH 0@T 0S 0S  0R ` 0 /0@S0@  0V@@p`@T 0SP00S0  0UP@T@pP -LpR 0Sc0R` @T` PRd R 0S 0S 0S p0 0Q 0S!@ T0 0R0 0P 0S0@  0U@@@PPU*@ P 0R 00  Sp00S0@  0W@@@pPU R0 0}0Q 0p r0S0@  0W@@p`c@T@P{ZP `R[ R 0SR@Tu 0Sr T 0S  X0 0R0 0P 60S0  0UP'@T%P@` 0 00T Sp00S0`  0W```p@Tx t@0Q 0p 0S0P  0WPPpP@TP` -LM `R 0SPXPU  0SY   @pT p@TPXPU  0S@\PTp 0Spp 0RppU @~@T p-LM`@PP  0@Q : RP T0 0P \PPRpP  0 Q: RP0S 0S0SQ  0PR 0P  R 0P P0 Q0P ,0RP $0 $0cc0S  0R 1P 0R 1 0-LP@@T0 0-L@P(0Z0,PS 0h0 p-LMP@(`,0QV php 0-L00PU t x@T0x0T0 T00H0H \ *@TP(*0@0P]`F5``4 -LM@T0,,h+ x00x@h``` -<0P @000%P0%0 P0000 ,0 40 PP D0V $40S000 y G,$0\f T  ,0R ,00 0R($000T,00p ,04P$ (40404( 4(040 0408R8<0@<0@@DD@PL H   0H@L000 P p0p00 0R0 0 "0 {$ 0Rp%,0U (04SQ ,0 bPK0 P0K P Q40|808 Sx<0<St@0@SpP0DSlD0SiL0S 0Sc0P 0 W!0 ,!40S000 400S$000$0f00 00 !0  z0,L  a,Ȁ00 R*^0 t 0 PP0\ PP 0P00 (3_"F5`X`l``0@- 1@P, \  ^:\ $0S 00000S( \ 0^5:$0 ^%:\ 00\ $0S\0000 0^:x`` -LM @T`pP 0D @P Q0#03QP U ,0U 0S: -LM 0@cB@N@N@ -L4ML0 40 0@\@K@ P*0 P0\h\ , KYP, V,$0 D V* 0P  Q0#03QP D0 ,0R 0S:D4 Z  @PK0@400  D`@pK00K aP(Q, 0S:0$ R:X $0R *0S!* R 0S!$0 S: 0S* R 0S!, %*Q $ 00\*\0 5@pK00K #PR,0 R/*X $@pK0 00K P0D 0S*, , R 0S, %*0S05,0 5:$@pK0 00K PP`Z0J0 0  @  0 Q,0] Q[:D RQ 0SD 5$50 5:J,D 0F ,0RD $0 ( -LMLP`p V `1Wp!V`!, KPdP,0@n 0, R0%0%0 T0,0 A 0S>*$ WW:D0 S`aK40D (00 R?s0 $ d`1 $ L0( cc40 040( 0S0000C0  0V0, 0h V0 ,@ @ 0S:,00U0 $ L0( cc$ H0D0  0$ ,@ 0V0S00 &aF5 P0-L@P L0P40 ( 00S0@CT0($ BH"&d -LMpL`\4`5@P0 0 P  -LMP$ Kp`@P* $ 0S $0S(0SLQW# 0 S p0P 0$$0U @p 000C0$}@PTU0 S 0000C00$ 0$| -L R0ԑ00đ\0 0R010201<0 0R*000000갻_`F5NN -L$M0 0 4 S@P` 0QT, K5P`>,0 $@0\A 0 S:2\7*Z`!>20K0  0 @]P 00 >2Q2^:40`, R ,00C,0,(0,Z ``0K "0 0,0 @p` -L$M`4 :#:S @>0. Q< "&0D P@  H 0@ H?0 KzP @ 8 0,@PL@  1 0<S-*$<0Q*0 Sb 0S_$04 <S1( (0 $Q#0V)0K*)K jVp:00L00 S  0<S: 0H 4D b@L V8 (*80S0)0K 00 Ha,P 0S)KZ )0[ S  )KjpҟV:0 , 000c P ) K @ 阚_ -LM 0  S 0` p @ 30S0@0S0 (PU`p >0~pW  0h:#:S P:SQ:Q:I q   `PS6 4 0 6P 0SR  R ,0( 0C,0  ,  0 @`` 0K !P000 tP q ,0 0R,0 $ 80SS SPS P9 QS@@S- 0   000  : 0K  09PH  10S     0@ |0 P80 J,0( 0C,0 : P,d VʦU_  R  2 0R.* [ )  -LMP`@53 0S0 *"*@S>0N`b@P $*T p  00l 0 x, KP,0$ @D( ` 0 gZ 阚_ -L Mp0*"*0>0>0SpbJZD WB: W@ @0` P000 `00 -P0000 0P ,0K 0 ,PnD 0  0  0 ꘚ_(3" -LM ! ^>0.@  aR0@  OP@ P @@ -LM*"*>0b^@0  P@ P@ -L0 *"*0>0>0S b^ ******* 0 /  0&  0 -LM*"*>0b * 0H ,6S# `p0d,$#&@PQ : 0`\:bP  ` -LM!>0 a 0* FP   -0LS   0 ` P P # -L  -L$M00 R0, P4 8 0@000S ,0>0>000  #20#0 Y030"8S8 p`004$&0! 08 0, <  P@<^0Q: 㼂`p0 @000"`A00t P000@/ D2 H)&R R ,46S @ ,  !0 ,0 0P@,p!0 i\ 0 80S 0@ /T 0 < $<\ Thf 80S   |0@ 0 -P 4 00 T|0 0 , :#:S 0!_(3"` -LMth0!F@`PAp`|@T 0 S @Tp 0S0S`2S,2 R 000  0 " "00C02 0 R l0 000 202  B 00 0202 R  0`<`D`L`2-0C22HSD000   202  B <`` -LM2@ P0 00  202  B 2 0h0h0   @@2402   偻" @002`<`D`L`2 03 R 0+ 000 202  B 2S2 R00|00 0h 00  0<02 0   R  0D``<`L`202ܽ20230@-04 "QP h@?!l!0 ^:0A^P 01:?01c10@F5` -LM , 0 "X00 ZY"0@0ŸT0d0l h`x ^ `Y0  a0<"6AB4  8 z0YCQ< <0 b40Zi8 1P0@8 04j Xf4 "*p@0&04`  8pj0>00 00>0 0 0P  P00( ,0d 0 @\00`T@@0DPXL@L  00 0 c84`<`F58_ 4`B}8_`8_l`F5 4 4 -PL R: 00B 0 0 P ]` 4 -LM,a> 0R^PA0 pW 0gS*D@`0S:>0 N@ T *$PK0S J $ T:r|)Ph5*DD@0>0>0 0F58_8_$ 4`&aP 4t 4 -LMℒ0SP&J1l `!db@0SP> 0p`S@`0A8 PNLZ0S J1` @ 0R:P@DLZ60 0 R    R  B1PP @P0UT 0R( 0R0S*0B60 0 B0CR0  R  B0PP @P0U 0R*60 0 0R0  R  B@0PP @P0UF5`` 4 4 0-LP@KP@ T0 -LM,  \00 4 W 40SbX%Q*!p WN `Vx!0S`VT!0VZ: R`4A (A0!X:`V!0P0fUq څ1eAD PEU @, Z 00  00O0 0040t 00Z00 oXTw @P 0<0o4ol(` 44F5``<4t4444 -1LM0`V!` 0C`V XXA1d1>0 `piPPN `V!`0V0`0H V, `Ph0d-Q^& Q 0 0 00 0 0h `0! 1 h `01 0h` !60!^` V,j<0W ,0 ooF5``F58_$4 - LM 0\ , 0` @,pP 000 p8 00\,($0$doF5d4`444`4 -LM0K` C <04 R8 @0R D0R"X 00S, 0 Q00S(0QP 22L Q x2 Q 4Rp pVz V0 0!PUd R0000 0   B 2 $00C$0Z 2 00 008 08 04"0KY 0 "0I "P2 Z 280Q2ڹX! 0h `@#60@$~  0Pu  0P " "000徒1PUV`yL0!PU0QUQg`d`_` _4 -LM`@Pp+T( 2<02@ 0h #6`@0@$P&P  0` P 0` " "000 0h`#60% R 0 0 00 0   R 000 0 0 " "00C0"0 0"` -2L @0P U0Dr2 0h"6`0& R 0 0 00 0   R 000 0 0U " "00C0"0 0" 2a |aR 0p10  0 " "00C02 0: R $12 000 202  B 2S02 00C 02<20P0000@0@20$ 0R0l0 D h R @0U p 2p 0 2``<`D`F5L` -`LMVp At00TPPU `V2  "  0S 0$"12 -XaXqLz0$ R0D0 2@ TPR1D@hg R0000 0   B YUP 2<2O0 0S0@@@ 0$ 0 0$ ?\0 R 700S0@@@P 0 00 ``H_ p-L M K0 "Q `KP @/1l1 0^:0A^P :?0s8 c! 01pV0b0 0&aF5` p-L MP`@ 5@@@t0l l0@@X0X ET`@@1@0STp`F5,`$`0`8_8_F5 -LMp0 0 4 00 P0,P Ǡ,K 0 Pj\`0 젟 @L T 0  @@\x0  , X,@ 0P4D 04 4 00P叮jVJ0 ,,`48_8__`4$`0` -`!L M0P0 I @@04`p P000!`00 <P000000 ,0K 0S 0 00 ᫰,PtеwL 0 0000@@,@ 8_,`_(3"0`&a8_ -L U00R0S 0̠ W0U0V00S 2T 0  TV U0P0UA  V n 0!6 P0 U00R0S  0 0v  0 0 -`0@LTpPP P W* 2$"  2 02㢲10@T0 $C02 簲砲!202%2  0 p   0!6 000 X0 0,A0 0 0'+` -LM800CV!   bp ` 4Z00@#:0#T7H@T 0Z0!02 02 @TrX 00 \P Р~2@ Z00S ;+!2022@02H@T _$P,)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+ -LM`G`@`0L pQPP H\P 00Ch10 Q`_$4`5pp 0@-d@0/C2b,S03S0#S<0<<0bQ/BR@ H@0`VUUU -0LM @`PL  `Pp@ 0Gp101e 0V`0 p @ ?CSD00D SD0\ ,0,R0Sꘚ_``D4VUUU` -䐟LMp 0`S' PS00U 008 0B6C0@`XTP,0XH`8(,J 0```d`x`@3 -LM pW     ? W̠ b @0@0S0  S  R P U ' pWK 10 1 @0="0Q/S 00 0C002"$10$1 01001 @pTR 20p00p0C1 0R1000@ 0S04ʾ0  h p0S 0 l h0R 0020X00 \ P0S P0KU q 0 0 PPP Xd| Wx \0KQ0  @h(41X0P41 0P@ ` K0K0PXPP@P > Wp  402"  Q  m*  Rg 2d0 `0K$ T  T.+20208! W8!  2  0aq h0K @0 0@0!6 k K P 202 @@ TM K 0 !6D 0 P  ' 0!6.0P PM@ @@ 2(10(1>,10,1#` -8RL101s@s@0T1A d0SsqP1d0Sf@D 0 ^pc@dlh0PN 1@T ZW ڸ X@ ZW"0S00 0C00"`Zھ" 0 P  W2<1pG0<1 0!6 2P 2J02 J `2"02p T00R00 S n8,P101Gz`L`<`D` - Y3 LM>A0 0 %QQ:34 (0  0aS < 8 00`VԢ'PQ B/ 1b10 ^:0A^P:?Pu &Q` TB?!l!0 ^:0A^` 01:?0S p,1c(f1P12" Q4 0*R0#  R <P, P\ , 4pABPZ2#40,!0Q!0000 00C0" $00C$0" rppp" 000 PP,00S ,0 8 l0 < RP@0RD 0S@48,KP0lP,0 e`F5``d` -LMp@T' P`Q0000 0002000@0$ 0R@0$0 D @Ti``F5 -@0LM@T 0( T  @F5P4 p-K0C+㒍P@A fT1`|$qP@]0SEBKAG>KA0C+fP9 1` Y( PU! WpG 4 O#J6; 0ъP@An0$ɊP`@(DTU WpG Y$@<0@d 4 ꠚ_`h]44_448_` -L|Mܒ@0XpP 0 0ᫎP@80S S @0X 0 0᪎%$ P2!b10S pP 0OP$K8 4#RZ 0`E` 0 VP @QCN@ 0 ! 0P C@\0PP@ 0R50X @00@0 0D!000dh00h0 !T0H0 $4>0CFT0 0P`d  t0 uP 0K 0JP@qp KT$;H PP@cT0 PP$Lv_Q]F54`_484X4t44 p-LM0@( +($00P,P(0; ([P` 0 00p@80S$ p0@ P0  ׍t$h00bh0@AP gL0(,$0^0\p@ _`8_4 -L M @ 6@B"K+ -L M@ 0@2"K+ -LMT0O$K4#&:P[Pp ($@ĐPb0O&#J86$[\d \@@_wTPi阏0 0+400 @,_i 4 -L$M8 @< `8@ @ 00  <_8 億 <0$SH H@0夛D 8L$@D? 4 4K 00K, KP00s 8LD  ? 40`PD"pe]@8>`U< H00 W p@0000^$ P0l$ R': 0S#:06>0. U$ % @0 b$Kp @P$0 0c#& $ a8  e$0 0e#&B4A- p0Q:>a?1 &#l!b0QPop*H00p "F!V: U p -L   2 02ᣢP$20t SY` 2ᜀS  t  Qʚ0pSKtW Y 2ᜀSt P 0R@Kt= G"72 `K@: UpWXKt\ t0S @t0#00tP0P0St`0 tp=00 K @K 0KtP} 0|@Sq:`Rm 0pSi*202eK K Q_0@S[PKtP2K02@:`p\HPD p-LM P 0R 0Rp@8 @0`<P` P0Sp(4 -LM -LM@8 000 p S0`P40 1 s @:Pp` W400S\P,  W 0 040 2! "0,00 1p P`P 1S @:Pp` W0W 0   &\0  ,  0!,0 @1\ B,s\, # \ ,K 0P@,0"@ ",,01,2202, ,L4T4 -L4M@00# T p` Ẁ"0 @X0 0S 0S RT P00SX 0X 0R0t T 0 SX0pP0 0 0S*pe0嬡@@0K`P KH  4 Lp D 0 8p , `PI 0S>0HK 0 0P@/ U8 W00W00SbP R00Q0#02SXT0 0C0 S UX0 a) 0HK 0 Ẅ <PP TfX `4_ p-LM0 PU@ p0 S@`@0P0@0 ͅ  岃 ꘚ_ -L M0 p` 0S 0S0000P p-L M4a0P $߿ 1 @0T0 U+ T0S( (@T@T 01 P0S <0@T0 ph鶿0  (Q,0,0, 0<0000S @0 0@0000S0@ꘚ_`8_8_0S@-+@,  0 000@l4F5F5 RQ-L 0P0000 P 00S0004 RQ-L P P 00S00000S4 -L@M\TK K < 4 <#:0K [0*":("0004 0-PLMU^ KK @<4 Ġ<̌,ʠ#:0KK@ P 0[S*0":(0"$000`4 -LMT2@P H2R@p 3S,0S00S}40Sz80Sw 0  QV 0`Sh0Sg 0  0P\ 0R,0  0S0sJ 0SI R 0S0S0S ȺP5 02,\ ,48 <#R: xP, 00SP @0  0,\,, P , #010く/a_` -LM0@,0 P00 4 80  0  8 h0 2 "` 2"`tV;40S/ `@hT@D!ڰ00C0PP*` 48<#x\ |,,08P s%4\400040  1h0` -0`` h40S) `@fT@Dڰ000P:P` 48<#xs\ ,,08P4\40`4 f0` 0` hP ` d;5h;5\;5`;5` -L0M∢ 0 ( L H SP`0S/50S 0S 0S0s ,0S00S40s{ DKD`K<@KH0K >Pk H0, ,pLKVP L0S10L0 (0 S h(H0S<0H0 H,0sS$[ 00S40S80S0 0@@P0,0S 00S 40S80SQ  l0` x0cl R;+<4< 4l :0 l 1ꠚ_$4I] -L4Mß Ƞ, 0(,Y`P\0 "P 0S PŸ,0 S ,8 R 0S0S0S R P0s ^ HK ID0YRX T0 Ÿ@KY2\\ 1@ 0TL0 h0p W@X YR,0S00S 40S80SH0S 40G 0T00\00S @0S l0:0\/  %P@0S X 3S@0S<0S80S40S ,@K PZ 3 SP0\ 0RP0 L,@K PT P(HKsꠚ_4434'TK]H3 p-LM`P@ P00P3,@0 9p p-LM`P@ P00P3@0 p -LLM☁0\PKp`@K|A$0 ` a^8KX@TKD@0`KP ?@K[@K@PKP\PKXP@3W `\ $0S $ 0W` 800C80` 80S080``\ @V 0S0C 0 0` 0 0@`0 4W0,  $@Gꠚ_383D4X4\4d4 0-@L4PP 40 <0$wU800C800 p-0LM@PT` 0 PPUʜ@TU pP 40 <0$ 800C80phEaPx0 Rl0 P P 0S P0S 00S7585Q@- 0`SP*0SP:P *0SB  RP *R 0S2 P*0SP: -LMᐈ@ppT, P` `8T VX P8T D8T 88T48 T (8T$8 8T*8T8 T 8T 7T 7T7T*7T 7T7 T Q 0Sl 7TB7T<*7T .|7T" l7T{ p7T d7T uD7T V 0S-,0 S $, d0lY PpZP; K`P ` 84K40[S/ Kd@KxK 1P 0 1\@0[d 0@0K@["tp0  K@ KT0 P bP 0S \00\0dK KbPpQd5T T5T4` (K`Pm ` K0[ pS (K@K K  1 0 1\KbPp 0P WY c\00CS\0`4T? !T4T L4T8 r 10aR001#0p 10bP001#000|3T 3TV @1.sjVy @1 qP#0000q4#0000L|g!3R/W2TO 2TZ1Z2T 2T2T |2TW Z p d2  R): p @2  R*0S $ 00SP 4#$0$  R 4R00$"48<#P g1T X1\1^d1Tt1T*81Vd1T T:X10SPW  0\n$1T3e kOaWu 0T0 T 0T0T*00T 00Fꠚ_ku$juPliHLi0UiViii`ei@gi`di@fi@ii"i !i i ixFixi %i i 44Ri Ii Qi Si Ti `_i Gi Mi >i4Ni0WiHPi Oi Ji(Ki -\9LAM`VP0p, P 1  4 -0S S/cH0S U8 Q1 HPTP,蜠K D 0[S -0S h@ 0 SRh8 RU5 H0S |0SH|0[S\ q'0000q'00 00 0@P  =d00d 7@ 0 0Y0  p7 ,0S h,maP0004S Y VP d0 (ZKo4$#Ġ0Č6xK7K4p0 0K0K0 .Kl 倀KlKt0 P 0FS0 000$1 0dKG\K0HKc0KdK>@Ɵ.D@KD0HKCKHKG0KmP@  9P 80S0C80Ų@T 80S0C80Œ0 .K00 OP@ 00S 00$10h5 H0K_ P[ 4} DşHK4P@7  P 80S0C80@@T( 80S0C80 .K P 0S0 00$10Pp4 R(6 c 0  `iGOK@H0K1 d0K1 (4(  0  P  Q .KP 0S0 00$103 R *  0|0i@K@~T3(0 H0K0 d0K 0 P  U I2 R  0 Y hK P 000 ` P0 82 R 0L xPp 1 R0 1 0 e ^RUS  PPP7 00( 0 )0 X1(  4 p0`00|00 RP 0S  0SP00 0PR X 0 R 0 R 0[S0[0S[Q4#$0$)K$"48<#Q $Sꠚ_L]`_433__3$4`444a,4p4 p-LM@ PX0 `0S R Q000 Rph P0`00 0 0 `4 p-LM@Pt R0000 0P @`U00 0S S @0S SS000S0@ R \00C\0 0@ 0 2` 0S0C 0 ph7  aa4@4 0- LQP 0 @R T0h? d -LMM$0YZ,0 0P X1  4Q x4Q -`4 ,0S X,0S^0S[F/0SSV0SSRQO3XS O3X0P p@/`Kx  ( K$U00  3  R0TK\0KhP 0@ X< !xK U0h0  d  P` 0@QP@0pS0S 12XKOKv0)v2Xq  SK 0T1 `V OK0 S `VT\ T< PU p ` 0S0C 0 00 R 0PV PpP#0ST PU p ` 0S0C 0 00 0@0S00PVPpP4:_4@-|0\ 0S \ Q @ 0 0R 0 0^@0 04:_ p-LMp`@PT 0S @T 6@0 0P0 S00@@ p4:_ -p0LM@T 0S @T P P R0600 ht4:_ -LIMp`0,0 00 P 0SvP,6 ͵P`g 0 0 PU 0SPU6B 100,0 S ,U0SU P 0 0 0R 0OK`0`0[MK@0K<0A1T (K 000S`A U R0600 0S0C 0 CS/K 5700SP` V OP 00 0 `ꠚ_41i -LJMp0P 0  0`0CS 0  0S -RALQBp`L PUe 0 S\D@ @\P0 S ꠚ_d34H4 -L M`0 X, 0 2PU8 O@KT1 PU0 R) 0 P@ 0X0Ÿ,Ÿ 0 0>> Y 0 0>>P@ 0 0 0>P@ 01 @T p0S @T00 R YDJ P?J8 $1 R 0 0 \ P00Q00Si"QPW,p 0@ 000, PʿP, p0bSʳX0 0 R PZ60_\`DaI]\4 -LMw, @pT`P 0S$ @TW  @T 0 R @TU0 0 R`0 h0 RP6,0SW y  Pp0I] -LM@  @0T0  0 R @T0K Q$H0SA  AR 0 RQ R\0400SL LS:00S S* S00S S:00S S* P_G] 0- LP   @   @0 -LM@@ | y hu -LpMpxPK0@X 0 Kx0 p`KL;L 0 00   00#0 Q  i頚___4 p-LM P\ 0S \pQ  R H00G\`@\ \Z %P QP ;PTT@ P , P T# T 00#0  p  nP00 0  00  0 00   #PT0S 000   P GPT@#G]$G] -LM@pPvPT T oPD P1@T T dP, @T+Pa0S 0S 0 @ ` PpP@ P`p I0 h`0S h 0 @`0S 0 < `0S   _L]44484d44 -LM\`0@KP x(0  4$#000K 2 8K4 KK |0 h qPPK< @0 X0KWK,@ < 0@ JPF@,P 40 000K`Da @K@KKKK 1 !0 1\ڴ0[00K [ K  qVP (0 S ( VP/P t0 R0 TC KP ,0 R  4ꠚ_34L]4$4 -L|MPK0`x@ p$0  uLKhKK8@0 @P 0KKT0KSKp0KoK,P (P 8@ P $0S D$80 0\0ꠚ_833<4L]T4 -LM⸁QR Q$ p`]\ 0 l R .R Q 0ll RL .RJ Q?QDKPK [   [000[S  A0BS 000S |@KX\IK I [PKIIK00l0 0 $"4 4  0 $0 S $lꠚ_4 p-LMXQH 0R@0 ` K5R= L0 S*$1 R  0S pI48J0 R   0 R ]P\,KhPP  H+P'0/S9S0BSꠚ_L]444G]3<=4 -L(MĢ0p(0 Y%? PU 0` RP U PU `0S4 VPDPK|?0Ÿ.D ᛷP @P H  0$( 0 "48<#8f L)H0@\ 1 x 0@Z0S(00R8Q8 R*H8pW  048< S  8pW0<0 8 Rt0Sf*0H00 PPp\ H(T pp 048<@x 0  @k( g0@0D@0 0$L@ 00L@0 @  0L40`(0QD0 |@ D0 0Sp@ R@T 0 00SKZ @@$ PP  $ 048<00 <$ 0\0  0@4<2DL   800,0#2P,6  0R0P00S@T  0S@T Q  0cPT  0cP000D ` VD @ 0S0@T 0"R@080 T8P 0S P0SuZ @0`C0(0C8#88#$(," @"(  ( 8 0VJ* 80 0 B0 8$YD 00b$0ǩ00C080! S P 0P U8 #H0@\ 1 0@804 `<ß008 PP 8"Ÿ0D 0b0~"00C0H R 1 0@Ÿ@08 㯹XŸ00媹h㧹8"00墹H㟹00LR R:0`P?@ @PE( 0 0@8 @ D 0SLh>0S( *P'WZ'08 HQ 1 0@80zHP100  0ӵ ZP E,0K8 P<080  , 0R0% *0<:_8:_t`X:_I]p`$`I]l``|`3 -PLUp `2X !@@W( S0 㠨Z P$4D 00b0哨 00C0p`l`0 0   00 80<808 8<<80808 < -LM㶸㲸0aS008PU U p00C08P<0 R% Up 0R`<0S P<@0 z 0XR<0S~00z ow 0@<bX:_$``l`I]` -造Lc0S ^`P00Y80S Hp`80@@80SI00mDX:_$`|` -L(3(0$ 0 0J] J]DJ]PJ]Q0-4 $Q Q(0 `0P@ 0R++++ + 0@000 0Q QX0RH0 R@0RP0R00 R80 0-pP@LP 0S P  P @0 S00 0@J] 4 -$L M0p`@A P0`P 0'S1@ 0S 0S 0S0S0S 0S (0K  #) &P,0:S @0 40 P0MS1z  80S $00cj 0 XT 10000 00SV:XJ p4   R9 R/  R' R < 4( <"4)<(#,(` ## 0P `@0P`(` 00S00000S 00S0 0 0 00S1 Rt]/K00S: 00 B00 0  0h0h$0C0CMc$u1P@  0R0% :P 0 SR0Q0P@ 00K P 0 0R0% * V UV (4P t`L] 4`|``3 -L$M4 0 4 p0Qg ! 0@00X80 % 0 S8 %@ ` :V :0 0< tPP0\,!!- 0 @0S {ʀS S eS) < R00<0  <0P40K 88 @00 0S0}0P 1   0 @<0SL+|++++0< ;P@ 00S 1 0@0 < 0000 S S0P 1 (  0 @<\ \< R0 00P 1  0 @<\ \00t0 00S 1 0  0 @00cS=ʂS000S 1 @0@<\V X&S 00S 1 x  0 @0(0P 1;01 0 800S1 p 8^000S 1  0 @X000S 1 8  0 @< RA(0<0PPc 1 0@ S_*c<@D[ZO !!V'$@ 1(01L01<@1=)01 1< 0 18 L@ 00 0g 0 0@GP0~ Z0  ƟA.L` BP`0@ `0Pl<0000 S$ ʇSf DS! S000S 1 h  0 @< R'XS%0<0WP  u0 <8000S 1 `  0 @<\X3`%0 07P  ?T0 ?000S 1 P  0 @< RtX$0<0P  E30 E000S 1 X  0 @<0SSXT$00P  <0 <S 0CS 40S X X#00P Z ß `LP`0@ (` < RA<@H"9Z 0011300# 101*$00<0Z000 0 1< p 0g ̐  80 S- p32( 8 Y b ^04\ W0 @1P=)010P 0$004 s0 (0P$00 p00g4C<0S<0SXO000S 1 H  0 @<\X1X!0 05P  JDR0 ED1 R$!0`P0@0S 1  0@08 % 00P@ &,0K wP`0  , 0R0%` *P `P@Yt`L]!4`ʚ;`P_4_`0J]__`8!4`3 -LM/R, 0 p^ 00 S0% I:X 0 ` P0 3V <+V V2 0R0% :P 3V0000`QQ@0 4 ,0S , 0K Pp  0R0% * 0 S0% :X dK0\ d0Kc K\@Kl  dK0L -PS@@KHKԻ0 H0KGK< HK 00 P@: 048 <:R0D0 00 H K\p 倠 |P p x 儀 h`K ,3 (3!10S dK K0 $(,<4<!4"< K0 l 2 Rz f\@K   0K0 pPpr  00R0% k*,Vc 0@S0% :P9 0!4 R`P Q 0KKPp  0R0% *_ 0R0%@ /:T 0 0Ra% 0S" 0S0% :P 00020C0 `P 0KPp  0R0% *+ 0KPp@  0R0%@ *<V0K0 Pp  00R0% *$0P@ \ 렚_`X!4\`,G]L]l!43 -L M@0(  $( ,<4<,4"|P@U110SPHDPK㪺0 C0KD K<`K0SG E P, 40" L0P0SS<1 R L0R:1  R' L0R$*W*0P@ PpP 80S0C80ڔ0@T @T (0S `(C L0W00S0$" Kꠚ_DJ]HJ]LJ]$`@J]!4 -&LDM0PTP ,0 0S80\0 `P dP @p` :Y  HK@h@ )0@K hG0KHK卾HKٙP@0[S  U 5 ,0S ,?0[0S 00f@CZ #++ , ,0ST 0S  SZ T @0Kl @ [R R h@K H0KPd0 Z Z Z 񟗲++++<0\0 ܰ@P԰UX !!ϰ|$` 1$@01Ű01`1`=)01`@ ``\ @R R㫰@$ᣰ$ R 1 0+10 ,`(`SKpA @a0@RSD0SA La0LRS00L S:WA @a0@RS `A@0@ \-P+^pG`PP@W Y @*0.S@,0U* T:0 0, S*00S0C00  00 S000C00 00c 0X  0 0 `p  5q׮@\$Ϯ$ R 1 0 +10 ,(<81>P_4_(_ -QLMP`pd V00UPT0 SRJ00SSFPES`FLSH0SBj0S>0S:0 S6?Q3 ?R0Q0E\) R0FP$ Q$ @R" Q 00S00S ᏷P0pi0\0jS\ 0jSg qP -L Mp, 0p  4p 0SAR0 > 0`V @ T 0 R @T40S` pV,0 `Y0P P P  0   P  000P P040 _ -LPRM40 020 pP 0$< 0 W8 `x U @T 0 R @TWPU0X0`P`80#2   X0#00 PK EP<  0 <  4 R- R0' 0R0"00c,$,!$#,,  ,K  00S 48 A 4 8 100S00,0 08 04<#$ 0P<0 <  <0 _`_ -|#L4M0Pp,0 Pp 0R0% :Z- HK10 H0KG K0c HKT0 @T: h0 A@TW2 h 20S'F @HKLP0 `PPP |2 ,0S t,@Lh@0S  PK 0 2P@ r0:S,0S00S40S80S , P0S 0S$0S(0S T PQ 0"0 # W (!0,PX  h 00S!X @P0LHKX P XPP0P0 pi@L@0S  PK X0W L0K u PP7 L 0R0% 0*]렚_#a? !4`ʚ;3 -$(LM0'Q,0   (\ 00S:p:00(L00 (( 0@℠K 0 姹 ᣹K0P` K`KPK嘹 K 0K@KpK`KPK   0 _6@T 0  >P0 @T0[Sp RE  c` 0: 0000@S1\6   0:( @@ 401K<1 0P Q 1 0@Q 1 0C0@\ 񟗗P,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,D,\,t,,,,,,,0S 1 0@\ 3 ,0S ,0S1  0@0S10S10S10S10S10S10S1 0S1B0S10S10S10S10S 1t@K 㭳KK0  tP 80S0C80 R01 R|K.0 70[0S1@  TȠ }0P+^TPK(@L0(  00@S*PL ( ˷@0 R 4@40(0@ꠚ_aI]!4L]!4 "4@"4& -LM@P`p @0 \:_p"4 -&LAM0p,0 `@0PK ㉷Z - H6 R<6 R 0R0%P r:Uh  KrK n0[ST 0[SH 0[S 5 Rş@0 5 ,0S ,žKzx 0[0S0S <5 R Kh0 ,H@K0@K KG0KHK%P` 0P 0S 4 R80S0C80ŲOK KKV @K ̲P80S0C80ž0[`S 0[@S KK 㹲P00  3 R K KK*NK(H( ~''Pz!R0 ! 僑Q I0 00 S T3 Ra KK@ KKI0PI 0PP !@! 0K@- !R3삟! 啪20SPBdPK@K&`K"0KxK c0KdK0K0KKK\KK {KK wFK !0@P@KKK0 0KKah |嘥1 R K KK 0[0S@@RT1 R K KKdx= 1 R aK@ KKx 0 0 R K KKj0[0S4#$0$.K0[0S4#$0$-K0P@ E?K P p P  0R0%P |*L{렚_I]J]L]T`"4"4"4 #4t#4#4PJ]TJ]&,$4@$4|$4$4`3 -&L4M0 P`,0 C6 R VU 40 <Y 0H@KP0 NP 0 @KG0KHK崵  P 000 )Ph P 0Sd  Pp]>@6XR 011%202+$0 0!ppp p"@`$$Q 1+ 010 (p,p<81 p0p0c,  80S00 0 b I0 R,# 0000RT : KP 0 0R 40 0 SL  0L0 p`0@0: 00 @ @@-  )(v0(0@@@@@40 L0S 0 P @ L  'P(` I0g 0@T0 R4 |30 S T  Q@a@ 0DS:?>0R@}!0 0 g 000 zPUhP 0Sl P 0Sa 0SW 0SM !@( B("("48<##80@@ 0:4( ? 40 0@@LP Y 1 0@Y 1`P 0@ 0@1P@ t1 ,0S ,00S000 00S0 0 000S000 00S0 0 0a$ mbAi00ST\R 0SO 1 0( I *C`gBXU P000 L0 1L@00S L ꠚ_`I]P_4_(_`%4 -LM`@PT :Rp/U U S*` T  \(`P Q` `S*`0S`  @`0T0U00S# - 0L 學P,J]_ p-L M@ᏢPP 40`00 @K@R0SL LP808 PpآpբpDJ]T&, - LMR 40 S L00P00 0 %4 - LMR 40 S 0 0 H%4 p-L MQPPP 0@S0 `ph,P 0<PKp*p 0 phKp\J]t` -LM@00K p" 0@ 00 "@0P ,` U0@K!!  0K  ?@0@K ܯ p0 -LM`5WJ41W0@!0c48+W0!0c4<%W0 0c4 DW0 0c4 D@!390Q 00R D WpZP, @0PP A0 R ~p0H, 00 S0 L 0C # 0 0 R Yp@ꫪ`_ -LM, 0PR* L0QڂV, 0S*@Dp`@40x ư@T4<@0 ,0H 4 800 _,`_J] -LK] -LM P4 @ dB!2b2c621b1c00Sڜ0P*0 R 04P:l0l  >"h\ dB!2b2c621b1c1\ 0,G]\`I]PK]ax%4 -4@LM㐭 0h#aм,5 p-X`LMP㍤@T 0 S00 00C0T pa - LM(080 0 4 !  0 S܋'=Ћ'=P@ 0S ! 0@4`P0@ 'R`00`S L+0@0S1   0@4 ! 0@@T  R0S 0S$0S *0@0S 1 Q 0S0s R0S 0s Q 0S0S0S? R0S 0S$0S4 0$  R' R  R R R R R R 4 \ \p Hy0S 40ZP 9P@ 80S0C80H00㔬0 0嵟Q 400S 8 R  04,0 PU 4, (0AS:(Q 0S a(40Sb Y\ `0S 0S0sN 0S0S 0sE ǟ0@Z 1 @ 0@7@U wgHL0 S4K8K @T480\ Tǟ011 ,7PP0@0S1 0 @04 & 6 RY ` P4 |Ɵ@04  ,04 (00yD&0@,K0K4 K80KP4` 04%,0S"%0@0S 1 8 0@40S 1  0@4 0 0)S0(P 00Ps" 5 R5P@ <0K( P4  < 0R0% *$40@0S1 8 H<0H R@04 1910 @4 R; @ 00  カP3P@ 0S 1 0@40 P 0SPT3 R X`Pp@ 0@0S 1 8 0@0SP@ T  9P@T400SAvP04 C 40h00S+ !48<#,#80 4 00S 00S !48<#,#8 0 4 00S00S 04 d1P@ 00S 00S 04 00S 46(pP4 V!0@Wc 1  0@0*0Sl> @ 0T  # 0@04S1#=#= `W\```aaaaI]`I],G]\`<aL]`d``L]%4a `l`_3 -L MPp 0)S0`(4P 0 0A( Q0%(":P `@D 02P`P @0 00K( PP 0 0R0% *,0K( PP , 0R0% *d`3 -RL M`p40 @0S SP V g* }pP P`eV@1P@ SN SVZAP 0/0K 00(<4<"4!<^00 S: 00g0 @P,0  00g0 @P,0  0g0 @P*0  0g+0 V R*Kӭ"[P"48<4 #8V0Pˆʎl`` -0L0@Sp S FS S 0@ 0S 1  .0 m @0`P``0` -LMh@, P{l 0 RM 1 0(@3T CT +T'  PP0 p3T0000aa 0V#3T T +T  )0P@,0 S ,尴<T 1P@ <T (YPP  00Q  )0s0ShDK )0D dPhh@`K @ [R R Y 0S )00 GPhhf?0[0S03K?0[0S )00PhhMꠚ_%4d` -LM$0K@ p3T#0[#0[00aaZ@d;PRU 01M_0P 00>_ 0-0LS-P 0 :R 0Qt0*@hT0T0PLD0DD @w80,/"AuL]xaL]x"a>_>_pi,5 -LIM‑0,0 ݚpaP0S\q01e1 @T 08MK> 0 8#XR 㯣1@@@opaV PU @Y8`TP`8YVpWڐ㌣0 0@ @@咚 ,0S X,_K;L8S/Kꠚ_ L]a3>_>_xa"L]L]L]h&42i p-LMP0 R@!K*` 1l1 KR! 01K![R:xxP 0S\p Q R 0S RQ[ L]ax"axa -LJMⰡ 0?R`(0 301b!QQ0+PX l1 PT`1 qWO 01 DAD1 R 8q 0 $,p4@p0 0S00‘(0 S (Į 庨 404 4S-ܙ@Kp0 $K dR/KʙXꠚ_a7585"L]$a L]|&4Da&431i -LJM q01b`AR( P3*0S0 㡙0 \㉢\ 01l1D LR!Ȱ቙(0 S X(VLK@<0 $K R/K( L]_a&432i -L$M` 0  $0#0#(,0#0 0#0#0#0Q@0 U   k0S$$  PUZ 60 #<#<0*ğ@0  0  @0#0#$0#(,0#0 0#0#0#S0Z,0    ,P{ ZX=, L3Z   0S$$ 5 Z8 P'  @<c_pi,5xaa -LMs$, 0S000 0|D1g ,0R dğ`Pl 0@,D R 01gt1 R 4 R 1@ ( 0XP`_ 1^  80SY (B`VQ 0 dSF lS00<\#\ QY 0,@S  \(00"(Q00S 0,pS0dS lS r02@ P"0PP 70 @  r007 0'S00pKS$4,0O`@0 0@KP``\@0 d0@K`P``q圑0pS4< 21< 02 01g\!`0S @A0 <8#x\R\< 3 A 1c0 <0$`4S@0 0@KP<`` 0  0  )0,@PU l0P@ 0 ,@PU L]aa>_L]aL]@L]HL]` -LMp`ړ!0IP@? 1l  80Sg (3@T1 1P<U1M xP 0S*P00SL  L S:00S S* 0 RS!0 0 0 ᎓w0SPP U PP 0l0ӠP 0K@ 4K04` /KP^ 0'Sʚ;h>_p>_d>_ -LM Ÿ`@0P`p`H@)`@Va 01;!202501$1  (0 0d!0PL 1A  80S0$ 0bc Q|P`. (00 e  bB!112b3b21c12c!bp0 00@0 P 0 P P 70 @7000c0cpaP_4_$_ʚ;dL]aaL]\L] -L MŸp0@0 04 `cV/VP0P 0R0% P :Ux 0 Sr0S000g P$Ÿ_0^5Ÿ"p 0@R/*1R, 0<A /V800`S*0S 0 00PP 0p1 p1!b100X!u0P 0K 4 ,@ 0? 00@ 00@0;PL 00@@0 0@0  ,0K PP0 s , 0R0%P l* ,@aPa`a L]"L]axL]XaHa3 -LM\pK 0 P , 0 U p `  QmQaQU<QIl0@S @h0S 0@d0S 0@`0(S 0@0fT0S'0`0(@CT00:Z   P ppp 0 `P 00` R Z0 00`  `0 <00l0S Z! 0 0 l  l00lh0S Z 0< 0 h  h00hdP Z 0+ 0 d0d  dP0S  0S0S0S 0Sy @0 ^i 0U0  0S  R  40 0SJ 80S0C80B0 0R  000   x0SR  R> X0<0 X0 400  1Q<1 1 P0@UF 0S=  R: 464S3 8+0@\ 1 X 0@A  L0KR LK\ ,0 S ,嘥LP 80S0C80VLPU 0s00tK^\0K x@K@P t \ ̠t 400   R R  R R  R Rv Rn Rd l RHx0S tt Q5 \,: 04(^ 1 h0@Y<t4(<"4\  0b0C0t S 0 d0S   h0S 00  l0S,0 0  ,00 ^!@pW  !'(@202 011$ =)0 1 t7p PP T @ 0K~P   0l8#8#00 S!$ 00l0  04<#$ 0@ 0D8#8#$(,""(  00Pd 0 S  0S0 0 0#0  ,,<0   0 @R 1 p  0 @0KP 0S0 bQ 1 `0@p00`W \0   pXQ4P@ @700 @0 4P@ 7 0(S ` 1  0 V1@01|0K K! P࠳ C1 @01 00S00000S 00S0 0 0 00Sz00Sp\#0410 Qhe00S_ 00SV # 0410  00SG  RA00 @0 1<Q<12   000S0 U 0S Q42  0S U 0s00Qj P 0S 1 P0@\ 1 0@4S!0@^ 1 X 0@3  P 0SP 1 R U 0S~ 4z P r0SP@ T fP@0S 0S  O0 R X0<0 X0ꠚ_`'4P_4_$_```85I]L]`_`('4@ P0A @00Sa0S 4 h000 Wt `P0@3  X 0@ᄊ   P  0 L KLK  Ɩ -  -0\K   &0S @  " B B@DNlhd`8#8#$(,""(  P ppp `K ! P  dK !P  hK !P  lK ! P T  R-L`@c@DP[U5 01V0p! !O0V0ppq X `  ᝚P=@d$5$ R 1 0+10 ,p(pd 1018 0 ! 0 `7( B(0PP_4_ -LMP@Pp ,  ` P 40V80S0C80O00P0 0 P& Uc*a0  [ʚ;l3 -L`P@\ )R1S*P 0\0T00S T T PP0p 0 :RpW 0 :Rpp 0 0pT \ U -@0`TLpP) P$`U` 0S{EyU8X P P`@${+y @{x@ꘚ_ -L4MT0pP,0 D5\P W`@8 0FSAܙ,ؚ,$,\,P,T R 0\0 0S$0S \,0 S ,0S@T5x@PK∖PP` d4 R X4 P 4`S10`0-0T RTKgT 0 Sr3T0[ 0 T RXKTX0SX0[0ǕT 0SP0S0S0S Qd 0SQS0SI 0HKL0 ‘0 H0KG K@KLKL0S <``V 4S0S$ @T 0\  @T\ KP@[ 0S0 000@0QőPT00J00S4#$0$ 00S1`1 Rj1 Pe `P 0(T% 0S"P0S0S0S Q; 0SP 81 RA,1 P< 0`S @T1 V 0S @T' hPT  R000 00S1#$0$ ᐀P  5IwPp7 $0P 0 0Pꠚ__I]L'47585_ p-LMP`@/ U  U U -p0 0V0 0pL0 0 0V00V 0 Q40I] -PLM@  R Q000 R5hsw -L$ML0QPp,0  @㝐00 Rp 0S ` Rv Rs0)S     0000cS 0,0 S ,[00CSY<,,,,$,P, RO 0S 0S> ,2 Q6*Q 2 Q/ 0S0S0S 0S HPKC@0 H0KG K@KoP Q 0$R 00S  100S1#$0$ *R  z00 SY R 0 0R 0" 0%* R  0 10R f R0S 00j < R 0 10R0S0Sꠚ_\'47585 0-0LP@ LP4 1 0'S(9P)  P P P P  00hx00S00000S 00S0 0 0 00S0ʚ; -LMP 0(SpP鎆@o`ᆆV- 01〆 @202y0@11$ =)0 1@@ @0@0 0( B(0 0( P PᲓ@7P_4_P0 S00!0S00!0<S00!P00! -LM`P 0R@ K:T 0S20 0q Q0%@ :T   MP000 @0 ,0K P@` , 0R0%@ *#0S00q 0j0 @P0 0(0K P@` ( 0R0%@ * 峰d``3 -LMᤢ 0\(0 ` 6 0p00 S0l B 0@S 0S0S0S 0S 0S  R0s RS 0S S 1P@ n(0 S (O0S  R0S 0S$0S R R  0s RS$0S S8PKp 㱒0S  㪒0S 00S !48<#,#8 000S00\0a0 @P0 0U(0a0 @P0 ꠚ_`p'4 p-\0\@LMK` `00P`Z 00@p>_>_>_ p-LMP @4`#Ġ0Č P 00S ot6D #211@,0($phȄ$(L]Q>_ 0-0|$L"4 40`P$@"4 40$0S 0ҍP 00S 0h5L]L] -LM 0R @`P :U  0S t 00S0S9 S1@0S 00S$ P 0S P0S 00S0 0 00SP` V ~P`$(4#$(,""( 40S 0S0S0Sn 0S 00S^ P 0SP0SP  ā,448!#8?As\4#$0$ `V pp .P`V 00S0S 0S0S0S  PX (0S S~5ᓏ0 (  l0$0(4#$(,""( 0Sd0P@ $0K P@P$ $ 0R0%P *售QL]>_`3 -pL0P@S㜃0 @TP  `@VPTV ( R  BR(  U` PV mxT `@VT$>_a -L$M8 < @ 幽P 0V@7pNW 01H2P02B$0001PPP P9@`1V 01,101'00@0@( PP0 PQ`@PPPP Z  0: `000  f@0Sn  _800 0@<0P0PPPPPPP L0SN ( :04K 40 ͋<0LL!`PP0@ Y0 K/K4  1 0@<0S ʂS Z00 Y1   0@<0SY 1 B/Y1 , 00S P P80 6P_4_3t`L]>_ -LMP 0 0 0 RT@00 DD<00aah h錭M]>_x#a#a,5|'4 0- LP|8wq8@900T0@  030?040: "# ? 0 00uMb|q! -LMH0@S #SL t0 L00h0QQT0 Qh 009R 0L 0@G]'4v p-LM`@(P0V00@ 0`p -PLM \ Q @T0 S *01 0 S00@ 0(㷊姬'4(4 p-PLM@PdW 0SS 0SLapP: 0BS(갸,,\,,, 1S 0S0P U 0S p@0 \ 孬ꫬ0S |  1S$0SL `@0P`(`Op C,(4L]L(4L]`t(4(4,`(4 p-LM@PK0U`$L0@ $0 00 ὓph4 005`_ -LM@( 0 S  iPUq <`Vm H1Q p QgWh 1S ,,,,l,1 Q Q 0 0<   #0041 ,1Ba  0 0S 01 00 0S \ 00001 0 x0Baa0 L0 Q000匫 (剫 冫(4L]5MbL]L])4)4D)4 -L⑀P pH D1D!00  01@T Q 1 Q::@T0@T `Pq 0 0bS&q 0 0bS0000U0@0@T 8| `0H  a R@ThB@ꍶ@м,#aL]5x#a`_aM] p-LMpaPP $0@SO TP $0@S@T1 R 0S@2 T  4Q' 0 R0 R@0S S P 0 R 0S \ 0 \p 4R 0Sv 0Sqx#aM]#aI]I]L] -L0M衟0D@K`p(0 ᬈ_L]`)4l)4t)4 -0LS< 1\ 0S \0 R0 R 4Q  VP P0 0 (0#0 ,0#0 00# 0 40# 00S0#$(,"QM]I]x#a#a -LM` P X1, @<`K^Hp;~ <ZPP$ \! !0X0R00S 0\00  ae ~,0 S ,僓1USU 01 ~ P0@ |<eꠚ_I]`_5L])4 -PLM0@) 4 00 S H^ 00S 0S1ST0t 00S0 S! <0H  0hQ  PL]5 -LM40 , P`0Hp< ,0S , P40 V V V40 #50W00S X$}H00W040 40 40S 40SH0؅0ʅ4؁0ʁW< mPpH ßC0 0 0< ׆$P cV0a0 0140X#;40p0p <?P@) 6 `o00V01 I I002 Rq 2@ T< k 0S0C 0 00 0@@avz40 \ `D0@14SR _>_l,L]L]_L])4*4 -6L,M5, \0D0 @@0 h 5\T 5\ 5\5  Dş,0 S ,姑5\ x5\1$ < ަ@ 0 @ 01 RӲ20`$0 $"P@UQ[00S{H 0P @$TE1ꠚ_liHLi0UiVi#a(*4Ni0WiHPi Mi Oi M]aJi(KiǸ4*4x#at*4 -PL MP@` Q 0S0S0S 0S  wP` 40;V 4 t20 SHpW 0@T 0S 80SX00 S,0 lX I00I oY[0X0 S ,0SP @01Q8 Q3 000CS ,,\,h,P,0S Y T 1S @1 R41 R!10YX 00SYX  w 00 o R 0`a0 0@X00@I ӃP,  ``傥*4I]I]5L]*4 -Lz p 0aa0PU 1@ R 0"%>CSd0PUhlz@0  ,00 ?0#3 0,#a5_M]Mb -L Mp0`S, P@F PC V 40 40T 40 }PqTZ!1  ,  0  0⩴ 0 4@G@Y 4G 1!S:R+ 8C8Sڴs 01P0 S @T 00!1 1 Ba  0@004!410 }!01!1 0 r! P@ H0rPA@ P\0S @40c>v@0u\@P\u P@` 80< 0CR80H*45MbL]L]H0GS S S#S 5SS ʇSS S p-LM@!`\ HP P Fp3000  00  00p#P00pQ 0 0S X忥'pPU (岥 ᅆp0+4X+4 -SLMpP@` R00Q00S3R`U-  4hP$ W W *`X h c0X0P00S` U i%`   -L Mp, x0W00 4 `0`00PU @W(0 S(PV(`(@U(W ,0X 000 4x0阁0 0D D 9001100 $!x#a -LM, 4 0 x, 0R0 80 < ,080@0 2pW , R 8 Z%T@PT @08T#X1e18@0X0@0 pW, R@00 0 @04 S0 0 080 <Nx889 @ ڻP?L00X  80 0< $ 0438 r0 H10aR001#(0\000P , T@PT 1e 0( S`"X@TS0 0  ✻08#Xᇲ 'M]+4 -LMX0@,0 `p XKC hK? 0R60帐 0 弐 Đ 0% P@ h:T^ `xK *0S@ u0S.0Sş@0 |,0 S x,儌XK9d ٢0S hK0D Т$50S xK&  ƢP @ 0踢X0ST0SP0SL0S&[4R t0S d0S`0S\0[Sx0[S S pG@K _P R010 0S  0S 0S 0Y0R00Sh0[ xKSppP`z K0P@BY I0 00 S 4s0S[ xK⪱ I0@0FPXK 9PL T;X0ST0SP0SL0S 0XK@ @002Q0@0 XKx K-dŸXK$P"Ġ0 0Č2 XKx KKX0ST0SP0SL0SXKL H@KxK@K0 H0KG KrP@ 40  00 R T;sVf P` 0  p0S 0 R 屡w0[0S4#$0$'Kp0S0P@ 0K VPĀ@  0R0%@ *H>렚_I]L]4`+4+4+4+4,4<,4l,43,4,4-4<-4`3 -L|M`K 0 , %0S I0 00@-v@pp%vW  ! vH%P101v$00,0PP1P P00S!W V 0S @0$0 0     0@00 :0` 0HK@~dK~00 0VH0KcKGKd0K\PK  5 R0S R 0(S@@KdK  0KKdK!P @@K (` x0(0     0  Rr Rh ^H 0@#$(,""( :( @@t K0R0 $  K@~Z 1`P 0@ 0@@0 \ 80S0C80D2 ,0S D,- q P I@ 0 @@ 0P 02~1 0 I @ @ 唂 00S0 0 0 00S1 R P 80S0C80q᤯0 4CTG  ုPP@@@@K}J4 #$0$<5K4P %KX` T0 P@K\PK1 <1 KK吠 t@|ʙ$t$ R 1 0+10 ,P(Pj `R000 TP @|YT+j|YphP@ 80 R ⩤X0 @DL]t64 -L,M` @pj T@ D  1 ; S00D0 7PP L0L00L0L0L00L0L0 80< D@H80< D@HL0 P0j W P_ L0 @T 0 R @TY @i80S P1 \00\0P0pX0 P0P 0Y@ 8K0q  00bS00bc8 xRQ:Q0 D0S 0 <0 ,0 H :H 00+P@ 0 R X0 @劔80< S L0 < KP<Pt0 R Σ<X0 LhtL0 P`8<0<<<`_ L]6474 -LMT@T  NP HP 1S@T p-LMS@T L0@T2 R @T 0S L0t@T@T 0Sf L04@TtR@T 0@ @T@T 0@00@Tp0S P T @T 0@@Tp0S P00000P PU L0 dP` x1 R (X0 \`ƓP` 01 RP X0 `岓00SP  PPP00P0IPP0P 0 P0v 00Snp@T| 0S L0@TfP0 P 00S#PF TKFM]x#aaL]P74 -L0~n0`pfHPPP( 0f0V@0*` %Vx( K,0K JTZ:T<)+ P, 0L00( 0S 0H F5&a&a\$a -LԅD=4 -Lͅ`=400-@P 6 018#811  R R  -0L;dP -LM`pEPQ 0 0S @QP|%> p02SN H%%>!D @A0AS= R ;%4 0 , %00 #0BWS W-Y-Y-Y-Y-Y-Y-Y-Y-Y-Y-Y-Y-Y-Y-V-Y-Y-Y-Y-Y-Y-Y-Y-Y-Y-Y-Y-Y-Y-Y-W-Y-W-Y-W-Y-Y-Y-Y-Y-$X-Y-Y-Y-0X-W-HX-XX-Y-Y-Y-dX-tX-X-Y-Y-Y-Y-Y-Y-Y-X-X-X-X-X-Y- Y-Y-Y-Y-4Y-LY-\Y-dY-lY-xY-Y-Y-Y-Y-Y-Y-Y-Y-Y-Z- 0ts0A0CS Q X@@0S $% , R|2xl2D PL4 8<40$ 1?3?3  0  0x0!pn x ell%10?30 @U0P%  0?200  024P|3L 3@4@4@4 @4\N4T4$@434(@434|4<"4h4 3\4 34 3 3;4@4,@4 30@444@4:4<@4D@4T@4\@4l@4t@4 0-@PL> `Sl h0 $$ à 0 < 0 $00@4@4 3@4@4 -pL`@Pu$ T 4 Z DU pP@TXD4(4P@4@4@4@4@4\N4 -L0 Z\@`%Z' !00St 0t  rW\PD  e/@4N48@4|=4=44 -O8@LMpOSP!b$ $00S 0 hdX@@  f@4@N48@4|=4@4@44 -@$40$&S !PL$pdxl dVH@4@4@48@4N4|=44=44X;4 ) !3000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A R- bs_notimpl_bs_mmap: args at 0x%08x - bs_notimpl_bs_r_1: args at 0x%08x - bs_notimpl_bs_r_2: args at 0x%08x - ؁bs_notimpl_bs_r_4: args at 0x%08x - ˁbs_notimpl_bs_r_8: args at 0x%08x - ᾁbs_notimpl_bs_w_1: args at 0x%08x - ᱁bs_notimpl_bs_w_2: args at 0x%08x - ᤁbs_notimpl_bs_w_4: args at 0x%08x - ᗁbs_notimpl_bs_w_8: args at 0x%08x - ኁbs_notimpl_bs_rm_1: args at 0x%08x - }bs_notimpl_bs_rm_2: args at 0x%08x - pbs_notimpl_bs_rm_4: args at 0x%08x - cbs_notimpl_bs_rm_8: args at 0x%08x - Vbs_notimpl_bs_wm_1: args at 0x%08x - Ibs_notimpl_bs_wm_2: args at 0x%08x - x p 00eEj R ,0 10 T\ TO]L_T_ 0-0 L@  ,0P   H0 RH 0hi0, `_O]P]2-@@Pr?0RW` o-|o-o-o-` B`p Bp` B`RE0C`R9`8p-o-o-o-p-p- p-,p-` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `p-q-p-p-` B`p Bp` B`p RpPP2-B@P00O0RW` q-tq-q-q-` B`p Bp` B`RE0C`R9`0r-q-q-q-r- r-r-$r-` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `r-r-r-r-` B`p Bp` B`p RpP2-D@P?O0RL` s-`s-ls-xs-` B`p Bp` B`R:08`R/`t-s-s-s-s-s-t-t-` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR `t-t-t-t-` B`p Bp` B`p RpP% $0000% $00000& $0000 -L R l\000Х000 R 0 4 8 <0 R  R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R 0 R0#400#8 80 RR 0 R 4800 R## 8##,0R0@-0#88@$HHP%XX,ȠȌ8 R0R0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0RC-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480 p-LM0@S`P: S S00 S S R/ !R0 R R R =R 0 R R R =R=S Q ``^P0  R R R 0  R R R0SppP]0-2P? @P4@54?3P0p-2`? h@@PPP`5P65?3`pp-2`? @@ P dK\P8\00S 0,!X0T  P L  HD  @<  8$4 ( 0,, 0 (4$ 8 < D H\  d 1 100 1`08<100g p-LM0 @P0 "!HN 0L`, @000phyL Hphꘚ_`001ဇ- -L,M \P` Y\ H0C 0L Hc$&R   R  R0Rႁ0僁0#q W 0P0 L P KpH00CH0 p 020P0LP 2 HK A Z@ j8!P \$6BS -L,M \`p V\ H0C 0_L H$&R   R  R0RႡ0僡0# XL P P KpH00CH0 p 020P0LP 2 HPK A Z@ i8!$P \$6BS@-,!@0 H@ -LMp`MLP0 S@0 0 L`<@긵_$ 0S00%a -` LR000 | |0@PL@dDFA 02b SpD 0 S0``00`hLiLP@0,!0*4  40L0C0l"uduD%aPn]T%a_\$aP%aT,a&a_̏3Xn]A4F5A4P] Z_B4P]P]P]P]`HB4`B4B4B4 -LMQ700CS(-- -X---- 0 #Q0\ 0S- 0 Rd00S000  0K\R-0 -Q 0P]%aL_r] 0-LMPK 0@{P0 0S 000 0nP 0S 0@00 0aP  0Sl 0000d0SP H0KP ,0CP C4_ C4T4C4C4C4@-0S0 P ?@A1c   ?2c0p0S0S000 L0R 00S1b1,  P]Xn]gfffP]QP]f__ -L@A,@` po8PP 0 Q 0 P0 0   $ ( 000$0(0008 -L MP S$(`p@, (KH,K @;P,00$`p(0 -L MP$(` pQ-0V80, @ R0@\00T00S\0, $0 0( `0  (K,KU -L$M$(p 4 80 0 R8 P0 UQ0 `! 0@ 8T@!,K040K PU 00`V00S P P00 $0 0( 0 -LVsC400$0(000 p-LM@P` D5T 0G0S>Q&ꜞ----Ԟ-T T @Xp 0@D@@T@H|tx st 0@ 0@#@ 0 Q 0XpDC4\$a$ahC4C4C4C4 -LMPpU' `V @ `\  0V PPP  @ @N@@P@ LL@N @@ @P,a|,a -0LM0KSp8 <0 00 , ? `00V1* P&Q @Ϡ/ 1b10P:0APPϠ$:?0s1c4 1!00  0j 00V:< 80 R< e40KS0n40 0F5` ->0LMnd`p4 v<P@L 40 R08 &8 P00U* V 08    0Z UJjF:804 0S80 Q@X, K00K`P 0 0L00< 0SH qF5\$a&a&aC4>0 >0 X;F5M0@- 0@^0 0@T 0 P^0@ЍS0@P ! -LM8 \p 0 0 0c@0 < 唒W`D h 0x"Y, K00K @, 0S 00 Rr .: #:L4  0808@0S @4^ P>0. U:00R ^ RG 0 0c4 :#: cQ!P4 4@ 000lQ0S@@ < \ D 0 RD ,040pW0<0 `D@0W@< 00 ^P @,0<@0 S0h (8(#8Q4 "*4*64 00S 4 Kky&a  0-LMP 0 .@K PP@ PcP*40 0\ @4:Q0 : @0 \0 0 0@-P@P`p. ^  R00\:\*R:^ >00 0 bS0!>0>00>000 0S0l0l -L@㬀TPp`  (0@T -L@, TPp` ,@ T -L@㬀TPp` 0  @XT -L@, TPp`1 @\ T@-^@>0.  Q:00R^  -LM@`TSp R a :@TVPbUP!W W `e L 0D@WH\$a$a -LM`0VPp R a :VP@bT@!W W `d L 0D@WH\$a$a 0-`@L\0P 0  ,0R 0 0S0h!qX%a\$aDC4 -LM`PV r @0S  2S @2lS2S~ X`TpPp0JS |-|-|-|------0  p0p0@p0 Kp1PAA0S 1 R$ 1 ?#+0AB%@p Z 11@T pp!mp`p TpL1L ?#+B%00p0 ?#+0Ap0p0 0X pz" 0|  phmip#3%a$44I48I4HI4XI4hI4tI4|I4T4$a$a$a$a$a&3%aI4h&3I4p3I4 J4$a$a@J4hJ4J4J4J4J4J4J4J4K4H_T_! 01 ,   ! 00 2l 01  ᘚ_P]O]\$aX$a'a&a`!`C68`@d`03 6 !03! {C@-p` PDq!03 `aPc_BCHd$MQ`pp50q0q180K0@<  0 P \$a`_'3_T$aF5 R_L4L4 M4PM4 p-LM( \@SP`8 0 0m ,m ('m$m mm$m4m00S8@< D  mHxmhgkdlH Tl LlM4M4'3M4M4XN4t<4M4N4,N4TN4`N4tN4N4N4N4N4N4 -LM \Pp`@  @p, 0p9? -LM, ^0P0p @`H   \f 0 `p0 ,1@  -l!LM000 0.!0 S@C$1Hpx,17 X1: `N @0 PP 0+P Hm} P   0>0.S4  0S00TVl  @0 R  0H 0@`_L4T$a p-LM@0P`XT" T jK0V0P00S 0[0ppTK$0V0P00S 00pK0V0P00S 1[0p\$aN4 88#4S S - LM(4P`0Sp @"0pgMP`(0S00V00\00S 4@Q0 0CS ~V00\00S(TA0SPJN(4 SJ-T------------@\. 0 PD; 0 :#:cQ! ^A`*)  @Q`1h#R& /P  DA`0S000S pp`V  Q#  -*&G`00i&aO4&a&a&a p- 88LM#Đd0`PP 06 ?S R7P%&:FFp阚_Xn]-@-0  80@0@ h0 T@ 8 H0D000H0D0 0,40,4440044&a-88P0S P0S00 ,40C,4H0 Q H0D00C0CH0D0440C0C44&a0@-8P @+ 0Q P00RP @0 0@0 P0 "  ,4,400C,4 0Q  H D0 0CD0H 0D H0 0CH0D  $4 0C4$$4 0C4$&a -@ LM0|@  xh T$aD,a0@-x@PQ0000  00 0  0 Q 00  0P0O_- 0S  R0000 0 0  0 B 0S 0S0 <00 0 00  0O_ -!LM!:Q(@T!h' 001PQ _fp$ KP$0W 000p`0S &21(p,f?fP@ (\O_&aPN_ -LM0P0b0@T- qP* @0`$0  2 0R ( U$ 0 R 0R0 S0 REf&1?(00CS0 (0`i7fP0H0,0 @ R  0H&a&a&a\O_PN_\$a -@LM+EE(0 R 0H&a\$a -L 0E -L 'E8 -LM8@PTp`  0S 0` @TH 0L\R S @Q Q Q \ 0h0hS 4S  0h @T\  ipL -LM8@TP, ` 0U Z 0`@TQP U00P00S V \ @R U Z @Txc ``` *(": 1(Q"( 001 0R  0*"%,`VLpN W 0S6  10#R0 S& 2D0Sp0S `bQ `2 R 0R0S (2H20b@ 0S0S a 1P U P@R `@TU VZ`(*(": 1("(Q 001 0R  !!0L0p 0S"  0Sp0S 0Q 0 R 0R0S d0HP000S 00 0P `&a\$a&a&a&a -LM@ 80 Q@ i @ 00 8 40  `0 :8p#*  !( #8R 001 0R  :#58PQ ,  0`  |"`0 0PPP 0\Sj  H0D 0C H0D 4 R 0` 80S > 0S2  0S'P U ,1P R0S  0S@T00S p1 ,X!HD!@ 0S  P 0S  0S D 0S 0P 4$0C 4$ 0S  0 S  R L0@p4H 0S  P&a&a&a\$a -P@LM`pg 10S 0QPP 0SK SI \W- 0S! 10#VR0 Q S 1D0@S0H 0S 0PT 0S 0S|0< p 0S \0Lp `V  Tp@p阚_&a\$a -LM8PU` 1L D H 0S 0ppUB X@ Ta !T^  *(":1("(Q 001 R``(40C(4 :#%,40C,40 01p R T, 0 R( 0R%  w0P_U@X8@ 0S 0S| l0,@0S L @, 0S $0Hꘚ_&a&a&aL_\$a -LMlub0 @000 ( 0 0$,4( C0S0404@4$xL_L_ -L,Mph P4 @# P9",KQP 8i/ 1b10 ^:0A^P8:?0sh1c, 1! PP8PPWL   8 8Q 804 : #5 @ QH D H@( >0 S@# # 8@Q h/ 1b10 ^:0A^@:?0s'c!001@XI @0 L 40RP @0 4 PD7X  T  _< 4S44SSD0 SH0H0S S 6!aV@0`0ó @0` &W  @0`00@0<0D 0`H0 00Q00S H 0S H0 10#R0 S 5D< 0PW 5 Y D R8000($ ($D Z` x5W} 5 Ry 0R0u @S TE0Sg<5 YZ  8$0 )2 Q  0SKH 0S? H0 0S4X+ 4S44SSD0 SH0H0S S T4!AT@0`0ó @0` W  @0`00@0 6 300S 3 3H@3H0 p3@\ 0SY L3PS *8\P< H  "W 8< u b0 PtH 0S6 `4D01 LQ. 2H(L04d"SW \2 YD2 T  !< 4S44SSD0 SH0H0S S 1!QU@0`0ó @0` 1W9  @0`00@0<D  `00R00SH  0S H0 10#R0 S 1D<U] 0@ 0S 0P c00KS0l00 0+ ac)*(":1("(Q 001 0RX0l00&aF5`&a&a'3\$aT$a&a&aL_O44O4 -L0S7<K1 Q V$ 5 R 0R P0@T:TPP  0 SP 00dX (HW:4L000S < KH P 0S0S 0@(4$0C(4 0Q\ `0 (DKP C/ 1b10 ^:0A^P:?0s#c!D01B@TA  4S44SSD0 SH0H0S S 2!QU@0`0ó @0` V  g@0`00@0Y 0S 0 0S00 \0 ` `[X<0S V 2 R 0R X0z0X0 0S !HPP \@0K !< K‡P XzX P0S$ 0p0 R0S\0S 0S 8 ` R 0S  10  H 0S!0S@ <K1@T 0SP00P0 00 x Hh 00PL aY0l00$ P d&a&a&a\$aF5`'3L_ -@ 0L ʠ 1( P^! 0 SP0*"%p\0`00l 10 0T 00S,0H@0&a\$a&a&a -LM PP/*%:8#*!%( f V `!R#8 001 0R :#U@p*0SZU@:00g0l0 R U:Xh<0H,0@00p0&a&a\$a@-0$,@0S!*4*6 ,<1(P 001P : #P 0S ( 8. :(#8 #:T -LMP0 ` 00S@e00 T # 3U8 4` *%:8#*%!( 0#8Z!R 001 0R  R Pt : U#o*@Th f 2$pQ b/ 1b10 ^:0A^p:?0st"c!,01b@X2@ `R{Vp2 @0  @4pS44S@SD0 @SH0H0S S 1!AT@0`0ó @0` YH   `@0`00@08 R(40 040 8 Z U:0Um:8 R 40S 40 0S1,  0S 0 0S  0S 000S 0   T0H},0KS0l,0 0h$0HF5`&a'3&a\$a A-LQ l-x-|-x-l-x-|-hY -LM@0@0@ -LM@00@@ -L`M!(PQ&F 0 010 P40 > :#5@ T8 7 \ 3 >0p n#2 Q rϠ/ 1b10P:0APϠR:?0sX"c!,01^ 8\ 0U \ 0V\ 0 @  @ 00 08 1 RA $4  0 2R  1 R H8!00\@T06S0:<,,/H&a\$aO_&a&a 0-0 L"*("1("(P  \! 0 SP *"%0; L0 @@R4@ 000HT$a&a&a\$a@- 0 0 0 21 0 0s#0@$ ! 0#:8#*!(#800Q! 0 S@ 020000T$a@-`Pp !:H$$X 00S (| $:1(P 001P:#50 000!S$010 0-0@P$L 00 0S0ڀ0 R puP ` `000@0  0@0$0)$e<Y&a&aO_O_`O4 -3崓LM00p 00P$0, 0 ppp p0S P U:YZ @:4s4C<,c00#S' 0" "0"0"00a3C?6C#Z!"00#Rea!\"0T2@P"@L2  @@U4Ÿ4 0,,PlR0 "R@EWŸP 04T0D@YR 0@QR0!@+W0 @CR0!@W< hPJT:kZo`P@) E1? (P 0 01  @`P 1 000R ;P= Z9W 0p(Ā XXD?_&a\$a&aO_&aO_O_O_&aP%a&aO_N_O_O_O_O4$5K_8xL_-L_P]O4L_O4M_PN_-O4N_\O_t-O4O4l?_,P4XP4 p-!:LMP`0S@! 6P@) : # L0S L00 00SP@`p\PHH0H  R : 00 00SX&a&a\$a&a |P4 p-LMS@P` ,:8l#*( #800R 0 SP*  ^0"5060p ZX&aP4 -80L0 00 Ơ .T0 Xn]&a&aL_&a -d0L \R00#P00*0 $C!0hW&aP]F5P]00 R 0  \05055W&aP]P] -L$MS(S1"01@ +.  0 ;>00 @0+. R 00@0H&aP]\$a -LM40 >0P, 0 0 S S @ 8 < Z4 # 0 @4Z 3 #6S``V 0088000,^>>)*10S006J00 Z4!H,): R |H PP@ 8#8ZS#0@)`p@V ?>0U.! !Q 0@ST0ȌJ0 0H0 <)1 00! 10S00:00 Jh H\ IVT0T 0 80 H0@ 0<0 t808 0 80 ,0(6V&a\$ahQ4Q4&a&a&a&a&a&aQ40&a -``LM0pS P0  @P@.00 R&aP0P0S  \:00Q0S&a0@-l0@P 0S P  T :00U0S000&a@-0@ @0L 0  0 000 00 0| |0t t0@l l00?00?X0 &a &a&a&a&a&a&a&a&a&a-&al-&a&a&a&a&a&a&a -0L0Όn`VPp@0?0?0000?%:%6;PK #;J jV!Z^UQ]P]Q4 -LM PP%4*%:8#*!%( v W p!R#8 001 0R  :#U@*`L0HS @000ZU@:< 0S U:hH\$a&a&a 0-80L@T (PT V0DT0L_&aT4 -X2LMP, @ @,8V, 00$ V080 00 8 ,1( R 0S 0040 < R< 40 6R< 40 80 $Q8 0 X 0@S@T1S ?@4 Tf?p P@0C $@V01!R.P I P ............(.DP  0PP0!?#=?00c?S V@TjڣhV,@Y@ BP@CPmPFP$U&a,R4@R4TR4lR4O_l3tR4xR4 -LM(p`1S`>V#1(KPQ @/ 1b10 ^:0A^P%:?0s c!(01B@T H4$4D\U8@T W 0 *4U@TX0l00O_F5`R4R4 -!LM!:1(P`U!0 001 `R8pJ$JT( 000p帀00 0+; 00 :P 0 R 0Hp@:#:S P@*:#:"*S:(21@(PX0 P 40 P O_O_&a&a\$aN_&a -1LM@@pPP0 K5<PU$: 8 #!( R#8 001 0R0*"%0Q*0P0H `  0@O=P4 `&a&a\$a0  ")0 )Р)0 ) ) -LM@p &dP 0SPTT0 R0 00b81Q00@R Sh] Q]Xn]Q]S4 -LMiB2< r R0S tRP "88 #$0LTH2`cP 0S@ oTth P0Up7*!A06T&*46!SAQ  x1 :Pp`UJ1 16T:0U00 pW0#02S0ES . . .!.!.!.!.!.!.!. .!.!.!.!.!.!.!. !.TT-TT "88 #$hS(0S} d4+ah]\$aQ] Q],S4&aPS4|/ah3&aXS4dS4@BhS4S4S4S4S4S4S4 0-LMPK VP@ 008@\$a -LM0@X\$a -0LS S  -,@L,`P. p~4,!.@ ,1:404,1L@H@,!L m40V800`H`0 0 04逴- -LM 0@+  h_$`" -:#:LMS`@PR pK D7  jVJZQ&aS4 -L M00' H ~p@g0>0L ^| P'U@`H@ $@K,0  $ 00<ZUzjQP]&a T4 p-LM`00l H0N@0d0>0^P 0,0 L 0L0H pZQ&aP]T4A- QQQQQQQQ RA- 0@P`pQQQQ R40 ( 40(S"4Sl]40 ( 40(S"4Sl] 0l] -L M@0K0i/0P0H 'KP00 \ ,` 8 #8~4P6  0Y)0+\Pp]@ T4@BHT4># - 1LM @R)% %B? S )0  "!   LRJRtGR+BR?R|+L(\00 S 4.R0,RV()R$+x$RP]#5lT4T4T4 T4T4@ -pLM0`S" @0  2 BlR0PU *   00VU:`2 0Shn]U4 -LM`T^@PƄ ?p 0p 0,`e0@@n]\$a-??!0S0q1!1 R  P 000$0$ -LMP# ?,& Kl28ȟ(00 0 Q 08#8580p8 0dX000NTT0I 00iQ<)à@,,ȟ,(ȟ( b$x@ 3` `RQPQ a,Ơ  0G)PCQ0 @ 9#9S*00 S|0)\:00 0C0 - 000b1,0 PUZ0Q I$IT <O 0 C\f:0 0C07*,Ɵ0 C\V:00C *0,0 L0b1\0do:0 0C0p6*,\$0 L0b1\0Y:0 0C06*,0 L0b1\0C:0 0C05*,t0 L0b1\0-:0 0C0t5*,`0D0l10DP,%<P 50Pş$P0 C^:4L*Y,0vP0$A `P PUE `Zd1CP PUE `Zl4$hT dTP^ P`0&D@8D N@@e 0@@:P :@ :@ :@h :@,0 9@C(P `:@PU @Z 3 @0@+2p>01 `"&2 L"2 (Ÿ 0O0O" !01 P2L",DO4O!1O!1 1!1 OO5 ! 0 @6O5#1, X 0@0 eX\0C ^:00C0K+0 0b10 @>U4@\$ap]).q],U4 HH|/a_LU4|,ax/aX,a Xn]P,apU4U4\,aU4-aU4D,al,a,a/aD%a`,aV48V4XV4xV4T,aV4/a&aV4 CAV4T$aCaP]UUUUV4W4 _T%aHW4\W4xW4-P]-P]-P]W4W4W4W4 -LM 0R 0 @0 +@0 SS0 0 SSS000 S D@<N4Nh0 S DSBO_,aTn]Pn]W4W4 0-LMT@ PRLP8 0<< PX0S@0hn]@q]`n]dn]0Q 0    -LLNDYP 88 40  h]0 NW4 6.3T!4_t2a -L M8@4T 0 @@EP_/aDY4 -LMP`!0pS(@0T @/0S TdFP@ *00C0`!k$VN!@LY4/aTY4 -LM @PG 00000Sh0/a p-L,M,@K`P *%x 0K@,K[ PP @.0S 0[ [[8[<40p Np NpY4 -LM1(KJP`0p ]*,0 @p(@K@ @0' -L M$PK@p`D*0:$0K?*  )  )  )$  )8k$P0 P ` PK' -LM1(KJP`0p  *40(K $`KPp@ @0 -L M,`Kp)L0PH@X@0 ,K@+PK(KP P0u' -0L@ p60S h/Pu0P" P 0`V U004P< (0;4P00@ @00 0SV h4P 0,0h p-LM0$ 0@0(X , 0 PP% !P%0S  0`0 P0d P.0 y 00SHp ppP 0,0NKY4Y4 -LM@pUPY`U  -p 0$0  00 `0 000 020X 0 Pu0 3 @d- 0 -LM,0@S4>.L?.>.>.>.?.L?.t?.?.00Cs0 0 00, 0S 0 0pl .`%p ,0S0,0 ,$iL0S P_Y4@BY4 - PL0`04pSa0@0p0CS0ו Q.<@.<@.x@.@.@.@.A.HA.P@.@.@.PA.P@.XA.$0( R0(0Q 0  S0000@ R 0S R 0 @% 0S0,00 @ 0)S 00000@@@p@@B -LM0 S 0 KY4Y4 0-PL 4@ @0!qT p@DKT4@ 3S05 00hKmxK0; 08< 4 0<S8! 4K0S 08< 4FP,PQ <P+P zKvKsKpK0 S0@ leKdbK\_K0,LZK0,D4N4X44X4PX43dX4hX4X4X4X4X4X4T4X4Y4,Y4 -8qLM@P' 0Uă`9 U 0 x-U <0?R0S0AS8E.$E.8E.8E.D. 0@0p| OKP0c0T  EK0D 08    0P_n]P4T4`4x444 -@LMMT`pP1 )@T 0 S 1S 0S0t P K0S h -< 0 hJpT 0 '34̣44,4 -LM BI B@ ' 0S@0 @`0a -LM@ R000 h 0-LP,0@T 0U @T0`0a p-LM0`@V8 P/ P0[0X Z ,0SG.H.  R50ˠʌ ʌ00ɌH0 @P`q00P  phi0 `r+00  004`;00ZP՟8I``I`I444X3 -L#M\P@`p 2\ 2\ *@0S p  02\00  00h2\r -L2\ P2\ 0000000 000@00000@}̠ 0@ @w1\= 1\뤠 ` -*Q \& 0 00| 00 000p0#00 00 |6 @ ` *L@D4p8P<@m0\ |0\a{p0\x h0\Z0` Qto0400  00  Q@Q Q Q @Q Q QQ`H.73 Q- LHl4 p-0LM`Q0000 0S000 03$0S0$0H' i P4 3PU 4@\ 40 !PR %3U," ph`GP]|4do]44_6B6 0-#@TLP441S@T 0h 4# p-LM P@| 0`\ p| 0`\0` -pLM@`p iLP@0T 0!R@ 0T8o] -LDM0P,0 P@]|!0PY0XU 0 q0C Q0Q t$0 l pC T$0T 0 ,0S ,^0Tp 40!Ql@ 0l0 PP U h`K:d$l\l@TP U0 P@ T40 Pꠚ_8o]4-\0 S S S S SL\ 0 0S S S S S SL\ 0 S" SS 0B_S \00 "#0  0801000  0  L\00 ^ 00 \S00  SS -LM<Ÿ Q, @,sG 0@\㢟0 { x\10 2 \o ࡟Z + P`K PK@K }  yP@1 Y 0h 9G8,0 S <,/X7T.U. U.U.U.$U.,U.4U.K 0@T@c@cPUJK!@0L\ 0 @p0N^J0D@T;pp -L M0`KP pYG0KP*K @(K8)K0 -K,pK+K@ @@ N -L M(`KPp 6@K}(K0 pKP @@ -LM@}̠ 0@ @ -L M0@KP `pBU0K/[@/K&.K)K4 Π0 -pK*K`(`K -L M0PK` p@CV0K/['Ġ/K)K8'KP0 *Kp (pKo p-L M`  0@PU 0 pP nP -LP -L8p 1  @ @o]o]=3=3do]T483#5.ث44H4\4 -@L `$P P00$ ;004P$ $PЀ 0 PUb p@0SP 0@ 0UP0U dpl@0SP 0,@ 0UQ(l] .Q]l][]#50'' - 88L M#dp&, %P@} 0 Ԁ'PPq`V8 0P Z 8Z 2 RPQ0 000 z'%-,  R0 :0  R0 :0 0 0`'z%-oPP( U0000P00 P 0P0P00-PP0 P@%o] 0 !4-#LP`%P@> 0p'P' U0 60  U0 600 Q0  10S00 000 &% i 0<0-?o] -D@!88#L !$P` 4pK 00&((*&<&%4K20K1 K0K/`K-K,PK p0P%00 0 00<H0 @ 0   QP@0S % )60S2U6 !p2U t2U l2S  0 00<01U 1U  ?K e/1UE 1U 1U00 "   QqL10S 00p2 $P  0  UP0U 0p00$|&4400 0 0FU0Sh 0S00000]D0U^ 0H0Qo]QQ @pd Q@mdedAsd rdAQmqdhdk~gd.Q` -LM⼑@ `e, ' $0@pK(0 [_0 0P,0 Q8d0804 Y? R88 Y?0 !P4P8 h(0 4< n0*0X000  8d"(((0"4400$ 0  0 TR ,0S <, ꠚ_444WEV.4 -0L  10S -L$M(K@0PKp(KP`0&$$X$t ʠ,K+PK*pK)@K` .K-`K- 0- 40 L04@ p0CS00S 00S 0S P P 00  d30PP3H RP0 (33I 꼬444$4@KL 8 8-#DLp$!PP) @0d 0  0S(0 4 @V !*0gP@*0P@ o] -LM`P8 Pd,88 #$"Pt00pU0YQ @( P< K  2P` 0SX`p.4PK (D&,&Ƞ&*040K2 K1K0K/`K-@K,K0:00 0 x 0 0 P08 $ (<0,000 0P<<R_o]Q_'R \ 0L_S BR\00 -L\M⤑lPK0p ,0 f# @lKpP `0Kk P`ePKd@K@P X0[\K0S BS 0 480S 0.< 0 08 <40S0,0 S , @T K&0@P D[C0[0[/ [H[G[4$  0@ 50 0 0Sꠚ_ ND4 -LM`(PKp,@@(KN,P0 &KP @$PKp -LLM P@`40(pKS0 ?(K&K ,$KxKT0K @]PJ0[K [I[480S 00@ 5  0p ->L4M0Y?P\ 0TpKX0   0POQ`[4@[ 03[4  80 VJ0[K[4I [80 00 S 0S 0 S< 0P0 +01@XX 11 < 0@ 00 P0010X0   0+P$Q`[+ [ ,[ 0@4  VJ0[K[I [0ޕ ޕ4804 0   S0 0S< 000X0   0PQ[` 0 8< 40@ ^0 J0[K[40֕I [ ֕804 00@S P 0S< 00{\444 -L$MPp0@0Sڰ1,Kl   5,KT0L @` `W0S0@00 51順ĭ4 -LX  0 P0$0B(0P S 0i/d0a.0aN444 p- LMQ0`00@0  "!\ R0000 0  000  "! 0  "!pd0a` p-LM0@P`S.8.@.P.P.H.H.@ pD0P!!00P ` p@@@/d0a44-0!! R R0000 0  0!!  -LM @ 0@0hg_IO 50a -0LM 0@0 40j0080 00P0< 00Syh/`C#b2La2a1!BD0)8 h(.0ap]p]\40A@|4Mb4l.4 -L$M400 ,0  00K(0  $ 0 0 @0@ 錱. p-L$M048@K4 0 ` P0 , (` 0\H D 0@<4Pp0 , (` 4@ P }P pS.@.ܮ4@ 4 -LM@q/0s/<4H4 -L M0$0K` 00P10  "!~0>0$ ,P00$ ,P@ ^00$ ,T N~0 !!0$ @e-@T4 -LMPp`0 1 1\ 6@.@.г.г.\ \ %1C 0 0c30 00C = 2  1\ \ \ %9 K  -|4 p-T0LMP`00@8 ,T00 8\p0a 0-(1LMP0K0i/ 00P 900K00$ P-000 \00 ,0@0< \00 \00 ,000 \20SZ0C-0a@4@ȯ4 -(0L 00< \0a<_ -X0LM@ 00<,0 0S(000. @0a<_4 R_R_N  0O   ! -- -i0~n0`pfPP( 0f0V@0*` Vx( K,0K JTZ:TU P, 0L00( 0S 0H F5&a&a\$aQ0 F50 -L},04 -Lw,X4 0Q 0RR_@ 0-@@L- 0x@ppp`pP @ 0 A\`p0 b 0!!R_4<1aR_4.X_0<1a -0LM 00,0 p?o`sJ0v,0S0PPP /o b0 @R`,008 401o<1a81aX_R_1a@1a -LM@X-0DS 00#!40 0$ !!騰4<1a0G-0  "! R䠟ܠ101 R R101 R0@0@@ P$00p( 4 `0 ` P0( 4@P $0p 0!!1a81a<1a -<@LM8  0 00 0 0 1a -LM0,"0S{ 0`  "!r@P0   000 Rn0  "!`00#! 0   000 RR0  "!`00#! 0   000 R60  "!`00#! 0   000 R0  "!`00#!  1 L0 0!!~{4q]81a@1a1a -LM@@Pp` 0 0#!p  Pp`V H0` @%  0!! *R_X__4 -pLg@1248@ DMR "!0bP0SX0X 0T0  @  0!! ~*R_.4X_4M  0Ѝ0 01a<1a81a -LM0@  "!@0!!$ $0 1h81a@1a1a 0-L0LP 0P0@  "!@0  "!81a 0-< L0P@!!@0  "!081a, 00 00!@1a81a1a P- L 004,0P )X_4 P-0L  04\00S )X_44,0Q0 Rp0 0X_@ 0-LM000@P^+!00x!;Sy0 U0 42428"40 00PP( 0hB+y/P0 4 8  < @ D O H L P R ~L 0PP@ ,08P80%0 804   #%) Y004 ,004 0\004 ,0@043 \040 \004 ,0048 \004 ,0048 \004 ,004 0 \%ph`@в44 -LM80@ S0408000 P$aAi p-LMPd0`8l2/ p P |ph%d•p0l2 h    d2hd ,(2d• 0h0d \2"`jd2hd ,d•1 h0d \d2hd ,1 d•0h0d \d•hd ,0` @d2hd ,d•,1 0hd \d2hd ,dB0 0hd \d•1h \ zP@  $d2hl"lbB hphBT 0@ 0xpв45Q @G44 0 0-L@xPP/8S4d2hd ,0d” 0h0d \0 `d2hd ,d”l0 0d h\ l2 S0d2hlRX5Q -P1AL@`@ \@@`E0 p\0  B0C5AL8  <\0A 0 8/0C(  0B5 8< \0 $*;#30 \0x0 -PLp @`,0. 1 \JKLM0@ P P@@@Dt :@Dt hu@0 \ ,0; \8 , x0 -LMPXp1D@ ` + 04080` @0@PL X0 00PB0C@0 0`0 0R 0,0  @  0B0  00 00X,P0 p D0D 0SD0@D@ @00@0b 00 # 0c$0, X !P]D1a3l4 -LM`((@dϠ>1 0(P\ p 0S  imm@  D00 $  0/0-.p1,p0p -LMa00p@0".PP0   pe ( PD@U40 0(0K00  @00D ( 0$0$ 0Dp]D1ap]D0, S0D0D D @00H @0T1a 0-PH0LS@ S 04<04 HP0 -LMp\B PU  ( ^@T4`  P$0< 0/000 `@0@P] 0-@P LR000 @ H0 BT@  $Q  R8000h80 8004H00QH  0Q 0Q0 Q 000D0T0QL0Q#!@0<0 <0 0 AW@_W@@W@DW@CWBWEW -@0p`LM @H ^ W@ D0/RQ80 0@p0 < -H0LS40jh@B -LMH 80R@4< 030H 4h|.@BP0 S 0- LRP@ @0S #S0S S S lh0h`XS SD@<S4ꈳ44444̳4ܳ4T4Z44xG444 4 -0L00l0 S -LM@40 R$ $000hyꯋP]h2ap2a 0-L Mh0@SP4K3[p0\2[ 4 [0q pr002[r0Q4 [q0R0 p-QL$MP@P Q p8`K6[Q D0 Q\09 S  S sBs0Sr] 0-LM@PK0SP ,0 R 0 R z0h2ap2a -@ML0 ,0@(@V0Sh\4,.4 -LMT`p4@P0 0  0Psꘚ_L4P_-0S! 8 8#0 R 0 S  \00\00S\00r]l (0(S-"$  0Q 0\00 S\00 \0r] 0-4L@P PC A0P= 0Q7 0Q 0Q P0 000 P 0Q 0Q Q Q\09 P\0Q\099\0990r]A @A A h2ap2aAA< X0S0X0 Q0 0 0S00Q 0S \ 0S 0!R 1s 0< 80X00Xr]r] p-L M`d0` 0i/0PU4 0  ph Pv`@00 0\ 0H  ph`@\` 0p `@PL0S8pp]@T44.T4`2a0A4d2a4\2a@Ĵ4 -`"LM0pS0`V   @   @      QF `0d ,`0d ,`0dP ,`d 0 \`@d 0 \`Pd 0 \`d 0\`@d0P \`dT 0\o`0d ,`0d ,`0dP ,r] -LM`00 0 K $ P `0K00 P@0  "!` ,`0  ,`0  ,`0  ,`0  ,`0  ,m-0 ;S4e * <@)}d `\l**`0 ,`0  ,`0  ,`0 C/,`0 0 ,`0 4 ,`0 8 ,`0 .,`0 < ,`0 @ ,`0 D ,`0 O/,`0 T ,`0 \ ,`0 d ,`0| l ,`0x X ,`0t ` ,`0p h ,`0l p ,`0h  ,`0d  ,`0`  ,`0\ ,,`0X  ,`0T  ,`0P  ,`L 0 \y`0 ,`0H ( ,`0D , ,`0@ 0 ,`0< 4 ,`08 8 ,`04 < ,`00  ,`, 7 \`0d4 ,`@0d64 \`d0 0\ H8`@+R00d \`d 8\`@d$ 8\`d( 7\`@d, 6\`d 7\`@d$ 8\`d( 9\`@d, 6\`( H7d\0G` 7\`@ 7\` 6\`@C/6\`d 6\` 0d\ `H 0\`@L 0\`P 0\`@0 \`0 \`@0 \`00 \`@04 \`08 \`@0< \`0@ \`@0D \`0T \`@0\ \`|0d \`@t0X \`p0` \`@l0h \` d00 \`@ `00 \` \00 \`@d 00$ \`` 00( \`@\ 00, \`0C/\`@0.\`0O/\`@x0l \`h0p \`@ X00F/\X ``00I/\`H0 \`@D0( \`@0, \`@<00 \`804 \`@408 \`00< \`@,0 \`T0 \`@L0 \`P0 \`0 ,t'Y(d` x!ln?`1P` 0d\0 ,!]`0 \`@0 \`0 \`@0 \`0 \`@0 \ 0!!QQ@4@$aAi \2ad2a@!D!  /`2as]  4`0 `0$ `d 0\`0p ,0P   D 0- @LP,0@0 \ ,0; \ 0h 0-.@LP9\0.\  ,0= \0hp -LP`ႀ p.9\.0\Y.`0\0b/\.,00.\.,00.\.,00.\Bf/,0@@D t f/@0\WpG.9\.0\.`0\@0f/\.,00.\.,00.\.,00.\@f/,0@Dt f/00f/\b/,.,00.\' -LP`₀ p.9\.0\.`0\0b/\.,00.\.,00.\.,00.\DBf/,0@@D&t Of/@0\f/@0\WpG.9\.0\.`0\f/,@0f/\.,00.\.,00.\ 0b/\.,00.\@f/,0@@Dt f/,@@0f/\.,00.\' p-LM@P`0 K@!p p-LM@P`0 @pT$aP]\2a`2ad2a,s],s]0`:0T60H20<.00*0$&0"0 0080`V@D!1P<@00\ 0D 0C80`V @ 0`Vv@X\ 0D!0C L 0`V@e0H(E$C A?=;9 7531/0S ST4h444\N4\4T44ܷ4444D4P4\4p444444̸4ظ44444 44(484H4N4444(4@4L4\4D4l4x44444Զ44444$4 -LDM0`SU S S00S0S 0$<0 #1p 0 3R:l@T#d Pl d0l 00 l0l @l000l @h0l$!l0h0$1l l@ 0$ l0RP !: l0 RP :@\\ d@ 0 00l@$0!P2 U0: 000l@$ 0!P2U 0:0Su 0h@$ 0h@$Pp@ 00$PO h0P0h0  1P!pU0@?Sd2 Q  Zp@2 0S0"Qv St , R2 RVXX PU X@PT@T0X140 0, 00 R( d P d @;00@\ PP \ . X 0X P0 04 0 40  0 \ PP \ 0X00X P *,P@@Q UPU@t@P1sw@Pt PpDPm Pixx]Rs]4\N4\4T4 -쐟LM`ࠟ @pF? R 0R$ Q PU P 1S`NV$p$@P0 P0 RT  0 R 0R>3 -LM `$#0PU 0S= S XPU0 30 0 S04 40@40PU Ö <†@† <00 P  P ?2Ά40 40Pφ 40P@ XPNU&11@F? R 0R Q pW P 1SpW Q0 K^P OU Y 0R P 0R 0R 0 PB2"22""22""20"3<–@ 0T<2@ $PP@ 30CS L2L"2"D2D"2"<2<"2"0$("($0S VP. $3 400$3  400$#4 040 <2@ $pPX1X!2"P1P!2"DPNU$$@Kl0KgPX0 PR0 RpLL0 R; 0R8{xu4 p4 0 S h4 4>3` | P ̽  @ Xt!T404L!d!,!p!84\4x444н4 0- 3Ls@  Y PP 0$# 040 $3  400$# 00 4 p-LM@PU`8  U p4@$([$[ꨄ$$ 0(̄Xt! 0-LMP$0@4 @0P (3 $0h|0Xt!4 -LM@($&$h% -QL,M@P`p?$38K 400 P0$3 <0K40@ K0  0P@80<  4$@T$3@ p400 $# 040 4@4 -@LPp`2 $@T`V@2 $@T2 $PP003 -L0M$34pK P00 4\ 0`2$8K 40@d5 4005Lld\TS   40@P@44 4 T4P4X44444 0-@X5Lsp ( b, PP$5S"d%X 040 d5S 40\5s d5 400d% 400 0n -LMP@Tp` T `dwdw4+`dp\@hh 0 `d@0S8`5d`V^,п4 4 -`LGNF@DTPp *0P 0S@T:W@ * R 0R @T:Q 0QP0 P 0S PM30I3 -LP -L Mp(0 p`6?P{ 0L@ @40@0PlP̆ $@0%P]1 ,"1Z,," @0R†† 22 d 0X BR4 h  1X!@0@KPP( 0\ N2P ܏ 0400U 400UoX,P)H&@#( 4< \N4N4$4 5$4,4D44 p-LM,2t`@0PpD0,2 L0 400  040 6($ -LM@PcU`p0  U Y4@ ,2/0R,2h0X04D\00 80 (<  0-P@L 0 0 0-0>0LM>0@lP0 l @0ŒQΌÌ QÌ  0P  0 04 -0L* -LM@P`p <0 ` p 0 @ @0 -0L MЍDC p-LM0`P@ (0@}0Tp' p-LM S `PK (008#8 X0$ S,  (@@H$H0 X@e0 X] 0X U 0XPMph(085#8$ Xp N 0- SL @P (008#8 X0$ S 0(0@08#8$ X p-LMP0S$`@  0@0 /"?C1t @ 0 (0 "1# 0S  @ @׿544 -0L h40  -LM0@ ( P 0h0h -LM0@ P(hph` \0 DX0S0  R  h3PK4n/4 -L -L$Mp00p@"0";S 00 0 000D0 PZ0D00@4B: ZR7  hD0(0Z(PD0 ڌ0S'J 1 `Q0@2 P0@L0 0X@ 1X$Z`F(PEZ@0K 0,0P`  0 h@ @0X@ <X@ 0X@ 0X@ 0X@ 0X@ 0X@ 0X@ 0X< à, Dt t0<K8 0` 4 8s0i 0^0 0j ]0 0UT4$aAi$4t/p/<4h4z]\q/@q/ 0-0L@P 0X 0X 0X0 Q0- LP ? #NDBK"d0A0B?@T >@P`P 0 p-LM@ 0PT 0T` $8  `$VpVp -@0㈠4p0  LT5 Q+  $  0@ T  0T  0T0  Td  $ P0 P0000S  0 T R 00Rw/y/y/ y/(y/Hy/Py/dy/_0  T  $0@  T@0  T0@ X0THßH#,0 S Q0Q 3 r  *T %< ! @Pl 8S080m0$04 40|0 00 `\0 L0@  $0`  T  $Z0P  T  $`0 @ TP@ZTU0  0P0  T  $0 0R50  T!0  T  $P  0T  0T $ 0P00 x0 @0 0 XPt2a4l]d}/[]L_4ȏ/x/L/4444404L4|2a'h44 0-@L 04 00 P 0 T0h p-0LMPU` ,0S PU@ 0@=f 08f8P<RTPlgpC%l]d}/[] -LP@T`p-` T 0@`(R 8S h - LMhş0 0 P)((, @4 L0qWH Y8PP= Qp5% 0 lZ   0 QA00 p0 00 5h 4 ,, 0S 0Sp) `p8$84l$P@ p  0Sp0 p0 HQ3Q p 0p00 0 H0S H!00 lK H !@TP0 @TT000 T0Hp0 Hꠚ_{]4 -LM@p0  0p0 p-L M@0pPt`x0p0t0880V @U 0@@p4N4d4 -PLM@D 0R@ 8pP堀`U UJ +<W0  p0 o0 & U*帠`0 x p0 0RTp0x 00 h `P"U:L0a 04000 T${]\&55 -L M`84@P㈠ $8 ,    $P  $0PS p%P+0 , 0  , p0 0p0| R,0H4, h0"2  $ h0!20, h0!,2P0 000 Tlp P0 0SA 0  $ 0@.0U:x t0 0Rt0x  $P0Ta90U, 0 0 000 TD0 R m000 0pp0 \&55$5 -LP `p $  $ @,o@ -LMP`pd}N $0 @T N0 T00 0 }N $0 @T 2i5 -LMP `p@,! 0T@0DD @T0 T 0T 0T @0T0 T $i p-L M@0K 00`@ 0 PP @ps@ TPp`0`@PU LPL0! 0Q S00 4 0p2al]2a[]d}/ p-LMd`d0\P P0P@ 404 0] 0@pv2at2ax2a{]2a2a4 -LM℠Pp@0 `V 0 98808 40P( (0px2aD{]L_2at2a2a {] 0 2ax2a0 0 2ax2a 0-LMP@`@P P0@8HH$KD 0  $@ P 90T4d{]M3M3M3/T/ =M3d{] -LLM \Pp@` 0!Pꧨ? Q-LhWR 0-LM@oPP0  00 0-P LR@ R 00Q |0Q t@@ @j R@80Q 00Q 00@YW ZW $ 0s 0s@M30{] -LM@T@T@7P $0 R T0@{]{] -鈠L0pP`Vʆ0dQ@`DgV Pp$0@A@{]M30{] -PLM@ 00h0@{] R-L 0 h0 {] P-0L Sh -2LM 2 "40 0<0_0400 4 a0@8 4 `0PQ 4 l@`/8<0H 8 <0 $8<0L < `T400A`tLV8 `Vp p00A`t4V 0a 0@Z 0T0 N 30,0 0$0 (@ P 5,K| 0T0x `'* H0-8 !< 2aO3O3/X/|]`/|]{]T4Hm0 // -L -L`< X@ 40Q@u gq< T d<p W41smp W@ T 40Q@u =T< T8@T00@p e8TL0@] RT  P Q18<Tq 1 S RP @TXT m81T?L0| PRH 0S l0USpt@ P<8 x3H Q@ 8T00!r @T U< 0 04p\0@4 0\5040 \004 , 004 , 004 ,@'h|]p4 -h1LM \1+R pW`Vp`@P, 0 4 08  WU5` c@ L \H XQ T@TPZJ5; 04 8,oE7$aAi -0LMS 7@h1 -LM@seZ0 h0l hꬵ/`/ -2aLMqP@4`KT01@T4 @1R@ T$ @1R @TZ@TT1@T0(@VUUU -P0 0S  0S 0S01|] 0-0 L0S 0S 0SQ001@  nbt PD00l/"b0|]Q0 0`|]Q -sLZPeT -LP T/T/T//T/0hd$h:4 0-PL@T///$/H/@P@0S @0@P@P@P|]4 0-t0L PR PD@EZ000 d0 000|]|]R R | 0\q 0 Q  -LDM2x0 \ t3\ , o t0"40t0 0_  3P;.XK  @0S S P@0'\00$?tt@ 2 0S0H1H!\11  |50|51  |5@0|5|5F@0 1/@ H_50%0P100\0\020hL1d! 0P Y @1 ,0S (,G\!0`/͊_0@@%0P0`@#Hh P 8`p@5͊P%00\`ꠚ_ 544(4|]#5(// 4ث4~,4JHFDd44 -@L`$P P00$ ;004P$ C$PЀ0 PUb p@0SP 0@ 0UP0U dpl@0SP 0,@ 0UQ(jVhVl]/Q]l][]#50 -LMD@!88#0!%PpPLH~||]_|]D4|]|]L4`44T4|44444 p-LM`tP@T6|( T dupTp06@00;0000006Et#00p44 p-L$Mt#P0@Sp8`K T0T80K@ 002K0 K1 KX0t,0 \P <2[2[  0u04\44 p-LMP@8`P+ 00 00000 0 0 S0$0@00 @ 00 40 ,0, ,00 40h0pp$/// 0- 0@ JLP 0h0r5 -L$Mp12l1,0,0 ` ^8p 6^~6 00@6 IP  ,  0$00$0  oO 0(+@ş@-,tP0$0 o0@ ,@0S000 2080 080 00S 0% 0p4 p(B4 X0 ,q P0eQ0<0, 0b0`0C 0P4 Q0@04@ 00 E<$ "X@0 0@e 4 0   Y 0 5p%p@ 0D80HP0 (0$ T@3 Pu0* @4 _Ƞ,Ƞ0  D L$0 0$00R  $0   0w  "$0 0$0400@ 0PI0 pp40 S 0!0(S Vڰ0S0K 0 9p)p @2 OP0.4@000 0S\0#1 0 0 1 0P ,{P 0 , 0(+@T @4 _Ƞ,Ƞ0  F0 pp0 0 4p$p0 0p p,@10000 90P@'00 X,q P@T0(T4 00Ś  0 6/'44444d4 -LMP12l1, p ^ `0@yR420 Pc 00 [ 0@@= 0T R P0$0@(0 T- 0 0$0@T  0 0 0 000 bQڰ0 0$0c }T 0  (00 W00  6dX @ 0p@<0@0$0/ H  0 ('44444(4 p-LMPJ `@I0 00$ 0 ( p(ph p-LM`J@ P.00000  ph(g -LM02ct$Y1 pP,` 0 S /0/x///8/// p-LM@0s |`|P#40!cS!0S0spp0 0S S000l]l]Q] -Lⶱ$0 h],=4/5P] -<%LM400 (,0 0 5 r "4"@ !$"R`5pK0$PP@ 42똔@T  0KG@P  d0 pK`KL DR R a $P_F@_T0 ST0S *Q0  0P l0S) xX dR R b NDLɵP_@_ήT 0K\QP 0SG  ̂2r 0 00S  `2 ,0S ,kL"|,88 #Čd2` 2a T@,R0Ÿ00 !((!4q"$0 T "U0s0 0 0 S00 0S񟗯l/l///l/l/[ ((0"4400$04 $@DOP  Y 4@J1 RP# P@0 开"4  0$|0 020$0 $ tpkh00 0 ld000ꠚ_Tn]_4d],}]й3444$4Z444h]l]D4t4X1#]444 -L$MP(  R 4 <3, 0 (0580SP540  <0 S2<0(40P0Z 0S20(8 ~5,0`D08~Z< I 8@ pH @ Y1T(0$<00 8 l@006H P H d$0D0 4 WH o@ x W 0BSEρ <0RfPWD0W00S H R:0(0 80S)8 0T0<0#@0(00 <00 6P\340 H@(0e?CT 43R 4 R$340 0@e?CT40SV 00:0034,0 vP4 0S8"S4 Pp(He/4p R!0S 000S+ .S( S p 0 0^ *0S R: Rx 0> p rS S@ 0R@0 0D0 dp0S  0CSSp0D 0S 0Sx  P00SR 0S 0SPx x  0S 0SPx x   00  0! < Q08 0000,0S0?0,080S00, 8444WEV4 4 -80LSP`p (0S KKT r> 1R0S RPV# (@2@R0`! 0R 0R: 0S  P 0 0 V08&e/e/WEV -LMp( @3D@8PھX, `L T(0 "<00 @ _5 P@jHo@ [ 0S 0S`v  P00SR 0S 0S`Pv v  0S 0S`Pv v 0 01,0 0T0,0 @0(0<00  5P@H( @0e?C\ 0R 0e?C@T e/000 4@00:0020S~P (HWEV -LM(`< @PtD8/\") T0S`Q@ 4<0(` 4# S0 S00Y0 4 80@4000;0000 -L M`, p^P@ V ,Q \P  0S0 00 (00000  7PP" 0S0 0p$P 0 0 @ 0㠡㝡㘡2a -L M0@S K 0KSㄡち {q Q-LpP 0S00@T 0a P@ 0T p-@PLMa `@@DUL< D0 < 40 Q$phD4T4X4d4L4 - QL MpPH<0SB8P@; 00K4 K400 ,0K( KP` (04@KP  @ P@ <Ep0S >04`0 0lpp@4(00  0- PRL R1<@T  0囹0  㖹0p0Sl0 0 0-0LS@P0Pxx ,0 S P <0 T  \0 0htFh 02l]0[]\&5 Q-`LP6q0<@T/ 0R 0S 0 㲰p0S0p00p  0 2p0W 0  0(0  `}]5 -LM@㱫p0  0p00$ (0  -PLM 0 0 P`W P-L`@ 0PU R@B $ph02T@D\&5 p-LMpP! PU  \ h 0 \2pp0,R 0 \p KP@@,`0h "0 T@D\&5 -2L@`p+  Q,10 XW 0Ra R R P-L P ?#?00cS0000h^^P Q hQ h - PLM@`PA T9 T# ,q0@<\ 0 ?01 <0!! <0 <0 <0 <0 <0(02o@ 0(@̵"P00R00S0P 0200 RpP0 b}]42a -LM0Pp 0弁p@E`Y@D0S0ץ0CS`` p0  00CP0ҥ0CP0p 0l"!0pP (0 o: (0 p (00(0o}] -LMܠHp0$H 400pP` 0p < P)$p 6 :w0 `ԲP 0}] 0-h0 !Xp0 L0  8#UP@008#HT}] -!LM0, p 0岂@囲1 8C00C8#0 p04`0p0@ᡲPᅲ  0 P8  X#, R Z 0J  X}] - LM0p 0尢W J , 0 8p C04p@0`]PA  0J8 P #,0XY0I }] -8!LM`p0 P@10`00C8#8 4,0 'p 0P  00 p04`0p0@ P  H0 !0 R8, Z#X0H}]P3 -TL M`p0  @JXı 0`8#84,0 Աpḱ0P   00 40 0Jp 4p 0`@ᶱPᚱ \ 0I!48#00 R, X040S0C040 4}]P3 -LMܐHp0$H X0`40倱pd 0p 8%X h`#80A40fpJ  1@T@}]P3 -H!LM04 0A-L`p^SgF0F0F0F0F0F0F0F0F0F0F0F0F0(F0(F0(F0F0F0F0F0F0F0F04F0F0F0F0F0F0G0,G0F0F0F0F0F08G0DG0F0F0PG0F0F0F0F0dG0G0G0G0F0F0F0F0F0F0F0F0F0F0E0F0H0H0H0F0F0F0 H0F0F0F0F0F0F0F0F0F0F0,H08H0F0F0F0F0F0F0F0F0F0F0F0F0@H0LH0TH0@@( 㮦p@@pp(0Ap0,0Ap,0 408<@@P< ,0@P `0Q0 X0E\ E0E EZ,0  0@ 0048<@@ 0Q`0 0E EX0E\ EZ,00,0,00c00L 00 D00cSP0BQ0 0S 0 0CR0T00T0g000( , p~ p|000t0X0q00\0l00%AQH0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0H0 I0H0I0H0H0$I00I0 0t 1` 0p 0x 0| 0 5Q0p 1`  -LM%A@5Q6\J0`J0`J0`J0`J0`J0`J0`J0`J0`J0`J0`J0`J0`J0`J0hJ0J0J0J0`J0`J0`J0`J0`J0tJ0`J0`J0`J0|J0`J0J0`J0J0`J0`J0J0`J0`J0J0`J0`J0`J0`J0`J0J0J0`J0`J0`J0`J0`J0`J0J0J0@ 0p 1`    6Q-L 0S R0  \Q-L 0Q 9Q;Q000 00 S0 0Ä0$Q   0 S!01000C0pQqQtQ 0SS0 0  p-LM3A@QL0L0hL0L0L0M0T0S PU:4  0e P 00T0p00 0 PU:T0S0PS J  0  PUZPU*`400 00PU`: P0 300CRT0 0`V*P U:`V:00000 E00PU: 0 !0A- LS/ O0 O0$O0 O0$O0 O0$O0$O0$O0$O0$O0$O0$O0$O0$O0N0N0N0N0N0N0N0N0N0N0$O0O0$O0$O0LO0LO00 S!ʈ01000C000000 S0 0Ä0j -P,L@p`/V 0@S #(0ZS\  ^`Vp,0@T01 (T01 }] p-LMH0PUP!`e0V@ D P0 S$D 40P\ 0T0pDP\ 0 R 0 320CQT 0pDʨ p-LMH0PUP!`e0V@ D  P0 S"D 40P\ 0T0pDণP\ 0 R 0 320CQT 0pD p-QLMP@K :Q P\ 0 R 0 0CR0T0pp0T0T 043 -L 0T@R34 nQ`1`!Pe\ Ġ$4 T@44$D 0 0aRP 0CS00P0 0S 0 0CR0T00T0 D0R 0cS0!PcP0HQ DQ0S, 0Q01 c, JQ KQD,( 0HSD 0Q   B P R 0 R 0 BS T 0T S0>"R ! B0,0 `0T00 S0R !0 TS2 a0 BRDPH@0S 0 l eR`1`!aL^HD H@DP34fQ @XQ- "PQ(0T@PS>0 eR`1`! b\ Ġ$4 T@>$f44$.cQ0S$ T 0Q3 0/S5 _0_0$_0$_0_0_0$_0_0$_0$_0$_0$_0$_0$_0$_0$_0$_0$_0$_0$_0$_0$_0_0$_0_0_0$_0_0$_0$_0_0_0_0_0_0_0_0_0$_0$_0_0_0_0_0_0_0_0_00@VP `VXK 0\@K@IPX0\ @004 8PJ?<4H4i?h?l?p$? -LM@P`p 0@0 00P+ 0@`@ 0@@`@ 0@ 00@p@`00 0 0-PLU@ U$L 㹟 ^0 /R 19R00C P^L0 0 C000^L00C4AQ$c0c0b0c0c0c0c0c0b0c0c0c0c0c0c0c0c0c0c0!R,00 ,R ,0,00,0 p-LM,@AP0CQKLd0td0|d0|d0|d0d0d0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0d0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0 e0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0ld0!R@ ,R@,@p!R@ ,R@!R @ ,R @ !R@@ ,R@@T@` @` 0V!R@ ,R@ p-LMP@p !0@Tp`@t 0!0@T@`@x 0!0@TphT3U3 -LPp@| !0@TDD@`01| 0 !0@ TV3V3 4S!3=8S>08S, >8 ST3T#1 $t2Q h2Q `2Q L2L2H2@2Q 82Q,2,2$2$2222Q 2Q 2Q111Q 1Q1111Q 1Q ʼ1Q 1Q1Q 1Q1Q ʈ1Q 1Qx18 h1Q `1QX1T1<1< @1}<1{81y41w01u,1s1k n1!10 101;C h~]@74444444444444444~] 444 4$4(4,404X_X~]53 0-PP0@0 L '* 0hY 㩄 -LM0S@PM0pQ- 0S0%\a2Pa ܔ0 0#r UP 20`00Spe00P0W0SPUUP  `PP0U\\ P庢P`0Q ᡔប#(44 -LMP@pᐔA@` 0R ႔ 00000 Q- LL4 00sS0S  -0L Mh0`p d 0Qx\x  Rp100D d Ŧ00 ` 04 0 800< T0 P?00 lP0@0|0Sx @0  i0`Ph |$+$00 000w8t,־X4X_Dp0~]~]T4~]X_`44t44 p-H@LM 0`PW$ $$P`0 pX_l000X_ -$0@LM@@@0@X_X_ p-LM@㲓0`S hP PU00020PUh(0 0 ,!ph钓5Mb p-LM 0 Pp 0SPd0@@SD1  0S01P !,0 S P0 (pa0`0CS00H00 R000S0S0 2c1PP=\廿0$ 00O00ߥX_l]u0[]544 -LM0@Sp. Q' 0 fPPhP D1P 81 ,!i醥00!QC`V00h0`VhP LT0S P0`@`P ?#<0 Pc 0U   pgP<0S0S 0$ i韑00ߡ i5Mb4 p-LMh0PS`pj<@V0@@T 840<@ Q- L0S h0S840 0- ((L" P 0AT 0S 0S TPU@T bP0000~]@- @.@~] -LM@@00NT -t0LM Ƞ Ƞ,A0@S 00080 0CS0 C ~]@-$ @.MЍ@~] 0-LMP@@ 0@0CS00 -LM\  p0\ 0p  0 0S0\0(0\T$1  P ~f}fvt -dL M^P@`p C@$^> 4$^ ,4^00 84p 0  84l p 3^ 3^ 00 3^  00  l|<3^ _D3^X +83^ 0S!1p ᕀ h=P`   ᵞ0 2^㱉P`X P X2 P2"#  02 (2a"# 00000qy |1^& 1^]n l   0     0 0 Qp1^E0\0 ! t=BZP`C  0p    t  0x0 00084- @< S 00 K  $@ qP`b0@? 0< Si< 0S dWW @W W@WW@ W @~]W@~]W W W 5MbWW W- 0 Ƞ Ƞ,@~]D0P  0(1S h0SP~] 0-L0LM@T@0P  hP0X_~] p-LM@d0QhPPSU h`VUhPP h`pU 0 (ɼpph`Vp44hP -PL Mp @0P0^ 0@ST@0\  <@~]~]P ,0R0!R r~] -0LMP) 00S P" @P`p0 KS0C$ K0 0l $ 5000 0* R0 >; S  X_X_~]X_X_ -@0L R 000 0S 0S 0X_X_X_ -4L,\ \ X_X_ -L MPhP@`; S, $ R R R 0 @@ @ @ @R <0T 84  0<@ PP PP_ P  @0`0RQ 4 0; X 0 0 @@ @ @ @R <0T 84  0<@; S) 0 @0E U  8:S00SP 2UP 30E8S0E8#X8UP 008#XQ0Q12,R0T0 R002Pp 0 ; 0 jl2R d2Rc0Sz 0 ; 0 Z RSp,"O <600+00S 0 00000S 0 00000S 0 0 0 000S 00#00S 00#00S 0 0@0@000S 0 00000S 0 0<<00S 0<#U 00S 0;# 0 yU 0S 0 R R0T0T00S 09#,pK | @@ @ @< 0@U 0 <0T84   0- 0P @@ @  @ @RL <0T 84  0<@0R  Q 00# 0Q 0 000 -p!LM04 S\q1Tq080 0K  8P`@`V@DPEAJ3[ S"[00b0cS  0KX8@ @08@ 040`၀?000 R # 3 R?H0`?À 4@ 0R # 3]~] 4S @08#<@8oS: S>; S P 0 R0,RX3 -LM@Q 00L0p000<0000000000000000000000 -<00000@ L `+ p\&0S \\ 0PP*; Sh!,\1R 0P: R: S:#:A >; S= ^; x   Sp , d0R P0 R:U  hK P0S r  4 p-LM0`PP@ S){P z0\  00  00  0 \p -L,M@  `^Q 0S `^ \ ^PK aQLXPpPKa @0T*<@8oS: S >; S|p2Q} @ T:XZ WePKa @p0T[* ; S1QO: Sʠ,ʠ >; S<@8oS: S <= S= 1P: 1P7 |1P4 TP*00@ ;   S 1Q P0 R:U 1 c0 @0Tp:XZ 况 10 p@: S:#: >; S Pw: SZ%Zr >; SPPm0Sb H4p40Q 0`c -LMpPW9`0S  yPP/ 0P0!!0Py1@ iyP  㚒U L0P1 1Py00 ]]44 p-LMP`0@T aW}fvt`WbWcW -LM`@`Tp P 0S   P0 @TY P -LMQhpp``WP: hZ5Whp  崳`@T 0S V 0 R0 R @TYW  \唳P0`0 RhZ44hP -@LTPp`u 0 S  0 P@ 0 P@  P@,J 0s P@4(4 -L M` @᳆, P 00CS (R4 0 pp\00 0T@ X 4$0Q44@8 8  X8   0gB 4@ CD$?1 c!@HL <0$ 001T0$ X0($0P b 0\`0d0 <0 1c80@ a00 2 Pld`40(!S$1 01!01 !01 0 0 0 0 0 4 0B SЦ0000000000000(0,0(00(0,U ^ 4 ($ްĨ0t0ԩ0L00H000|0L4 0-L@0PS  0Rc0Q 000 0 R@-@0P 10RS<8 00\3 000<8  0 E-<p$@RL1P̂+X 0`5%7,@Dt" X P P 00  0 0  00  0 0 Z 0P0@DtA A"0pBP@%,`c -LMX$`$pT`FvC%B$  ᚒ`F0v@P -L(@pP`0S P$` W(00(0(00(0G-PMPn `PT - ,p 000. 0G 1(/` 0@W0ܕ0܅  gS220 R0ܕ0܅ b BS22 0 R0ܕ0܅ b BS22P P P 0@S ("("48<#8h0^@`Ѝ1h<4<("4! 0P8 NPc~% (p# $Q@0N0x0~  01x0   00x0  01x0  00  0L00000 00000C0NH0~       0N~Y_Y_lY_Y_(0$8 Q!0  Q: m30@-P(P  $08@Dt @\ 0 0 A\(@Dt0 p-LMP z80`@T  @TphvzY_-LQ@0 0R, 0 S Y_]Y_,0 P 0SPY_ -Lp `PFz0@T U 0$ R @T 5zV 0 RX 0( RW 尃P zY_ -LM@ P`zpP@& U ,0U 0SE0,PV 00V 0S I00`00("X0yyP -LP p`y@zPU10  yU 0-@L yPeP@ 0C(S"H y0嚤4@-0S4 S/0!0@ ^@(00^$ 0lQ T00^ 0@bS 0 S00T0P00SS0X] -LcM✁0P@$0 0@@R00}/#\Bp1pTTpT Lإ0P0 $0S 0$"p ˥a@0S0!0000iK1 04 0P$@T0S 008 R 0  0S0 00C0:p&e00T 80P0D吥 4勥0P0ꠚ_]444T4P]=80404 p-LML 0 @x@dQh`hPhh h0^ pPdP 8\4,W(\40]3a`0]P4X4x444 0-L@x0PS0000 0@@0Շ0hx3a -LM@x0S R 0 00  0  hx3a 0-LM0? P 믒P0SP@002c1 , 勆P0S @L@喇id54 -LMlx`Pp@ 0Tp  R0000 0  Ux QxP@[@T3a4 Q- L¤4 88#$R\\ 0R01SP0SQ 00]]3a - 8LbMؠ8#P( `P0 Sx@jKq0S|||  0#@P@ wT (0 S 0(廌 Bz@ꠚ_]44 88#P0 ]3a -L Ƞ Ƞ,4MP@p <2 QPPy(2Q 2Q 0ό1Q 0B~S001<P   0 d0T N  VS00< R V P0KH0 @0KP T TD 0 ,p L` 8` 4 f00S 00<1 QP0T0 V 00S X gTH KyT H KyPT H0Q @0QQ(0$0p]UU@Ut}f~f3a0 0 4 S-L@PwA`p <0 Rp wQ \]3a -LM@vH 0S00  Q0 0 0S00hv3a0 R=  0] p-LM1@s 88 #4 pS0P`$0<`80v00@v 3a] 0-0 _0LS@ P0S 0000 8T00 0S P0S ?  ๅ0 ?అ p-LMX`0SLP-@ f1S0P.f00C0p]] 0-LbM`P0PP@0  cK T zfK' 0S +0 ꠚ_4 0-LbMPP0 @ bK0 ~fK 0S  0頚_4 -LcM耟0k_K`$0 @PK faPe-p၃`v @0iK0cS0| 0͇1p,\wX0 P v $0S ,$ϊ/ufꠚ_]]3a3a,4 -L0  p-LMQ@@P Q pTP L0S X R 0`S 玏X `1PS-p 0-LbMP@0 @S0 4P0$L0S-0fK1 v0 S `y00H0@ 2c 1奃P eꠚ_<45H4P4 000] 00C0] -LM  -LMPp\@`  1P& 0S \ 0S K0 P  0R 0 0 0 0 0 00  -LMp $0K`PP@0 PP @ @` $ $0 $P$0( 4$ P@0 $$0($0 0- 0 0CSL@ 0P U R 0 0 0 00C00  $Ped 0 -LM0p$0 @R F? l1 R001 P1 X0SP PR ,@I )o00XP!U00R00S@U2I? PePU T0S # 0PUYχ 0 0S 00 4 PUT T 0U 0 13 p-LMPP!4P L0@`TeULP XPephUeUeU@T4 - @LX `Rp 0PS 0 1< h` ፒPQD冒X05X01X P1Sx444p@-|` @P  0 Č$ L0#Q `P8Sp0 S0S Sn3 -LM@ 0 S0 S  -EMLM5BNKP@D@D;`0P , * &00p>0dt S S$40$  VP 0S  t Lğ,0 S \,TzKL LD4h (K_04(K)@(KC>ğ@(0K pEKğE>K0CI ppK 0KI V0LUpNB#(0KZ00P00SQ@ TKNN?>1 1DQ@ T # Z308#Q4ß4 嬑Z 0f MTPp 2THh 0S00S 0S E.K B BP| `RPh 00ST rW fT0T0`840` `PPP 00>0S S f SPd P010  P 0S}?d0000d>0S0 Sp \ T @ 0 T4p090 CP@ Tl 0 01 0CĠKh$UNK V0L\#ꠚ_T4<4N44C444443h4 4-1P44441144$4 -L MT p, 90S 0S,`0Vʆ0AP P , `0VT 0 DXZ  P T0S  0S<  3 K P  T儐 TP 0  0 00  `PP   b q Y  d _ d 0SS00D :4 50 H4d44444 -00QLT0 Q S R 1 e!\:0> 0C0 n>S -LhM ` PPpK $P@ < R RXp0 SD0Sl -LM 0@S b P 0S0S   -MLM4 P0p 004P( GBNK@D@D` ;k0` c S1P 0 S Q0\0 (0S p(u00S< L2Rz KA!-K A Bf0@ PP @DHL1@?1,4,] p-LlM0 d0 @P`KP d0T@p -QLM@ 兌0S~@4L4 -LM 0@~  ^ 0 S 0000 p-QLMP Q pP`V@*T0!@RT:0\0yP`-p -P80PL\0pHPP` V@*T 1S@ T:0 OxT 01P`fKO 0-LM@P0K  T TP@ P00C0 Q *T0\ 500  <080\4H00L -LM50`p 0P5 X00SX0 D0 Sf oN<@4P@ DH80@ @Pf @N500508pXp@1 0-50L0@ 5 X0PCUXP80S@0fS0N@Pm88P -LM4p^@` 00 4`N40P 0Ll004 40@N -LlM 4@T`pK$ P 0 04P $0S $$s@KPl4@Kꠚ_x4 -LM4@04 0P p-0L M<00@00 P4 K K0` 0 0  @0  0D D 0H@pF14Q-0 Q0 0-50 L@ 0Ppp ,0 S P0 0S^0P0CS0PkmF^l]F1[] 0-PP@L 4|0 l⠞x0S 00ha]| Im 0- 88 #PL!*0AT 0SPP 0P mp Df 0M|0L0|0xP 00] 0-D0 (("ALPtPLfMxP0] -LM⨑|0P, @p 4 @0@R@`K0 P@ $`,0 S 4,r]P0S@P`0T!8|@|k0pSpW)P0S ]P R@W00T00S KP`T@!T@#  Y  _PpP R@T|00|0 s]#ꠚ_44 0-X0L Ƞ Ƞ,A000|0P0CS00] 0-0PSL@D0 TL_ R0 0L -P   0-X0L Ƞ Ƞ,A0000P0CS00] -LMx0S`P(  aX2Q 9L2Q( @2Q (0 S $(q4002Q0S|00|04 @0R0 K*Pp-|00K K0r0 S;#0 0 .jt1QA h1Q\1Q% T1QQ Q@00 4@0@T@0 TpW  jQH0D0Q Q@00  0pQH0D0xP $1 QPx x0Svx ~ꠚ_}fUDU@4Uvt~fUU 0-LM\ @.Q@@?0@0CS00 ] -0LM Ƞ Ƞ,Q0S@p :\A ` P0lS`-\ ] 0-0EϠ30 0Ā^P1 S᠀00 0Y (0 , $@ n FnM00FH 0K0s| 1R14T43ap3p3p3Hm0 -QLM@CϠ m? R  0S T @ h/ Q0--0L@P  Q 00|1Sm?@u p-LM1 S@P\`|P50pYt`꣇X 0 43a -0 RL`p@ @*PX@ P 0p000 @WP:!YhE? R 1S 1S 1S m$>FOm\ _mm`m>FOm Qm00BaT15Q -L(M0PS`Z LpX @ W*0@ 0SLK S <00p0 T:!PiP @T*0P\?@T:@T*0\%@T:L0W 1S c LKgq@qZTP LK0|  @AT_ZQ*0P \ Q:0LKpQ*0 \ Q:0,LK p -LMm? R`1S  K` T!R\13 0K <\ 0[D!2 0K HQ 0[P!2 0K K07`0 Q-L H0Q 00(0Q`1 W@W@ W -0PLPp@0S' p+0\1c?@L`c a6g 00@W0@m004W\B00Z_Z_ 4 0-LM00P@K4iU Y4 000?0Y 00CZ_ 0 3a -L|M`K0 K' JpK@XpPP< @0S<6[S4 t0S 8\X 80Kp[Ƞ 80S4^00 1S80KḀ@40Oφh P40RφL P40Uφ0 P4444 4 4 0- LP@0PP 0 ZP 0S 000CSPPP 00 -LMMBKHH@` ;, _000 4 080cPPXY\` 0X0 Y 0\0 ` 0S4Pp X0S0S  S0 ,0S $,mX0Y0S 00CSD`1T`1T`1L`1T`1\10Y0  X0S SY00CS`1 `1(`1]10`1#0 U 0S0PU<0S =Q X Rs R00c 4D0 P;4<@0 P4X0SJ 00Pp$PPp& UX 0S/ 6S, 0S' Sx2Y T00BS ^1`^1`^1^1^1L ᰄ0 u  (姄nP 坄1P X S4>H0 P _P=  {D>0SA 4HP 0 S00S=  X0S 0PUh 00S> 00S<   NPL @ > < : 8S)000S PS00ꠚ_T4<4<4L4P4xG4\4`4z3x4444z3444 4(4,444 -pL`@P@P(PU@ZW0@0CS0vWAT P"G0W1 !0  pp@ -Q L1-  Q S 0S q -L`p@PPPU@Z@P`@PPU@Z/@`p p-LMP @ 0`@TP@ Ƞ,Ƞ 3P@@p p-LM@HP8P #8 T0 000Pࠁࠓp -LMP@U`1p @{0<0L00MQ0PNPOPRPSP L0 -L ML0Xp 0 8@8P`DD!LMNORPPQ@S` -LM0p,  40 0`0  N=WP$ FFFL08 >0U0d0S B0e f0C 0g 90K Xh 0C4i0 j k000mno@l`9pK9 [qp , src̀00`040080@00D00d @#0So] p-L M0PS@- 0BS|f1g1g1h1f1h1j1Dj1j1T 0R0P RA R*R# T00CS000@  0PPpphC0\# | Uc 0 /T T 0Q0ph ;cD 0@@@ 0@ T R 0\`@ `@48" <S^  hi0jk 48T0Q0M 0 -~44404X44 -L`M`8@p08P^#K DD$K$K0@K PKK"`K!`K`K`wP@ P [ P@4 -8LMȠ,Ƞ#83 ,z3 -L4) 0-LM0088P?0@N0K0K KKPKK0K@K@K@K*0 -LM@40S0Y0 -LM@0 04JS00X0 04JS`0:`0 0-LP000!0(0X0,!0@08 k00CS00 ]|M. p-LMP LB@,`( M[ I[&1<09@00 10, 0 `A00$P0phu1s1 -LM ` p0S= @0SK $P U 0; S  SU:0 0T@ D`00@ $P0T@ P`P@0S S, 0,0000R@1}R0~1@0 |u14<0S8<0ŧD -LM`q ( SC,v1u14v1v11  Q, 0 R 0,0000HR@Z1mAR$0Q0@DPA Z D 0 2E0HY0S4  D  @`0 0  T0|v14 S00-1LP0RR00,0000R@10hQ 0-LM =@0TA KPK0K 0?0L0K00K0K0K@K@KK@KPPP[ -L M =@TA K0K ?0L0K00K00KK@K@KK@KP0 [0[4 p-L M =PUAd0 K! K p!0K@0L!@[ 0K00K0K`K0KPKK@K~P p-L M =@TAT0$ KLd K p@0L 0K00K00KK`KPK@K$K#`KKZP00 p-LM P # H`@#b@TT !phy}4 -L`pP@P@U@2 020 =ꘚ_ -@ LM@0 =20CS2hꘚ_ - =pLWP@`  %S@ (O\`@(@TT &H$Hp}4 -@Lp`P &L P %# (DP@(@TT hF}4 0-@L}_ 000S5  006S$   ` =PU? 0h87 #80h | 0@-HP@ 0, Q ^?0 -04L P <4U mN @ @TaVp `4<4 1_0SA@)0!gVp`4 -LM@ X{ T hO p-LMP D`@ @TT ? ~$ ~ .& ~*? $phU V|' 4 -LM 0S4D 0 0P 00ꐀ3 -AML M∣BNK`@D@D;Pp , P%| D!| >P@$=?/@@3#2"0RR"@;C.K B=P@#0D >8?LbP!2 p/p0`TkX2S \2S `2S H{ ,0S 0,%dNOBNK@D @D@`? {y \1!0p4 1!0  P0P]1}o!4018  @<0 !1pB 0FC$ R "0A"%B58? a1  NL 8KP 0 S00S\" 0@T~00S`"00SX"  `S{xꠚ_T4<44411T4\43V44p31h11z1x{1 |1 114 -LMp@0S}o0P_aLLN4@ dCcB?Z5"0 BR0",NL 1Q-0 Q =0 -RLM`pP P$ ; 0 0ㆫ P_N@@sPWNU2 01RN 101LN$0001``` `CN@$s$;N$ R 1 0+10 ,`(`|15 p-AMLAO0P `0 P 0 C400h\\  P202pZ xLp'1`4 -LM@ = R#'> R 4+Q P 4;4Q 0S000C04P4 ;$4, - = LRP0p}4@@ /L$yo @nTڴ4 H " b7P9 7P3 H R  K DAd2S 4O@04$ +$K^ Xh^T0mh^P mK(Zx x4|154 p-LM@? ?PEPP? 3P<PP? *΄%&Pd @roPP ̠d ` Pps 4xpl h 괇11444 0- = LR}_'> ( R $@T A0@T@0 0-@L}OP@000,  0 -P =pLP@`wMK1TZ1TD*1T4 1T ` `2i 1i i i 5i i 6i( p-L Md0@0d0P`BwJO0 K` 0SJp94 -LMP0p@ T J]dPVhP=lP$`PPP`PP |P'.4=4X|ZbR됂TbP leP0l2: v4 vP hOP0h2$ xv dvP d9PdR ,v  v(4H4h44442 020 6ꘚ_ -@ LM@0 620CS2hꘚ_ -L MϠ ^`Pp  @0?0(0K:4CʠHC6 GD(K!K%K#@K"0K'PK&K$pK@T -LM?`pPP 00S S @ @K@K 0@ K l0 PT0@U0[ [0pXv 4 -LMϠ P`UCĠp@ K 0Kdh 0P} K L0v @40PoXT Xu! 4 -LM$26S0 00 @T0@Shu 4 0- 0 3}_(0LS $@T ?0@T[>0 0-@L}OPz>000,  0 -LM?D 0Rp( 00 ,0  (0S (] 04K 4 [30[ d1Q`hU&h@ P0K< 40 0 W0Sw90KΠ =0!U @P`ꠚ_<4 0/QN -LM 0S0 0|P 00@3 -AMLMlBKPHH`;p , 8u0X2 6P@ #->@"0@b"42@/2b6P@ Xt ,0S ,B]4R!28 p/p P ht0T8P 0 Sz00SD" n0@TFHBNK @D @D0@: 01Ά3 1Ά0+!?PPPC8ty zU  P0`Vd10p`!4\1 X!0T1}O L!40H18  <0 0!01p: 0 +<$ R "0:" ;n.8 *gZ0  G4 g00SH"00S@" |dVꠚ_T41L4<1T4|4>4`0 481,11З1Ԙ111T14 -LM00PS0`*[Z ? 8PP9LP4TP/4 4G2p0CS2+4@}O L<K;7B.2 0CS 2oG4 mQ-0 Q?0 -RLM`pP P$ ; 0 0g P@G@!lP8GU2 013G 101-G$0001``` `$G@l$G$ R 1 0+10 ,`(`0-LP ,@7P  0S 04P7  P 7 -LM&N0 S  ` 4P7  eP7 p-LMP@2 01oQ07S\0 0\0 ̠8@L0 @phz1 -LM@?pQP0`4@ R# RR=PU L̠ A0  @`L= r,0K ,0 S\00\0X00X0`,00 0 , S,00C,0 >F 7P\00\0 4P 5 +F &14 -LM@?P`Q0p FV VViFd00d0X drV Pm4d;4 `0S`00`0n4P? R4 -PLM@. ? 0pR)}_*n% E ; 3S ~X dEX`0FXiE ;,0 000S 30 3 R .x15 p-@MLA&N`P 0 P PHH  0S202pp'1 0-@L 3S& 4+#PU 0S0  00C0P 00 4R ; P4P 04P4 ;$40% -LM0p4`@@ @Ep>7PXm \7Pg 1.0 @*!0 @#!E0 @4  0@ =8? P X q mD?8%> zP X O̠L    $*^@ $4 ;4D VWW DPW@0mPWX,Iq4 4,41x15L4 -<2LMQP@p`o2QY*2QI 2Q `$: = S$ =@S @ 8C8`\2D$\2  0 K [ 0[40 yP\2 8 0 Kl[ 0[ 40`@ e4040 R0w 0T54P`4@`05h0Q \0QP0PLՍڋ@0Q}/ 0p7`2i 1i i i  5i i 6i( p-L Md0@0d0XP`pD&N0 K`I 0SCp}h4 -@LMP0p&*TVLPUPP<TP#`PP|Pl`PP dP #4=4d궞lb|갞b!P TP0T2X 5pX /p P PP0P2X xpzX dpP LPLRkX , peX p4444484 0-LM+>@0TA KPK0K 0?0 0K00K0K0K@K@KK@KEPPP[ -L M+>@TA K0K ?0 0K00K00KK@K@KK@K%P0 [0[4 p-L M+>@\AdBT0 K  p@0  0K00KPK`KK@KKKP00 0-LMQP@ ?0@00K AĠ0EKK@KPK0KKK0KP0 0-LM?0@P K0K 00KK@K@K@K@K@K0PS0^o0`4 -LM0p4`,#> <4 #>?\ !#>@?\ QU@ P4<4$ #>@&3;;10"  Q0S 3;;!00U@P485 -L M+>@ \K @0 0K 00KKKKKKKQP n 4 -LM 0S4 0 0P 00X] -LAM•BNKP@D@D;`p ( $Hn <n P R!2 p/2p-.2/1C.K2bb BP n (0S (V4@Q0PT4NPN 0 SB00S" 60@TBNK@D @DAP1 Yny /O0 0@4 0 0 P 0`PE(1 }>T0  A  b00S "00S"  @$nꠚ_T4<4441P1\44p31114 -@L}AT`   0S0P}A4p@ 1<(00oA  3Q-0 Q+>0 -RLM`pP P$ ; 0 0n PGA@(fP?AU2 01:A 1014A$0001``` `+A@ f$#A$ R 1 0+10 ,`(``LVp0@ ;@4X;d4 XXm.@d00d0 LlX (`00`0  0S iD4P+> R ? 0-+> LRi@0P 0h0 0kh0h0m0h0h0 0h0oP\00\0 p-AMLAO0P `0I P  0 C40 (\\  P202p 3l p'14 -LM@+> R4+Q P 4;4Q 0S000C04P4 ;$4 -LM+> PR0p4@@ m?" -yo gd@'Tڴ4`   u7P5 K7P/ p$ #  "  $2S 4}O@04$+$.?Q DQ@0iQ P i?kx4154 p-LM@? ?PP? oPP ̠$ L Pp jkp $144 -P+>LP@p`k>1T\1TF*1T6 1T ` >$% = S =@S @ 8C8`p2/$p2  `( `hp2 ` @ [4040 R0q 0/4P`4@`0/40T(0PLդڢ2i 1i i i i  -LMP0+.@|To d00d0jL>0 K p 0S9>4 -LMP0p@` T}P$PS(P:,P!`PPP`PP |P4=4|b됂bZP ,P0,2 nj hjDP (P0(2 xXj dRj.P $P$R ,Cj =j(4H4h4444 0-LMP"D@0K 0KK@KPKKKKK0 0-LM8QP#@0?00K@!Ġ0%K K@KPKK0KK0Kl0 -L(M`0KP@Y$0[# [4Spid4K8 KoP@ H@!0i4Pp,i 000 P@6 0  P@$   0 P@ 4, n Li4, ( 4444@4h44 -LM04P <4#Π000  m@#.A0T00p` @ 0ȠȠ W p" KP `45JT@4#N<4 4 8  #8! 4 -LM @SP~/gP (i h 4 -LM 0S4! 0 0XP 00̂3 -LMpAP K7P  h `0@VJ2S 2S 0P|1 fy+P4P H<L@``,P $hy I1!0@4 1!0 P 0pJ"Z,0  "< uP 0 S00S" 0`V00S"00S"  4}h4\4444p31p11q4 -MLMBNKp@D@D;` ( PYh Uh r0Sq ἀϠt开0\d > e (0S <(P"-hꠚ_T4<4441_#5,4 -@L;42`Shpf0P0S 4@ +Q"00;4+042qQ-0 Q'>0 -RLM`pP P$ ; 0 0 P^;@?`PV;U2 01Q; 101K;$0001``` `B;@#`$:;$ R 1 0+10 ,`(``LVp0@ T:4X;d4 XXmG:d00d0! LfX $`00`0  0S >D4 p-AMLAO0P `0㐖 P  0/"-C4? 0@ $\X  *Ph20h2p vfXp184 -LM@'> R4+Q P 4;4Q 0S000C04P4 ;$4% -L M0p4P@` 9@yυ 0@ #. 004  00 @ 7Pp y7P  2S $@ $4;4i9 P  ex44 p-LM@? ">PP? oPP ̠  L PN|p. ep' 144 -P'>LP@p`j591T[1TE*1T5 1T ` $9$$ = S =@S @ 8C8`,2N$,2  #>  M,2 #>  @ [404.0 R0"l 0)4P`4@`0<*40T(0PLեڣ2i 1i i i i  -LMP0'.@|To d00d03e80 K p A0S84 -0pPLMT@ PS$P:(P!X`PPPPD`PP <P4=4X R4+Q P 4;4Q 0S000C04P4 ;$4/ - !LM#NPp `00?  P ||  0SP20P20K# p C'h1 -0pPLMT@P: P!$`PPP<`PP 4P4=4N4PPLP@p3 60T 0T  640440 R0@ih0T\0QL @ @ ai i i -!> Rd00d0[b4 -LM0`4P@ 57P: 7P4 <? =Pp 5bi5?? ,Pp tpO0\  p$@ $4;4 bx44414 -RLM`pP P$ ; 0 0㒒 Pk5@LZPc5U2 01^5 101X5$0001``` `O5@0Z$G5$ R 1 0+10 ,`(`PU`0p a44V;T4 VV d00d00 `V I4 (K 0 P(0Sd0`000d0`00S .43 `D4 0-LP@q 04 P*0S 0P:00SQ-0 Q!>0Aq- $0A0 0!q "] -LM 0S4 0 0P 00꼃3 -AML MⰣBNK@D@D;P` , pxG` lC` `P@PL#?@"0R0#@(3/@C.K3S B`P@840400 `4 ?080@0<0 `Tt80sn <0sk @0sh 3BnK`F `F 0P@Q#,_ @ tP2B2tp"41 !01o !4018  <0 !1p0&  0@s'$ R "0)&"R&e# PE0 2*3 Լ ,0S (,G_ 302_4hP  0S 0S 0@Ty0S@0S80S0S<lo_Xꠚ_T444 2 423.4H1x2|2 2 2X 22 2(444P4d44 -@2LSPotPzE00 22p0CS2X4@ x'w&#n0220 K -PL M@`P P`^EtF(K ”?00(0K%K#pK!K'K&K„$PK"`Ka2P0CS2, -PLM@p` R`pUFG,K @00,0K)PK*PK+K'K%K(`K&pK42P0CS2 -PLMK B KT0  P00[ -PLM@p` R`UGF,K @00,0K&PK+K)K'K*pK(`K%PK2P0CS2 -LMP`B厏Tj1p0/y 0 4 T  7PE 7P = y} u m &H0S D0SP4P@@04$+$1JD TDP0D1^$< 4x 25x4 p-LMBPT p+ >$ 64`0@  P7TphK7'Q-0 Q0 -LM┡2 S`( tp4 U  <4   (0S (E0K {9)[ 0)K0RU@ P4<4  0 ?0S r!?0 00U@P4 ꠚ_4 p-LM2`SP4"8 "4D0 LP&4<H0 EPOD0|  `宼ܻ20CS2pf ,%]` p@244 -RLM`pP P$ ; 0 0㧍 P0@aUPx0U2 01s0 101m0$0001``` `d0@EU$\0$ R 1 0+10 ,`(`0-LP $@7P  0S 00P(7  ûP7  -LM*N0 S   0ػP(7  P7  -LM@2S"2S 4+Q P 4;4Q 0S000C04P4 ;$4- p-!L!M*^0@ `0. @;\< l1L0 H   圻202Ǻ2@0CS2T20 2pk 8 \0⼶ ? 7<@24 -PLbpVt@ m/4X;d4 XXm`/d00d0: t[X 2H02弻20CS2`00`0 - 0S CD4 -LMPp2S@t` RA R00R``V h0l0h0P(T AD0  @202120CS22D02h20CS2h 0m[h`,0K & 04 C, h00h0 R \00\0 @-<X00X0, ` . '7P\00\0 4P .@2$4 -`L2PS@pk.1TN1T:*1T* 1T p .4 - R @R @ p8 K0 @ g404f0 Rta t^4Pp4@ tl0T `0TT0PLծڬD0T/0|!p2i 1i i i 5i i 6i( p-L Md0@0d0P`Z.*N0 K`T 0S .p4t -LM@PTpP@DP<HP#`PPP`PP P "4=4龹뤂b긹븂꺈b+P H˸P0H0 p?Z \9ZP D嵸PDP $*Z $Zh4444 0-L2_S2(0S0h"$@T $0@T0 0-0L"RPO 4@00"000"000,  0P2S0嚴 -PLM@- 2tpS)_P`% T-"2S @ d?`0?i?-",0 000S 202 R 7x 252 020 ꘚ_ -@ LM@0 20CS2hʾꘚ_ 0-PLM@P 2 SQ 0 @      K0 I [0[Ă p-PLM@`P 2SQ p @ FĠ0 K K`KR  x   0SH08 #\ 08S0 S ] -MLMdBNKP@D@D;p` ( t,Y  Y P#Q1B.K`? B B`%P,@峸0PT<2S 2S 2S |X (0S d(AG,0@;H!L0D1 @!0>` 4 P0p;!1PJT I0HP0P$, ε,sP 0 S00S " 0@T00S"00S"  <{Xꠚ_T4<444\444p22h22Z4 -PL+hp`00@S 4@ ( 00+ {+ZQ-0 Q 00Y -RLM`pP P$ ; 0 0 P+@PP+U2 01+ 101+$0001``` `+@mP$+$ R 1 0+10 ,`(`0-LP $@7P  0S 0P7  P(7 -LM"N0 S   P7  ͶP 7 -LMP0p(0 0`S0@ 4@ R- R00R@@T \2&0\2ƹPV ˠA0  @Xƽ\"0dW\B(0K  ( 78X00X0( @ *  7P\00\0 4P * Y2$4 -0`LPpU0@ *4X;T4 XXm*d00d0u PWX `00`0 r 0S 2YD4 p-AMLA"NP `0 P XX  \劵PP20P2p7 V>pP24 -LM@0 R4+Q P 4;4Q 0S000C04P4 ;$4 Y p-0LM @R0P4@ p*`7Pl 7P 2S $@ $4;4ph) P qVYx44 -LM@? ?bPP? 3YpPP? τ$! @p叴oPP ˠ ` P尵޴鐼 4/V鉼 ꅼ 22444 p-0LM@PQ00 4@ R R00R``V& ph20h2F0SUphU\"0 UhbY4 -0`@LQPp+`)0T 0T p T)404-h0T  RL  @ p@ "Yi i i 0-P@P0L HR 0d00d0U 0S 0hY4 -0pPLMT@PSP:P!@`PP8P,`PP $P4=4Ҵ$ԃ,b̴8΃@b?P ߳P02괻 SUꮻ MU)P ɳP02ꞻ x=U꘻ d7UP 峳PRꉻ ,(Uꃻ "U(4H4h4444 -@LP`( 0pR000SP0p P 0 P0p  x(^000m(7 -!L000p0 @`PZ(0S$ S(R( 0R000Sp0p00p@(X0l0X0 l0004(|00|0000 0@@0 )(0a0a` -LM 0S4 0 0ٶP 003 -AML MГBNK@D@D;P` , pwT sT ᐽP@lh#?@"0RL#@(D3/@C.K3S BᏴP@840400 叶4 ?080@0<0 `Ty80sr <0so @0sl 'BnK`F< `F.0P@R <T 4 tP^62tp"4 2 "02o !4018  <0 !1p\  0@$ R "0U"~  P902<V'  ,0S 8, <(S<E'02S4⒳P  0S 0S 0@Tt0S@0S80S0S<t S \ꠚ_T4<444824T623p3.232528:2L;2H<272\824`44 4,4 -@2LSPotP90805&2p0CS2倸4@ < 02&0 s -LMP`P p 2S Q?0@0$0K20020FGD$K#0K@K!KK"`K KpK冴2@0CS2Q 0-LMBPT 0K K 0PP[ -L MB T0K @K@KP [0[ -LM 0K\ K  P -L M@B$\ K0K K @wP 0-LMBL^B$L K0K PK@KK 0[PPP -PLBpT㎯e&o @Tڜl | 4R r 4 C h 7P5 }7P- i> j H0S D0SP4P@@04$+$%m8 p48l058%*R@$  /4.825x4 p-LMBPT pLD <` 00@  t+T pho+.'Q-0 Q0 -LM2`Sp`t4 X  <4  o$  0RU@ P  :40S- P  0@pU@P4<4 Y   H@ o 4 &* p-LM2`SP4"8 "4D0 mP&4<H0 fPO̠D0x  `ϰ20CS2pᇶ꧷ (FQ`꠷ p1244 -RLM`pP P$ ; 0 0Ɂ P$@IP$U2 01$ 101$$0001``` `$@gI$~$$ R 1 0+10 ,`(`0-LP $@7P  0S 00P7  P"7 -LM*N0 S   0P7  ǯP7 -LM@2S"2S 4+Q P 4;4Q 0S000C04P4 ;$4Q p-!!LM*^@ `0S @@;T<d+ H  @ȯ2022@0CS2T20 2p闶 46P0 k,<@02T4 -PLbpVt@ #4X;d4 XXm#d00d0g tPX 2H0220CS21`00`0 Z~ 0S LD4 -LMP`2S@tp RA R00RppW h0l0h0P(T ̠AD0  @32 02^20CS22D02啯20CS2ݴh 0Ohp00K S 00 m000S,KA d0+0[\00\0X00X000 0C00 0 0p" 27P\00\0 4P "@12$4 -`L2PS@pj"1TM1T9*1T) 1T p "4 - R @R @ p+ U# @ g404x0 RtU t4Pp4@ tl0T `0TT0PLկڭD0T/0p2i 1i i i 5i i 6i( p-L Md0@0d0P`NL"*N0 K`僮 0S8"p4t -LM@PTpP4DP<HP#`PPP`PP P "4=4뤂|b븂|bZP HP0H0ϴ pnNɴ \hNDP DPDP꺴 $YN괴 SNh4444 0-L2_S2(0S0h$@T 20@T0 0-0L"RPO 4@00"000000,  0P2S0ɨ -PLM@- 2tpS)_P`% !2S /4 d3`03in!,0 000S 202 R B8252 020 ꘚ_ -@ LM@0 20CS2hꘚ_ p-PLM@`P Q pV pU UPpU] U 0ll MP`P`0U  XrU Q_0UPl4 3B7F p-PLM@P` 2SQ pUUphU] U 0h hWM`P`0U  } cU Q_0UP83l4B7F -LM 0S4& 0 0mP 00P3 -ML Mp`p0 ,0 3PP@xBNK@D@D; sM  LB.K B B2PP ^01!`!1, ἀ1!峀1p!Pj=P,P筬0`U@0婬PN 0 SB00S\1; 40@T@!00P (%P P1 0S 0 0 ͩ ,0S ,4t L00SM= 00St0   \Lꠚ_44T4<4\4(,20hl8<4x4P]X244<4 -LŸ N=RP0p  0  0SXb0S,2(CL @,B%!@00CS0Q 0S @ 00C!i- 0Pb0!i-Q0AP?|AP#pAP \1 3X 烪P00W KP K˫X kP00? K8 K곫P SP00' `K! LK[.h|4|<PHL(44h44(4H4 -0LMmMSpi!`@ !%=@ ?ZDPU@@T+0 @ [, e''0    P0ñ HbK0]K[K4L3L448H'O24 -LM?pP0 \`,0 J \0A0S3NM]1P p1pᴠᶐ,0@000'0@ |@  0p @厪 I0P@@P  B1i= 2 ,@1Ri= oE<,0HN2' -LM?St2p` d2R X2R M]P@2@"p 0 00@04'2@ BŸ   @1,( 0@? SN ?S 1R" ʈ1R 1R Tx1 @l1 p p 0 00 01R 01R0ASdG2pG2xG2G2G2G2G2G2G2G2G2G2G2G2G2 0P 0S0S? 2K"K,pKtD0 ,pK2K"Kl $(HN2'*D:( -L@M 03? R`@ ϔ\ 3R c3RA  M] C0?pP% W@-00 00 Rhx&2  lŸ (` pt /`2P@ @    B*%-I 0""K0 2K"K %> R *PS @cTdT 8 (("bPPl9l0)Nln8 K0Nu, 01  >PPQ;0 0 PPAPP@4PP-N @ˠ 4<   PEs Q 4QN n   u4;4$@ $9 Sx8 T8 @88Pꨅ3"VS 4Lj2D44T4t44 -`LP 7 3p0@ - l|4t=4 ,R <ShF= ߖ|8 ږ |DQ- -LMpzsP`Us 0 0$  0Q< $P< <800S`P 40PP<00S<0   Zz ` <4<8  4  @h h0@K4@ , @P 0 #P $000S$ 0040$0$40D`(00(0 R6 2p24 sr-LP`p  0 $@T uv u 80U 0@Tv D0VW W%P "6 64444 p-rqLMP`  0 $ R uv0@ u 80U T pv D0VT404040@?$5T4 -QLM@8 0C?. B"0v7 s7|44 - 0L0\ s0 00 0-$@0 TLP,00 L0 P0@T0 0-$@LTP L0 0@T0 0-$@0 TLP,00  L0 0@T0 0-$@LTP L0 0@T0 -PPL0@& 00 1 ` ^{'i$8 80$8P 8T0@8$0P 8$8 4  T0  h35T34 p-LMT P0`@H \ 8  0$ P@0 8$8P <8V @ $8P@40 }TppT0 p0h@T0 00 T00T0| `X08<#30$P 8T0@ \ 0 <$ 8P< 꼗254 0-P(0L0 T0@08T0$P0 4PL0 0h p-LMPP 4* 0` p8 $48@P0$ 4@@ pd R0d0 `00S`0 L0`@@ppp p-LMT0@![Y$80 P8}l`$8P0 4P ` _cVH0S T0  p8$;P8 T0hT -LL  -PP 00LR`p @$<0 T ,00/ @-h( , \00Q0S p-LMP0`, P@ @@0K0TT0`K@P`Tp 0-T0L @PP X0  v k _ U\0   B 1   X00H  00hT 0@ T d00<0H 00T 0@ T d00<0H0 0\0HT  0d0T 0+ \0T H 0d0T 0+ \0H( 0H0& {X0H0& rX0H0# hX0~H0# _X0sH0"WiHP1Q- -LMT0@h0S 0 ?C5A0P 0S0Q T  (RL#R!&R$0RA0R#& -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000. 000008P0 $4P0@8$ 4T0@@ \0 -P   006    0000000  < 000 006 000@006 000 0008P0$ 48PP0$ 4 -L>P ؊3 p-LM@P`/  |3(0tH0 L8 P`0 T0d  $8P4 00 X0pphX؊34̊3 0-(0PL@ F 0ES 42T222 H0"S 00 H0"Syp H0"S 8P0 $408$;P 80$ 8P0 $4V>8$0P 80 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000$8P0 4# 8P0 $4P0@8$ 4@ 000 006 @006  0000008$P0 4@ 0-@L8P0$ 48P0P $4$0 S8P0 80 -L)P 3 p-LM@P`  t2(0lH0 L8 P`0T0 $8P4 00 X0pphE343 0-(0PL@ 7 0ES ꀦ22L22 H0"S 00 H0"Sfp H0"S 8P0 $408$;P 80$ }0 -LMPp@ 0`,@00 8P0$4 P8P0$4P08 $ P4,0 0,0P0@8$4 00 0,   00300 000 0000000000000006 -LcP ,3 p-LM@P`T  t"2(0lH0 L8 P`0T0 $8P4 00 X0pph,34 3 0-(0PL@ 7 0ES ꘩22d22 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80$ 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@@@DT꤫2222222222222222ȫ2222ԫ2000000000006006 -LM@E8$P 08 -LlP P3 p-LM@P`]  t+1(0lH0 L8 P`0T0 $8P4 00 X0pphP34D3 0-(0PL@ 7 0ES t22@22 H0"S 0"&0 H0"Sp H0"S 8P0 $408$;P 80$ 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 000008$P0 4  00000000000006 -LP 錋3 p-LM@P`  ta0(0lH0 L8 P`0T0 $8P4 00 X0pphꌋ343 0-(0PL@ 7 0ES ꜰ22h2 2 H0"S 0X\0 H0"Sp H0"S 8P0 $408$;P 80$ )0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 00000P08$ 4000  00000000006 -LM 0T@ P  @%#,00R0S ? 4Z p-LM@P`/(0H0 L8 P@00T0( `R phz/ $8P4 00 X0pph434 0-(0L@P0  H0"S0ES$222820$x|05p0c0-4 -LM@(8$P 1<8 -L  L53 SL? 0 #?8  0  P00 ^ 0D4 p-LM 0P ?> S@` .( |H 0LP`8000T0 $8P4 00 X0pphT.4H4\43 -(0L@pPA H0 S?0BS2,2220$ ` V 80P$ 8 0$8P 88$P0 4  4,p4 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@  000 006 @006  000000$\ 0 0 P8$P0X 48$P0 4 D4 -L6P 3 p-LM PL5 3S@`* L5 3S?   -(0H0 P`8 0L T0 $8P4 00 X0pphF\,0L0? 0L0 34ԋ3ȋ3 0-(0PL@ 7 0ES 갺2к2|242 H0"S 00 H0"SZp H0"S 8P0 $408$;P 80$ q0 -LMP` 0P00,P08 $@4 ,0 0,0P0p8$4 00 0,  00300 0008P0 $48@P0$ 4@ 00000 00000000 006 -LM@"8P0$ 408$0P 8 -LBP 3 p-LM@P`3  t-(0lH0 L8 P`0T0 $8P4 00 X0pph^343 0-(0PL@ 7 0ES 2<222 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80$ 0 -LP 43 p-LM@P`  t,(0lH0 L8 P`0T0 $8P4 00 X0pph434(3 0-(0PL@ 7 0ES 2,2ؿ22 H0"S 0|0 H0"Sp H0"S 8P0 $408$;P 80$ M0 -PP0 @0 ,0L8 P0$p4P08 $4,0 0,0P0`8$4 00 0,   00300 000 00000 00000000 006 -LM@$8P 088$P 1<8 -LP p3 p-LM@P`  t+(0lH0 L8 P`0T0 $8P4 00 X0pphp34d3 0-(0PL@ 7 0ES P2p222 H0"S 00 H0"S2p H0"S 8P0 $408$;P 80$ I|0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 00000P08$ 400000000@006 -L1P 鬌3 p-LM@P`"  x*(0pH0 L8 P`00T0 $8P4 00 X0pphLꬌ343 0-(0PL@ 7 0ES d22022 H0"S 00 H0"Smp H0"S 8P0 $408$;P 80$ 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 00000P08$ 4 00000000 006 -LM@`P:* L%?> p #C2.*(0H0 L8 PP00T0P0 $840  X X0 \0  h,h*$8P04\44Č34 0-(0PL@ 7 0ES 22|242 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80$ 0 -LP ܌3 p-LM@P`  |)(0tH0 L8 P`0 T0d  $8P4 00 X0pph܌34Ќ3 0-(0PL@ 7 0ES 22t2,2 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80$ 3f0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 00000P08$ 400000000006 -LP H3 p-LM@P`  x((0pH0 L8 P`00T0 $8P4 00 X0pph6H34<3 0-0BPL@ S 22|202 H0"S 0& H0"S[p H0"S 8P0 $408$;P 80$ r -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000B 00000$8P0 4$ 8P0 $4P0@8$ 4@ 000  @006  0000000068$P0 4   006  -L/P 霍3 p-LMP@`  '(0H0 L8 P`0 T0d 8P0 $4T   0XX0 pphBH'3H' 0+꜍343 0-0BPL@ S 22242 H0"S 0 H0"SZp H0"S 8P0 $408$;P 80$ q -LMPp@ 0`,@00 8P0$4 P8P0$4$08PP 4,0 0,0P0@8$4 00 0,   00300 000 00000 00000000 006 -LYP ؍3 p-LM`@PJ  '(0H0 L8 PP0 T0d P0 $840  X X0 \0  phnp$8P04\؍34̍3 -(0L@`pP 0BS 222D2 H0"S  H0"S0$ `0d 0S`0 $8P0` 4PL0pH0 S 8P0 $408$;P 80$ 0SH22X222222x222222222$8P ;880P$ 8 0$8P 6S$8P =$8P @08$8P 080$ $8P$8P ; :`c -Pp@ 0`00,@L8P0 $48PP0 $4P08 $ P4,0 0,0P0$84 00300 3 000008P0 $48@P0$ 4  0060 006 000 006 000@006  0060=@S S000  00006600 S000000 p-LMT0P@`& V @ $8P@40 }TppT0 p0h@T0 0 L0P80 $88P0 $40P$8< 88 P0$4X08<C30 P$8$8 P<8꼗25 - LN5 Ó0 ?0 0 PP 004 p-LM`@P5%0 R %( H 0L80PP0 0d T0( Rp ph% $8P4 00 X0pph%\4,]4334 -1`LQPp@V(0Q 0GS 2t222 H0"S H0,S 4 `8 P0$48@P0$ 4@@ `0d 0S`0 L0`@p H0"S0$  $,]734 -LMT0P`SPJ 000,8(!P0$4P0@8$!4p,00,00S ,0 00 h$P0$8 4 0008P0 $4P0@8$ 4@ 000 00000000 00600 ;$,]7h)444(34QR*0S b R*0S -R0 0c BSR48 R p-@P`x BRpR0 BRRRR-0^0  R R0 R00-P@cbP L0 p-QL MP@`S K0 V Ks 0K Kp@rPp`@- a0`S@@BR0-P@ 0bR3 B1 010QP:  QQ0Q00 0cc 0S !1 0S 00S  p-QLM`P@S 0 8V pp@rP`&p`R 0R\ Q- *0 Q*0  aQ! -LM`pX P@! P P @T00PU0S ##p@W l#`FpGP  PH#00PW "pW`F4l34T4-0 R 0Q cP 0 S Q!0-P@P !20R0-P@ 0bR03 B0 -QLM2p`S)P@WU (W # 3f g0T0e 0d0 "2R0c0 0 Z  p @rP*`ppp@-(Ƞ !8"(,ȠP@p^`b `n0 # 3\ c l0 "2R(#ȃ 0(BR00.8 c0(R0#03 8 " P@p0(R0#03.8 -LMK0KR @0S R -LM -LDM@PKP@ 4\T QP 0P KSR0S0PK0 P@[[TK$P@KK ,PT@,83K#[$8KK[[R3KL K0KKK4pK@KX d0 d@@DTd@ 0S 0d@S@d`@ p0`SL` `` \JX0@\@ZXp3QPX h h P Uh R `0d@Dh \ l l偀 0 RPh H  `\ 8R \0`FP(*SdP\l 00 L cPe%88cP\X%X@ʷ0Pe%8P d`F\P l@00 L P\P%X@ʷ000l`X\l ` R" h0S d@\ c0 Sh0`@.L0#\ ʌ0#[[[2[P T PK $[[[4[P T P KP@V8#C0HL8#90HB8#/0H8\ h "  P T P0K\]p@-^`@ Pb 0 2%$^ 040p@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  0-LBP|@ 0S L| 0SPeT 0S \00LS `00000S  0SbQ1QR0@-P@ 0bàR? B0QQ000-P@P@0Q0-P@P%@ 0Q1Q3:P: R0P0QcP  R0-P@P@0! !Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R@-@08#8S  0   `3` `! R0-P@ 0bR03 B00`]``0 B`3`1`1c11c!0"b2c3c0acP@`]_ NR- R 0S0 \R000Sa@\0S S0S0S  S 0S R  0R P0Qc\R0@-P@0 A@P `R00\00Sa@ 0zR @R00Q00S ZR 0 PP ^0b0Q|333ē3ܓ33 3$3<3L3 h3 3 3 3 333333Д3Д3Д3Д33333!3"3#3$3&30w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-H t @H t @  88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| n;AvXaM ְdx !!!!!!h!!p!d!|!#!Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2005 OpenBSD. All rights reserved. http://www.OpenBSD.org 3e4 3333 3@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@netconnetclsnetionetlck!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~U%%%%#%\&#&h&%#&d n;0&AvQkkXaM~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@\D))@V))؍)XX)Z)p[)^)X^)p`)`)8)$*)(*)؍)*****D**8)$vmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJXC-dC-p#=4<"4=4<"4=4<"4=43 33 =43=4=4 =4=4=4=4=4=4=4=4=4=4p =4=4p 0=4=4p `=4=4p p>4=4P  >4=4P >4=4P @>4=4P P>4=4 $>4(>40>4(>4$>44>40>44>4>4To4>4To4<>4To4D>4To4L>4To4T>4To4  a4|4a4|4\>4`>4@d>4`>4l>4p>4 t>4x>4 t>4|>4/>4H~4o>4>40/=4H~4p >43 Z4>4 >4>4 @>4>4 `>4>4 3>4 >4>4 >4>4 >4>4 >4>4 0>4>4 @>4>4 `>4>4 >4>4 >4>4 >4>4 >4>4>4>4>4>4 >4>40>4>4@>4>4P>4>4`>4>4p?4>4?4>4?4>4 ?4>4?4>4?4>4?4>4 ?4$?4,?4$?4 0?4$?404?4$?4@8?4$?4P<4>h4>4>4>4?4?4?(4?H4?d4?4?4?ā4?4? 4? 4? ,4? @4? X4?p4?4?4?4@܂4A4B$4C4DX4Ep4F4G4G4G؃4G4G04Gd4G4H4I܄4J4K4K4KH4K\4Kl4K|4K4L4Nԅ4P4P4P$4QH4QX4R4S4S4S̆4T4U4U(4U<4U`4Ux4U4Uć4W4X4Y$4Z84Z`4Z4Z4[Ĉ4[Ԉ4[4[4\ 4\44\L4]h4]4]4]4]$4]\4]4]Ȋ4]4]04]d4]4]̋4]4]04]d4]4] Ќ4]!4]"@4]#x4]$4]%4]&4]'T4](4])4]*4]+$4],X4]04]1Џ4]2 4]3D4]4|4]54]64]7(4]8\4]94]:ȑ4];4]<44]@t4]A4]Bܒ4]C4]DD4]Ex4]F4]Gܓ4]H4]I44]Jd4]K4]L4]P4]Q04]Rd4]S4]T̕4]U4]V04]Wd4]X4]YĖ4]Z4][(4]\X4]`4]aȗ4]b4]c44]dh4]e4]fИ4]g4]h84]ih4]j4]kЙ4]l4]<4^l4^4^4^К4^4^A4^B<4^CX4^Ex4^G4`4a̛4a4a4b 4c(4cT4d|4d4e4f4f4f4f04g`4gx4g4g4g4g4g$4gH4gh4g 4g 4hȞ4i4i4i 4j84kT4kp4k4l4mğ4n4o4oD4o|4o4o4o 4qX4r4r4rġ4r4r$4rP4st4s4s4s̢4s4s4s,444444 4@(444H4@44 4@(444H4@P4\4N444@4N4T4`4t4x44N444N444N444N444N4N44N4ȥ4ԥ4N444N4@44N4@44N4H$4,4N4@$444N4@4<43@D4L4N4T4\4h4p4t4N44|4N444444Ȧ44Ц444444N4(404N4<4D4N4T4\4N4d4h4N4t4|4N44|4N444N444N444N444N444N44 4N40484N4H4P4N4\4 N4N4N4N4N4N44N4N4.H.....8....N4N4N4N4N4N4N4N4N4N4N4N4N4N4N4N4N4N4.t..44z̹4Թ4 ܹ444444444$4,4@44<4@`4h44p4|4@34p4l4t44l444H44443ĺ44̺434`4ܺ44434434HT44GC4 4p4444 ,4444L4HT\4\4h4@x4434 44`CGCZ)IeI44л4ZIZIIIII0I0PI04ػ4I0E44]I0E44PI  I444ػ4@"44p4-/444044D44\44t44444 ")A44u ܼ444t4@&o@o @o @  @& 3BI0E@I0EHTI0E44@I@(#0Vw4`44t44444444444Pttt3V444V 4448V4444VD4L4h4p44V4444s4444oo PM44k&h= = s qPs&! qh4 4l C@4T4 x44a{]/.|.X.L/$/C(.} 1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@ 6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] LN3 ["$&'X4gklrdK2h@P3   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000vt100t<0D=0TO0|f0p>0?0  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_ABCDEFGHIJKLMNOPQRSTUVWXYZ888????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?TP0X000444444 4,484@4H4X4d4p4x444444XBBp@m@m@ f(  pt""(4I@@@@1` QFb '               <'1,(101101`:1;1(@1?1D1D1dE1DE1@W18/?9:;<=>?@ABC D E FG HIJK,LMN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c..d\|e 2"#6&$7'%8(&9)'0--=.^~/@`0[{2]}3;+4:*5\_\|9mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/02'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$2*3m4%56;.7:/8!d<> 2" 3!4$"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]13@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~4'@5``d\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-`?./[0+*]1}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]2`3m4%56;.7:/8=+~d<>\ 1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?.eEz/[0!]34{5 2$}y6,;7.:8-_d<>\ -'?.^`~0!]/[34{ q3s34"s3s3Os3 2t3ZRu3s3FFt3t3Jv3Mv3 t3 u3 u3 Bu3 J4w3X~x3 .y3 Fy3 .y3 [w3Z1`[1`1a1d1 d1 f1k1k1hl1( @ v @  @ @  W 1 Q `@  q1@  0 2 A` A @  @  @ @ @ @ P0@ P@  A @ @ h@ } @ } } } @@ @ 85@   q1  L+ L r1L2@ D@   O  {@Pr1o ! A! F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF |9  1@1D1(1 B W  0{&"=F@n a- 1l1X111111@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 01p1181{%1`10111\1111l\ 2 22 222@#2X)2 P Q@9@WPurl_int_miibus_readregurl_int_miibus_writereg:5g hahh! !(3P@3vK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik*++,,--../-@@A&''(())**++,,-MNO`abcd e f g h ik$%b(&b,'b0(b4)b8*b<+b@,bd"h"l"p"t"x"|""" " ")$+$-$/$P ^2 _2|c2܏2!A  !@@@@22242224(4 2,22Q`D4222`42t434$202245422T2ص22282D2l2822l2442224222}4}4}422204H4`422294822202<22 4,46L4!h4(|4424D2822n`4@`4n`4n` 44H2<22!84L4`42T2244,222urlphy_attachurlphy_serviceurlphy_status  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzOpenBSD3.7RAMDISK#10 @(#)OpenBSD 3.7 (RAMDISK) #10: Sun Mar 20 20:50:59 MST 2005 OpenBSD 3.7 (RAMDISK) #10: Sun Mar 20 20:50:59 MST 2005 deraadt@zaurus.openbsd.org:/usr/src/sys/arch/zaurus/compile/RAMDISK dackirqtargetlunsizeintrcontrollersocketfunctionchanneldriveconsolemuxconfigurationinterfacevendorproductreleasereportidphywsmuxloopbpfilterdrive at %s channel %d drive %datapiscsi at %s channel %dwdcspl%s channel %d: reset failed for drive 1 drive 0atapi type: %s c_bcount: %d c_skip: %d missing untimeoutwdc_probe_caps%s(%s:%d:%d): using PIO mode %d, Ultra-DMA mode %d, DMA mode %d using BIOS timings%s: transfer error, downgrading to PIO mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to Ultra-DMA mode %d wdccmdwdccommandwdccommandext%s:%d: %s %s(%s:%d:%d): %s physio split wd ioctl request... cannot proceed user_strat: No ioctl IBSSwiLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB): unable to read station address address %sWaveLAN/IEEE node%s: received packet on invalid port (wi_status=0x%x) wi_rxeof%s: received packet of unknown type on port 7 %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: wi_cmd failed with %d %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: wi_cmd_io: busy bit won't clear %s: init failed %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: unsupported crypto algorithm %d wi_ioctl%s: mgmt. buffer allocation failed %s: tx buffer allocation failed wi_do_hostencryptwi_do_hostdecrypt%s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: wi_start: xmit failed %s: host encrypt not implemented for 802.3 %s: wi_mgmt_xmit: xmit failed %s: device timeout Unknown PRISM2 chipSymbol %s: %s%s, Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: Firmware %d.%02d variant %d, %s: %u (%d dBm) put_rateswihap_init: sc=0x%x whi=0x%x Sending disassoc to sta %s Sending deauth to sta %s wihap_shutdown: FREE(sta=0x%x) wihap_shutdown: sc=0x%x whi=0x%x wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s wihap_auth_req: station %s short request wihap_auth_req: returns status=0x%x wihap_auth_req: algorithm unsupported: 0x%x challenge: 0x%x 0x%x ... wihap_auth_req: new station wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_assoc_reqwihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: returns status=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: rates mismatch. wihap_assoc_req: from station %s wihap_deauth_req: unknown station: %s wihap_disassoc_req: unknown station: %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_ioctl: i shouldn't get other ioctls! wihap_mgmt_input: len=%d MGMT: unknown (stype=0x%x) assoc resp: assoc req: probe req: reassoc resp: reassoc req: ann traf ind beacon: deauth: auth: disassociation: probe resp: ftype=0x%x (ctl=0x%x) ne2000_attach%s: setup failed %s: where did the card go? ne2000_detect%s: remote transmit DMA failed to complete ne2000_write_mbuf: negative len version %d.%d%s %s: unsupported OHCI revision %s: SMM does not respond, resetting %s: reset timeout ohci, legacy support%s: blocking intrs 0x%x %s: unrecoverable error, controller halted %s: resume detect %s: %u scheduling overruns ohci_add_done: addr 0x%08lx not foundohci_rem_ed: ED not foundohci_abort_xfer: not in process contextohci_root_ctrl_startOHCI root hubohci_setintr: 0 interval %s: isoc TD alloc failed ohci_device_isoc_abort: early return rd%drdattach: device name too long RAM diskfictitiousrd_idleAll breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d %-12sdb_commandCount missing Bad modifier Ambiguous No such command Malloc debugging not enabled. the kernel did not panic procscalloutallbreaksextentsmallocobjectpanicpoolprocregistersuvmexpwatchescrashhaltrebootpoweroffmachineexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallshowboothelphangmandmesgddb> Bad function %#n Argument missing Too many arguments ELF[ %s symbol table has bad start address %p ] ELFbad magic[ %s ELF symbol table not valid: %s ] bad e_machine.strtab.symtabsymtab unaligned[ using %lu bytes of %s ELF symbol table ] symtab corrupted= 0x%lx %c\%03o%-*ld%-*lo%-*lr%-*lu%-*lx%-*lz: %*d%*o%*r%*u%*x%*zAddress missing Value missing Syntax error Symbol not found Divide by 0 Negative shift amount ^R String too long Bad escape Bad character Bad character in number End of stack trace. --db_more-- -%*lo-%#*lo-%*lu-%#*lu-%*lx-%#*lxFaulted in traceback, aborting... Starting stack trace... %-12s%#*ln %s+%#lr[after %6d] bsd[ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s %s%s Sifting table %s: db_printsym [%s:%d]+%sBreakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! After %d instructions (%d loads, %d stores), radixmaxoffmaxwidthtabstopslinesUnknown variable No value All watchpoints used. No map. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx Unknown size %#8n = %#8n Nothing written. () Score: %lu/%lu db_hangmanloadfirmware/etc/firmware/%s%s: address %s dp8390_initdp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed rndrdextract_entropyarc4_stircd9660_lookupcd9660_inactive: pushing activecd9660_reclaim: pushing activeRRIP without PX field? RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_P1282RRIP_1991AIEEE_1282SPcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: directory crosses block boundary %d[off=%d/len=%d] fhtovp: bread error %d fhtovp: crosses block boundary %d fhtovp: lbn exceed volume space %d cd9660_strategy: spectag VT_ISOFS, isofs vnode elf32_load_fileOpenBSDexec_elf32_makecmds#!/dev/fd/%dswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init/sbin/oinit/sbin/init.bak/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initinitclocks: unable to register softclock intrfileplfdescpldup2: fdallocclosefkqeueplknoteplkqreaduser mapping failed kernel mapping failed %d init died (signal %d, exit %d)waitppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: unknown locktype request %dlockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: upgrade exclusive locklockmgr: processor %lu, not exclusive lock holder %lu unlockinglockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: draining against myself lock type %s: EXCL (count %d) by processor %lupid %d with %d pending not locked lock type %s: SHARED (count %d)malloc: allocation too largemalloc: out of space in kmem_map%d,rwlockrw_enter: locking against myselfphysbufphysio%-16s %-8s %18p %s %5d %5d %5d %d %#10x %-9.9s %-16s COMMANDSTRUCT PROC *UAREA * PID %-10s %18s %18s %18s VMSPACE/VM_MAP PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSGFLAGSWAITPPIDPGRPUID PID %5s %5s %5s S %10s %-9s %-16s usage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info procplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0idlestopzombiedeadonprocADVLOCKCTTYINMEMNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCFSTRACESSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDSWAPINBIGLOCKPROC (%s) pid=%d stat=%s flags=%b pri=%u, usrpri=%u, nice=%d forw=%p, back=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawn%c%5d %-10.10s %18p %18p %18p plimitplsigaplpauseissignal procfs debuggingpid %d was killed: %s sorry, pid %d was killed: %s coredump%s.corehashinit: bad cntsysctlsysctl_disklocksysctl_doproc%s,denied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleep?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func smashed stack in %spreempt: cpu_preempt not yet implementedsetrunnable unsupported >>> %s probe returned %d >>> probing for %s* mapply: no match function for '%s' device>>> %s probe won >>> no winning probe root device %s not configured %s at %s%s (root)config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: duplicate %sexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: device name too long%s detached config_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structurewrit%s%d%c: %s %sing fsbn %d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dfilesystem type %d not known.. assuming ffs dk_mountrootcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0bufq_default_alloc: no memoryextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundFLWANTEDWANTEDNOCOALESCEFIXEDextent `%s' (0x%lx - 0x%lx), flags=%b 0x%lx - 0x%lx extent_print: NULL extentklogmtx_enter: ipl not implementedphpoolpcgpoolpool_init: too much uptimepool_get: %s: page emptypool_put: %s: page header missing page %p, nmissing %d, time %lu,%lu POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p no log curpage %p %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) kernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %slogprikprintf%llx%llobug in kprintf: bad base0123456789ABCDEF(null)0123456789abcdefaddchangeddbdisableenableexitfindlistquittimezoneverbose--- more --- 0%o*UNKNOWN**FOUND*%3d free slot (for add) Unknown devno (max is %d) %3d at disable %s flags 0x%x ???%3d %s count %d (pseudo device) %s [] ? Unknown argument %3d can't change free slot change (y/n) ?%3d %s changed flags changed out of memory. already disabled Error unknown state %3d can't disable free slot %3d %s can't disable pseudo device %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before more enter ddbdev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst don't know toggle verbose bootingUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Device not complete number or * is missing Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d Unknown command disautoconf verbose %sabled Unknown command, try help User Kernel Config UKC> Continuing... sys_ioctlselectpipelkpiperdpipewrpipeclpipeplttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk empty foreground process group putc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersmbplmclplm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0: off %d, len %dm_copydata: off %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_copydata: len %d < 0m_apply: len %d < 0m_apply: null mbuf in skipm_apply: null mbufm_apply: off %d < 0m == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREFsbappendaddrsbappendcontrolsemi-panic: sbcompress sbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 4uipc 3piusrrequnp_attachunp_bindunp_connect2unp_disconnectbremfree: lost tailbufplgetblkallocbuf: buffer larger than MAXBSIZE requestedgetnewbufbiowaitbiodone alreadynchplcluster_read: DONE bpcluster_callback: too little memoryClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocksvop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvnodesvfslock%s_mountroot failed: %d v_lockvnodefree vnodefree vnode isn'tvgetvrele: cannot lockvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevvgonel: not cleanmissing aliasVNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADtype %s, usecount %u, writecount %u, holdcount %u,vprint flags (%s)|VALIASED| VBIOWAIT|VXWANT|VXLOCK|VSYSTEM|VTEXT|VROOTkinfo: vp changed WARNING: some file systems would not unmount retrying unmount of %s failed with error %d syncing disks... giving up done %d softdep vwakeup: neg numoutputvinvalbufvinvalbuf: flush failedvinvalbuf: dirty bufsvflushbufvflushbuf: dirtyvflushbuf: not dirtybgetvp: not freebrelvp: NULLsyncersched_sync: fsync failedmounted on: %s syncer vnodesys_mountmount: lost mountunmount: dangling vnodesys_statfssys_fstatfssys_getfsstatsys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lockvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_leasevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_whiteoutvop_getextattrvop_setextattrvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfifowfifortag VT_NON, fifo with %ld readers and %ld writersfifo_badop calledspec_read typespec_write typespec_ioctlspec_fsyncspec_fsync: not dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calleddos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largemsdosfs_reclaim(): pushing activemsdosfs_inactive(): pushing activeextendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath(): .. not a directory? RRaArrAamsdosfs_sync: rofs mod dev %d, %d, %s msdosfs_createmsdosfs_write(): bad file typemsdosfs_renamemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_mkdirmsdosfs_readdirmsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED)bpf_detachd: descriptor not in listbpf: ifpromisc failedbpfbpfwritebpf_mcopybpfattachif_attachsetuptoo many interfacesif_attachhead: mallocif_attach: mallocif_clone_listifioctlifconfif_getgroupifpromisc%s: can't handle af%d lo%dlooutputlooutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedrn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtentplrtfreertfree: %p not freed (neg refs) rtfree 2ifafreertrequest deletertinit: wrong ifa (%p) was (%p) rttmrplrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputroutebad channel ignored; freq %u flags %x number %u invalid channel freq %u flags %x invalid channel (NULL) ieee80211_media_initUnexpected mode %uBad IBSS channel %u ieee80211_wep_cryptstation %s shared key %sauthentication %s: shared authentication failed (reason %d) for %s received %s from %s rssi %d %s: got power save probe from %s %s: power save mode off for %s %s: power save mode on for %s null nodeopen authentication failed (reason %d) for %s newlystation %s %s authenticated (open) station %s authenticated (shared key) %sassociation failed (reason %d) for %s station %s deauthenticated by peer (reason %d) station %s disassociated by peer (reason %d) %s: station %s sent bogus aid %x %s: station %s aid %x doesn't match pspoll aid %x %s: enqueued power saving packet for station %s %s: station %s sent pspoll, but no packets are saved %s: station %s sent bogus power save poll ieee80211_ibss_merge%s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %ull beacon tsft %ull %s: sync TSF with %s %s: tsft offset %s%ull ieee80211_cfgsetieee80211_ioctl%s: no memory for AID bitmap! unable to setup inital BSS nodebegin %s scan passivecreating ibss end %s scan ieee80211_end_scanfreeing bss nodenot in ap mode, mode %usending %s to %s on channel %u %s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d flags %08x 802.11 packet too large: %ustation %s deauthenticate (reason %d) station %s disassociate (reason %d) beacon bigger than expected, len %u calculated %u%s: station %s power save queue overflow of size %d drops %d assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocdeauthreserved#13reserved#14reserved#15INITSCANAUTHASSOCRUN0x"NODS %s->%s(%s) type#%d %dM +%d WEP dataTODS %sFRDS %sDSDS %s(%s->%s)no recent beacons from %s; rescanning associatedsynchronized%s with %s ssid channel %d start %uMb %s: bogus xmit rate %u setup APL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDaeamarauazbebgbhbnbobrbybzcacncocrcyczdkdodzegf2fifofrgrgthkhnhrhuidiliniqisj1j2j3j4j5jmjojpk2kpkrkwkzlbliltlvmamcmkmomxmyninlnzpaphpkprpyqarorusasgsisvtntttwuaukuyuzvnyezazwarp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: can't allocate llinfo arpintrarp: attempt to add entry for %s on %s by %s on %s in_arpinputarp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to overwrite permanent entry for %s by %s on %s duplicate IP address %s sent from ethernet address %s arp: ether address is broadcast for IP address %s! arptfreearplookup: unable to enter address for %s revarprequestrevarp[NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p ifa=%p genmask= gwroute=%p llinfo=%p (NULL)Route tree for AF_INET (not initialized) in4_cksum: offset too shortin4_cksumcksum4: out of data in4_cksum: bad mbuf chainin_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectinterneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeouticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dipqeplaeshmac-sha1deflateip_initip_dooptionsattempted source route from %s to %s ip_outputip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputm_pulldown malfunctiontcp_pulloutofbandsynpltcp_outputtcp_output REXMTtcpcbpltcpqepltcp_inittcp_respondtcp_ctlinputtcp6_mtudisc_callbacktcp_timer_rexmttcp_usrreqtcp_identudp_inputudp6_ctlinputudp_usrreqipip_inputipip_input: should never reach hereetherip_inputMD5Finalfile system full %s: write failed, file system is full ffs_realloccg: bad blockno%s: optimization changed from SPACE to TIME dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optim%s: optimization changed from TIME to SPACE dev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocpos = %d, i = %d, fs = %s ffs_alloccgblk: can't find blk in cylffs_alloccgblk: cyl groups corruptedffs_clusteralloc: lost blockffs_nodealloccg: block not in mapcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corrupteddev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %u bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free fragffs_blkfree: freeing free blockdev = 0x%x, ino = %u, fs = %s ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sffs_freefile: freeing free inodebno = %d, fs = %s ffs_alloccg: block not in mapstart = %d, len = %d, fs = %s ffs_alloccg: map corrupteduid %u on %s: %s ffs_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizeffs_isblockffs_clrblockffs_setblockffs_isfreeblocksoftdep_flushfiles calledsoftdep_setup_inomapdep calledsoftdep_setup_blkmapdep calledsoftdep_setup_allocdirect calledsoftdep_setup_allocindir_page calledsoftdep_setup_allocindir_meta calledsoftdep_setup_freeblocks calledsoftdep_freefile calledsoftdep_setup_directory_add calledsoftdep_change_directoryentry_offset calledsoftdep_setup_remove calledsoftdep_setup_directory_change calledsoftdep_change_linkcnt calledsoftdep_load_inodeblock calledsoftdep_update_inodeblock calledsoftdep_slowdown calledffs_mountroot: can't setup bdevvp's ffsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck WARNING: soft updates isn't compiled in ffs_reload: dirty2ffs_reload: dirty1no UFS2 support ffs_statfsupdate: rofs modffsino%s: typeffs_write%s: nonsync dir writeffs_fsyncffs_fsync: not dirtyffs_inactive: pushing activeufs_reclaim: pushing activei_ffs_size too smallmangled entry%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact2ufs_direnter: compact1checkpath: .. not a directory chown: lost quotaufs_linkufs_whiteout: unknown opufs_whiteoutufs_renameufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_rename: lost from startdirufs_mkdirufs_readdir: lost in spaceufs_strategy: spectag VT_UFS, ino %d, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lldufs_makeinodemode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_nodealloccg: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedbad block %d, ino %d dev = 0x%x, ino = %d, fs = %s ifree: range: dev = 0x%x, ino = %d, fs = %sifree: freeing free inodeext2fs_mapsearch: block not in mapext2fs_alloccg: map corrupteduid %d on %s: %s ext2fs_inactive: pushing activeext2fs_indirtrunc: bad buffer sizeext2fs_readdiri_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryext2fs_direnter: newblkext2fs_direnterext2fs_direnter: frag sizecheckpathext2fs_writeext2fs_mountroot: can't setup bdevvp'sext2fs%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsExt2 fs: unsupported inode size Ext2 fs: unsupported optional feature ext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_rename: lost from startdirext2fs_mkdir: blksizeext2fs_reclaim: pushing activeamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereamapplamap_wipeout: corrupt amapcownowpagecownowamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countuvm_anon_add: can not allocate %d anons uvm_anon_adduao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: hashinit swhash faileduao_create: malloc swslots faileduao_create: asked to enable swap on kernel objectuaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getuao_getpageudv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_pmfail1flt_noram3flt_noram2flt_pmfail2flt_noram4flt_noram5fltagain2uvm_fault_unwire_locked: address not in mapuvm_fault_unwire_locked: unwiring non-wired memoryuvm_fork: uvm_fault_wire failed: %duvm_swapin: uvm_fault_wire failed: %dschedpwaitscheduleruvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: submap allocation faileduvm_km_suballoc: unable to create submapkm_getwait2km_allockm_alloc1wuvm_km_alloc1: non-released pagevallocwaitkmthreadkmallocvmmaplkuvm_mapent_alloc: out of static map entries, check MAX_KMAPENT (currently %d)# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs= PAGES : <%p,0x%llx> refs=%d PAGE %p: %b flags=%s, pqflags=%s, vers=%d, wire_count=%d, pa=0x%lx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) checking pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< uvm_page_printit page found on pageq list anon backpointer is OK checking object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on object list uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_pageboot_alloc: pmap_growkernel() faileduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: bad free list %duvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = BSEARCH number of buckets = %d uvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! pgdaemon%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retrys)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern/kmem)=%p/%p swapsysuvm_swap_init: can't get vnode for swap deviceswapmapswp vnxswp vnduvm_swap_init: extent_create failedswapdrum_addsys_swapctlswapctl: copystrswapctl: miniroot copy failedswap0x%04xswap_on: miniroot larger than swap?Preserved %d pages of miniroot leaving %d pages of swap swap_on: unable to preserve minirootdisklabel regionswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getuvn_getpageuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin6_pcbconnectin6_pcbnotifyin6_ifloop_requestADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_controlnd6_prelist_add succeeded but no prefix prefix ioctls are now invalidated. please use ifconfig. in6_update_ifain6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to get interface identifier %s: borrow interface identifier from %s %s: got interface identifier from %s %s: got interface identifier from itself in6_ifattach_linklocalin6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) %s: no ifid available in6_ifattach_loopbackin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattachin6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetach%s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICMP6 checksum error(%d|%x) %s icmp6_notify_erroricmp6_notify_error: in6_embedscope failed icmp6_mtudisc_updateni6_inputicmp6_rip6_inputicmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d /usr/src/sys/netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d (src=%s dst=%s tgt=%s)icmp6_redirect_inputICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_input: invalid ND option, rejected: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s icmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s ip6_savecontrolip6_nexthdrip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_mrouter_doneadd_m6ifregister_mifdel_m6ifadd_m6fc: %s o %s g %s p %x dbx %p multiple kernel entriesdel_m6fcip6_mforward: ip6_mrouter socket queue full ip6_outputassumption failed: hdr not splitip6_setmoptionsip6_setpktoptionsip6_rthdr0nd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsduplicated ND6 option found (type=%d) too many loop in nd opt nd6_options: unsupported option %d - option ignored uninitialized ndopts in nd6_optionsln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookupunspecnd6_lookup: failed to lookup %s (if = %s) nd6_freend6_rtrequestnd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) nd6_rtrequest: malloc failed nd6_ioctla router(%s) advertises a prefix with non-link local address default router list contains a non-linklocal address(%s) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) nd6_ns_inputnd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad NS target (multicast) nd6_ns_outputnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_inputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: invalid ND option, ignored nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid target address %s nd6_na_outputnd6_na_output: source can't be determined: dst=%s, error=%d %s: starting DAD for %s nd6_dad_start: memory allocation failed for %s(%s) ???nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_timer: called with null parameter %s: DAD complete for %s - no duplicates found %s: could not run DAD, driver problem? nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: DAD structure not found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required nd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_ns_inputifa == NULL in nd6_dad_na_inputnd6_rs_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_input: invalid ND option, ignored nd6_ra_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid ND option, ignored defrouter_addreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlinknd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_offlinknd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlink: %s/%d is already off-link in6_ifaddin6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_usrreqrip6_detachudp6_outputspsrr1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spFaulted in DDB; continuing... address %p is invalid address 0x%08lx not a valid page framedb_fetch_reg: botchbranch_taken: botchscp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08xBad frame pointer: %p Bad user frame pointer: %p %sr%d=0x%08xtrace: pid %d not found swapped out at %p frame address = %08x frame address must be specified spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbuscpufootbridgemainbus_bs_alloc(): Help!mainbus_bs_free(): Help!%s, #0x%03ximbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtloglgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcund%s %08x %s%s#0x%08x p%d_f%d#%s[r%d]cpsr[%c - unknown]%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d, rrx, %s r%d, %s #%d{r%d-r%d}^[r%d#0x%02xf%d, c%d, No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheUndefined instruction in kernel Warning IRQ's disabled during boot() real mem = %u (%uK) cpu_startup: system table size inconsistencycpu_startup: cannot allocate UVM space for buffersavail mem = %lu (%uK) using %d buffers containing %u bytes (%uK) of memory cpu_startup: not enough memory for buffer cachecpu_startup: no room for system tables; %d bytes requiredsinglekdb-a-k-s_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POSTunknown buffer type %d _bus_dmamap_sync_bus_dmamap_sync: ARM32_BUFTYPE_INVALID_bus_dmamap_sync: ARM32_BUFTYPE_RAW_bus_dmamem_map: size botch%s: SA-110 with bugged STM^ instruction rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step 0ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzunknownCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**%s: IDC disabled IDC enabled WB disabled WB enabled LABT EABT%s: %dKB/%dB %d-way %s unified cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. %s: %dKB/%dB %d-way Instruction cache %s: %dKB/%dB %d-way %s Data cache branch prediction enabled DC disabled DC enabled IC disabled IC enabledunknown CPU (ID = 0x%x)%s %s (%s core)Processor failed probe - no CPU ID Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P) uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Non-emulated page fault with intr_depth > 0 data_abort_fault: Misaligned Kernel-mode Program Counter kerneluserFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortInvalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x badaddr: invalid size (%lu)mmrwpmap_enter: no pv entriespmap_enter: failed to allocate L2 bucketpmap_init_l1: can't get PA of L1 at %ppmapplpvepll2dtblpll2ptpplpmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: No L2 for L2 @ va %p pmap_alloc_specials: no l2b for 0x%lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_chunk: no L1 table providedxscale_setup_minidata: can't find L2 table for VA 0x%08lxuser pmap (%p): pmap_kernel (%p): domain %d, l1 at %p %08lx: %c |0000 |8000 |10000 |18000 |20000 |28000 |30000 |38000 pa 0x%08lx: krw %d kro %d urw %d uro %d %c va 0x%08lx, flags 0x%x dumpconf: bad dumpdev=0x%x dumping to dev %u,%u offset %ld dump device bad aborted from console i/o error device not ready succeeded area improper area unavailable dump to dev %u,%u not possible pagemove: size=%08lxvmapbufvunmapbufpxa2x0_gpio_boot: failed to map POWMANzaurus_reset: failed to map MEMCTLThe operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Attempting to power down... %08lx -> %08lx @ %08lx cpu not recognized! OpenBSD/zaurus booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables freestart = 0x%08lx, free_pages = %d (0x%x) switching to new L1 page table @%#lx...bootstrap done. init subsystems: stacks vectors undefined page pmap initarm: out of memorybootfile: %s bootargs: %s attempting to switch console to lcd screen %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s off INFO: 0x%x (VALID flag %s) SKSV: %s FRU CODE: 0x%x ASC/ASCQ: %s COMMAND INFO: 0x%x %c Incorrect Length Indicator Set%c EOM Detected%c Filemark Detectedscxsplgetxscannot allocate scsi xs could not get size scsi_scsi_cmdscsi_execute_xs: invalid return codescbusyunknown error category (0x%x) from scsi driver probe%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess DEnied - ACL LUN ConflictLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Begining Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedCD Control ErrorPower Calibration Area Almost FullPower Calibration Area Is FullPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullDEFERRED CDBParametersError in %s, Offset %d, bit %dProgress Indicator: %dActual Retry Count: %dASC 0x%02x ASCQ 0x%02xDiagnostic Failure on Component 0x%02xDecompression Exception Short Algorithm ID OF 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)host adapter code inconsistency unknown error category (0x%x) from host adapter code User command with no ioctl User command with no buf scistrcmdlen too big physio split the request.. cannot proceed DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S SEAGATE ST19171FCST34501FC iomegajaz 1GBIOMEGAZIP 100ZIP 2500661467MICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibusscsibus at %s: %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun linksscsi_probe_busPLEXTORCD-ROM PX-40TS1.01FUJITSUM2513A0800DELTIS MOS321 3.30MICROP 1588-15MBSUN0669vendor-uniqueremovablefixed targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sscsibusprintdirectsequentialprinterprocessorwormcdromscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: impossible device type offlinescsibusprint: impossible qualifierNEC CD-ROM DRIVE:260cd%s: not queuedcdioctlATAPI CD-ROMSCSI CD-ROMdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_disckeydvd_read_bcadvd_read_manufactcd_scsibus_set_pa_immedcd_scsibus_setchancd_scsibus_getvolcd_scsibus_setvolsd%s: WARNING: unable to establish shutdown hook %luMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lu sec totalunformatted mediadrive offline%s: not queued, error %d SCSI opticalSCSI disk%s %ssdgetdisklabel%s: removable disk stopped - not restarting %s: respinning up disk %s: respin of disk failed - %d %s: ..is spinning up...waiting sd_atapibus_get_parms%s: mode sense (%d) returned nonsense; using fictitious geometry %s: could not mode sense (4/5)%s: WARNING: cache synchronization failed /usr/src/sys/arch/arm/arm/softintr.csoftnet_intrhand != NULLsoftintr_establish: unknown soft IPL %d: PXA2x0 Onchip Peripheral Bus pxaip_attach: failed to map CLKMAN CPU clock = %d.%03d MHz pxaip_attach: failed to map RTCpxaip_attach_critical: failed to attach INTC!pxaip_attach_critical: failed to attach GPIO! addr 0x%lx intr %dpxaip_measure_cpuclock: can't map RTCpxa2x0_probe_sdram: impossiblepxa2x0_watchdog_boot: failed to map POWMANpxa2x0_watchdog_boot: failed to map OSTWARNING: using filesystem date -- CHECK AND RESET THE DATE! pxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented pxaintc: Interrupt Controller straystray interrupt %d intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxagpiopxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller %s: Can't map registers! %s: failed to hook main GPIO interrupt pxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dcouldn't establish interruptirq %ld%s: unhandled GPIO interrupt. GPIO#%d saost%s: SA-11x0 OS Timer %s: Cannot map registersclock: hz=%d stathz=%d clockstatpxauartpxaudc: cannot map mem space : USB Device Controller %s: init failed, error=%d %s: unable to establish interrupt at irq %d: failed to map registers %d%s: Unknown depth (%d) apm%s: battery life expectancy %d%% %s: AC on,off,unknown, battery is undecoded (%x)highchargingCRITICALbackup power,%s: failed to create kernel thread, disabledapmevpxa2x0_apm_attach_sub: failed to map POWMAN apmlk%s: failed to map CLKMAN %s: failed to map MEMCTL pxa2x0_apm_sleep: can't map GPIO pxa2x0_apm_sleep: can't map OST pxa2x0_apm_sleep: can't map INTCTL manufacturer 0x%x%sproduct 0x%x function %d "pcmciapcmcia_card_attach%s: error %d detaching %s (function %d) (pcmcia_function_init: function is enabledpcmcia_function_enable: function not initialized@ %lx%s%lx%s%lx; iomask %lx, iospace %lx%s%lxunknown (%d)multi-functionserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus AdapterPCMCIA 1.0 PCMCIA 2.0 or 2.1 %s: CIS checksum failed %s: CIS version PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecified, ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x;%s: %d errors found while parsing CIS audio readonly powerdown irqlevel irqpulse irqshare io16 io8 bvd_active wp_active rdybsy_active mwait_required; maxtwins %d; memspacepcmcia_parse_cis_tupleSVECFD605 PCMCIA EtherNet CardV1-1%s: using CIS quirks for AmbiCom IncAMB8002TPMX PE-200DIGITALDEPCM-XXPCMCIAUE2212D-LinkDE-660DE-660+RPTI LTD.EP400CISV100RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212ETHERNETW89C926Seiko Epson Corp.P/N: EEN10B Rev. 00CNetCN40BC EthernetNE2000FastEthernetLNT-10TNNDC004743118001TAMARACKGVCNIC-2000pR01Ethernet CardiPort10/100 Ethernet CardFast-EthernetETHER-C16Fast EthernetPCMCIA LANCF10Base-EthernetLinksysEtherFast 10/100 Integrated PC Card (PCM100)Ver 1.0DE-650DFE-670TXDLINKSYSE-CARDI-O DATAPCLAcorega K.K.corega Ether PCC-Tcorega Ether PCC-TDcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDSMC8041TX-10/100-PC-Card-V2XircomCompactCard EthernetCFE-10: no suitable config entry port 0x%lx/%d, %s: can't match ethernet vendor code : can't map ASIC I/O space : can't map NIC I/O space : function enable failed : can't get subregion for asic : unexpected I/O space configuration %s: couldn't establish interrupt %s: can't map mem for enet addr %s: can't alloc mem for enet addr %s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase Digital Mobile Media CD-ROMPortable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI Adapter: can't handle card info : %scan't allocate memory for command queue ,0x%lx/%d: can't map second I/O space : can't map first I/O space %s: couldn't enable PCMCIA function %s: couldn't establish interrupt handler %s%s : can't map io space : can't alloc i/o space Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11ISL37300PWLCFL-11INTERSILHFA384x/IEEEVersion 01.02SMC2632WNANOSPEEDNECWireless Card CMZ-RT-WPVersion 01.01NTT-ME11Mbps Wireless LAN PC CardAddtronAWP-100 Wireless PCMCIACabletronRoamAbout 802.11 DSIntersilPRISM 2_5 PCMCIA ADAPTEREval-RevASymbol TechnologiesLA4111 Spectrum24 Wireless LAN PC CardPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN AdapterAllied Telesis K.K.WR211PCMpxapcicpxapcic_mem_map: bogus kindpxapcicevpxapcicsspcic_attach_card: already attached%s: unable to create event thread for %s %s: invalid CF slot %d %s%d:failed to map memory %x for scoop %s: %d silo overflow%s, %d ibuf overflow%s com: unknown uart %s: console : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, 16 byte fifo : st16650, no working fifo : st16650, 32 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: can't establish soft interrupt.comprmcomstartcomcninit: mapping failedlcd_pxaipzkbdscoop: failed to map %s : Onboard Peripheral Controller zsspcan't map bus space zssp_read_max1111: not configured pxa2x0_ssp_read_val: not configured zaurus_charge_control: bad state %d zaurus_power_check: bad state %d wd: <%s> %s: %d-sector PIO, LBA, %lluMB, %llu sectors wdattach CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors LBA48, %lluMB, %llu sectors %s: IDENTIFY failed __wdstart: bad return code from wdc_ata_bio()wddone%s: soft error (corrected) , retrying device faultdevice timeoutST506/MFM/RLLESDI/IDE disk%s: %s wddumpwddump: try againwddump: device timed outwddump: unknown error typewddump: %swddump: drive faultwddump: DMA errorwddump: polled command has been queuedST506wd_get_params: bad return code from ata_get_params%s: flush cache command didn't complete %s: flush cache command: drive fault %s: flush cache command timeout wdc%s:%d:%d: not ready, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad statewdc_ata_ctrl_intr: state==RECALrecal%s:%d:%d: %s drive fault error (%x) %s:%d:%d: %s timed out piomodedmamodeno media/write protectedinterface CRC erroraddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectederror not notifieduse one of: %s[a-p]parsediskboot_file: '%s' rootconf: device name too longboot device: %s. root device (default %s%c)swap device can't figure root, hope your kernel is right rootconfroot on %s%c boot device not knownboot device: lookup '%s' failed. invalid geometrydos partition I/O errordisk label I/O errorno disk labeldisk label corruptedwsdisplay%s: screen %d-%d added (%s, %s emulation%s: screen %d deleted wsdisplay at %sdmux: console (%s, %s emulation), using %swsdisplay_common_attach: no memorywsdisplaytty() on ctl devicewsdisplay_switch3: giving up wsdisplay_switch3: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch2: giving up wsdisplay_switch2: screen %d disappeared wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwswaitwsmoused_sleepwscons: copybuffer memory malloc failed wsemul_vt100_output_c0c1: ESC in kernel output ignored \[>24;20;0cP0!u%5\wsemul_vt100_handle_csi[?62;6c[%d;%dR[?13n[?21n[?27;1nP2$u/wsemul_vt100_handle_dcs: bad type %d[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~OPOQOROSOpOqOrOsOtOuOvOwOxOyOIOMOD[7~OBOCOA[8~[6~[3~[2~[5~[4~[1~OjOkOlOmOnOowsevent_readwskbdwskbd at %s mux %d: console keyboard (mux %d ignored for console)cannot load keymapwskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwsmux_setmax: no memwsmux_setmax: no memorywsmux_attach: error=%d wsmux: attach out of memory rasops_init: couldn't lock font rasops_init: font table is empty rasops_init: fontwidth assumptions botched!fontwidth not 8/12/16 or RASOPS_SMALL - fixme!wsfont_unlock: font not lockedpre 1.01.12.0usb: USB revision %s, not supported usb_attach%s: root device is not a hub %s: root hub problem, error=%d usbtaskunable to create task thread usb_create_event_thread task%s: unable to create event thread for usb_create_event_threadusbevtusbtskusb at %susbreausbreadusbd_add_dev_eventusbd_add_drv_eventusb_add_eventusb_detachusbdet%s: event thread didn't die usbsynusbd_transfer: not doneusbd_start_next: error=%d usb_detach_wait: %s didn't detach NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXXvendor 0x%04xproduct 0x%04x%x.%02x, class %d/%d, rev , addr %dusbd_devinfousbdly0 lengthout of datausbd_fill_iface_data: bad descriptor(s): %s iface descusbd_set_config_index%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port usbd_print%s, %s configuration %d interface %d port %d%s: at %s (addr %d) disconnected multiple%s: %s transaction translator%s %s: hub depth (%d) exceeded, hub ignored uhub_attach%s: %d port%s with %d removable, %s powered %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: port %d power on failed, %s %s: cannot open interrupt pipe %s: no ports, hub ignored uhub%s: port %d reset failed %s: device problem, disabling port %d %s: strange, connected port %d has no power %s: illegal enable change, port %d %s: port error, giving up port %d %s: port error, restarting port %d hid_start_parsedefault bType=%d Local bTag=%d Main bTag=%d Global bTag=%d BAD LENGTH %d uhidev%s: %s, iclass %d/%d %s: could not read endpoint descriptor %s: unexpected endpoint uhidev_attach%s: no report descriptor %s: no memory %s: %d report ids uhid at %s reportid %duhidev_intr: bad repid %d uhidev_set_report_asyncuhid: input=%d, output=%d, feature=%d uhid_do_readuhidreauhid_do_ioctlukbd %s: attach failed, %s %s: was console keyboard This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). too many modifier keysbad modifier sizemultiple key code arrays key codes not on byte boundarytoo many key codeskey code size != 8umassumass_attachCBIBulk-OnlyRBC%s: using %s over %s %s: atapiscsi not configured %s: command protocol=0x%x not supported %s: bus attach failed %s: isdata not configured %s: unable to get Max Lun: %s SCSIATAPIUFIISD-ATACBI with CCI%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: transferred %d bytes instead of %d bytes%s: Unknown state %d%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Get Max Lun failed: %s umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cbaue%s: EEPROM read timed out %s: MII read timed out %s: reset failed %s: setting config no failed auemii%s: getting interface handle failed %s: missing endpoint aue_attach%s: couldn't get endpoint descriptor %d %s: no memory for rx list -- packet dropped! %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open intr pipe failed: %s %s: open tx pipe failed: %s %s: open rx pipe failed: %s %s: watchdog timeout %s: close intr pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: abort tx pipe failed: %s %s: close rx pipe failed: %s %s: abort rx pipe failed: %s axeaxe%d: read PHY failed axe%d: write PHY failed %s: media change failed axe_setmultiaxemiiaxe%d: getting interface handle failed axe_attach%s: %s, address %s couldn't get ep %d %s: usb errors on rx: %s axe%d: usb error on tx: %s axe%d: rx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s axe%d: tx list init failed axe%d: watchdog timeout axe%d: close intr pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort rx pipe failed: %s cue%s: read MAC address failed cue_attach%s: couldn't get ep %d %s: cue_send error=%s kue%s: warm boot, no firmware download %s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load trigger segment: %s %s: failed to load fixup segment: %s %s: failed to load code segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer kue_attach%s: kue_send error=%s cdce%s: no data interface %s: could not find data bulk in %s: could not find data bulk out cdce_attach%s: no union descriptor %s: usb error on rx: %s udav, setting config no failed udavmiiudav_attach, read MAC address failed , missing endpoint , couldn't get endpoint %d , failed to get interface, err=%s udav_setmulti%s: udav_send error=%s uplupl_attach%s: upl_send error=%s urlurlmiiurl_attach%s: couldn't get endpoint %d %s: failed to get interface, err=%s %s: url_send error=%s %s: %s: bad register %04x wi_usbwi_usb_attach%s: open pipes failed %s: already detached %s:%s: invalid packet id sent %x invalid packet len: %x memsz %x max %x %s: wi_usb_send error=%s write_record buf size err %x %x wiTXsyncUGH RX UGH TX wi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet wiIDLwitxlwiusbthrural%s: could not set configuration no %s: could not get interface handle ural_attach%s: MAC/BBP RT2570 (rev 0x%02x), RF %s %s: no endpoint descriptor for %d %s: could not allocate tx buffer %s: could not allocate tx xfer %s: could not allocate rx mbuf cluster %s: could not allocate rx mbuf %s: could not allocate rx buffer %s: could not allocate rx xfer %s: could not allocate beacon %s: could not transmit beacon %s: could not transmit buffer: %s ural_rxeof%s: xfer too short %d ural_tx_mgtural_tx_data%s: could not read EEPROM: %s %s: could not read MAC register: %s %s: could not write MAC register: %s %s: could not write to BBP %s: could not read BBP %s: could not write to RF RT2522RT2523RT2524RT2525RT2525eRT2526RT5222%s: timeout waiting for BBP %s: could not allocate Tx list %s: could not allocate Rx list %s: could not open Rx pipe: %s %s: could not open Tx pipe: %s %s: timeout waiting for BBP/RF to wakeup mii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_phy_setmedia: MASTER on wrong mediamiiautnsphyDP83840 10/100 PHY: %s, rev. %d nsphyterDP83815 10/100 PHYDP83843 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYiophyi82553 10/100 PHYexphyxl: 3Com internal media interface %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYrlphyrlRTL8201L 10/100 PHY: RTL internal phy rlphy_service: attempt to isolate phylxtphyLXT970 10/100 PHYLXT971 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphySeeq 80220 10/100 PHYSeeq 80225 10/100 PHYSeeq 84220 10/100 PHYtqphy78Q2120 10/100 PHYukphy: Generic IEEE 802.3u media interface %s: OUI 0x%06x, model 0x%04x, rev. %d %s: no media present bmtphyBroadcom 3C905B internal PHYBroadcom 3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYnsgphyDP83861 10/100/1000 PHYDP83891 10/100/1000 PHYurlphy%s: %s: enter down%s: %s: link %s  3ad'( @@ @ 3P3X3\3d33h3p3|4x3333333433Đ3А3ؐ3333  #*($#! " xN]N]<55XO]pO]H5.5 o]8o]<5"5ho]o]|5&5o]o]|5&5o]p]H5.5q] q]T5258q]Pq]T525lq]q]t525q]{]525q]{]d525xr]r]T525r]T 5T525s]s]|55 y] 5|55y]|]|55z] 5|55z]z]T525{]{]T525{]{]T525$|]<|]T525$|]<|]T525P|]h|]T525||]r]T525|]|]|55t}]`}]565~]~]5 5 n3]<5:5 n3]<5:5p3]<55]]<55p3]<55p3]5*5,p3]5*5,z3]<55(30]<553D]<553d]<55P3x]<553]<553]<55ă3]<55܃3]<5543 5<55<3,]<55@]X]55.l]]55.]]55.]]55.]]55.]4]55.H]`]55.t]]55.]]55.]]55.]]55.$]<]55.P]h]55.|]]55.]]55.]]55.]]55.0]H]55.33340&0&!l   p @x3I dM xP V T PU ? h $u \ x{ \G 7n4THIS is A memory TEST pattern 3     4 p   L  L P X  D 4 P P!x!! L! @ @   )4! ,`_ 3t"38#35 3!(3!03!4d!83!4!@3!H3!P3!X3@!d3$!l3hY!`4!t3!\3!|3!3!3!33$#!3!|4!3%!4U!3Z!p3Z!3L!T3L!3p!3Y!ȣ3$Y!У3E!4E!أ3G!<"4G!3$F!3F!3F!3!3X!3t"38# 35353@!$3^!,3!|3!!!h!!!!xx4k_4k_P53a 35(3T5035<35H355|_ ##$__!l!!!PX(!!TF̱!@!PNL!RR!CE !ST!NM,!!CL\!0PL\!0RE!@RR!CE !ST!SL!RR!CE !ST!ER!CE !ST!*5$+5!D+5#p+5#+5!+5!+5! ,5!L,5!x,5L!,5#,5#,58!(-5!-5$-5#-5# .5`!D.5#p.5#.5#.5!.5!$/5!P/5 $|/5P!/5إ!/5!05!,05!15!X050!*5P!05`!05#15$p_t5*5t%+5! ,5!L,5!|/5P!/5إ!/5!05!X050!*5P!l_5*5č%+5! ,5!L,5!|/5P!/5إ!/5!05!X050!*5P!15$t_5@,!54!5native-*D5@T!%$hI%("N%t%pu%8"8"@** $("("("("("("(" " |" ," Ě"(" *T4"0"("("Y%!"Y%M%("("("C"C"C"C"\5" D"XD"5"5"6"6" 7"45""5"5"5"5#5 #5  0 "0"|"#5#5#5#5#5d@B @5N443xG#G#`$5 j#8j#Hj#lj#i# j# f! 3X4333<"4333T33Y433333 33h4H3433 34 33343 3N4N4###X# #H###@###T###t#o$#(#ttyclsttyopnttybgttyinttyout#X###h###$$\#######$#######$#######$#######$#######$#######$### `3(5l$(5l$h&& &T&3t$$d'5(5Tp$|r$Tp$p$@q$q$P3ffsB)3ext2fsH*3cd9660!3msdos(5*5XB5B5`C53545\6555d575 E5E5F5$$2lockf@` 333 333$3,343 *5$+5#-541%|/51%/5#/5H$05P$X05l2%*5X$_D*5z%{%X~%%%|%`%33*53+5 $3<+5 03h+5 <3+5 H3+5 T3+5 `3,5 l3D,5 x3p,53,53,5 3,53 -5 3L-53x-53-53-5 3.5 30.5 3h.5  3.5 3.5 $3.5 03/5 @3H/5L3t/5\3/5h3/5 t3/5 3$05 3P053|053053053153,153X15315315*51515*5+5D+5p+5+5+5+5 ,5L,5x,5,5,5,5(-5T-5-5-5-5 .5D.5p.5.5.5.5$/5P/5|/5/5/505,05X0505050515415`15*5$+5%D+5H%p+5H%+50%+5#+5@% ,5@%L,5@%x,58%,5%,5%(-5%-5#-5H% .5H%D.5H%p.5H%.5H%.5H%.5@%$/5@%P/5H%|/5#/5#/5x%05P$,05%15 %X05 %*5X$05@%05@%15#$_|25*5$+5%D+5L%p+5L%+5%+5X%+5<% ,5<%L,5<%x,5%,5%,5#,5%(-5D%T-5d%-5$-5#-5L% .5L%D.5L%p.5L%.5L%.5L%.5L%$/5L%P/5L%|/5%/5%/5H$05P$,05,%15L%X05%*5X$05%05D%15#(_35%D%%%devopndeviodevwaitdevindevoutdeviocdevcls*5$+5%D+5ب%p+5ب%+5%+5L%+5Ш% ,5Ш%L,5Ш%x,5%,5\%,5#,5D%(-5 %T-5|%-5$-5ܤ%-5ب% .5ب%D.5ب%p.5ب%.5ب%.5ب%.5ب%$/5ب%P/5ب%|/58%/5#/5H$05P$,05%15%X05̧%*5X$05 %05%15$,_,55. .. *5$+5%D+5&p+5&+5&+5$&+5& ,5&L,5&x,5, &,5 &,5#,5,&(-54&-5@&-5& .5&D.5$&p.5t&.5h &.5&`?&20123456789abcdef^^3333ئ3&8&#$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@BC =D$E =F$cde@B@B@KLاO[@T6nQ%l7Jpp@@@@j j j  95\:5h&H&&&T&&3d&(:5\:5d|3333333333343333(30383@3H3,2D=5x ('''4 (D=58((((((D=5,7(((@(Ď(((`(D=54*(,(8.(p/(D=5',(8.(p/('X'D=5(,(8.(p/((D=5)(,(8.(p/(D=5ؗ',(8.(p/(P'''D=54*(,(8.(p/($*(h3p;5D=5 & dXx=5|=5=5=5=5}E#(D<8Q @X,D>5H>5P>5\>5\;5`;5d;5h;5t>5>5@>5>5>5 >5$>5(>5,>54>50>58>5<>52(@AAA==(A* dd%(i @@@@@@@@@?5|?5`` @5@5?5?5?5?5?5?5$d@5l@5h@53333.)d,)T()\")H<)*5$+5w)D+5L)15x)p+5)+5H)+5)+5) ,5|)L,5)x,5a),58e),5#,5h)(-5p)T-5)-5$-5k)-5) .5P)D.5)p.5D).5).5).5)$/5)P/5 $|/5u)/5|m)/5d)05),05m)15)X05)*5)05 )05)05(15$t`A5*5t%+5 )+5) ,5|)L,5)x,5),5ܸ)-5k)|/5u)/5|m)/5d)05)X05)*5)p``B5*5č%+5)+5) ,5|)L,5)x,5\),5)-5k)|/5u)/5m)/5d)05)X05)*5)15$x`B5 ... ...)D))))) E5E5F5*5$+5<)D+5*p+5$*+5*+5)+5* ,54*L,5 *x,5),5 *,5#,5h)(-5p)T-5`$-58*-5%* .5D&*D.5'*p.51*.5D4*.5d5*.5)$/5H6*P/5 $|/5)/59*/5d)05),05)15)X05)*5)05 )056*15$``C5*5t%+5 )+5* ,54*L,5 *x,5),5ܸ)-58*|/5)/59*/5d)05)X05)*5)d`E5*5č%+5)+5* ,54*L,5 *x,5\),5)-58*|/5)/5 :*/5d)05)X05)*5)15$\`E5U*U*V*B/<  :>B87/@`P /mnt` @@<@`bT 08:>B/<  :>B87/@`d]@@<@`bTU :>B`P PPT`((((((((((((bcѪ pA :>B:>B@{4:>B@{4TA:>B@:>BnE6:>BnE6)eA :>B:>B(:>B(kiA:>B:>B@}:>B@}FA:>B:>B:>Br)A:>B:>B:>B@7 d=A:>B@7 :>B@7 :>B@7 :A:>B@7 :>B@7 :>B@7 F\A:>B@7 :>B[ :>B[ nXC:>B@7 :>B@7 :>B@7 JA:>B@7 :>BD :>B@^'L&A:>BD :>B@):>B@);IA:>BD :>BD :>BD jpA:>BD :>BD :>BD vSA:>BD :>B@^':>B@^'.A:>B@h!:>B@F:>B@FӤA:>B%&:>B%&:>B@^'%GA:>B@^':>BR':>BR'XVbC:>BR':>BR':>BR'n~A:>BR':>BR':>BR'A:>BR':>BR':>BR'A:>BR':>BR':>BR'IA;:>B@:>B@:>B@{4X`hpxHx >T:>B 4:>B:>B ڌ!:>B(:>B(:>B(!:>B@:>B@:>B@q:!:>BU:>BU:>BUH!:>B@K:>B@K:>B@Kf!:>B:>B:>B8!:>B@}:>B@}:>B@}!!:>B x:>B x:>B xs3Z!:>B@:>B@:>B@TA!:>B6:>B6:>B6!:>B@A:>B@A:>B@A@x!:>Bc:>Bc:>BcrC!:>B@r:>B@r:>B@rO:!:>B :>B :>B k!:>B@':>B@':>B@'n!:>B<:>B<:>B<N!:>B@T:>B@T:>B@TGY!:>Bm:>Bm:>Bmm]!:>B@:>B@:>B@5]!:>B:>B:>B W!:>BD :>BD :>BD G!:>B@h!:>B@h!:>B@h! ^ԍ!:>Bq":>Bq":>Bq" wC!:>B@":>B@":>B@"  !:>B2#:>B2#:>B2# /!:>B@5#:>B@5#:>B@5# R!:>B%&:>B%&:>B%& d.i!:>B@^':>B@^':>B@^' M_!:>BR':>BR':>BR' P!:>B@(:>B@(:>B@(>!:>B():>B():>B()c5!:>BY*:>BY*:>BY*˪!:>B@C*:>B@C*:>B@C*޾,!:>Bي+:>Bي+:>Bي+h]_!:>B@p#,:>B@p#,:>B@p#,vS5L!:>B,:>B,:>B,!:>B@T-:>B@T-:>B@T-$Є!:>B3-:>B3-:>B3- X!:>B@ʅ.:>B@ʅ.:>B@ʅ.m3!:>B@/:>B@/:>B@/7,!:>BO0:>BO0:>BO0r,f!:>B@$0:>B@$0:>B@$0k!:>B1:>B1:>B1zp!:>B@Q2:>B@Q2:>B@Q2A!:>B2:>B2:>B2!:>B@~J3:>B@~J3:>B@~J3wY;!:>B3:>B3:>B3砑!:>B@{4:>B@{4:>B@{4xu+9!:>BA5:>BA5:>BA5`!:>B@ج5:>B@ج5:>B@ج5@!:>BnE6:>BnE6:>BnE6~!:>B@6:>B@6:>B@6>e!:>Bv7:>Bv7:>Bv729 !:>Bȧ8:>Bȧ8:>Bȧ8;/!:>B@_@9:>B@_@9:>B@_@9w6!:>B9:>B9:>B9#9q!:>B@q::>B@q::>B@q:=8 !:>B" ;:>B" ;:>B" ;ó!:>B@:>B@:>B@!:>B:>B:>B)~b!:>B@9:>B@9:>B@9ic!:>B:>B:>BC!:>B@Ij:>B@Ij:>B@Ijmc^!:>B:>B:>Be=!:>B@v:>B@v:>B@vt!:>B 4:>B 4:>B 4  a!:>B9e:>B9e:>B9e y !:>B@:>B@:>B@!{!:>Bf:>Bf:>Bf!Rr!:>B@.:>B@.:>B@."aλ!:>B:>B:>B" !:>B@W :>B@W :>B@W #Kz-!:>B@ :>B@ :>B@ #o!:>B[ :>B[ :>B[ $B!:>B@ :>B@ :>B@ $͠!:>BG :>BG :>BG %!:>B@$ :>B@$ :>B@$ %Cd!:>Bt :>Bt :>Bt &!:>B@ V:>B@ V:>B@ V&s,!:>B:>B:>B' Ru!:>B:>B:>B'!:>B@e:>B@e:>B@e(BKd!:>BP:>BP:>BP(!:>B@:>B@:>B@)!Ղ!:>B(:>B(:>B()C !:>B@:>B@:>B@*!:>BU:>BU:>BU*~!:>B@K:>B@K:>B@K+4;!:>B:>B:>B+zx!:>B@}:>B@}:>B@},?!:>B:>B:>B,b!:>B@F:>B@F:>B@F-v!:>BF:>BF:>BF-*6!:>B x:>B x:>B x.H!:>B@:>B@:>B@.L8!:>B6:>B6:>B6/&A!:>B@A:>B@A:>B@A/X!:>Bc:>Bc:>Bc0jA!:>B@r:>B@r:>B@r0]C!:>B :>B :>B 1zU!:>B@':>B@':>B@'1%3!:>B<:>B<:>B<2!:>B@T:>B@T:>B@T2F z!:>Bm:>Bm:>Bm33{!:>B:>B:>B3hY!:>B@7 :>B@7 :>B@7 4q!:>BD :>BD :>BD 4DU!:>B@h!:>B@h!:>B@h!5;!:>Bq":>Bq":>Bq"5C!:>B@":>B@":>B@"6!:>B2#:>B2#:>B2#6!:>B@5#:>B@5#:>B@5#7zC=!:>B@^':>B@^':>B@^'7`o!:>BR':>BR':>BR'8+~!:>B@(:>B@(:>B@(8JN!:>B():>B():>B()9jk!:>B@):>B@):>B@)9(C!:>BY*:>BY*:>BY*:l/!:>B@C*:>B@C*:>B@C*: ) !:>Bي+:>Bي+:>Bي+;x!:>B@p#,:>B@p#,:>B@p#,;ɚ!:>B@T-:>B@T-:>B@T-</!:>B3-:>B3-:>B3-<g!:>B@ʅ.:>B@ʅ.:>B@ʅ.=*W!:>B`/:>B`/:>B`/=-5!:>B@/:>B@/:>B@/|b!:>BO0:>BO0:>BO0z!:>B@$0:>B@$0:>B@$0 FiU!:>B@Q2:>B@Q2:>B@Q2(!:>B2:>B2:>B2,!:>B@~J3:>B@~J3:>B@~J3I4a:>B3:>B3:>BO0#M!:>B@{4:>B@{4:>BO0Aнa:>BA5:>BA5:>BO0ՌZX!:>B@ج5:>B@ج5:>BO0Ta:>Bv7:>Bv7:>BO0,nc!:>B@28:>B@28:>BO0a:>Bȧ8:>Bȧ8:>BO0Vʲ!:>B@_@9:>B@_@9:>BO0 ka:>B9:>B9:>BO0E!:>B@q::>B@q::>B@$0K!a:>B" ;:>B" ;:>B@$0Y?!:>B@:>B@:>B@$0|la:>B:>B:>BA5c!:>B@9:>B@9:>BA5J`a:>B@Ij:>B@Ij:>BA5C'!:>B:>B:>BA5RoNa:>B@v:>B@v:>BA5/!:>B 4:>B 4:>BA5Ra:>B@:>B@:>BA5$Q!:>B9e:>B9e:>BA5b<a:>B@:>B@:>BA5ƍ!:>Bf:>Bf:>BA5Zya:>B@.:>B@.:>BA50Ȟ!:>B:>B:>BA5Bya:>B@*`:>B@*`:>BA5/Y!:>B@ :>B@ :>BA5טa:>B[ :>B[ :>BA59r!:>B@ :>B@ :>BA56ڶa:>B@$ :>B@$ :>BA5M!:>Bt :>Bt :>BA5,a:>B@ V:>B@ V:>BA5 j*!:>B:>B:>BA5 Aa:>B@8:>B@8:>BA5  '%!:>B:>B:>BA5 aZa:>B@e:>B@e:>BA5 M!:>BP:>BP:>BA5 a:>B(:>B(:>BA5 !:>B@:>B@:>BA5 Qa:>BU:>BU:>BA5 ]C!:>B@K:>B@K:>BA5  a:>B:>B:>BA5OY!:>B@}:>B@}:>BA5=W%a:>B:>B:>BA5g!:>B@F:>B@F:>BA5[a:>BF:>BF:>BnE6JH!:>B@s:>B@s:>BnE6d)a:>B x:>B x:>BnE6mH!:>B@:>B@:>BnE6p`a:>B@A:>B@A:>BnE6 !:>Bc:>Bc:>BnE6ՑC%a:>B@r:>B@r:>BnE6!:>B :>B :>BnE6a:>B@':>B@':>BnE6Ґ !:>B<:>B<:>BnE6-a:>B@T:>B@T:>BnE6Iī!:>Bm:>Bm:>BnE6ܻJa:>B@:>B@:>BnE6B!:>B:>B:>BnE66;Pa:>B@7 :>B@7 :>BnE6ܤ"!:>BD :>BD :>BnE6O`a:>Bq":>Bq":>BnE6~!:>B@":>B@":>BnE6L9a:>B2#:>B2#:>BnE6!:>B@5#:>B@5#:>BnE6Ja:>B@(:>B@(:>BnE6#!:>B():>B():>BnE6.a:>BY*:>BY*:>BnE6r!:>B@C*:>B@C*:>BnE6#"a:>B@p#,:>B@p#,:>BnE6 M !:>B,:>B,:>BnE6Jea:>B3-:>B3-:>BnE6_j!:>B@ʅ.:>B@ʅ.:>BnE6a:>B@/:>B@/:>BnE6e!:>BO0:>BO0:>BnE6 lea:>B@$0:>B@$0:>BnE6!:>B1:>B1:>BnE66pBKa:>B@Q2:>B@Q2:>Bv7 <Џ!:>B2:>B2:>Bv7 na:>B@~J3:>B@~J3:>Bv7!Vt !:>B3:>B3:>Bv7!QGa:>BA5:>BA5:>Bv7"Sݶ!:>B@ج5:>B@ج5:>Bv7"La:>BnE6:>BnE6:>Bv7#x $!:>B@6:>B@6:>Bv7#a:>Bv7:>Bv7:>Bv7$Y~+!:>B@28:>B@28:>Bv7$0 ]a:>Bȧ8:>Bȧ8:>Bv7%˿!:>B@_@9:>B@_@9:>Bv7%Za:>B9:>B9:>Bv7&L;`!:>B@q::>B@q::>Bv7&Ajga:>B" ;:>B" ;:>Bv7'?e(!:>B@9:>B@9:>Bv7'a:>B:>B:>Bv7(!:>B@Ij:>B@Ij:>Bv7(¯a:>B:>B:>Bv7) !:>B@v:>B@v:>Bv7)[a:>B 4:>B 4:>Bv7*.]!:>B@:>B@:>Bv7* a:>B@:>B@:>Bv7+l g!:>Bf:>Bf:>Bv7+(Za:>B@.:>B@.:>Bv7,ş$!:>B@*`:>B@*`:>Bv7,na:>B@W :>B@W :>Bv7-!:>B@ :>B@ :>Bv7-7a:>B@$ :>B@$ :>Bv7.ҽE!:>B@ V:>B@ V:>Bv7.gSa:>B@8:>B@8:>Bv7/^*[!:>B@e:>B@e:>Bv7/o2a:>B@:>B@:>B@280ކ)!:>B@:>B@:>Bȧ803xa:>BU:>BU:>Bȧ813㋲!:>B:>B:>Bȧ81Ta:>B:>B:>Bȧ829!:>BF:>BF:>Bȧ82'0a:>B x:>B x:>Bȧ83#ډe!:>B6:>B6:>Bȧ83@a:>Bc:>Bc:>Bȧ84<׳!:>B@r:>B@r:>Bȧ84V8a:>B@':>B@':>Bȧ85'Bs!:>B@T:>B@T:>Bȧ85sxa:>B@:>B@:>Bȧ86E5"!:>B@7 :>B@7 :>Bȧ86;a:>B@h!:>B@h!:>Bȧ87$ū!:>Bq":>Bq":>Bȧ87W;a:>B2#:>B2#:>Bȧ88}4!:>B@5#:>B@5#:>Bȧ88j=a:>B%&:>B%&:>Bȧ89 !:>B@^':>B@^':>Bȧ89~a:>BR':>BR':>Bȧ8:1}!:>B@(:>B@(:>Bȧ8:ia:>B():>B():>Bȧ8;OM2!:>B@):>B@):>Bȧ8;ϔa:>B@C*:>B@C*:>Bȧ8<J]o!:>Bي+:>Bي+:>Bȧ8<9a:>B@p#,:>B@p#,:>Bȧ8=޾!:>B,:>B,:>Bȧ8=.Ca:>B@T-:>B@T-:>Bȧ8>+wD!:>B3-:>B3-:>Bȧ8>a:>B@ʅ.:>B@ʅ.:>Bȧ8?d q!:>B`/:>B`/:>Bȧ8?wW=a:>BO0:>BO0:>B@_@9@@+!:>B@$0:>B@$0:>B9@Oa0a:>B1:>B1:>B@_@9AY!:>B@Q2:>B@Q2:>B9A-{a:>B2:>B2:>B@_@9Bש!:>B@~J3:>B@~J3:>B9BB3:>B3:>B@_@9CGį!:>B@{4:>B@{4:>B9CLa:>BA5:>BA5:>B@_@9D!:>B@ج5:>B@ج5:>B9D8a:>BnE6:>BnE6:>B@_@9E.=!:>B@6:>B@6:>B9E)a:>Bv7:>Bv7:>B@_@9FR!:>B@28:>B@28:>B9F^1a:>B@_@9:>B@_@9:>B@_@9G0P!:>B9:>B9:>B9Gaa:>B@q::>B@q::>B@_@9HV !:>B" ;:>B" ;:>B9HfCa:>B@:>B@:>B@_@9Iz!:>B:>B:>B9IJa:>B@9:>B@9:>B9J6!:>B:>B:>B9J~$a:>B:>B:>B9K3:9!:>B@v:>B@v:>B9Kt8a:>B 4:>B 4:>B9Lq!:>B@:>B@:>B9Lema:>B9e:>B9e:>B9MXg!:>B@:>B@:>B9Mda:>Bf:>Bf:>B9N!:>B@.:>B@.:>B9NV\`a:>B:>B:>B9O!:>B@*`:>B@*`:>B9O%|a:>B:>B:>B@q:k,!:>Bt :>Bt :>B@q:ea:>B@ V:>B@ V:>B@q:zC!:>B:>B:>B@q:1Ea:>B@8:>B@8:>B@q:Jr!:>B:>B:>B@q:Oma:>B@e:>B@e:>B@q:^w!:>B@:>B@:>B" ; va:>B(:>B(:>B@q:+3 !:>B@:>B@:>B" ;tua:>BU:>BU:>B@q:(!:>B@K:>B@K:>B" ;; a:>B:>B:>B@q:1>!:>B@}:>B@}:>B" ;2a:>B:>B:>B@q:X!:>B@:>B@:>B" ;šma:>B6:>B6:>B@q:Q!:>B@A:>B@A:>B" ;_ha:>Bc:>Bc:>B@q: F`b!:>B@r:>B@r:>B" ; b1a:>B@':>B@':>B@q: nw!:>B<:>B<:>B" ; <a:>B@T:>B@T:>B@q: d!:>Bm:>Bm:>B" ; AhOa:>B@:>B@:>B@q: b!:>B:>B:>B" ; :`a:>B@7 :>B@7 :>B@q:  ?!:>BD :>BD :>B" ; a:>B@h!:>B@h!:>B@q:!:>Bq":>Bq":>B" ;6Ua:>B@":>B@":>B@q:m!:>B2#:>B2#:>B" ;"Ta:>B@5#:>B@5#:>B@Pd}!:>B@^':>B@^':>B@V4a:>BR':>BR':>B@gn!:>B@(:>B@(:>B@DvBa:>B():>B():>B@JCM!:>B@):>B@):>B@ *a:>BY*:>BY*:>B@YR!:>B@C*:>B@C*:>B@oa:>Bي+:>Bي+:>B@Y !:>B@p#,:>B@p#,:>B@`-(a:>B,:>B,:>B@ғM!:>B@T-:>B@T-:>B@яa:>B3-:>B3-:>B@.N!:>B@ʅ.:>B@ʅ.:>B@5ua:>B@/:>B@/:>B@M2!:>BO0:>BO0:>B@ <a:>B@$0:>B@$0:>B@!:>B1:>B1:>B@a:>B@Q2:>B@Q2:>B@k!:>B2:>B2:>B@F5/a:>B@~J3:>B@~J3:>B@¶}!:>B3:>B3:>B@ez.a:>BA5:>BA5:>B@!:>B@ج5:>B@ج5:>BEa:>BnE6:>BnE6:>B@Z}!:>B@6:>B@6:>BFo!a:>Bv7:>Bv7:>B@P!:>B@28:>B@28:>BuAa:>Bȧ8:>Bȧ8:>B@6!:>B9:>B9:>B67a:>B@q::>B@q::>B@h !:>B" ;:>B" ;:>Bra:>B@:>B@:>B@9 Q!:>B:>B:>B@9 a:>B@9:>B@9:>B@9!Y!:>B:>B:>B@9!ja:>B@Ij:>B@Ij:>B@9"I!:>B:>B:>B@9"JAa:>B@v:>B@v:>B@9#YMd!:>B 4:>B 4:>B@9#iQa:>B@:>B@:>B@9$O!:>B9e:>B9e:>B@9$I6a:>Bf:>Bf:>B@9%Bb!:>B@.:>B@.:>B@9%m囬a:>B:>B:>B@9&#Q!:>B@*`:>B@*`:>B@9&a:>B:>B:>B@9'/u!:>B@W :>B@W :>B@9'MZa:>B@ :>B@ :>B@9(t!:>B[ :>B[ :>B@9(#a:>B@ :>B@ :>B@9)UK!:>B@ V:>B@ V:>B@9)gZa:>B:>B:>B@9*,!:>B@8:>B@8:>B@9*ba:>B:>B:>B@9+{5!:>B@e:>B@e:>B@9+\,#a:>BP:>BP:>B@9,̈́>!:>B@:>B@:>B@9,Ca:>B(:>B(:>B@9-9!:>BU:>BU:>B@9->oa:>B@K:>B@K:>B@9.!:>B:>B:>B@9.Υa:>B@}:>B@}:>B@9/ed!:>B:>B:>B@9/Wݱa:>B@F:>B@F:>B@Ij0SJ!:>BF:>BF:>B@Ij0DPa:>B@s:>B@s:>B@Ij1|'*!:>B x:>B x:>B@Ij1Ea:>B@:>B@:>B@Ij2OԤ!:>B6:>B6:>B@Ij2&a:>B@A:>B@A:>B@Ij3_!:>B@r:>B@r:>B@Ij3ka:>B :>B :>B@Ij4rOP!:>B@':>B@':>B@Ij4VRa:>B<:>B<:>B@Ij5YGft!:>B@T:>B@T:>B@Ij5 a:>Bm:>Bm:>B@Ij6ipq!:>B@:>B@:>B@Ij6ona:>B:>B:>B@Ij7|7;!:>BD :>BD :>B@Ij7a:>B@h!:>B@h!:>B@Ij8X;!:>Bq":>Bq":>B@Ij8̯a:>B@":>B@":>B@Ij9c!:>B2#:>B2#:>B@Ij9|Фa:>B@5#:>B@5#:>B@Ij:JM!:>B%&:>B%&:>B@Ij:a:>B@^':>B@^':>B@Ij;=!:>BR':>BR':>B@Ij;|a:>B@(:>B@(:>B@Ij<X)!:>B@):>B@):>B@Ij<pZ~a:>BY*:>BY*:>B@Ij=!!:>B@C*:>B@C*:>B@Ij=\a:>Bي+:>Bي+:>B@Ij>>>!:>B@p#,:>B@p#,:>B@Ij>A{a:>B,:>B,:>B@Ij?L~!:>B@T-:>B@T-:>B@Ij?lNHa:>B3-:>B3-:>B@v@WVw^!:>B@ʅ.:>B@ʅ.:>B@v@1)a:>B`/:>B`/:>B@vAhgh5!:>B@/:>B@/:>B@vAs̤a:>B@$0:>B@$0:>B@vBZY!:>B1:>B1:>B@vBBca:>B@Q2:>B@Q2:>B@vC$~!:>B2:>B2:>B@vC[8a:>B@~J3:>B@~J3:>B@vD>M!:>B3:>B3:>B@vD>a:>B@{4:>B@{4:>B@vEIl!:>BA5:>BA5:>B@vE~a:>B@ج5:>B@ج5:>B@vFv}!:>BnE6:>BnE6:>B@vF *a:>Bv7:>Bv7:>B@vG6!:>B@28:>B@28:>B@vG*FGa:>Bȧ8:>Bȧ8:>B@vHT8U!:>B@_@9:>B@_@9:>B@vH;a:>B9:>B9:>B@vI1!:>B@q::>B@q::>B@vIZa:>B" ;:>B" ;:>B@vJuN!:>B@:>B@:>B@vJyM6a:>B:>B:>B@vKVN!:>B@9:>B@9:>B@vK>a:>B:>B:>B@vL!:>B:>B:>B@vLdI'a:>B@v:>B@v:>B@vM'zs!:>B 4:>B 4:>B@vM+a:>B@:>B@:>B@vN!:>B9e:>B9e:>B@vNFL=a:>B@:>B@:>B@vOQ)}!:>Bf:>Bf:>B@vOǜd!:>B@.:>B@.:>B1!:>B:>B:>B1!:>B@*`:>B@*`:>B1P!:>B:>B:>B1U!:>B@W :>B@W :>B15Za:>B@ :>B@ :>B@$0w!:>B[ :>B[ :>B@$0̆0a:>B@ :>B@ :>B@$0t_!:>BG :>BG :>B@$0a:>B@ V:>B@ V:>B@$0 !:>B:>B:>B@$0KNa:>B@8:>B@8:>B@$0Zq!:>B:>B:>B@$0a:>BP:>BP:>B@$0Q!:>B@:>B@:>B@$0La:>B(:>B(:>B@$0@!:>B@:>B@:>B@$0oa:>BU:>BU:>B@$0GC!:>B@K:>B@K:>B@$0ea:>B:>B:>B@$0ݤ!:>B:>B:>B@$0 :g!:>B@F:>B@F:>B@Fay!:>BF:>BF:>BFN[!L!:>B@s:>B@s:>B@sC0b!:>B x:>B x:>B xewH:>B@*`:>B:>BQ:>B) :>BG :>BG   P)]):>Bt :>B:>Bs :>B:>B:>BP:>BP:>BP:>BP/tmp/disktab.shadowhZO:>B(:>B(:>B(/tmp/fstab.shadoww :>B@K:>B@K:>B@K/tmp/resolv.conf.shadow2 :>B@}:>B@}:>B@}/tmp/hosts :>B@F:>Bf:>Bf5:>B[ :>B@8:>B@~J3:>B@e:>B@K:>B@K%:>BF:>Bc:>Bcrű:>B@':>B@7 :>B@~J3J:>B@h!:>BR':>B@~J3 ( -EiJk:>B@C*:>B@Q2:>B@Q2 ( 0 8 @ H 6%3Gt{mI[;P>֚F Yfl*~iz'BP;,!MT6-x.m7Lj4ߍ=)Z_[uLWL xgἵO`U^w&$Q%"  $᱆>>,[Zև['v)Y-7cQ\_W 8*[[ I˂H\7 >R?"gE,*G, U`=1m.g VY _P  . .. catchmod)chgrp) cp dd df edexpr)hostname ksh sh ln lsmkdir) mteject) mv pax tarcpio) rmstty)sync)ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP  . .. pppfirmware6groupFspwd.db protocolsservices disktab fstab) resolv.confL hosts) ... ... ... ... . .. bin dev etc mnt mnt2 sbin tmp usrvarinstbin .profile  install.md upgradeinstall install.sub . ..chown)dhclient disklabeldmesg)fdisk)fsck) fsck_ext2fsfsck_ffsifconfiginit)mknod)mount) mount_cd9660 mount_ext2fs mount_ffs mount_msdos mount_nfsnewfs) newfs_msdosping)ping6)reboothalt)route)rtsol)$umount ... . .. binmdec sbin share . .. ftpgrep)fgrep)egrep)gzip)gunzipgzcat)less)more)\sed . .. . .. . ..misc keymaps . .. termcap ... . .. tmp db runempty ... ... ... ...ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 RMlist="$RMlist $1$2? r$1$2?" [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 M r$1$2$d c $4 $(($n+$count)) 640 let count=count+1 done MKlist="$MKlist;chown root:operator $1$2? r$1$2?" } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist="rm -f" MKlist=":" mkl() { [ "${mklist[$1]}" ] && { mklist[$1]="${mklist[$1]};mknod -m $1 $2 $3 $4 $5" } || { mklist[$1]="mknod -m $1 $2 $3 $4 $5" modes="$modes $1" } } M() { RMlist="$RMlist $1" mkl ${5-666} $1 $2 $3 $4 mklist="$mklist $1" G=${6:-wheel} [ "$7" ] && { MKlist="$MKlist;chown $7:$G $1" } || { case $G in wheel)g=0;;kmem)g=2;;operator)g=5;;tty)g=4;;dialer)g=117;;_lkm)g=61;; esac [ "${grplist[$g]}" ] && { grplist[$g]="${grplist[$g]} $1" } || { groups="$groups $g" grplist[$g]="chgrp $G $1" } } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M drum c 3 0 640 kmem M klog c 6 0 600 M xf86 c 2 4 600 M reload c 2 20 640 kmem ;; xfs*) M xfs$U c 51 $U 600 ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 29 $(($U*16)) 640 operator M nss$U c 29 $(($(($U*16))+1)) 640 operator M enss$U c 29 $(($(($U*16))+3)) 640 operator RMlist="$RMlist scan$U" MKlist="$MKlist;umask 77;ln -s ss$U scan$U" ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist="$MKlist;[ -e radio ] || ln -s radio$U radio" ;; pf*) M pf c 46 0 600 ;; pci) M pci c 71 0 600 ;; lkm) M lkm c 35 0 640 _lkm ;; iop*) M iop$U c 73 $U 660 ;; fd) RMlist="mkdir -p fd;$RMlist" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist="$MKlist;chmod 555 fd" ;; crypto) M crypto c 47 0 ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; hotplug) M hotplug c 37 $U 400 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist="$MKlist;[ -e audio ] || ln -s audio$U audio" MKlist="$MKlist;[ -e mixer ] || ln -s mixer$U mixer" MKlist="$MKlist;[ -e sound ] || ln -s sound$U sound" MKlist="$MKlist;[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; uall) R ttyU0 ttyU1 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 R uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse*) M wsmouse$U c 62 $U 600 ;; wskbd*) M wskbd$U c 61 $U 600 ;; tty[C-F]*) U=${i##tty[C-F]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 dodisk svnd $U 19 19 $U 2048 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; ramdisk) R pty0 rd0 cd0 cd1 st0 st1 wd0 wd1 wd2 wd3 wd4 sd0 sd1 sd2 R sd3 sd4 bpf0 std ;; all) R ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R cd0 cd1 rd0 tun0 tun1 tun2 tun3 bpf0 bpf1 bpf2 bpf3 bpf4 R bpf5 bpf6 bpf7 bpf8 bpf9 pty0 xfs0 ss0 ss1 ch0 hotplug ptm R local wscons pci iop0 iop1 uall tuner0 radio0 audio0 uk0 R random lkm tty00 tty01 tty02 tty03 apm crypto pf systrace R wd0 wd1 wd2 wd3 raid0 raid1 raid2 raid3 std st0 st1 fd ;; wd*|sd*|raid*|ccd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; raid*) dodisk raid $U 71 71 $U 0;; ccd*) dodisk ccd $U 21 21 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" list="$RMlist" for mode in $modes; do list="$list;${mklist[$mode]}" done for group in $groups; do list="$list;${grplist[$group]}" done list="$list;$MKlist" if [ "$eo" = "echo" ]; then $eo "$list" else echo "$list" | sh fi wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: dialer:*:117: nogroup:*:32766: nobody:*:32767:  . ..MAKEDEVttyp06ptyp06ttyp16ptyp16ttyp26ptyp26 ttyp36!ptyp36"ttyp46#ptyp46$ttyp56%ptyp56&ttyp66'ptyp66(ttyp76)ptyp76*ttyp86+ptyp86,ttyp96-ptyp96.ttypa6/ptypa60ttypb61ptypb62ttypc63ptypc64ttypd65ptypd66ttype67ptype68ttypf69ptypf6:ttypg6;ptypg6<ttyph6=ptyph6>ttypi6?ptypi6@ttypj6Aptypj6Bttypk6Cptypk6Dttypl6Eptypl6Fttypm6Gptypm6Httypn6Iptypn6Jttypo6Kptypo6Lttypp6Mptypp6Nttypq6Optypq6Pttypr6Qptypr6Rttyps6Sptyps6Tttypt6Uptypt6Vttypu6Wptypu6Xttypv6Yptypv6Zttypw6[ptypw6\ttypx6]ptypx6^ttypy6_ptypy6`ttypz6aptypz6bttypA6cptypA6dttypB6eptypB6fttypC6gptypC6httypD6iptypD6jttypE6kptypE6lttypF6mptypF6nttypG6optypG6pttypH6qptypH6rttypI6sptypI6tttypJ6uptypJ6vttypK6wptypK6xttypL6yptypL6zttypM6{ptypM6|ttypN6}ptypN6~ttypO6ptypO6ttypP6ptypP6ttypQ6ptypQ6ttypR6ptypR6ttypS6ptypS6ttypT6ptypT6ttypU6ptypU6ttypV6ptypV6ttypW6ptypW6ttypX6ptypX6ttypY6ptypY6ttypZ6ptypZ6ttynull66zero66stdin6stdoutstderrrd0a66rrd0a6rd0c66rrd0c6cd0a66rcd0a6cd0c66rcd0c6cd1a66rcd1a6cd1c66rcd1c6wd0a66rwd0a6wd0b66rwd0b6wd0c66rwd0c6wd0d66rwd0d6wd0e66rwd0e6wd0f66rwd0f6wd0g66rwd0g6wd0h66rwd0h6wd0i66rwd0i6wd0j66rwd0j6wd0k66rwd0k6wd0l66rwd0l6wd0m66rwd0m6wd0n66rwd0n6wd0o66rwd0o6wd0p66rwd0p6wd1a66rwd1a6wd1b66rwd1b6wd1c66rwd1c6wd1d66rwd1d6wd1e66rwd1e6wd1f66rwd1f6wd1g66rwd1g6wd1h66rwd1h6wd1i66rwd1i6wd1j66rwd1j6wd1k66rwd1k6wd1l66rwd1l6wd1m66rwd1m6wd1n66rwd1n6wd1o66rwd1o6wd1p66rwd1p6wd2a66rwd2a6wd2b66rwd2b6wd2c66rwd2c6wd2d66rwd2d6wd2e66rwd2e6wd2f66rwd2f6wd2g66rwd2g6wd2h66rwd2h6wd2i66rwd2i6wd2j66rwd2j6wd2k66rwd2k6wd2l66rwd2l6wd2m66rwd2m6wd2n66rwd2n6wd2o66rwd2o6wd2p66rwd2p6wd3a66 rwd3a6 wd3b66 rwd3b6 wd3c66 rwd3c6wd3d66rwd3d6wd3e66rwd3e6wd3f66rwd3f6wd3g66rwd3g6wd3h66rwd3h6wd3i66rwd3i6wd3j66rwd3j6wd3k66rwd3k6wd3l66rwd3l6 wd3m66!rwd3m6"wd3n66#rwd3n6$wd3o66%rwd3o6&wd3p66'rwd3p6(wd4a66)rwd4a6*wd4b66+rwd4b6,wd4c66-rwd4c6.wd4d66/rwd4d60wd4e661rwd4e62wd4f663rwd4f64wd4g665rwd4g66wd4h667rwd4h68wd4i669rwd4i6:wd4j66;rwd4j6<wd4k66=rwd4k6>wd4l66?rwd4l6@wd4m66Arwd4m6Bwd4n66Crwd4n6Dwd4o66Erwd4o6Fwd4p66Grwd4p6Hsd0a66Irsd0a6Jsd0b66Krsd0b6Lsd0c66Mrsd0c6Nsd0d66Orsd0d6Psd0e66Qrsd0e6Rsd0f66Srsd0f6Tsd0g66Ursd0g6Vsd0h66Wrsd0h6Xsd0i66Yrsd0i6Zsd0j66[rsd0j6\sd0k66]rsd0k6^sd0l66_rsd0l6`sd0m66arsd0m6bsd0n66crsd0n6dsd0o66ersd0o6fsd0p66grsd0p6hsd1a66irsd1a6jsd1b66krsd1b6lsd1c66mrsd1c6nsd1d66orsd1d6psd1e66qrsd1e6rsd1f66srsd1f6tsd1g66ursd1g6vsd1h66wrsd1h6xsd1i66yrsd1i6zsd1j66{rsd1j6|sd1k66}rsd1k6~sd1l66rsd1l6sd1m66rsd1m6sd1n66rsd1n6sd1o66rsd1o6sd1p66rsd1p6sd2a66rsd2a6sd2b66rsd2b6sd2c66rsd2c6sd2d66rsd2d6sd2e66rsd2e6sd2f66rsd2f6sd2g66rsd2g6sd2h66rsd2h6sd2i66rsd2i6sd2j66rsd2j6sd2k66rsd2k6sd2l66rsd2l6sd2m66rsd2m6sd2n66rsd2n6sd2o66rsd2o6sd2p66rsd2p6sd3a66rsd3a6sd3b66rsd3b6sd3c66rsd3c6sd3d66rsd3d6sd3e66rsd3e6sd3f66rsd3f6sd3g66rsd3g6sd3h66rsd3h6sd3i66rsd3i6sd3j66rsd3j6sd3k66rsd3k6sd3l66rsd3l6sd3m66rsd3m6sd3n66rsd3n6sd3o66rsd3o6sd3p66rsd3p6sd4a66rsd4a6sd4b66rsd4b6sd4c66rsd4c6sd4d66rsd4d6sd4e66rsd4e6sd4f66rsd4f6sd4g66rsd4g6sd4h66rsd4h6sd4i66rsd4i6sd4j66rsd4j6sd4k66rsd4k6sd4l66rsd4l6sd4m66rsd4m6sd4n66rsd4n6sd4o66rsd4o6sd4p66rsd4p6 memkmem66ksyms6drum66reload st0rst066nst066nrst06est066erst06enst06enrst0 st1rst166nst166nrst16est166erst16enst16enrst1bpf066consoleklog66pxf8666 dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: . ..chown)dhclient disklabeldmesg)fdisk)fsck) fsck_ext2fsfsck_ffsifconfiginit)mknod)mount) mount_cd9660 mount_ext2fs mount_ffs mount_msdos mount_nfsnewfs) newfs_msdosping)ping6)reboothalt)route)rtsol)$umount dhclient-script export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs # emacs-style command line editing rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet alias $alias_ip_address netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } if [ -n "$new_network_number" ]; then echo "New Network Number: $new_network_number" fi if [ -n "$new_broadcast_address" ]; then echo "New Broadcast Address: $new_broadcast_address" fi case $reason in MEDIUM) ifconfig $interface $medium ifconfig $interface inet -alias 0.0.0.0 $medium >/dev/null 2>&1 sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface inet 0.0.0.0 netmask 0.0.0.0 broadcast 255.255.255.255 up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || \ [ "$reason" = REBOOT ] || \ [ -z "$old_ip_address" ] || \ [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet -alias $new_ip_address $medium delete_old_routes exit 1 ;; esac exit 0 MDFSTYPE=msdos MDXAPERTURE=2 ARCH=zaurus md_set_term() { } md_installboot() { } md_checkfordisklabel() { local rval=0 disklabel -r $1 >/dev/null 2>/tmp/checkfordisklabel if grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 fi >/dev/null 2>&1 rm -f /tmp/checkfordisklabel return $rval } md_prep_fdisk() { local _disk=$1 ask_yn "Do you want to use *all* of $_disk for OpenBSD?" if [[ $resp == y ]]; then echo -n "Putting all of $_disk into an active OpenBSD MBR partition (type 'A6')..." fdisk -e ${_disk} << __EOT > /dev/null reinit update write quit __EOT echo "done." return fi cat << __EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. The 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} cat << __EOT Here is the partition information you chose: $(fdisk ${_disk}) __EOT } md_prep_disklabel() { local _disk=$1 md_prep_fdisk $_disk cat << __EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT md_checkfordisklabel $_disk case $? in 2) echo "WARNING: Label on disk $_disk is corrupted. You will be repairing it.\n" ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -f /tmp/fstab.$_disk -E $_disk } md_congrats() { } #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV > /dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(< /tmp/myname) ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat << __EOT The fstab is configured as follows: $(< /tmp/fstab) For the ${MODE}, filesystems in the fstab will be automatically mounted if the 'noauto' option is absent, and /sbin/mount_ is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up #!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while : ; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat << __EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp ( cd /tmp; rm -f host* my* resolv.* dhclient.* ) cat > /tmp/hosts << __EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done < /etc/fstab questions echo -n "Saving configuration files..." ( cd /var/db [ -f dhclient.leases ] && mv dhclient.leases /mnt/var/db/. ) ( cd /tmp hostname > myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done < hosts > hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2> /dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x ELFa(t44 (00000xxWxW$$t 444OpenBSD -LTP@0! MP@ -0LM 0PS`@p0 xѩ/ P000`P`0 R ^ *0 0 Q P:00B 0B  0S SX 00-SL@  @1S@DQ@Dt @Dt0W -LM$@0S0SW -< L04S0 00 h7@0t 0S000 -LM`pQ 0S5/Np@PPPQ P Q088 8^Q  0 p-PLM@@P` ph 0-@L 7PP \P%3 0OSP8  (0"0SPP0W -"Ē<LM`00 娂R 堢2 pHP=〢xxS PU 8K`0   ^ 8 @0Ÿ8@ u Rx  0p0000S0  10S0 0 B W1!0S:  1 R0 1!00  qd P8 0b0CS+< $<`P$K4 V U"60 1 0xS S *S 0 1`P0E" $ VUp`P%%K5`P*%F:`P!%O1r 0 M` w 0-x0L\lP dP 0aAq 0A q 4@0 S *0 H0 R0  -LM|0PS l @Q 0 S Q 0 SQ0000CA 0 b 0@CR5 q衟0R !\b QU*P U 0Q0M*P U0 U0a00C00Q*0 S 0 0 a:M 0 0R0 * 1R0 00 R 0 S 0000 S 0 S 00CS0  0 S Rt00 B0  U  0R*bJ\ *P U QP*P U@HL p-LMxPt` \pp00l0IL00 @@S  0  cL0 00LH@ -l1LMP\ T @0@DtPC 0@D t E$ 0PRp: a00CP:0S S1 P"* 0 0 0P* 0p0bS0P* @R000bI ]0e@ I0 0 0 @P:0 S H@ 0-PL0S0L 00@CT:0S S TtP5* 0 0 PP@a@ II0 0 0 @DT:0 S | -LM#d\T;P0 r D@00Cs0 -00Cs0h<84 -XsLMPH30443 R0 CP#00 R 20Sx0@$P 2  00ra P 0 Z ; SL x20S !0' < \R\BX R0000ӑ0Q@$i\RB  R0000ӑ0Q,A  A Q0000ӑ0QxQQ0000ӑ0Q0`@%,"/ k$a0P 0P 0ࢡP~K묀0  0N:P_0 0 C: P  Q aK 6:P 4\&/84Hlx@ w 0-LM@KH8P0: S  0=p 0qXv0S000,L KPP0000 Km8@ w -rLQ 1 Rs*Q0a Qaa  J ӜPA[ @0 Z qz0+ 0 P0    00 0A001 40 00 0 0p00 0< 7z P 0000 \000 00<0 0 0   J<L wD -0LM Q' 0Q" 0Q 00@ @ R  R *pQ b  b'J000S h 8D4 -lLMP p KP`?40@_ V0, 0V0 0 0 0S 0pf  -00CJ0 iR @!*R0 00bF0Y000 00 0 < %u0S` 0 IL, w -p"LuM0d yK,0 Z1!0a S `!  B! 1 =9 =1 ". 9'P@"0 'r/ p`PPno 0 HP PoOK!dPP+A , R wK t1 RpVOKd0\!A o,wK P $1$P@K!0dA[,v/K0吀K, 10ϠAlC &0 ' p`0d P늁8, 0v/K  ,40 ,0S H,Y.A?l@dlMbd -LMet@Mbt@ -LFC -LM01 0`p0  P 0 pWp@0P`0 0S0C00   Ztx XH0 `@%,"0:pq ,84 w -L Mq0^ O `0P@SD 堚P @0 PS 0S'00 K3K40,0 up  0 @ PS I0 P 0@ PS 0S H 0S 0S2[ 8c8X0 K00 , =P0 `@%,"0J:pqm w p-GML M2 `@P d "]Xp?@E 0P8 ````F-K0 B BJ0 @bTQ7ANK@D@DPxP 4 04 04 =K0C 0CT $ d 0Ps0-S D+ 8G0$(G㊠C  <H -L06 5wT -LM`PP( @(K,pK 0  (0@SG -L M0@p00 0Sf >vPP 0S nSW =]P0`0@Q NP QIQG  0V0P . 0' Y0  0000V 0`0 ,K+, ?R0S@p @pr0"Sl 0+Y000 LPH00D 0oSP * -||LxM@P`pd#WpA P0@$S3ت̪`p2`2`p22qx2 Rl2L2\"0QQ@c (2 R}`KrPpF0S'pW PU `@|)UP@Tjo U P1 R  \WF  jE0pS `K@\P40: S S' {3P0 R 0  DWP pjO0S  D ~FzFuPPLgF}<*x|L6C 0P wp -LMp Kq@T` P P@ Tj_ 00T 0-x0L0PS0@Q  8P 0S(0 R00 R0L6t P-L` 0S)nS 0@ ,P@l0PP@p` ,Pp@0oS` EtL6 -蠟L0S 0 R0 R bq X @ Pp`0DS 0 PUjOvP D0\j/T0 6jojz2|L6 p-L M `K P@]0s  !tptp -LM, pPo5G"%$,0O"#!,0 0o -LMP, 0 s2  B 0R00 0`p @T TC C4 Tv TtC CTe TcC0C,4  0s Q @ZP@E 0 o#Z/ T" psl1 R/ @pTg' "Z`PT0 P# 5"P@0  PsTos ! !`P@0psx !P@XXC0 RC MC 4 { 5Y@A  -0LMPpP`)0 R @;$0 D' 0 @*s0 R zpW@ $0@Tj_\s K$K @@@ '$00 x HTd| -1L4M`, P!10 00 @,0P 1PrTBp< AH0`JZ/ 0@K 0&@`T9 T7 B BT) T' BBT T BB 0@K,0<T00 rZj B0 B B 0P@0 E" *!0PKY@xH -`L@z2PP pJ0S p<"Pps w -LM`@P0pa5 YP@ n0S T n0 $$Ln -0L ;0, -qLMʠ`0 P6 \P0d .40( 8%P<(@dl W @ed, 0C0  $H0QZ T? Z ?D  xTvh -HL M, 0 [PnP #1RL0S @D@030(APp g@AB`@Av#,Pc P 00 0b0  0 0$ D0QZ T?,Z ?D xSvl -AML ML6 DDf@Pp, 0&Rpq ?0@8Sz<Ph5 WPp0S HP4 R=:P42Ptp4 8$ 0@bT<4 Q T Z\ +P`+  P  PP 0SP(0  P7P<4 08$ <4 P<$0R08$R0S 01P 8叚DDPP B.K B B(xP@ %4P4npl0S ABK@@}mP 8$RP@0DP@Tj_0T,2 R  08 $QP8.P1 RbBKHHcrP\ yP4 +P0 + 0  \P uP`t 04D000$ 04| 04T  00TP` %vP` -P &P |!P GP`x$ l AhC dth7|\(< -PLMP P` @ pK#  80S@@o 00S00$ 0-P@ 0LSP  0S0S0 l7 -LM M'}KpG pG, P@qPq #T@U h`P 0S 㧖PP @KA <0A؉  3) 0QqA9  :o9@X AỖṖ2 ,0S ,k#o9@T!p@R P. ៖᝖KAA oP9C42 R uOKA-PoP , O@oaMK@D0 @D!@mAk0Sp o0S7k0S 㼘 @o8oLuK-P-]KZ .P]K  'P@U0 RwIKA 0nPA`<0StPP@) 0?T?<vDTW\ %8ht( -L4M⠘在T `D0, an 0DSpH  TTX' R  08S08pW $En @TP 0S T 7p DW7' 0-n0WS[PBO0gWpW' 7` nP h7Qp`' 47W0 n  p 7 W$'m @ 6pW'm  p6W&m0S   R |6pWt0&m0S$ $  R <6pW4`0\&m0S( (  R 5pW 0 &m0S, , R 5pW0%m0S0 0 R |5pWt0%m0S4 4 R <5pW4`0l%m0S8 8 R 4pW 00%vm0S $pWH0%jmL fmP bmT ^m4WYm ,0S ,喗0SR p44W($(H"P0 pW 4ppPTKPKp3PTxWC@=0($(P'mXP)0BOSl "l Rp^ X3pWßL0#P m0Stt3P p3W#0lp|)P_0BOSl Xl RUp^ 2pWß0 #Pl0St t 2R P2pWH0"lx0 2pW "lx0 1pW"lx0 1pW\"lx0 1pW4"lx0= pl1lW"T4pPBOl0 $1pW!ll0 0pW!vll0 p0W!|P 0BOS 0 p0Wt@!t0Vl40H@KLKL0 000KJl  pDll7Դfv $,4<DLX`hxHX?D $,4<DLX -LM` KiPUp@ *PP T"P UjO 0 0-x0L0PS0@Q  IP 0S(0 R00 R0h7 P-L` 0S nS 0@ ,P@l0PP@p` ,Pp@0oS` <h7 -PLM`p 0SP@@@ὒPP 0 p<d -LM@p`PC Tp K8kP  0S -SH0=1@ !@!RP 0@0@l -L M$$@$$$ $0@Bp p-LM@LPPP'PP ;Pp4Px/P` `)PL$P @ 0J<pp$D<p(h,T p-GML`1 M Xa T!P0@4 8! Lp ?P -K BoP B I1Q0@cTQ?ANK@D0@D4 lP# $04 04 =K 0Cu$PfPx Pl f0$L-P@ 4;kC |>C l0 D t  < -L0. m)U  -LM`PP( @(K,pK 0  (0@Sґx; -L M0@p00 0Sf jPP 0S nSW =;P0`0@Q ,P QIQG  0V0P . 0' Y0  0000V 0`0 ,K , ?R0S@p @Nf0"Sl 0Y000 LPH00D 0oSP  -L4f -ML M .0~`P,0 -Jp B0@3S 0 X  8T `| (D`= <>LP PͿ<P  ,< = =XLP d x=,LLP < \=,<|-<< << ; ;; ; ;;,; ;;,;;,;;,p;l; \; T;vP; ~@;<; w,; $;e#;,k;o; d:h:+]:a: `b0FSQ :M>KQ0C0C pDp   InK`F`F&P@ $`9Y0S 4: S < 9MKHHș@ ( 9Pv9؉9^@h9 9T D PQ R$ U9 P^ T Q R U(0  ܤ0J   H/Z 80380S5 0S  8 R 8 R8 R  % R\8 h8 R`8 R 5 Se  88 Rk i U Up80l X00R00S7 P 0@ P 10135:3P 7 X7 R 0B$ 70S4 \7 R R0$ 70S4 7 R 7 R\$ 60S4 60S4 6 0 S4 0$ Sa4%S04 RPؔ6Y> A7 Д0AP,  76X@JP w7dV000TU 3 5#:,P( c70]7V00X@6h1h ? O76``U 0#5 %* % U UU 4S X0 4  \ P  @.7ؔ  YRJ^   #7$X T \% P ؔ PY0 <U U%1 ATE Uc cc 7Xe 00S.K05 \pt \ IC6<0S@#/Q 0SKoP\0@  TS050P5 P  P㬄 X#%*X4dPP<5 4< 05 0@RQx <%!q0`J  0 5 SP L S3 p0# U Ugg Ug gg 6X 0H,଄  <Ja ~6` 0%P@V`!X:5 S S V X X42 v \b 2\b`$"#00C4 74R 00UV `PYf4S\004 e$ V04 0S03$ 54 5 X4 (4 $ u<Qp ,0 S ,uC <xh   8 L \ dh x   L    , (D w   L l    Ddfv, ؖh  LTX\dhltxgfff   D<|  $ @ \    NK@-GNK4@@4  P  4$S440 $ 5    ^ % Ue0Vf*0U U00R00SU $0R eVU:PU L U0#03RQ $$呈p ܤ P%0W^  Pd \0#03\030"S3  `Q15P,<"(PK0d1P ^ U * X  PQ ܤ 7p 4P  5$ UP2Q 4( Td0 25P%$P ܤ0 0 P B24P%40P$(3R ^3  X4LS \ R 0\J>Kܤ0C@R0 00aAU0!|rP!d0B!U0PBBBB@B`BBpB0BPBBBB|4(KM.KP B4`( Kp$(0K4(K4(K-K0 B$@5 (K 4D% 0K.KH5 4 B#4 `5 4L% $D PT"$`lK``V! ` pK @X K DP,Ġ KHQ. ,KL R$D @5%(PK(`K@d! \!4 $ X! $0@ P \ 5 )0R`06P$(6R0/ D!b0 $v> 0Xp6BNKx6Q%̠%4%(@D@D0 P5& !0S66TQ$0 N0o00  e T &ܤU0 U 0A AH7(KJ.KP BX7(K`'(0K$"$d% $$PT0!l |! D! `0 @ p lKd`V,Ġ@ `000 q%4$4]$ 0&> 40Q4V>d8U U Uʠ 5 V:%V#5U8'L40S@.ccx3T5l r3P0!01S030S345-*Q$H9U! $UT  h9Q eVPR 9U  T 9R UP9R R/5 fPBNK@D@D*5 P K#p$ e !Pa4: S ܤEnK`F `F @P0   %'`\d4S: 8j\d4S0u T([44 嬄 D D ~gF -LM@(K_P`5  ePpp0W0* R00S 0rS`Fv (P@ LP@Z`F (00T P P (0vj?(0 3(0 T0 -PL`p@PDP @T:T @2 $: -LPgM/, `sjPBp  Q q00  R P\ 8Ÿ q00  RP 0`SpSapCP 0S.S  L00Y00S ,0S 0S 0S $0S5MK  0pI w8pW0SH00Y00S(0 0(0,0S0,00S' 0S $0S ?P $0 ?c02 $00 ,0S ,;0 {$, u (l oX XP@ <4b0edA<A\ DL h -LMpaQ5Q/aQ& a,Q0S hE44 0aa`8|@|PPaha<Q@aLaDa<a4at$(0<DL Q-0L $ Q*  hTh -LM`@p] $KጿP]0S0S 0 J$0 UR#Ux p-LM`PU@ T<BPP UTUpT- 0\ \8 0000ӑS^ 0 ^0x Br0 BS 0r0 -ALM3 0 08 0 0 0 0t 0d 0T 0D 04 0$ 0 0 0 0 0 0 0 0 0 0 0t0l q @`p,Ld| -LM00`Kq@ 00 pPPS 00@TH 0uS> <S2  0BS^Q 0( 0 0 0 ?R(0  -R   4K >P@ 40 R0 0(@|1 v1DP0 0( d:P 0L`1< 0pPP8@H P-L l 0-LMt@ 0Pd_Q n]@y  80h_0(0 _ 0S -LM0:(0 P0( 0S(0 0 (K  _PP) 0S& =P`u 00,pK D0cSb iSI lS> oS& A0S 0S 0S(0SP0AS, [0 0S0 CP,00 0oSP C,0(0xP,0 0 0oP,00 0iSeP0 TC,0$0XXP,00 00.(0pJ? -LM `P0p-S000P(K 0(P P@  0S 0 Q (<0w70r @|=H D0h0S $ "-,0 0$  -LM@00$0 C 0+ 0 -00 $0 0 0+ -0 D0- -L M0KS0@0,0  K 0 z0 0`t -LM@ߴ\0 00S 0 $: 00 $ 00 $: 0S00  <<  00 0 -LM@孴[0 0 -LM0@S  hj0 0 << 0 -LM@匴00$08  0 0(0-K 00 $ 0g@+$^ -L h] -LM K00"P/t - LP /nt  - LP.ot  -A0 LR`P pPJ RDA R pP3 RA R pP R@ R pP 0S 0   0 p  0$  $ 0 p $ 0   0 p  0  0 p |  -LMl \, P`p 0LSDP dlt( G]Z@T 1 ;]W%X  @zW $8W8zW $8qWh8hW H8_W $(8VW00 NW $7EW@ $7<W  73W  7*/W00SW $ T7W 47W 7 W 6W  6W $ 6@W  6W $l6W@ $L6W ,6W  $ 6W 5W  $5W 5W 5W00 lWP5W $05W $5wW 4n@YW00cW4ZW $4QW@ $l4HW L4?W  ,46W$ 4-W 3$@W 3< S S 3$ W  |3W $\3W  <3W  $3W $2W $ 2W: b0S Q KdeW " @ ^ 0K0 P" XK 0SXL1 ,0S ,叅KXKXXKXa0S @K00!d 0Sn}i S  Selhd`oI - @[4 [( [!,!L!X hxD  H T!t `! <,L\th!      !!p! px!y!!!!!!!! 0-0P@0LS 0@0J-00 0-|PL0@S d0dZ00 0HS@Z4Z$Z0000! wW -0L0CSQ tM00-  Q^00?  Q^00@  ,00 0 8 -LTM\ X3XSp`| , xp p <R|0W |0@J0T #|v;pa@ PX`p0| `Kx| 4Pxt KPJ4K|x P}W p8|0S0t  | l h 0S |`KxPKP& |0 | Ql0Sh0S,0 S ,x PZ xQPl*[PP|0 |(1  0P @;WMW0l0  P|0|0*.t  GZ~pA|@Px :p7 P*Hx!!t@"ht@ؖgt""("0"H"C wT" -0L tH0d" -rLtM@P`!:pF@; -P4,HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH4H@HHHHH@HHHHP`1`1`00P @a 0T Q $T 1@K |P`  *0: SP  0`S˂D T 4# B  wW -GMLM1q\ P@`E `1`!\1Q0T+K AAP4: S 1 R ZP0P NY 0 S ˂T0S~P ANK @D@D0 +PK AA{PP0 R4: S0)   w<#SD# -0L 0c70X# -(LMP` 0 %z9p ?0@8S񟗄""""""!""""""""!"""!"""" """"""""""""4"H"P"l""""""""x""""""""""0S#00, d 0S 3 [ 0S T 0S#00J t#000d#0S < D3<#0C40P 0 R * 0000 t""! n"0S  "0S0Pa0Ua ژ2 R t2t 0 R @prpŸQ @0P@ S00CS## $$$ %U sP n SU fP  0M U [PP 1\   00h*0ESH D@P姱P P  g U( 0 R, KP0ESU , Pe/ Pw Yr 0 RmmL'(@ @\$`$C pD$@hDX$"lDd$"h$\ wmd,@ p-LM@P`M0Se/ U0U $000 0 ph)p  @@ -2LMpP` A(( ( (100 1 RT 0S? 1 R20S 0 S(  \( KPH Q$ K@@"tP (0P sol0@P 0XV SPR0S R0Sx H0 R\ >PH"d$X@@@AWEVhDpD"md,@4A `C -LM0pS`B0S0% . R2!9( 5, 10 -4 )8 |%< l!4S X("PB4S  <0B4Sl4ScP0SZT0SRP@\0 S@PFUں(PU@0S PU@ O&ia  0@0p 0 X 0S S@!18 0 0S S (   0   @ t@ \@0 M0 lECC? D(DCCCCCCCvCD DD?D$D4DP?> -L,MB0 80 0P, 4  ~딠p`0 w0S= / P80BUa ,P 0lP 0S 0ڕX څ!,L, D 00Sv Sj ,$$"4Q 80!R,00CS0, 0  ,0, o,0 8Q e# ,008M#P,,00* C R +, 000 08@F#$ @,x0 08,#P,,00* C R , 000R,̣0R,ƣ ,xM L,T80a ,<<g|D?DDDvDDDDDD -LMZ0, #00 00pӑ Y33`   Rx3x!t0d 0P Y ( <, 00 $8 4 <  m+. P@PtB Z 0 Y  0 Y&. P@P[B Z 0x $hY (XP2LL"8@To0, 8@T$$$P T  0s@ \0 BS@TZ@TP@\ xvPU@ #T0 Dh 4c0( IX0 00CS00  ä0P ṢL 000 *X00 #X0xlDE E?E E,E8EHE\EpEEEEEEEEFX8FLF\FpFFFFFFSFFG -LM@0p8(0 pP P@| 0 0!02|PD @P@\ o_Ke/"+P P`D e/8\ PP3 DA @QX`D00CS0X0ӤX0 PpP A00CS00Ӥ0 PpNUnUS(0 S ({  TSpN4ST &RC< R@GG\h$HTHH w -LM0pK040 F1PPPS눁@O@@xP`L 0\!(` P@M 0#SQx040 40S x4PK Pp 4 0BS !WM0S SM0 S4Q$O/<$II@ I4I -LM@QN0S@K0C 0C00 !^P4V4 P 0S44X0PH`L0S440044 PV 0S=0S440 50S  440@40@4 U!$P+VpPh 0Se BNK@D@D 0*04S\  4 44!\0PpPL W00R00SB$!B~KpG pG M4P 8V`P !*PPBNK@D@D0 044 S;;S(  04 @40@4 PBNK@D@D0 044 S,  0 @@ PBNK@D@D0 044 S8  0\ @$ @$ LP BNK@D@D0 044 S0nP BNK@D@D0 {044 S4\P BNK@D@D0 i044 S<JP BNK@D@D0 &W044 Sptv87P BNK@D@D0%D044 Spt~$P BNK@D@D0p%1044 SptP BNK@D@D0$%044 Spt=`P BNK@D@D0 044 SPFP a0BS0S8a AR:R `0A8BV< B.K B BD$ PD4` 044 SV P D4`044 S<$V<4 `- DPT` *0S yP #@T:q30  00S044 i04S44S 044 0< 0<$ @T6 TV* tP `D4<$P V ePD4` u<$4  <4V TL"D4f<$PuqV ?PD4` O<4P~ V 0D4 B<$4 <4P m D454 <$0aC1 0 ?@@ ]8@$ @$ k,0 @qS t, x d"@40@4 /8@40@4 )$ BNK@D@D0 044 STI440CSpבxʑ@ @ (@IDI ?\I8??`I$IIIIIIIv9LL IDJJ(J4JDJ`HJTJdJpJJ?H@JJJK K@K\K -LM(0S`d ,0S 00SH 40S Q| 80S0 ,0<08S804 <Ph (PaPY ( PR8SIPU@0a Sp>P7<P-00S$0S0S8PU@U2 \aP 0 bPUZUP< H C8?;x7l3`/T+w(<|KKKKK0LXLLLLM4MHMhM|M -L3Mp0moKPe/OK 0 )e/% KK?KH2 01 2e/$1 (  0S vM -d1L(M\@@K @ Dq04Q@K`@@ 0r < 0m C 0h 2 0c H 0^ 2 0Y 0. T  d ` \c X T5 0p; B 0`6 XX FvMvMMNHN|NNN,OdOOOPPP`PPPQ82P *0P ": -MLM N~KpG ) e/9 , {Q   P PXP 4) KA  BA .K B B)   EP@j(K0PS44S I(K0S0( K0@4@44 @@ @\4p*S:\4 X4(KS:X4 0mKS(K008 He/뎎KH:   *P 00CS00  ä0e)(K00q\P@ VP 0@pSA8S\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\U\\\\U\\\\\\\\ V\\\\\\\\\\V\\\\\\\\ WWXHXX\XU\\\\YtY\YY@[X[\[\p\Z\\U% _OKe/o e/k   P LlKe/[ E `0 @8 PP 0S WK@ wp kHP@ 6 0 H8r :gKƟ6 R@@R@J OKe/ e/ Z  } z 0) e/P Z  P e e/ OKe/ e/  e/hPOKe/ e/  jOKe/ e/ Z  . + 0) nOKe/ e/ VOKe/ e/ (8P"OKe/ e/ Z    0) {Z      .v7 3]UH0| @P3 RLZ )9 e/P< tCtt#tPP  R0000ӑ yS0 R000ӑnSU P#00ӑyP p2 ,0S ,s  P@ e/ F FU P@  0e01J $$FPP0S e/lPZ q POKe/ e/ e/ V Z 4 |81 RPZ  )9j e/;P   kPM Ke/ e/  ,囙*D QLQQPTAQvrdAQQQR?$R0Rp dVp0( KBNKa@D\0 (K@D . 0<S,T8TpTTTTTU p-RLM0@`+ a@ R\0"(\` phȸ ^0S  0 SS S0d0T!\ ph (<<fP0, 0 phTLU|AlUUUU -SLMp 8Ka`N‡PV(VT` P~ 0S0Sy  PK 0 SSZ, [RW R08 0R 0 @T0 4J 0 S?0S< 0S D408   P`1 R 0SS 0J(U ` ͷV P4n01  0S0S" U <1 Q *(1 Q :0S S R000 00000 0 ((PU2UP 0S S R000(U @@1P000 hVTVLULW`WU -LM&KPpT b[P1^PD1@0!P * U:U: Q:Q"P^^@(1 Q:00Q$^T 0`S 0!@l0Q` PS 0S`wm0S@0 -RLM0`pl a@QgJ(T` iR 唀R 0E  0l!00`1 \ p; p0 3 P 0S S" P0bS0c00 Ri7 P i鞶*0 `0T< 0Sh. 80ixT (@@AP0TLUWWW,XK0C0C4 , p@2(K0PS`V2(K \ @   0@R1(K T1(K `\j1 ,0S ,my 0g g0C B#b"Baa  X8 < ,CLL!L(CH 090 03Y jBKJJX@8<$ C;K  ,C厛P 0(K;K, S QQa B RR24  wj4 mL00CS0X0  äX0 f(Y4YXEF\Y -$LkM0Ke/ ,0 H4dB0!PP ÚP@ ὚P' @T`t\BX 0@@B T8@ 4T00CS00  ä0 T`@ UPP  P,#3P P@t x3x tg,@0\#\3P P}@t 3  tQ0@8 # 3P Pg@t 2 t;8@4"2P PQ@t p2pk t%4@<@T44T" L2@ 5p@S pb <PRR0SS T * R 0 dR0b00S@<@P!1P P @t T1T$ tDh!h1P P@t 0 tTD0 ,0S ,k0  e/10 a00> h0h@ H0lDYU>@a嘁@@ T@ p1GT0\0CS0<0  0DD PP 0P* @P" @T@ 0@@ T@ 0 T00CS0 =@00T ػPx0K @1SL$0?I\]K0C0C4 000 !8P@0@@ xC PP 4S JnKⴀ`F10 "\a0@|$qTʄ1SBKAA  0(wA0w -2LMp`@0P0 $ \0 K~ 0 ~ x 0p ^\ :` 0X ^< :# , EDw,Xhw xU -LM`pP@0 0 08!0 01QQ p: p 02 X P 0 0S ܮ֮P V 0 SS Px0`000< 0S40H. 8 0Xx,XxxydXU -2LMpP0 0|0`` `@t P0P ttT @(:  hy,XyU -2LMPQ  0  @ e@t 0& t 0T:` pW; 0  \l< X0  g@ ,*0 0$zd,XXzzzU -2LM`px \p0@PP@ @| <0< | {{,XU -2LMP 0 Rp`0 0` `@t 0 t 0 @ 0xpx!txP` @᧔P @T<< 0 0T @T{h{,XU|A{{{ Q-Lp`( P% P# P! P !@R @PP q@T! 0 /\ ^P᳷P cP cA4 $0F> |(||$\|UDP0S  0 S Z -LpMpK`Pb0sep @T X 0S@ 0@0P1 |rdAedA8CD -LP\p@` 0B0C3SOꬒ44T <0( ,0P<0( ,048  1hW <0( ,0P( 0V ( ,0P<0W<0( ,048 ( (0R, ,0R0 00R4 40R8 80R< <0R@2 44 4:P$ o|||}Ą}U0 P 0Z<0 0Q1 -L8M0U@p 55 u  % 5P<T$4@  $"Pp 4Q 0SDP &PpdCP(D0: S  S  S0 0p{ 00 R000Sg RD?;#003 <0S c#?;0P@ ?LD T@ ;00S  ?+83 0S,3@T c ?t2"@@ 0S H2 AR;;S" ":00S 0S 2Ql2l"d2T"H2D2q60S0||\ Kb1Ps1  @4 00 ~6!0!+@% 00 o60!@g0*60d!@T P!5P00p 0Q  60!?0 0T Pk60 ?0P 0<0  H0,BHEDD@B0BtDxD@EDE0B0>0BDLEE 0-QLP) 0S-x0  P[P@ڸ0 T ;;S0@0T@|0 t=04\ 0T =00  '[P@0 08B0B,BLEtDD4B0T -b0LP@@xr r PP PX"000SQ Uڅ;;SNU8U0011 U00R@@T U 1 Q Pn=4!0|!=l1 h_=\[=,40S 40S 30ES U0P0 0 R0Q/PU30 S 30S 30S 30S00PX=00 0008B,B0B;1 e;1 1p  1` 1 ?+XP}8B,Bm0<h܇ -LMdNK@D0 @Dp (0 Pw P0 0hDDDLB -QLMP`ttp 0 cRU@@ 0Pd0U`0 0`P DDLB Q-L`Pppp 0cPU@@ |0Pd0U0`P0eSDD -pLMX*ڴ崠 0@cTPoV@0U@0 @0pWď0X0W00P@PDDLB -a=L|M0 W Ypp 0 cRH?S P@RP@ MP 0`V0W0VP% 0 *0  KP a=p Q 0 &t 0p :0&P 0P L0P VDDԏP$LB -LM a Q0 0 0pKhPzP0S U㜐 la1 0cPaQ0 P0 K0K>PtIt1 R000 QJ0P 0pZ@T_UTQ 0S%  Uڨ 0S 0@  Q  R 0 R u/Tp0 R 0PT &,  0/ DDE8Pd -a=LM0 a 0 4 {PP,d  P 0S KPrP0S0 aq xL@T 0K ڰQR PPşU=p1 R `1\ 0.P \ 0S  1 R0 SKlP a=p Q 0% 0 .w%x 0p .D K  ; `%0 0.DLBPܐd -pL0S@`@PPʀ0 @ xP0@0X0 <,0/$0@TBDLBEdEDD -\"LM`Qp,` <0S 0SS.@PrB 2 A Q0 `aȁȑȡ!A0PP 7 Pʀ!P 0R00`bP1 (,0/0,0 A1Pe  0 @00Q #P,,0, V ڄ@x0 x0V0`b0X 0H0 (0 0SoPEXEDLBDEDD p-LMhP0 S\` @TT 0S40  p000- `BpB=L p-LMhP0 S\` @T 0S00  p000- dBtB p-LMhP0 S\` @TT p0S40  p000a- hBxB= p-LMhP0 S\` @TT L0S40  p000=- lB|B= -LMdq0`SP P!#3!"c10cAT R$0S9 Q0S/ T 7P T $`P p00T 0$`00  XPp0(&P$C12dAN@d@U000XRP`B/>3XBTv -LM\q0`SN H!3#c1c0cAT R$0S8 Q0S. T P T $`P  00T 0$`00  噵XPl0(&PC3dAd&N@d@000XRPdB\BTv -LpPP 0S ,0SP!%0aV 0S ϡP0S$0 0@0S# V ⢡P00 0$ 0 T %P(@M`PP0000hB=XB -LplPP 0S ,0SP T%0aV 0S sP0S$0 0@0S# V FP00 0$ 0  %%P(@gM`PP04000lB\B -LM@(0aMP@ 0S   -1LM 0 bM@ ^0 - ! ^  ^ a0 :#:900 P \0  ^  ^ ^  ^    0-LbM(MPbMK@D$@D0p 0 d0 KX0P  0 娠@0 0 0S O0\  D, 0A0- SPL@ 0]0S8  R0S+ 0+8` -a- `L0Q!0p@[ P20P d 0p QL *4 $* PP Ē0 KS- L0P 0 -PL@LPgb=0  |1  d1  Lq0 41  1$  1*  00   0A0a-   am` ;t P0@09P0: S `0  ,h 0S HP (,$0H8 W! -LTMr0 $0 @!P2b- 0LS`P2`  0L`pPKS񟗞<<<a=0A 0 PP2 HD 0L P,2 0D P 2  )$0 S $N1  0. P1 0& P1 0 P1 0 Pp1$ 0 P$1* 0 Pa=0 0 P; 0 PLPP00S S S S  Pd0 )@0l A 0 Pv A0qL (,$T|0 mS- L(0P 0頓0 mS- L0P 0験0 8E -2LM pR@ nPb0   : 2  3 l"0 , T2  % <2.   $262a- u am` & 1>   P F $04 4!N0 P V $04 4`!f0 L1^  P@:0@0P3n000cBP) 0: S `@0 0S@P0 ` `,o 0S P `@0 0S@ Pn#RE (,H8$0 |0 E -H$L|M0 ,0  P $00CS 4   4圐K R 0  P3=6K 0 P7#00CS08lll00a=0p`P@00S@b-P ``06  P03 ($3 0i P3 0a P 2 (2 ,0S ,L2 0J P2 0B Pa=. 0: P`2& 02 PDR>0 0) PF 88# 0 PQN0 0 PV 88# 0 P^ 0 Pp nP/P*Pn000cP@P00S S S S  P<00cPy0 'sq0b= 0P@60 0 PL [b=0P@06\  0 P 0Eq ؓ(,$@qQ-H0 4S Q 0 S  qE -LMPpPb@03 R 0#400"400"40 0"40  0"40  0"400"40 a͠$ 0 `48 0`  !H8 0Da=$"$2T:0D0P300cPP*!0: S `@0 0S@P1 ` `,o!00 P `@0 0S@ %P0 400 400 40 0 40  0 40  0 400 40 a͠$ 0 `48 0`  !H8 0yE (,$08H P& -%L0M0 (0 H P4H@ AR4  0ASxlxxHPa`%<%8.K-0K.[- [%<$,0KP0K+K(,0[+[pPPČ%H8 0P`KPH0`P@P`b- 0^ H3 %S(0 S (J0LS#H@4B0KAKB [A0[4Pq 80D KC0K 83H@@ 4#H0 4@0K?K@ [?0[4P#H@ 4>0K=K> [=0[4P" 4<0K;K< [;0[4P" 4:0K9K: [90[4P" 480K7K8 [70[4P8"@460K5K6 [50[4Pa=@,@8@4 K30K2K1K4[3 [2[10[ $4(PpPE400K/PK0 [/0[4UDKP2P-000cP@P#D1H`0S S S S\H  ePH<00cPLH0 B%EC0HP H 0 @@,@8. K-0K,K+K, [.[-[+0[ 4H0P@b- P0@/HP b=0+ K. K- K, K#0h (,$Ȕ -0` LK$KP IP0]P| <Pd 0QpL0L xP0, $ lE(, Q0-L@P%P/0 R#0U0 R0S 0;0 R0 R0 R 0a  00h0P0 L0L P90( $EtE DD8(,( p-LKtM @`KPIP   \L0  Fp]$p 0 00$P- 0P ) -LpM`@KPP X0PpWH0P 0R ,0 ^$PE -LtMpPK@P1 R* 0R5 0: S, k PP  0Q` P X 0x @ $X0L $FP 0R #ElEЕ -MLP4M H4p , t * $00C S T p  x      3P3 RIKII 4S+P) 8#0@P \ `3 RT3T P00##3 ,0S ,G3P 2 Ro 2 uBQ R0P0 R0Sx"0;0 RQQ B0S|2 R p2a  02L妘P mP0SBB0S1 R  IKAAP!x0S$\1  4t!#d1_1 . BnKP`F`FU!B4: S>p@ Ppx 0"00 ,  D%x "B bX ExElE(,(@EtEDD8|Lh0Ȗ p-LtM`KPaP 0@T0: S Pp&L 0"pPVp pE -LtM0@/SP @//㫗`@pKT/ ` 0S0S ĵx0\x0S0S! = E -@LpMS` Pp0S 0 R KP0Sl00d0 Rd00H6P00 " 0 "BDD$P -LM@C0Sl`0JP y0S u04 !$0 RPtEppE -LM@0Sl`0!P P0S L04 !$0 RPtEppE -LM!@=P- 0h!ꔗ -LMRp, `1 0S00000SPP0e0 peR  V@*0S@T*0S T00- x@ x@@T P`W,0c 0 [!pWBP  0p\!x/0wQ` 0 EE̗ܗ p-RLM`0 PpX@0T<  P 0ph! B  0-0@SLP 4 0R0a 0hE8 -ML4M!0QP,0 pG`1 KK`(@D@D V k#  >P p R0 RPa- 0S0S 0  0 ,0S ,EK(A4A P a=(K0Q p0| 0QX0P4 0@   0$ `8PX|P -0 0R00000L R0000 R0@00x0 RlAh0P PP0 REP$ EEEEB EE p-PLM@` 0S pAPP W@P0/S00H 0 S8 @`0 0 PPPPp ȘBBd0 R00T0T QH0  \80 R,0 P0BEEEBB 0-0P LRl0@T 0S @T00SU0 ((PEB  -QLP=aq R1 0S  0S0! @0S00 0 gP 0P 0P 0` P P 00BBEB EE<x -#L M0PSr6P 30C S8$<Xpp2 R 0, K@00KP0,0 00 L 04"+0 "% 0"bMb=0@䡟`l `0 @p 1堁 * RU 3 R 00  +P0 `ç 0`!)0 L1 l 04!  Ra- 00 R0 0 R  R00 R0 00S  0a @0@00PI00P@EBBEPp  8 -P1LMP`U; pP@5*(P00CS00Ӥ0(p  T:0P0D@00CS00Ӥ0 P p 1T p&PH pP  uP@P0  P ETؙ -2LtMxŸ@0pŸT S, Pp$T ^0 CR 00O2 ,0S ,lB0R Y h@K%1 R@(08&B`P0 \*L -$$q0LS`P P: 0-S00 00 0S&0@T0  <:TP 0 0:S l R1 0 LP0+?0C0 hKEC E p-LM0@P/|P00l00SP`ph8<0Sph00phEx|t -LTMptp % p 00@JS񟗈+,,,,,,,,,,,,,,,,,+,T,`,,,,,,,,,,,,,,,--,,4-@-L-,,,,,,+X---,-,,-,--,--.,..///(/0/,/p(4qDTA0S`0@0w, 0S 3wCvPv  4 uk4Po\j43 Pvd43u,3u$33t 2-Pt29 Ps2s2r2rBp2P: 2p2pH2p 2|2 pt2@p}l2pzd2|w2|qP1@ 0S `Pa0CS"p................1` 0S{1P1P1P1P1 `&t1p1{1PzqT1z-L1y*D1y'xP0a,AH0pK @p 4<1P@x 2 0~P@ P⋅UH@ 0o5 0'EC PE8E |PEE8EEExE`EtEE@EEEEEDEtEDEEpEB,CWO<DEn9D8DDPBE؛ 0 DBXL0@0t0 X X0 t0SI0S| |0 0S@1@1111 0S@0P0 0S0w 0S @0P 0$!0S0<1 _P1 RH!d1 pQM Q ! R 1R B Q @A1A0t0 001A0t0 01A0t0 02B0t0 0 - 0PDDLM@, 0 4 8 0(Bp 00@JS񟗾44<6<644<644<6<6<6<6<6<6<6<6<634<6<6<6<645<6<6h5<6<6p5|5<6<6<6<6<6<6<65<65<6<6<6<6<6<6<6l45<655<6h5<6<6<6<65<66 6 6T6(6D6T6`6t6|6<66vfP040 A606666|6T6t&h640Y8  6 86   w4 8:P8  <6 0 f5b5%5 \0X5 | 0-S 0 , 0S,  5000 Bx5x%=l55P644 0$0,0%000( 55 %, 5R Q@b $4 00CSTY  0S6688YpP. Yi 80I`0< 80 VL h῍P\D;P< mPp$ᮍP(4 RYPW Ø3 , RPC0S 0S ]P 0S,30 ^tlP@\ LrP R2P 2Pp_P `P x2`0P<0 20H CQ0"Q0v <2PlYPN YY 8 I`0 @0 8 V; @Q P1+P B CP PP1 RY0  5ElP@x ~`P P0 O\PPUP `P`P@  FP.P \0S @EDC `Et(4@LXd$?$?$?$?$?$?$?$?$?$?>>>$?>?$?D??$?$??$?$??$?$?$?8=$?$?$?$?$?$? @$?$?$?$?$?$?t>8=,@4@$?@@$?$?H@$?8=P@X@$?`@t@$?|@8=@@@$?$?$?@3x3x#000d3+ X3gH3@c@kP@ P 3 R J Db尒ŸH0pK  p /2P@l . 2z` @ pp`⇁VH@ L2PkH2b 0-S 0!0S "22!0291100!101|1!0&H!1r!!0QS@@,A,AA R PP R860S,1 $\P 0 R   R 0 PP  EtEE@EDEDlEEBD`EC \E,C4WOEؿDECEECEDpE<PBTPE؛ p-0LM` |@P̀Vd0 P0R4BDL S00CS00  0p ph!`ElBĊ P00B -L0L R02 R  菀B P-L 0SP1 0PS$ p,fPp`=`P@ 6P  ppP0VPPS0  U  0S( 6 ̝BBp p-LM KP  qd R0\4P0 0b0CS#EEEEEEEEETFElFEEEEEEEEEF`P$K4 V U  0xS S *S p`P0E" $ VUp`P%%K5`P*%F:`P!%O1Q0r 0-LMKPhP @"#  0 S R 5PP   B0 0 C 0 0 E p-ALM- 0a~Q 0x 0s 0n 0i) 0xd 0h_, 0XZ$ 0HU 0P 0$K, 0F# 0A' 0<P 06 01( 0, 0'% 0" 0) 0|( 00`! 7Dd8HxğD8\ -4@LM= 0 08 7 -p@LM@ 0\4 0LE 0<B 0,0$= 7(l0 -MLML0P`(0  0S ,[(0 S (7 @Rpx 0\S@ S  R ?R 4PP`  4PI000S  \R 0R 0S _4P 00@0@0S PS" GS0000S 00P 00PPP840 0gS pS00BNK@D@D ; D 04z(v pDDܢ -@TpL 0S S4`PUP P @@0`S 0 p`PPP P<TDD 0-\0P@LT 0 @T0U$ }PD -LM0PS x@T l1P0000 <1`V0S`" 1 R @T 0T @T 0TT 004 0 8Pp  R/00` @0/S`0 0@4 R/00pDEẸ p-!0LM0PP@ 0 R 0 R pp0 " 0/S @T|0 RpxPT @`H0@PpUP00DEE p-0LM`0@P?P6 *P *P 0S p*P P Q  P Qp*P Q P0 R /QPpQ @PQE@-0 !S@@T0]P P 0-S P]P ^ \ ]\ P Q0 -r`0LSP 0/S^ 0S 0/S6 1 R1 RlP`10SS S h!?X 0P`810SS S +0  P` 00CS0 R.000S00K @O L<0C<0S.000S0P0@5 300C0D DE  -ML MPP1 pD$ nK`F^,($ 0S,'0Su0 S0 K0S% .S @c PP U$0 S x$ 5d0 K@TTEHAE(\  ,8` p-LM@P` 0P D0 L\ 0 pPࠣ -P`L/Q@@e Tp Q@:0Q Q0@*0CQ:0QQ0@*00 0p -LcMZK MpKK K(@DKK( @DN*K", 8WKWLK KPH0`K: bK(J,J 0*P'02(K  UT1*00UT1:T3 0 PPi1!(K(K0@cTP 0S 0Y pWp,0 S l,/4T *0S 0TP*0S0T0* K\ 0 1(K R K(z0(K RK*K:K(ׄZKX:KZK(8z0S  KP KZK(8TWKQ :K(0MD T\ -LMpXP, @ *0S &S  \S 0T*0Sh /R9R,00`BVP"0S 0S0 `bV0dV @\S R0P -LMpF1PU|4PP 0S`Q>P@ 0 S/R< t04aP2 T,/00 1  bPfP 0S|]l]]]]0=0 RQ0 qh@T0 0S/S F@ ,۽WEEEDEDE 8`X0X P -88Ls(0 R2pEEE p-L,M(@KZP UP PP KPt <哕8828Ÿ@@4`K@PK$Ÿ0 0 ,0 4 VPV PPF JP6 DP& >P0  40 6P 0PpX!6p@0S P@0S P@0S P@0S P@P P 0K  ? 0K  8w 0K  1k 0K  *_ĦPE|EH^̦ -x0LM @R`0 R P0 RP PaPDDD p-PLM@3 R0 (a0S= 0#S4 \S. GPP$ 0"C12d1@cP 0S P.P P0! 0pxT  `N 0#S@ eP,BP  D/>3=0X0X P#3!"c1 0c!R 0S R(/>3D p-PLM@3 R0 (a0S= 0#S4 \S. PP$ 0"C12d1@cP 0S P.P P0! 0px  ` 0#S@ PeP,P  D/>3d=X0X P#3!"c1 0c!R 0S R,/>3D -PpL`@ 0Sd /PPp0 S 00C S0u 0S.P@j U 0SE00/0S1W 0S !0 0P!10@ @@P000 RH 0G ., @ .; P 00000 0S MS CS000 0S 0 cS mS00dv,QW0p0@ .QT@}  ( DD <x@-0\ @a 0S)  S   0R  0R \\  0 S0S 0 S0S  0R DH -LMP0pS@ q 20  00S| 0SmT`q @P_0 1 !.B=R pGV0G SRlkkHkkkkjkkkj 0!0!>C111v>C 0C0 !0!>CP00 1 !.BR00 R0S P&0B00 1 !.BR00R0S P0 1 !.BR P 0 1 !.B;R qp010!.CDR Pk?C@.PT @} 0-LPL@DT  0 0S0  D  -LM✁`Pa 1 R 1 Rl1l!11a11acAT pP0 S @T0 0RT 00$,0h!,0D$qv -dpL0S ` AT@0`V01P@P,,UD p-LMP@T0 p0Sx`t 0 h0hiX0Pt000 + 0 DGETED -ML0M (R04 ,0  2 ,0S ,j.4! +!8 0AT ~KpGR0pG8 @T^+P@, Q0 0Q  zP _D! Tz+4a=  8,1008 AE  0`PS 0S0&0S  7pPT 4a=0 S0ń8  $ DGD$< 0-LPL@DT  0K0S0 A DT -8L@T`0 !0pAT ~PP! @T *P@ ~P ~P 0! 0A**h T  y~P * ~P Dܪ -t@L0`SpPP -0AT O~P @T ,~D 0-LPL@DT  00S0  D= -0LP -p`LP% 0Ƃ"S12e1PcAT 0S @T 0ST Q *P@ 0`0 10 AjD/>3( -1L M@\, `p? ̡1 0, @R@\`0 PPI P 0S: Pda00S0@P! 00S00S )P 00 0 0    0, PhPP 0p p00  ` WPP 0X0@ )P 00  DDH 0-LPL@DT  00S0  D= p-LML`0S P0AT  0@TPOUpD -LM䀟pPP, / 0"c12f1`cAT 0S @T$)P@ /}P pP ,000! 0AF)(oo0ST D/>3 0-LPP 0A"#12b1 cAT 0S @T00 ST 00 00) )0D/>3 0-TPL@ T0 04 @00(0S000D E( -LMP0@SȠp  0S P@|0BS` x0 (00 徐 L 000o(`V$ 0`00D EDX -`L0S$ PPUJp0"S@0S 9 0RH Q (PUZ(000DDtEDD p-@Q0@LM@C!1`@P  KP*0P0:0 R@U K0P0,*0P0:0@p  -P 0S\ \P00S0 BSL`h~00L\:0000L \*P\:000L\*00L  L 0 00L 0@- 0P@CR,400L\ :1!P@00L \*0\:000L\*00L  L 0 00L P-  *0 R: R$0 R:  Q0-LP0 S\  l0S @T0   0ܚ8E -LM}P@ <{Pp7{P \ 00CSP0 @ ($ 0锬D4EЬ -LM@, P, (#, ,3cpp0K0CS d, {R, l0  , p,2  t , g,2|   a,  W,`2a-X2bb0  00 02R(0 ` >0R 2"00<(@ /R m   @<0S@P `1`) (@0/S  00C0L`1 41) 41  5R K0BS` 0@Q KP0  @P00 9p 0 0 :0xx 0, V, 0LP , L, E$ (,H8  EE -|3LCM p3 B, R̈$؈$,3 R 3 ,0S ,)BP0SPcU :"Kd Ky0b S Sx 0CSU Kd 100KyK 0P>KdH2 0P >Kl$20 P  2 D>Kt10 Pa=.K0 PK+K 0PxK7P PBS$  #0 $ 0<2S x(@'(PKdA (KPYoK P0 `A \A XA TA PA LA HA DA @A EP\C000 3>K 1PVPCP_K|#^?K@|A 垚PHx!1RS@$0P0;CS0,084Q0S|  X>\ɔdƔA |!r 10C1 3At0\ |T0 02pP@LT00< KcK0 ! `VKe/K:1  < K eK R p0S:w 7 P 0S o5  1 刡  00Ì bK 0PʱH 04~<&r,6,T&=K@oPhO\&Y?KP0C PaP Y?KP0C PSPwo㎫F]?K >0(K0@00 Q O? K \300 0p1  000W ]?K 7 ]?K &P@ 00 ȸOOK,Zq@+  0-LP:㽓0^  x0\*P0\@ PL0@ Dz@P@4㞓 G,GGGE$E -LMe@`@ -MLMXXb0PpH,0 pp03*0* 201 0 2 1  Q P1@ԡ`0 810 @@j0P0?P P$JKx!(@D@D0h!`P]ᶩ 0P ,0 Q  , n`8#8P#$0$ @JK(@D @DK<:(<2: !<(K0<:(<2:(LL!<  0EG(GEPI X T8U@E(TtDEUUؽ,DLX -T0L8M<0 0  8 @ 4 0K0 , ( $   @K -CML M␁0P0 P00SP,  d1Q  0P1#\Q:,0 S $,kEKJ J0 0`$ ( KX d 8 \ }0`FpںP ` BNK@D@Dt 0dpP  K@ʺ0TdDM -LMaP#P@e  623 Sp(0S RP, ,0((0,0 0 0 0S1&+,0S&& 00,0S0 00 0 R @@x|2P0, @( ,@ 0 a0C0 ,`0 (0jRMHEpTD -0L)M1A1 L0 B0Q 0`!0 `0000L0 S  `0 00 `P(yp@W a 堬0001V' @ 00CSLw00 0S o1P01XQ0P 000,0 QPUM`EUU -@LMT F10C1h@-p0\ ` L00n^@` 4K0C4  01FAPo \ $  0 =00S00Y X |6#1@% "X`P$R<1 ,0S 4,W 0P@v00h0U0@6  0yP`Zx 0i&(0CC1l5h0`00S  ow 0;SHMľԾ4U -MLM0\C\L#, 4 @(  P@X34#A6T< 4 ` #140\F" $p`B6# AV#1%Y X @0 0 у X2R^ Qd _\0 iD'80  \0  [ >T $TTU,X 0-(0@ LRP 0 ,1, 00 0-(0P@LT ,`P  T00T0S 0 T @0T -LM@0T0 T00S0 T@oFQppfhcd0 R T\0K0 N 8T (O8T@ LwHTT` -0LM@ 0h ַ\ 00CS  00 00 r xU -PLMp 81 Q  @0P*0DS9@T:0T j V- * VĀ0 0bPP( 00p$KZ`$ 0 0 h640  H0F  V00 RUTMTT 0- L8M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@4 &$0$  00C00TUT -LM@Pr0 `0"pM b0@SB 4<x1 b 0`ip1 h V\!000`01@ m0U>0(!S 10`00!0`00 0@TQ 㷁P 岁0 R T@D  0;T@Dl垁zX] T0 R UTTC TT^DET8CTC`U p-L@M P`K?0S 0S  0 p -LM`t`ğ QS, @ Dd 0S 0S3 p P0S 3 ,0S , 9 0ṢģL0S P먓0S 0S0\CS Y0S 0S <0S @C 1 D@! T 6`Vh!h1h!X0 d1@L@@0,@ \@ ,0KT@ P@ L@ H@ D@ @@ <@ 8@ 4@ 0@ 6`TP (0@T*0U U@\K (0PT*0U6`V =&ꀠ?>1 L!\  @YP ?>1 A! @TڑRڎM$U0TT -LMpj0W0 W00S`0 0S 1S4  4p0S@600CS:l$0S X V@dP X X X  X P@1(@Q0 T @P@6#QHP@T1X@QtT PY #0001 01S<  XT3  ) X3(&P3 L# p6$ 4$0 R "0S y$0`0 P0S22   {ZP 2p pl P BT~ 0H0 P0Z$ k2 R 1 R ;T\0# PX @@T%@DT M1 R s P @2&6h!0 `<1 RD(K0 I@0 $10S 0SM P 00`(< 㒮P0S0S p3 P\ mttU(UMTTUTH H"M $TT0H`xDTv -LM@PpPpe`VWY!?> DR.000 0. $0`F0V$0@X L0 S00*jP (@ R00  0R 0S R0R0S~ P ~0 R < P` X0 S00Dō<<!$UTD HUT THv -La8M0&0Q 0  p 0KL P H D @ < 8 4 0 , ( $ @0(0PU *0T0 T00SP (0@U:6pW<0P 40H@ PK0S  MTHU -LM`VPڴp崀@PT 0S  0T @T R 0S `FVP 0  0P 00HUD -MLX$MT0,0   BRl| P $PC3EKJ 3 J0ß q3`R( K#d `$ *B>K0CMKH0C4 HP RP`V:0#`V*0CP\ `V::2 ,0S , 0S 0 S s S "u P" j  00C0 |"lb Pd  000 00C0  0RBB60C ሯ1 (K KK$ @$ @0\4  X$  0堑r6 0SF@H0 RT P00O0$`1F.00 P Pq Pd P 0:90|oUMM UMDTܼм$v,Lt d -MLM$p\0,0 (`; R 0S L0 S8(K 4  `0 A?(K  A?(K D KKX0((K0Q 0@^^>KMK >o P$ $\ 0S  R0.S $0'$00Q0Q0 Q00SpG h'dI X (,0 S <,00 00CS񟗳  4 4   $0S&&L0S6 `03  00C SK$  $  $  $  $  $ ,  0S 00C S'|            00&N P%00C00000000      0S $\NK @D@D0, S^K PE0 0%5 R A$\00 PO$0SL0 R$ 4 RO$\ P; ;0: S0   4$009$\R  0.S  00a PbS L0S|3(K4!  `0A?( K A?(K KK W$\0 0 Q0hNK0ᴀ$00$03  0`0C0 k@@Q @T; Q 0S+ 0 SP $00$0P "00C0"_>KMK ȞPH"OD000.S "C HP00L Rm `0j 0Sg '\@P^>KMK @d$00$0@1  0`0C0 崀=@}?P$WP( s50.SR 00Ph L0S# `0 0S 0<0P$0 8MWTUDT\hTtUT4h $$0c -!0L1pCW:@`V QЀ Ȁ0 R 0pGW*0 R PQ 0 R x0 UP(`@H000<0 00C000MMUU8UU 0-L8M`Q QT!00 @D H0 @0 <0 80 40 00 ,0 (0 $0 0 0 K0DS0@T0@@ 00CS.` 0QP 0S P0  00dHK HK_l0SHK4 00  B(UUUM4@ -`LVP)P>1 1ER# @T 0S @T.!0EX00C0`FVP 0  @003T$UTT -LuM؆0,0  p! 1PW1 1 1  6 \ᄦP  (` ,6&'Pv !,6"! 0&& g&c rK_ f?K^4 Z(@1^*P P ?> P  RN+ 0`F<0^:6^  ^<ş 0P<,5% \?>1/1L.QAN 0 40\1嬤 01 0S  1, 0 S  0\` K_K<$1h,6 1R rKw P0S#1h& Ph0SR1#h&ҧP86 P90S 0S % T1 0S 8rK= Pß,0 S ,C1! 0 000S  ReK P !&001&ᄧP hTeK P & !00! &cPu 1{ vi,6KQ01,&K `,6|AQ000P0SH1 SDH0S%1 S!.0\!5 2! 5:? >PN0ׇ? >0N0CS`PdddP101 ,6 0f ,6!_ tX@0 H;MT$UH,PTXdlxU -PULp`:4@$@TPZ _U: 0  F(F0 F0$F --L g p-PLM@P`l0l R DT D0 Rp80 " 0  }l(F F0 --L  --L  -LM@I h괺 --L = p-LtM/P=@TK XP0: S p0`rSD B 0-/L@PU+D0 008S/00(+WI+SI00H -LUMpPKPP@lK80S-0: S  SU gyP U@P P@0 R000K@P h1: S@ c$^$F P-L P $ -QLM@ TP T Ҩ%4 -LRP ĨD -kMLM7 6@, @6K0A䆟 A 6 PP6: S &PK u&P0S| |6 Rq 0 S i\V0Sa L6L&@HfHv@@ @@@@0 00S P5P(0%<00PC0S0S X5 ,0S ,\L%e.K B BP \P @0@T H6<4"D0# sP@0@Tşş%5@0T06 v4 RД3S (0 త4 @@TZ0Q $R |P0S (4 R &6 P, ,4@ &PT6&  S0"",3 0{P@ Uh 6T#00/>10@F3PL <x3PTChG 1T3P= )P03$- 6SR ,@!0@T00 "2 B000"S P nx2:jlPP\Hd,(PPO@T J/ 迄Fn1  LPP>, 苄&R0S%"0!S$ ㎨puPL~FG ,> G 뚙?AMUTT MTTt,U8UTM UTT 0TpTMT0U$U U0TUTUMMMMxl,(PXdt|v -L M, Zß ?m3吃 ;LP hc+ #L3R,D $ pW,$  0bW@30EOa.6 0@Ɔ& 6F@V!3 ( &$6xr 0(& 0D 00 XB 0+00 0S2PU 2 00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55 ` d0 1 R,d0\ +ƢP 0 R,wAP@kU*0 Q@tPU:aA ,0 T UMTMSMMT(h@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% M -PLM@ 00 R$hv(T -LMp@-O`@v^ Pa0@S pd1P  0PUK T q,10  00S 2W~Cp pG R R0! wc.`fP%UPģ0FOa.U&pn  0 6 & p@⮣b0PV6@⥣ $CPlF? -0LM@H HpP0T D, LedA 4-L0(&S  d0 P0S\P P1 Pa S\Q 60QM -L: S  S  S H0 R4U S S  S ST -1L `R_qNP@@ ֥Td1 RLX1 RHL1 RT ,1 R $ QXp600CS0X0@ӤX0& T 00CS00 R0 0  yTYT nTNT 㓥YT00yTP  PXG@4(fT TTTT -0 @LM̀@@0 ` @@``峢PUPTp p @P00TQ  p0WD0@@WdUhUM UUT 0-PL@T 0&"0S @T@T# 0 @TT  d 000X 0000 0 @P@0TMhUdU p-l0LM@Ɠ0\S` @088 000 0 `PpMThUM p-LM0@S` PU 0 0U P 0 PPt0T p 6 Ul`P6@ S6& "," Z 6T  UvP\TMT 0-L0P LR @  (c$P 0s $T $ -LM8pP(2G 2 R b  ? @_jTo 1 RP a@T T rP(&Up@ U QW!0Z00 lQ3L1 R% PZD1 R 1YoV 1 !@Pc0 i@C@0PP  ?i@0@ 0P PPUgHTMTM UTTU UM8ThUdUTtM -L$M0 !0P@`_ᖄ@K &" $"40 D @K0, 'Qd4 ,4 P[ 0@0K,0QM@4 8@ H4P8pT54 , R0,# @K@_@K0  0`Q 00Vs# @ἠ0P 88 x 4@0pW U8@妠0@80 0 UT  -PLM, 00 ]@_l!@K0/a,@@K,< 蛓QG 0 0PP< ,@`K 0㊓Q.l0pZ o ߢ@ 0R  @@K0 `@0PK_tp g ?,\F0 Z<,S00 ,K U ,Up@-t@00CP`P``?>!@\1 00CPp010  p0U$UT -L8M 0@K0 ,0  -RSL4M@ Ppl h\\1  BRH KT 0, P \0 , K X T L H D @ < 8 4 0 `HH\KP@ 0 P0 X T0 PP 0p 4 ! 0U0?00f f;ƃ`` 3/00f V:TPU L0L X0 0 TP   U \KGU\w -L y - L0  h mH`U -L{mhl -LM0@S C\DTD\D00S lh0 R \P0008[ wTx -L`P똡嘁q@!qpb@1 P4EXEXE@EXEXEXEXEXEXEXEXEPEXEXEXEXEtE|EEE@@1@@@0 @00 @0 0QQ0 R|0 R 0 R|0 RP0 R X9P LH0JvUUpUU0UtUxU -0`P0@LpP |IPlP 00U0S8)PP$V 0 |UT0\ wxU -sL` P00CS00@Ӥ0tE U T T 3 R^ T0M CR `o000- CR 8^00@t$3 0 0 0S= 0^ CR /000T C@?R 00p P0@0@|2|t"0`000R P, 0Rp0 CR 0@0R P0Rp0R}p1 R 0^ CR X000I CR 0000R0RYp1 R 0$ CR 000RCp0 R T 0 R2 0T0Q0S* Dl >0@" eX`ᴆ@0ÞpU|U wxUtUUUUU -0p`0P@LP HP@ 000TH}0S lP@ 0 |UT0 wxU -LpMa 1Rp%  Vp@ PP  ᴟPP p @T^P0x0 KaP L@ P 3eP80 <GlU|U wxU( -PpLM`@> HP`FO HP H HP  HP4:HP GPl4 +dGP`FD4PVP@K 0GP GP 0-S6 GP `FV@ڸsSp0S GP`F@p $0Sx3pt3 l3 Y V,300 -X V  E  }GV:"0p0t0 GP`VVڠyGPPVUtR0S iGP 0S0S820S  P 0 BS0SR R0S) 4Q P  `F@1QP Q `F@X 000`FV@B10S$1Q 10S  F0 hP 201S00S00S X F0 hP|K4 MKrV{x0Sxڸ5@I?K2lpK1p`K01@TP apPh5`tPP@1@SPTUpPl r200000S 0:SP Pl PPU tO@T0, CR 0 R00p0K10SLX5U@ T 0 CR 0R008!R0S<1S0P [  p00CS00  ä0 H0 ,0Sl,:VYYi i8iiii$04Pv 0-0L0MP0@@K( 0 ɔ >|0| `P'0SX0 P0 H00<$ x 0S(0tYYY6i(X8Xh| 0-t0tP0Lh@h  \0\00 00>@08 `P$0tYV8XYY@XY5i  p-LM@`00X`PD 8dx@P$NP^PptY8X -Lqd0d0`pTHx0@#nPp@@Np0 8x 0tY8X$L -LM@KD004 (x 00tYd8XY -LM@-D004 (x 00tY8X@X -L M0p$0  @pp`0h\w$KP`@e$0@@S wtY8X@h40S 0S0S(-L0S 00  S\0Sp 0-@PL0 Np0 w0p 0-@PL0 9p0 tw0G -Lp=PP`@l哓d0p0`@0 @Uw89d@T( L  p-LM0@S`P 00  S;Pp@0Sp -QLMPp W@cX0$   A0S 0 0 SP @0S@0S$ 00 S0P QWl`||Xt H H00p@0S% 4i 08vG WDP -LBM M CNK@D0P @D/㋏KKK,0 PP墒 <0 ^PȠ`$( K 0SU (KP  <i(K0 (K 0Q`RKA K P <i 0Dr,0 S0,YYKivD?` -LM줟0@(0 S4$4QI4QDT00CS00  ä0 T 0S 0S ZoX)p@K Dd  ;<>K( `0 ^P`0SP@K(  #< ^P0P|]JPp |3 ,p ]Ptl @4 @0R0 0  CR 0R00Y0( CR 0R00J 40) CR 0R007\R00CS00  ä0 4+80< HD20@S& 0Ÿ0S @0 0R2!0S 1^ 80 00 |0S1@1S^m0X0CS00  ä0 4p10S P00@T`10S V8` 0M & 00@T PUX0@T  @0S 0 0$0Sk (0S(cYY$VLZXdYi t6i(( Դv?0 CR 0R00pph p\d p-L$M08@K`  Q 4 <0K 0 P R[ 0q<0S  lqu0S 00S Q0S 1#$0$ <NpHL< -LMK,p0 Q`Y} 0@S qW0000T00TQP  㩍 㥍T@D0T0T0 d20HL@-^@ 0S\\  P2  RR P2 R\ 0S\ -LM@  -Ql -L(M4q0D@K$  a 0 N i7 IYp0S0 0S, 4P%P0   1Yp`PU (0@PTPE@TU d@00PEU00S 㱎 0S( PYYi$,  - @LM0 JUTDD%7D0D 70@-@@@((0P\ P, ,0PRP0@00@-@@@((0P\P, ,0PRP00@0@-@@@ 0P\ P$ $0PRP0@00@-@@@ 0P\P$ $0PRP00@0@-@@@000P\ P4 40PRP0@00@-@@@000P\P4 40PRP00@|@-@@< <0@R8 80R < <0@R8 80R@`@-@@< <0@R8 80R < <0@R8 80R@H -LM`p&} P8 %00X{P5 P@ %ap 10@GS񟗧@htȖЖؖ $DdxȗP4\$P@@P4@L$@,4P44($P@ 4$@@@44333 3#P3#3330ȃ80 ;0t3h#@p3P@@\3\#P@T38#@x3PP 3h3d3`3\#PVT3#00P3#lK2"P2@@@ #0Sq`a2 R2 R 2 R2 Rp"0S0Sh2 R<2 R<"0S0倐ST2 R 80S$Y 0/;40"0S9 !0S3 %S" !0S! 1 R!0S!h1 R!!1V   x11 S01 R!1 Rp!p!l! 0S SP!S0 R8!0 R(!(!$!관4Kg FP :0T 0000 KVP"[R0 @ZHZZ80ZZZZDZ ItZ8Z4ZdZxZ(|X`8P"2n3c1@./A)b2b3c13N<000S `8P0I?BIIC -PLM@ c0PdS " H0Hn<0@ n' 0 n0  0Hp --M L0MpANK0 @D@D\ 0 P0 ` p0  U` 0S L >4 ݀> II -@bLM0 0Cs0$r r@ 00 0Cs0Pt@$K@ Pl$@T 0)@TAQ P |1 p1 R0PQ$C 0<h0PU 2  0 R0PQ 0S 0 RP㘀P >* 0P 000h10)PP 0UXG00IIIL -"L,M0S l0S0P L2@P@ 8@@ @@@@PP`"1h: 쁟PYLPKp) 0L` p8ZPI0) pL` /ZP6@ H0K: ,@ 8 H@ D@ @@ <@ 4@ 0@ ZpP HH00D00!81@P,!0(1 0 10 `@ `騪u0 ꟪l 0 땪bx ꏪ\` 0PDx 0j0PP dIII(a|```Z``  4@` -1L$M@HK,@ |H0KP0T0@0P 0P @ 0` S@)p p ````   @P ^@ @@@,P 0P20 PP0P 02S  0\` 00,000,0 Q 8,,0 RI`(aI -LLMTTC`0 $0 PPp0 SP )Q )Q 000  R0S^ " $0S $V \0P R T K.0ldK@3W0@L"0SZ0S T K.0dK@W0!W 0S T K.0dK@W!000SPP `T K.0h ,0L!(lL0, 0RL0RR000,0T K.0JdK@V T K.0>dK@V0 x 0>l` g0STR `Q0SK R pG< 0|``H|80 (a` -L(Mlq0@PKda @ 0 ~H IPD3[1 ,,!0vP"P  0 S  00 0 x 0x 3KGIPx8T 0꣨p8 0`i D`pi  -LPM∡0H@Kp|P `(0 HP DP @P 01 0 R 000 ^0 0-@0P0LS0S 0' ; |0PɋP 0x 00P 00鮦{8H 0ꤦq$ I<$ a`a4 -!LWM0,0  p|PUaKJ/ {d 0%T GP=WoK0PS @W 0]KS  @P U00R00SY0 ,0S ,. \\ K.0 K0 S \ 6D0D @- 0$ 7Ji(H4 -LdM☑@q, KⲠP0K0`0 ` p@ 0K K` `0P` 0 R  )000 PPPP0  0S 0 0 .0\ Kl`K@ dS0 0p NJP ,0S X, KS@ụ0 `X4 aL -RML 7 M(% 4%  ǟ7 ȟx,  ,  0 8 < @  t' _p. H0@/SP`8888888888T888888888h08<|88hx88$8@L0:;;@00S lVA0C2SE <<<<$<<<<0<<<<<<D<<<<<<<<<<<<<<<<<$<<<<0<<<<<<D0<00S|090;0:0;0:080gş80:( 8 07z]FKL L4EG.Kx t :  B0p l oP 0 j5 09F@ L]0:;8ꩤ TNKA r@ 垤0S 0 R 4%RQ #NKA 8D4P|ß0 R 4 R Xh 0@0hP00<0j,0, "NKA 2\3 R 4 R0 S  "NKADl2`P0S2 4 R.". MP"xT@JQ0 TVy/ eVkTT 2P00(y10 \4hP T +hPp!NKA P L0 R 4 Rk (`rX@@ a080 00 V00NKA 1Pڠ0 R 4 R Pø;d0 0:;7/0<0:;:?.ADb,bhC 0H'\'а|Ȃ0Lh8bh tJ0L`Xb\bTt||J'u ,8D\ wJK@0C, @:0C D P$0S \0 0 )*RP"0  NNKL2@D@DP)` 0T `RPD2) 0`RPlfafx4 0S Q0S22x 0 .0% >5 wP$  #0 5@T @@T ;TDTH$0 00000000@4@TP@0D @E@0 4 R1 @\ O>K)0C* Qps $KNK@D0$% R44:0  4 4: 0 {QPPX0 8EP00 0 s0% 0% 05S8%R 454 00) 0l0   ,0S  < 4 (%R +<5P(%`6 0s 400) 0   0Q4 ZQʘ&0) %R @0SX&\KPEd&@0@QP6&0@QP&ONK@DP) 0 PPP6) 0PPP(@ @*- $' 50C5 s| @ qBB (0@ ,x00MKBKK DhDKL@AI L@ A 0IH D L @TcPU\0SV(0 NH@0 5 @TP> Hx804 =KL0Cˠ 4 $5 4 HD5 D 4 )P L%$Ed  R 0S9LPڔ0   夤 0S \;P0S t P@,B:0=KEK0CL0C 0 0dPL: Ri g` .K0Cɠ@ 0Ch* @P u05 vPP:`@ +0V@0 )0 OPL%SPhO.K B0 B^PS4AP4  `J@TO^KPEPE 0 P@540SAP$zcT4AP~ Ln8BT4`<Phd p04 -|<@O>K0C)0C D OP [KNK@D t<)O>K0C rOp F-N>K0C 0C( cO8 <-00 tT t$"`=` :Pp % 1 PP JMAP 0 A,%0yX-P_P0  P$ 000P Xb\b -LM8P |0 R 0 l00 QL SOP 00 @4 @ @ @ @ K $O@@J$<00    0 ᄂlJ -3L$M R 0SS@@@@@@@@@pp3  r\\!00j0Kvg_3 3 .$(," \"(!̠0!0 `.2 p22@80K8P  0 0@ ,@ 4p $0P0?@ P`2 X0᳢0P 8 )u,f@K <@@<4 Ġ̌(<"4!Č ̌$ P3 K P- 8 P0 1P0 21 .1 +|1 (p1 %d1 "X1 L1 @1 41 (1 1 1 1 0 0 0 0 0A[?[0HP @@[0G @0H P 40K9K3K6Kd<@T K,Vip (0S4(JPJЂC p`D  p-LMP`0,@KHP 0  G 0SpP `  -LM@P  00R0R  00Shv#| -LM@P h00ShT#| 0-LP@P $00S0hX# 0| -L M K$3P@![A[R0 ʐP x0td P00TT0@LP r400 PP00ht@\l t Xx  -LM!4 00 0S 02!d\*00S꼙0 0 !8\ 0 !<(0( 0S00  !t@< -Ll000CS6666|6 h:h(ThBnh\J - 0 L 0 DJ - 0 L 0 HJ - 0 L 0 LJ - 0 L 0 PJ - 0 L 0 TJ - 0 L 0 XJ - 0 L 0 \J - 0 Ls 0 `J 0 g h -RLM@  pP+p0 s P T*U P pT PPEUTt`wl`P PP PPUZ)T  ip i+    B`C  -L M0D040 4? 0`0V 4 AR0C  0R$$0R:F`00V0 R 0 s0s tC0S 0 4 X3 R@304SP00 0` 0  0 0 0A> 000000000000 0000 `0`圢0A> 06 pIpq QcPa 4S4S 4?0 iTpP@uw*`0A>@t 0 001 0*l(pP|V*?T A.0O0P000B>0,10S 4PU/0K000 u*<040 00S 00S" 00 0000000`0` 0 0 0 0000000 0000 `0`0 $4SY*0鄇J0 J<  wL -pLM@ 00s)0@JH @-`@? 0"00\ 0S0S000\脇 -LMZIp q  Z0Y0:H!O 4  6y†04 S4 S* P%0 4 S4 S0 4 S4 S*p 00 0 4 S4 S:T0O YA. P ` `6& 0I6Y$鄇L -x0LM@ 4 BN@Ap@0t hz 00Np鄇L 0-LgP" 0P0Q  0R 0R Q(00A> 000 $$0鄇(00S00B>0᠙@-(0A> 0$Đ6I 脇 -LM@$0AR 0  0R0$$R 005:| L0$$R0$4 A  0@0 0$4 鄇 0-PL $4S0C! 4S4S 4 A> 0@0P0 A 0@d0 $4T0$0AR 0  0R$$0R* 000hcꄇ5=?0/9P6 0S000J p- LM 4B>0 pQ 0P@00QP`@BN@0 A>0A> 00$d0(@K B>R0  40 40 0Rpqph(p鄇`  -LM^Px 404@0  0000 0 00 0 0 00  0?\00ꄇ -LMX@ 0S 00 0  @0S0 04hꄇ -LM@0 Qpq @ -LM̀p`P@TC@!"^A>B.A 0 0$D4 dD P  40 40 4stoJ 0-tP@0L 4@ 4@ > 40 04T寵0@0h0鄇J00 ᄇpD0 00000Sp00000S p0 000  -p000L00 0S0  Pt tP@ qL0 0000 0S8 0(0$   p t x (0 $ 00 0 ᠉ -L 00 0鐉 p-LMP%A$`$@000A000p鐉Aꐇ -`Lp00S 0P@Ax 0 0S %A0 0 00(`S@0S0S阉 0-L@LP 0LR0 0CS00 00 00鐉 -鐠p0 刀0b? |`PUL@0S 2#P` 0s0s   0h(0(P0S @00?@08 0-1L R 0R:g"0 0R 00S 00S 0 P/ 0 P @T&P@:  h00S 0S<H0(0P<5 ;$0 0 Kę(̙J0   -0LMK0 !\T  - LP x0P0@0P00P "P @00S SS g h, K  0-H@0PS80L0 ,0,R:`!0P00 K   0-LP3<@@T:TT*0 -LMPB@`0p   P0p<0@ Z* P0P0i/   Pp U !W i  - >LM0.0?.00e=@]@0 S=@= +=0S?0SeXC`0SeX@e dM0S P P 0S#0K$`K$K P P 0(K(0 F@(P]T0DcS&fehxjempnmhfTe@h  $0|@+|@\ -L4M 1@TCT0K X Q@T0`TD0`BPP k2ݥT0V T0`VpD0`*PU R2@O2@ `H 0 ὥT0V00HTKCX崥 ᲥD  -1LM0S0 4  1p W OP` |@P 0|S`2@2 G@Pp8@ 80S0%S 0sS (080 @1p00@1T:'@]TY P)K ߠP {)[40D@00PP{0SD0 -,1LMP, UBR{jPp; 1@ 10,@1`@Z0 %S0sSZ   , ,1P@00P}1U:@T o{D  -LtMK@lP@x0: S@@Ҥ p-LtMP0SK` L1@ `MF0S9`d00S0: S /1*@e `0  QᗤpMM -LtMK@H;PH0KI00S꼙 0-d0L0ST00pP@u TU 0000頙L 0S00>꬙ -L M@000 p`P00T,0  300CW 30SW200CW 9B2 R 200CWUV Y0S x20S \1UVP n@ R R F20S pWWJZZ`P#p`Pv0X,0 p@q>P ,PL1AP-00Y000 # 1 00S0uv   00S00S0   00S6 00S 00S-pWZ00S0   ,0S 00p 000 00SYk 0 o \M,N<L -LM@`PpTW 000CT0 @T Jp`PvY ZE@TZXZ!o< \ -01L M0pS` 10S P; i>pP@+u)V 0AP 00S PP@$ 0pP@u l0 000 0ę\ -LMp`pP@uV iE 0S<00S,00S 0 0S00CMș'\N< P000PM -P0Q0L00 00 000MN - L00 00C0N p-LMP`(+@0  000p P0-L@P@ 0TD0hA0J0PPM0PPM -LM@0S00N p-DPLM@`T Pp@TpM 0-LP@P000P0000000000   -pLMP@u) 10S1!00`Q0 (P*ip@ VP@< P00 P8p0t T >  P 0`V00S;00 P``V%0P@` P@@P%@Ex00S00 S 0 P@ P pDP@$NL̙Й -pL MXrPp20S200QPW0 P@P u20S @ T T10: P@ P p1@0`PP` x!0$ P@ p`PP,  0,0 @6Pp@ 0000  %0 P` P l @0Q P 0Px00Sl00 @,@ @0PU`XW,w  $NЙL̙ p-pLM`Pv dP<p P P@0P`40`/@0P`p P P0`pJJ -L0SH hp0 s 0 0  BhT\ -LMp`pP@u P |00Sh0 tW V P@(0 f K!p -L M@Kv O p-LM`pP@uxFpP@uPph UT0 ph p-LM`P@P  P ptP@$00S/ ph -L M`P, , XP,0@cT A dxvP@ Ho6pw0x00XW0A ,0@T)y z  V0 U0 1 ,0c@0;p`Pv ,0@T ,1 ,0@d@ 0@ܠ,@00CT Tp`Pv XW  000S o70@0CTF D0@@^ 0 0@@\ -hL7` 0S 0 0S<0040   0+0 \@N N$N -LM⠀0圐p댠`P00V@@TP P㹞Vᶞ  b$H  bH`Pp$NN NL0 0DS@0 80 40 00 ,0 00 0 ԙH8<@DPL -L M@@0 S( P@p`p`20S, 2Ÿ  00 r0s 0SR !0S0S1 01 00p 0 00 0S/@@K 0*$1P a,1UP0!c0@PWP 0 0P00 0 0  0Rph0 00d0 0000 S 0 (0S8(ԙN8JJ N<$N(H$ p-LM0`SQP@0SPE P P@P0SUfp0SQ 0S0ASQ 00S0 0S  -qaQL 0@ l0T@lT@S   0^ࠡ0nP 0 000 h0 00000nP0<0 0n d0 <H8JN N@P H@Td\$0 000dh@P ꨪĪ$0 000T|l p-0LM0@S 0S PpP pp`P R`000SP PT R ,0000SS PpJ8 N -@LM80 00 B0 @00`08N N< -T0LM0@SJ@000S P @TZ8N -0LIP\ -QPp1MLP0 0``P!A0P000SPh0S `1@HT1@0@T @1@a0 0CRP  UR1000S S 00@0TS P0ø 0D Rڴ000SP W00P00S U PT P00C0LL0 0p<0 0P000NL<$N8N N -0LM00@0T0p` Pcڴ10U 010`@fDP`  TJ1U RZT010Pe0 DPPE0 0U00<NH(NN8 -p@LP`P 05P  T0P0@` "l@h 0RX0X 0 ?R D0@0 000c PT,<N8 P-L@p`5PU U nU"0 Pa50Sa uꈥ\ |0L 0R 0SPUQL0   RRyxw0 P50000050Sp 0S 0S0STQڨ0   RRPO0 P0 00& 0SI 4Q!0S 40S0ST0   RR(0 `P000 3 0S R0S300PSU T P0 :P000 ßS0 0S_T2QW T g 0 P_T$0S 0S a 000S|2Q00  C\2LB 0 P 0 P000=_S0S 0S  0S  0S 1 T "0  P  T  0 P000 P D10SLSS G >PC <P2 10S ST0 )0P&0 @@0@0@0TP 0 PX 000P 0 yP  000,8@JN NNK< 0-@1@LP T00 P0S1b Q 1 Rb\0 00R 00S 00S00S 0 000 00000 00 p00S d00S *00 00T000PT<8N NԙLP00S 00<0< 80Q0(000000Dؙ0 NN0 0 D p-pLM@0`t nPPEp@ p0.@0t T T000CUP800@(P@0 V000p$NN -@0LMTP/P *@0$0P0PE0* P` p Ulp@ZP\ 0 *0Q0B0Q*0Pd(0PE0`X0000$NN@-p@T* R  :P0b0D 6@0@@0@0 脊Đ`< @-P 0S 00Q ` -L``P@ T 0S0S*0 S0SB @ T 0S0S:p R000 0  `0St0 @ R0 0S0S@@0 S$0 0 0 `Đ -L^ 0 4N -LMH@0S dR 00 000P00Ȑ̐ -2LM0pS px} XW"Z 0S 0S *Z 0S0S:0S0S0$2Z 2 00`PQ PU`R?Q=PP;1 `XW `1`P0 00pv  0x@0XW4  0 V;U9@04P 0 `VU [0`P0 00pv  09@0VU80   `̐ȐLN -LMZP,"PU 0 S 0 S *PU 0 S0 S:0 S0 S01U 00 p ` Q `VpR+Q)Pp0P(0`ZGYE $1p0 00px  0@0P`Z,Y)pP ` V U x0p0 00px  0@0P` V U0 `L -LM P@p` P@t0u00X00S T00XtuP@tTU@0\ -L M0-S aGECZ,  `#/P LPp% 0S" 0SEPP` #@#@@DP 0`tU0S!P.h  Y L \40 , ox P 400S Aa0@S<0 -A @L2$0R20Њpd -'PLM! $P .P ^P@0 00 \P|@000C 0`@`000T@P@ 0s0s(АT\J x -LP 0-LM@ PKT 00000J -L M@K0,sώ0s 00@3J -L M^@K |0^0s 0s\0000 H00 0400 S P  J -LZP ,0, 0S J@-, (02 S@04R 0-PLMP0K K@XP# 0S00R0S$ 00  0N P-L0 } hzN 0-PLM@Y P 0P[0=0C:SGLhhhhhhhhhhhhhhhDhhhhhhhhhhhhhhhhhhhhhhhhhhThhhh<hhhhh4hhh\lPhPdP`P\PXP@8Pɔ{040K 0(10 e0@DH4T8TpJ0pT00C p p000C 000C?001\0T0@-H 0\8001000\0 010\0T0@-<00 CR,0010 BR0 000\0T0@-8 0R (0P@0100 R0\0T p-L MP` 0@R$K0S ]n0 +00$0s 0s 0 01$ Kp\<0T0@-P 0S0S0X@0^! 00S 0SN00^00T\ 0A\P<00 r0s  P0T@-p@0\`0 0r0s 00000\0 \0T 0P PPB@\ -LM\X@TLD@0 840 ,(0@44T< 8T 0 ` PP` h P00 R00SH0  0K 0P h( $  -L4MP@pß00K @KP  R0S `  D `VD r0s tu h20S R0S0S *tu $200@_0 K0tu 0S0S*100@_10!0S0S00 ?SRp00pWÏ0K D1t u  y0z 0 U T P @t u  U0T0 " 0 @0K@  Pl q0s  ,0S00S0K@0K0 K0@ K 0$Np@-`^@P  \\ 0S 0\ 0SP@Up^p 000L 000L 000L -@LMTP oDl< gdah],D\ -81LMXH @@ KxC@ pY:jP0  @`Pp!0S0S 0 0?00`0  X 0S L0DS$0   iLD\4N -LM0$ KK 0 0 NP$ - L| P00錯P -LML0K Ap@T0[S00KT[P -FML M08GNK, $8$@D @D0`PX 'v<p 20@FS 4<$0<Hp,6 R6 6 R0&<0tvKA $P00Q0S 8}0@9vKA ʶ$P00Q0S g0(8uKA 崶$P00Q0S Q0<:luKA 垶$P00Q0S <; 5D,5 ?5 ;tKA 倶$?Q0S 08:$000"000;~0@0{08x`4 R$  KJ p pGJ HT$ 0 Ps /P* P P$0004SP0;000@P P3 R3 5P3  080@0 P8  Pl3    P<3    P3 R0"< P P070$H P P060$T 060$P 070$L 0 70T H L 008rKA ѵ$P00Q0S (n0$000qKA 帵$P00Q0S U0,0|qKA 墵$P00Q0S t?0 0$qKA 匵$P00Q0S  )000 1 `bVQ$BnKp`F`F[P  4P $0&P U0-S C o**' UtUxUC  8hUlUPdUhpU< w -L4M0 4 00[ ,0 ,ZP@K0@P@P 0H0ᠯP 44 R 0@ D0  @ D t0H0 0D S ;0 oR04  0S00@ 8#8L0 T3 M 00CS0xS0 00W P@7<000<O0SB0S "0P  U000 )㈂L< C444 00 0dBD@0pt)`2 R  4@ 0SY ,K ,0D 諄PPI 6D080 ` 1B< @K0 00!P@# P 1 x)q@ R tlZd1 RH@4@0Sp $ 1 @bTQ04  0QInK`F`F04 LPDDT0 sT TpP, MK@D@D 000 )NK @t娄pY ,0 S ,i0  p 3MK@DV@Dr', X}P XZ W\ p7C 7,7X77ؖ w7U77 -LMp0R@ 0 P`# ,STP l"^K@0  0 S ,  St:;<;p;|; -OMLM|B tUdr  , u 6 ?K@KA K%0 B% 0UK 0 PROKH H Q *sU1(K R qP0`S @0 @PXa 0PS@TPP01PQ? d% 5P P P 00P@00P0S P R 0, BQp0  ,b|qRK@ ?K4UW;;(\w;;;< -GML M!0p,0  KJ`J*K@_ ?K0 K@_0dpT  0SS?A pV`P$ZWy0 ,0S ,~4<@< P-L@ p0 Sp p `P ȬP P4  0@Sp0!R  -LlMȀ0@K pd$0 `0S" 0`CQP|P0@` @&PQPd & $0S $~U T~LS@S@F <<<T<<< p-@LMSX`D00CS0X0ӤX0 PpP x@00CS00Ӥ0 Pppu YUyUp   =T0!400   00!$!Ƞ ! -AML Mp , @@ @4$ O#BnK84`F(K $t8 `F<$  iS  RS3(K l@T40 0S S@D00(K0?S (K0*S p3(K RTR " 0SQL#0000ӑb0CS64555755575,7555556@$@D<$ 000P-S+SP84 0T zOBK0A0A`PpO0"S 04 R[<QO0 (84+S  8-\ `   00( <P% iZ`P)@c0 g/ V@PQ  0lS @aZ dR D1 ,0S H,|F/ 3`P<$b20 h O000<4 @D~@D00< z@D< t@D< p0(K R ?O( K0?S 5X0 T BR X0`  äX0 8?ATXX Y 0-LpM 0Pp@K 0s |0: S S0 y# = w p-LgM`0@0 Pu y@T.K *0st |10! 10t!  0S 4X|pR@y?#edA<=H= -PLp@@W` pT P !0 0S 0 R   -L Mp" 0 @TT`P # l0 aP@B0 xP@\Q TR 0Q0N$`PA@ `=l== ?0@- |&>t0@Y.@P?/@@B@DRPN`,0 @`VP$@Z -@L MX &>opn003X$`pZ p-LM&> @`@Q ~NP PwU$@p= -LĠ[D 0Pp`0 W , t P00 -LĠ[D 0Pp` W, V#0 S sd -GMLM 0`p,0 ]MK@D@D 0Pr0 )K 8 - 0 SYR xX -LM P@ ?0 1<00 ! 0! 0 QQ?  0 1<00@z0u o0S 0<?S 0S 0S0?S0S  M-LMPT00\,0 `00S S00\ ,0 !0SS:P% 0@0@ 0? <#! 00!  00 0? <#! 00g,0S 0@0 @   !0$0   Lp> -L >>> -!0LS@ @@@@@@@@@ p0 P`F%$ @LPNT0d0@0OH? -! LR0  0        0(P@@cPE@c@@@Pc@Pc@@  -LM✀oK@pP, y @JL LP@N0L,0 S ,xl?4<?? -LM`p R0 @ˠ p7 P̠ 0Xp- @? 04p#  ???? -L,M|10  00S PPKN@0 @PP `DpKAA0N0PDK0000 N?(@H@d@ -LM@|30 ` 0p0S. mPNK1 TB  O! 0@!0!! PpR \!!!!!!!!! M,P) 0 !\!. 0  ` S ! 1 R !!PP @ @ PE0Nd0 , P@D ^,!00p@7 ^0 0p@*  ^0pP@ ^, 0p@ ^0 0tp@0^ p @@D?@@AEDwXx8APAdA|AAA p-L MPq00  0`0S !Mp፣@11Tl^kJ u @@p! 00@!0!P`@@D?@ -LM`|0@ 0 0p0S$ T11.QQQt@0SPU`*JPLHL@ ?_0L@XAABB 0-@LPL04< -LM†@0`t(0 L6oKp_H 0i(0 S (vDB`B -Lhv 0-@L0S P0  PgL0S0hB -0LM@  &> IUtB -LM@|00  00S ⬢P11>. \\$ ,)L {I LB@@ 0-LM P R|@|K  0S@ pX I@0TD  < J}s 0QQR'5 p-MLM`@0 0 Pէp* AK@@+0WP! TAKAA 0r00000S  r\00000S 0S@\[0 Sup -Q* rh000000S  r@00000S0S QQ: p-PLMU`x x0)d X$0@0\  PP0Pr0pBB p-LM 0@Px0`0X0S 00 0 0嬥@P @r p w -0 SL0S S h0 hrB -0LS S h hB -0LS S h hB -0LS S hA hB -0L t0B -QLM,  10S t1 h1h 0RXA0008,  00S S,1I0S* 10S&,  0PS0 p@`0 0^T@@$UPP T00U,  d e@  @2hP\0`@H0 0, (0 0!0 0 000tPd|vBB p-LM`ŤP@P 0 SP UT0  sK\P00@  fp\t w -9L M0`0fS eS gS l)h)d)000P@00GS񟗮\\\\\\\\\\```````]]l]`]]^8^_``@^```T^`p^\^`^^``````````_^^`^^`^_``(_`L_T_`h_p^p_` `x____``````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````````_` `_T u5 0 00 R5 5 5R9ʘ5 ! 0 B 5E ,K*0, R( P00R0S p AW(5 (EP%00 %6 ,K 0, R P00R0Sp44p44  t4l`4 T4 Bd$`4 X48T$P$000f@@0 0 0# $4X   0̹ 4N4LCI3JE3 3<3   8|3 l33/3)x3 T3$p3"p3 l3h3d3C\P3<P $P c3 2P0@S@" 2 )pp:20`V20Sg "0SM`Fj1t0@S "000P2382 42 "0T13 0 `1Q0S000  00BP T1 P !<tl!T!0@0T010SLEV00S0  VRP0P p `Fvp @`FvpWq0< 8C Eh\DX0ElT`HLLDDETEXXP|X w -LM@ PpK" p P0Sʄ0   T p`O p  00 0=n -LM@/hn@- 0@R:T 0 S* 0R S R  :0 0b0000$0c00 00 0(,n -@L0P00    T00 0D S0<PP4 0 0PS0h(,088 4R00C0 R0 (0, -LM@T- -LP00 p-0LM0Q 0R0SP  W+P`3S S Sη 08 PH,P@ph -PLM`b#PP20St.G AP X20Sw<<"0@S@00K 0` <@ @@ ,0K@  0@@pK0 KG\ , * 1@ <0R0 0S B S@ < lP@t1 Z00R00S H000 810S,10S 10SFq"0S 00S0F FP0SXRC@X00 R00SGCX 0S0S0SL 0Y0 R00S <00SDE \B wX84x`l DpE -x2LM< P \20S``JH"`0P=020p R8K  01@P10pK0P@ 0 0;P10S 8PK(0S0 00S,0S P` Pq0僐Z410S V``V < 0R0! R00S8A RV3 00S/00S+V# p0SR 0 00R00SR B0 0R00Xh0 : -00C0tHPXLXxl`84<; -@L`P1T T0q4T0S` }0U  R00000ӑ00Q000 Q0 Q0a !00S  R@000ӑ0!0a00Q鰡x -LM@Ppt ttt00S$S 0,p 0 0`^S0p0C00t S  P 0@ P00C0044   0RI r8200000S r2P000PU0_S ,S ^S $S =S -S :S /S 10S  R10000ӑ0.S 0`?QXZ, kP0Q(10S10S p, R X00b0CS0X40h0j`C f0Q0Q a01 h00S  R`000ӑ0!0a0 Q4SEExl -LM@0p@R`,@ *$R 4Sf 4S P`PR S Y7Kp20O00O4S  0 0 Sr400000S00S_S   P0S r4400000S0_S 0 S 0R r300000S0_S0 Sr300000S00S_S4SPk P bpW00cO0O4S @0 0 Sr200000S>00S_S:   P0S r200000S(0_S% 0S! 0R rH200000S0_S0 Sr 200000Sl00S_Sh  Us 0b00S10PcUj~pZ0O00O4SL @0 0 SrT100000SA00S_S=   P0S r000000S+0_S( 0S$ 0R  r000000S0_S0 Srh000000S00S_S@,@  0 S 0 b10PU, -LiP ( -LjP 0@-@TP* ^ \00S.^ H0 0S \4000 ӑ^ 0@T:0萡x-\0Q 0\ a p-1LM0`S@PNP10S U t0 CR 0R0 S 0@00嚒, BP$10S U 0 CR 0R0 S 0@0}0APU 0 CR 0R0 S 0@0TcL@0 00CS0 phT0  0p錡E -LM@P.>`p!"pF@K 0PD{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{` 1p1' 0`0 R0Y00 @b0Q T00S J0 R 0 R V @PG0P@S@0$8C EԡС̡@[ȡ p-LMK&>P @P`J011QhTZ ㋭P@Tj_EZpD]P TP`1 -LKM MCNK@D0@D,0 pCKKPPPM.KAAcP@4: S  S \7H,0 S <,kmK`F`F P@ PP  /P@h 2 R_2 R BPO P4S 0G0@$<@ 8@ ;0K4@ 0@ CK08K KKNN( 0<K @lP`! 04 1D MNK !0P #0 0cxA{p M@@\P p @OD@0 0Pd :IP $$  pO:0P 0 2P T]] (P@T Ph5mK`F`F P8EEȡԡСp$E wEF -LMp(K<PP3 @T `W@ W Tjo(TPZ ( D K(00(PZ ( D 9(00Tm@ 0-x0L0PS0@Q  P 0S(0 R00 R0@[ġ P-L` 0SnS 0@ ,ㅺP@fl0PP@p` ,sPp@0oS` ġ@[ p-PLM@ PPpMP .LP 00AP @Q T`8P. 7P 00,P 0Sp̡ -L 0KM#+ -L 0h F8FdF -OML M`3JKpI`@ | , u 0S(#( pk 90@?Sb 4@Tp|04004 0408 040p4 Q.K B B040< 040hQ 0S B^KPE1PEA@P $@ 0 4 04 $ 0( * D WQKAgap) X5<4 Z584 W5;;44  0P:Px Pl :b0$L)-P@< R hC 4GF<0 DGt  \G -LM@P T  Q q0@0  R\ `dG -LM@jP T  Q q0@0  R\ =|G 0-LM0P00CSK @ 0$ ϓ0 R  00@ÙGC -L0H gG -LM`PP( @(K,pK 0  (0@S e -L M0@p00 0Sf W=PP 0S nSW =vP0`0@Q gP QIQG  0V0P . 0' Y0  0000V 0`0 ,KD, ?R0S@p @90"Sl 0Y000 LPH00D 0oSP  -LM<@KpPP@  P40KP\XXXCXXc -0,0K * K<#pd ?0L:S^ЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏPЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏ@ЏЏЏЏЏЏhЏЏ|ЏЏЏЏďЏЏ0000S 1000,K +K&0Sb @ 00y!0pWQF pGw x ҨP;P`   0upGw P@ `nP iP dP -P@@0S  @`P0\ p0p ^<140K'PHHإ[[C (I[|8I( -LM0@S\ PH P8PP | -ML M$ß0`@( ,0 @2P`d088 B~KpGpGP"04 0X g048"qP0 T  QPP KA >KA B0Cm048P480   ,2X("@  0;08@Tk p@^ P+ UbX@ 1 ,0S ,eKAA ^;P<8C4P K  X L <08QNK@D0@D(!`4-:70S Y ;0S70S eY  ;;;;U b48t;08@TGeTn (hdI[[lIvHH %[HtHW 0-`0L@PT  \P @T(0 R00 R0[ 0-D0L@PT  >P @T 00إv p-LM:`ȵPP 0h 0@T  P @T0 ph  JpإpI -`LPp@0   0@ -PLM  0SlsnS `0 @KTN:0S@ @ 0oS0  [v -PLMP` 0S pUXaJ@G@@N 0p`d -L M0 40 (KP`* :2pP@0H U0S -Sl01=P APAP@0P0$`P00`40l -0L c0I 0 [[0[0[ --L c p-PLM@P`l0l R jT D0 Rp809 H  0  9c[[0 --L  --L  -LM@5帪 h괺 --L cc p-LtM/PcA@TK ~\P0: S p0`rSj h 0-/L@DAPU+D0 00^/00(+}+y00ء -LUMpPKPA\P@lK8:\0S-0: S  SU P U@P P@0 R000K@\P h1: S@ 8c$^=6[ P-L -`P  $ -QLM@ z`P T  K`4 -LP  D -LM40 $40  08 0Pp  P@=  PP a`.W X X0SV  0m 嘩8  8 0SV  04 P8 W ` _8W X00S($00 0 R 2X0 `,Kpx "@T 0S @T T ,  PB4ppW^^J R0000 0W 8 00$28 8  0"PP00  B 0S00C0V 00R0R`V` 0S 0S4P  0S 4P h_f_d_  0(<Pp  0 7, 8 R" 0PU 0S  0ԨU  0PŨPU8]84P0` XMc;LL'hJ|J[J[JJp vIJԴ,J-0 0CS%TT|82-41 R 0S Q SQ%-  !Tb0pKP -- 1-  ,0Q S l, \,TȪ?\SS\SS@sS]SS]ST4X T,T -LM`@`|,pQP Xo!QP LP   R RP Rp0S0C00 UX00U +,X B0P0 ,PW 0{Y  `~,\R\{,P" Z 8p,4)$04 L g,$08 L `,$0<  L Y,@0A}?$ !@ L N,D0$ }? L !D,$0, L t=,$0( L X6,0Q#$0H L -,81 R 0 #,! 00CS00  ä0 o|o7ェ000`00,}R  RS0SP0SL+ `oR TO/4T\SHT\TpTT]TTTMbUȪU^U(U@U p-LMHPH`@D+$ S0+  M L@ph\tUU Q-L`Pp00CS00  ä0h -|@+ $0p0CS00  ä0@@<+ 0B00RPP |U^W Q-Lp@P`8 \5 0LW3D 0V C,<R 3000` \ 0 CR 000 \\PV 0> CR 000Rh{0 R \{0R \ {0 S0 S 0-,@LP0S EP@0`^ 0-LBMQ0 0C @S0L_N *x 0S dU0+| L x 4F/K<0| UUUUU -0`PL@ p 00B S0B a0BSWBA0BS7BR@P4P0\Dll` `Q:0e0b``` -L@LM "00句P 0;0m\U -LP$M@KDK`@  0@ < 8P 4` 0@ ,P PPPp-DP QPP$ 0  ppPD0ph'U U@ *VL0 0S 0@T:Q} MNUV -QL$M@DT6 T- T$ T0 T0  @ 0@)0 R0 R000 R"x0 R"ddd@ `D0\@) D @0)V$V,V4V8VX XT^;HX -0LS00S4  0S hIh0 70Xa -`*@P L m 0@00@ rRpRc hRa P\ Pp0,S :S.SZP{00 00B SU*  RR 01 P0Sp* ,S UP*G1@01 0S1S01 R 1 SRP1 0,S UP*'0@S1S0f0C1rRpR 0hSpS00 rS000 0rSpS hS ,R@hR 0\S 0 /R7R0 0C00BS! 00B!00CS0 BR&, p-PLMP@a@A 8Օ00!S 0 ͕0!S0 ΕP0 录 0 p@0S ̟P 0S0Sx0 夕 R 0S l3`/P 4吟 @0 <0 p_@YMLY]XPYtYYY -pP0@P@TL`% 00000S 0T 0S0S\hTH 0S 8,P@`_Y0YY 00V4`LD 00N4` 00F4`8Y - 0 L0 Y - 0 L0 Y - 0 L0 Z -PL0M $ 0 0p0 0pS`! K$K{3P 0S@! K$Kr3P 0S$0 1ϔ$0P5P0 $ Q 0S$00aSP 0 0QPPW 00S  $000S $0C $0$0QR  0$0TJ0Zl0 0PH00}S <0<0S 030$Pbbhbbb -PLMX   KK ʩ(P<800 (0  'b cv -PLMX   KK ʇ(P<800 (0  $c c@c -LMM0BNK@D0@D`+,0 ɓV+pPP00U00S BNKB.K@D BQ@D BQ 00Q+a 秓PP00U00SBKA0A@-0K-PP ,0S,B wHc -PLM   KK(P 0d SKK(P 0DS <0<0 a,0 0^Pcdc 0-0@0P 0 0RLP0cc 0-0@0P 0 0RLP0cc 0-0@0P 0 0RLP0cc -LM4@0S [0SA 0-T@L0LPSH P@40,0P 00cLo P- L<80 ܈,0  :hkcca -Ly-800S (0( 0S00ϴP -PL M0 , ,K0K!?'P00 1埈=00!p4 tAt坈d14  40SDAL 4  0S$A0剈冴P`4  0S 0PU @piӴ0 PP@L d H,040@ L0 P0R  㯴 cd d4d"p[pH90V L@K 4)P0 08>P t  `GA0Tp1 B SK <mP," 90S9 up p1sp  p ȿP V 0S @p ǿ0p1  0L@K@<P`@TDfp1S]pd| X 80S 8"2ր 7рF70S7l"Ȁ:㽊P# P@<. %㲊PV ͊P Ɵ 0@誀Ɵ 0墀7V 崊P Ɵ 0@葀xƟ 0剀pp ~K `6P  !R B00S S S R B0! 0!R0 0S S S 50S$6"\ QP@ @ {P  {P    {Pl6|5 45 ~K坚P  !Rd 00S S S B B0! 0!R0V 0S S S 1SO T40S4"  gPRK@ j$0Sr0So10Sk P 4 fP@40 @S04 "R !p1sp|1S|?6=6"2  SSSx܉P20t1  x"t t1SxP(01 幫P 1S$  x2P@ 3 0! Po 6 5P Gu2B  t!p@ P 10`S1 10S, 10S(T"0S!0S:@2# 0C\0\00^H10 PoR0S*1K*2P 00Sz 00SvlPq0Sn00/PY0SV*01#0 CR 0RJ00G?,iPiXi8a`i|iiiij4j0xLHj\jojj0 wjjjjjjk10S 1U!  0|V BNK@D@D0!ut1 @4 < 8  XACKT1APA@4 PP4CKSAA4$ 84 1!0?2cS D40`4 3D4`$0RD4 D4HSD0`$0Sr` ,0 S,5<`pm|mmPi8aXiHomm0mn vhSK0C0C0 +,  %@$ R p< 8 4 BK J4`J U0@S񟗾^^^^DP 0tDPp 0Pyu04S440S (D(y$ U; #0SS5V4X24UV 4V00V00S30S#30S X X0Sp3|3 qyX30 CR 0R0 S 0P0XXu3 00000S "01000C0W2 0BSpRdppW00X00S u2 00000SpW)0U0 U00S@$p0 @<2QP4@ 5dW(UpX-U848S1  8 V-0K`ZP4A PP210SS5V4Vڐ10StA0 CR 0R0 S 0P0TX4$RB>K 0C c R+#$ق8Q 00 S Y44044 1V 0  <6 0 YR 00S <$`0RR0F<,0 S x,1< 0 t[$o,oP Ds,Popo -LM700 (@(0 x~古Po|o -JML M͟@͟KK` ͟VSp=͟N_N<,p 0P@004 <P@0< 0 $ 4  Q 0-S<$BxTU< ;x|<@T $_ \< X<RHK0C 0C)00P 4S 4 S9T t9Pt 僣P`I 0SA 凁P 傁P7,90S 0CS  7b4,90PP  4S8P@80<HP 4TSd8P- 84 $R P& 㖣㓣4DS7@$P ㅣィ4TS7P z4S 4  4S \ gd7 0S k0CSh6ppS7/4 APp``@VH70S> 60S 60S6&4S.ʸ4S 4S'4x6# 0C\0\00VK.K 6 B B Ɵ0O4Sʸ4S 4S5BNK4@D@D+(P`60S7 50S |50S/hşP*0S'450/P0S*,5#0 CR 0R00U4 00CS00ä0U4PVW0 S|4 VOh4#0 CR 0R00U(4*K.K3 B B0Od40S 30S 30S #4Sʸ4S4 S440@3 0 CR 0R00`U<3P@ 0 CR 0R0 S 0`0GU2P@ p` 30S2 20S 20S*x"4Sʸ4S4 S4P2#0 CR 0R00U2 00CS00ä0U140@ 340@ 0 S*1 4$St1 4弹}4S2  ڡ.֡ӡ4DS0@ ˡ10S$1 "@P004SM4 S0  4S4T 0S0Sf ,0 S,O.ooo,Loc0T\ wz[WoXoxZpZoZ oo -LM00 (@(0 tPop -LMϟ@`0 _X0K, 0` 4` <` 0>Ο0Οp0 >Ο0p0 P` ~PH H0S > 0RS ,0S X,00-S \>, TtQ@>D t8>0S H0S ,  .0 80 R@0  D0 H0 S  L 厠P! =0S =0SNP600@0S@ޠ<0S<٠,= p ,=p.LϠD0@0 ʠ< X, j~PS ,00|SO ,-P@/, @0S 0 S , @㦠<㣠= T00,0T|  T,p T/0p0WP<0S a0 S,gP<0S T0 S ;0S ,p , ,0S HQ;0S v ; ;RnL@;PL PH0S \ 0S H lP 0S  ( c _P@ 4 40S pW%,}P:00 l:p) ,00|S D ,70 00S,|  *0S:d: ,\0 00SD:, +O80 00KP0S;0 Z0 SiP))P0@0 @.0: S )0S009 H9@T 0DS0 0S 000DQppY90  p@0 S pWPdUQLȟ80OP< 80S 80S4(T0S,T0S X0S%X07# 0C\0\00jR|7XK |ǟ0OT0ST0S X0ST74077 $P`PpÙʈ70S7 60S 60S/ƟP*0S'60/P0S*6#0 CR 0R00R`6 00CS00ä0R46V0 S:5 W W,`V 0S 0 `]PPU 0p P@0S@0 M]P, 80pS,5p05 080 VP00P0  V[5#0 CR 0R00Q4E4XK 0O 50S l40S p40S X$T0ST0SX0 SX0$ğ@04 / P`L0S 000@20 0 CR 0R00nQV v V 00 CR 0R0 S 0`0VQ<3P@ 4p`P0S CP q|qd30S2 20S 20S*"T0ST0SX0 SX02#0 CR 0R00QP2 00CS00ä0 Q$2400@ 0 Sp41 000@ ,)80 S1p 1p080@<D0SD ߝ4屵r@ RH0S R0S10S 8 d1Rp {00 0,K0 p{K'hil 0$, 7qD0S`0d0D 㛝l00S70 @ 呝<㎝@p [oo(,q0[WXoo  w\zWLP(LpTpdpppLoP4 0@P@@80S 00S08040S4l 0S0S@:<7 -LM0 S 01 `0, 1 a 0 S00SS  |0S$ `͟lP HP < 5>R00= =0 >K P 0S S0 L<0S$ L0S la < XyP(:$:a?B1cSQ8 PUQ  U@ 'jKiKKgK qK mKo/K=KnOK@ PW1S_1S\1SY 8 t!1 (,10$10 < ȟ4<K^ 4"<  0jKiKKgK fKeKKcKbK aK$K(_K,^K0]K4K8[KK ğpL0DS  p1 P1S00 0Sd >KP@0S S >K  P >K ) ٨PLC P030 >K ¨PxXC0r/K1 帷P@S㔩PQ ZOK3(`K0S S 220S3 20S/H3(KKoK\0P1 \ S_K <@@P"P 0nP R `2 0S82  <2Dm QA Q^ ^ 8 0@X@G)0@0 0  $         $ ( , 04<8@@D  ! 1S0s`0a 0 \^$1  0S >K  P X@0P00  ,0 S,r&xpxLoq4qgfff(0 T04h -/L`dPPU1 1U_U/0p0W 0tj@+etZ.0PW0PdZ 9X0l0005Pp 0X0U.S100E 00EPEW W[Dtd -LBMAq0 S P q10S1  RAnK `F`F0X!P贇0 0YP0, j 10U B>K 0C0$  0 K(4 0BK @@ 尨Pʰ00S0  FU 0K0 +PP@00S 0S8 "lt$o<:t't -BMLM(7$'$70 '7 H , 厅 'P  0 S606+ 6PP6@P6vP6fP6Ȇ@6@@PP6 6@6@bP@ 0S sPP lsP TsPP @{sPPP,(6(qsP5  6 &P 0S50U0S 50@T@PP@ 0S KsP FsP AsPPtEl5P5  X5X P UI P c40NBS񟗓Ȣ Т          ܢ                                  (   4@Hp     3I#00#0F3;0 0 0 ;4303 3 <3033 rP#h3% '2 2\3 2L30 rH300000S 3M 3 g3  l2 0"Hp_2202 2l0 2H H gP ZƷP BNK@D@D+IrT2@ D崔04SBH4>P 10H P48P@ 㘔 㕔H@1 0@$ D4 < 8 4D 0CKdAA A0QS R  1h1 h冢0S 1 (P@@T d a@j LnLuDntx0,\uggdu0uuvt ttuToC 0u|$u(,_@<`Tu ,d dp[<`Pp@-& @`QP 0R0S  0R 0S 0`S`PQ^pppj p-d d0LM\` X0X PPP0@T000p, p@-AaP0$S!S0S S001  00 h!h1!Qp0 S S8  S0S00 S0000 S S S "S \S0S 0 0S "S P00P p4 0S00 S000px  -PLMp(M1@ 1QQ! ae0p2V*Q 0S 0S H0`2V: iYP@U@p`0` l P \<e0< ePEUuDo<ujv vT3OK0ua2g 2crB0@ #? 2cc#aw0S0S%NK/ ^PڄŸ0 S 0S* m@ j@" <2S b@ _@d"`zN !PJ1P@E%K 0 %K Śߘ1Po0uv 8@ 5@`0!z ,@ )@`x!zd1OK0uf2g2crE0@8!?` 2cc,! GzOKQ 0mH~vHP 00CS00  ä0 _<(,0 S,.AXo|TQ|vx(Yxųxxxxx,y -x3LMp 0@@,0 KH3H0b0P a  B=9 = 0 P@ / E0 K腃 KP@/ wP @K .ᵃQP0吠KS0SLŸ HŸH2@K00 YY~/ ~/ "ŸP@Y00 d!py\P 0SL0SI@K]/ PBڜ R>1 P@@PR50S1:PP@ K ͚0 @Kǚ 陙볗 1@o0ef2f2c BD P 0Ϡ#PE0l 2lADd`0 @y@K0 S00X<@,0 Sh,.A>P?vf"~XoųH~`~ -LM0`V *0羞0`YV@: H1 ᓺPUP@{`VA0S,0 :p0AT0[ 0S :000CS00  ä0# : ᅞ P@| 0 @0 C\0\00: T,0p0S,0 `VT -L MD00 K4@@p( P0 1[SP00@ht@T -0L M@K 0 K   -$4LXC h0 t D D < -L0+ \D넀 -LM`PcP( @(K,pK 0  (0@Sg -L M0@p00 0Sf PP 0S nSW =*cP0`0@Q @P QIQG  0V0P . 0' Y0  0000V 0`0 ,KC, ?R0S@p @=0"Sl 0ҜY000 LPH00D 0oSP 廜Q-0N. S$ddxdxxxxxxxxxxxxxxxxxxxxxxxxxxxdPP 0B00RQ  Q 0B00R -MLM`0$0 bNKL2@DP+d P0P0S}0 0CSxq0 %SnPPh0SX PR 0K @88 妩`^KPE(%PI0H0@T7 (%P@T'T$0 05R,AP'00S# 0U 0 05R01Sh0 05R XR D00H0Q@ d  $0S$$qԀ܀ -\4LM@P  mEoE'P#(8lllllllDllllTlll\3 3 3 3 33 #pc@30@cTQ\)dcP\;#  aP@3# s0S0(0$#p&# Z3  CMPa G2 0000C<0PiP  PWR 갷M X|tLWő0SH. D>W@ "42p, " $呯PP#劯PP" ,K⥄p" (,,ؕ(1" p@" zHAǕ 0H0Q   Sp1p0``!kBT刑pL" Hp@" 0P 大P  -PP5P ~"⁒0H 00E 0 0C qqq4q@P\Nqh| X́Ԁ w_,- -,0LM$@ VVS08L p-LMH P0S 000` ph`H@s,H0LH0000 H04 H 0 &080H0<`phq -LMH0@H XD0,0H00H 00(0 H04 H0 &080hq -PL}H0`@T Vp,vl 0S`0 ^W@H 0V0H 00h1HS@`H 0 = 00H0 00}=0H0  00'<0 0H 00h|00H 00 H04 HD0 &080H D0,0hZHtq 0-LM(PH0 ,0@S 0R⋲PzH00SS S Sq$0#!+P 0h!H0 H0@Pl100 $H0 0S10H0 0;S<00H0@2S0?00 w$H0@ 2S o$ 0/"/0B1 0H0 000H0 0S10H0 000H0 0S10H0 00 0H0  0S1 00h0鈂tq -LMH0@<0 ,H0HP  P !1P0,aH0Q 0SH0H0Qi H0PCH0 H00H0 0H00 0 _"H0 H0 0@ c H 00h 갂ȂЂ؂Ԁ 0-H0LPH D0,0H00AT 00 H0@80H 040H$0 &080H 000h4q -LM0p0S"(0H0 &|0PU  `$@0@!P 00!$h| PUhF, -LM0pS S S 鬀嬠ꨀ娠꤀夠(0H0 &0PU  `$@0@!P 00! @ m> PUx$0$<,D -LM(`PH"2PppQ, 0R 0RP@$0! 4 H 6;0S &0;0100 S+h0SH0@T 0S ⼰Ph @TfP@lh1S00000H0L<0,08,H,1 &P 40PP^p _  ኰPH000H0@H00S 000SP00H 0S@  0S 0S@h0 0bSpWhI@ |8h\$htH -L PP<!-1`0 pR y P@8O 40 奤0 804 0 $ P@D Z0 0吤1S 100,0S AP P@$) @ ,z$ 0@0$6 P@$`1S 100l0S + P@(P H @ lN( 004Ѓ4X 0-LM(@H0 ,0PS/0 S (P $H00SS S S$@ XH0P0S0hH 00(H 000hQ0逄t -LMHD @24 0bXP@m0S 20S H <0S0@<0H<0S 6!@0 <0H0<0H0<PTH@ 80S 6!0 oH0 880080H`Tq 68 0RڣOoH0  6@@8@80S 6!080H0 &804 0 S0l080X8#8#$H@0$ ࣸ$H0`$p#Y2 !4H88<#8h&H\0%0@@ H0804 mȄЄ p-LMH0@PH 0S 0SDH0a 0S6 0 eH00,6H0H0QFPH0  S00H0 0XbH0 0@000n<H Q0 0H0 H 0S 0S R0 0H 00H 00 0H00S UPS|H0QTnH 00H0P & 0D00 zph-4؂Ԁ<\x  -L M00PH$c(0 04 SSpb  6#0WH 0040S<0S 0,Q PH0 , < H@0S 0 0RpH0dH0QP DwH0Q,H 00u80S 6"0 wnH0 8ᴯ80080H`! 680QڣOfnH0 8夯@@8@H0S d1 80 0S0`0808K 㶰H0SS 1 0R0040 070K080KC<3K0S0``0S3 W08#8#$0$$43[4#DHL0$H 0H0%@H 40880  (0S8( tȄЂԀ؅ p-L MX`0P#DHL0$H 0,H$0%0@@bp -L{KM$pGBKpGMJP`@*J%@K,+ (H!@#H5.7%0KT# @ @P3L 6,  `3 #1SH  60<S  60<0 6!0<0H0! 60<0!0 0QH@`@ 0 ``` ``/H 5KSK?5H 0@0H 0A0H 0B0H0C`H@OmDH0dH0dH0L`H0P`H0T`H0X`H \/ -LMBKMH0P+p!0KKK╯H @D@Dd"@⎯`H5.7!0KP#  `P3H 6,L3 `# ` R00R0S5 _ 2>  \3 ` #1SH  60<S  60<0 6!0<0H0! 60<0!0 0QH@`0 @``` ``H 5KSK?5H 0@0H 0A0H 0B0H0C`H ,0D0H0dH00CSL` LH0dH 0P0H T0H X0H \ -LEM= K MBK@P+Hp!@C>KH`L3 F.KE>KH3 p=K @0$ P H X3 @D 8 ,t (t $ L D < 4 6=S F>K,3 6=`4 6=\4 6=T X4 @@0 @@@ @@ H 5KSK?5H0@pH 0A0H 0B0H0C@H ,0D0H0DH0DH0L@H0P@H0T@H0X@H \ p-LMP$P(P@`40S8`V@Zph p-LMPP @7P-{8`0H0 @T  @TX0H0Q c塉0 ג0ph雯q -RLM`P`B0S00ڳ`008r0S,B,7P 4N00A.N !N 0 N( RN$ RN,0S N`@4 Q 0 8l!0"`M`V@E 0 @ v> 0M E 0 v>  0MD 0 v>  0`MTMi鱞q(4H`tTs؆( -0LMQ`(0 p P ( 0$0 (000 0 - PP1 $K >  @(K9 ( @R 2 @b,K0 ,0 ) 0, @# t$ 0/ p ,<H -0LP`Up0 H0d &H@6SsH06S {WH0 6p H060S H0ƐHH H<V004 H6H$ 0h0Xv -ML M 3 P, #0H< 0BS:@<KY<0@pK@0 @G 00T`K0T0 S$ Dd0"H1 S@KHK0hPK0h0 S XH0"H(0SHx"$0SHd"`` Pg H@ &PN 40S0@L 18SG 8@4@H0 &0@冑9 40!1YsNK@D0 @DH08 64  64 1h1YdT1`"PsNK@D @D8ǝH0 &40!ྜྷ0 04 R8@Y ZK'P  0  0HR7`0V7 P {NK@D @D0h i0X H;,0 S@,B\ԇTs -LM( 0Rp80 00 40  0 $P 4 Z 8 0 K 08 ,@K0!=0 , (0  P40PU0 Z2V@!00P`(  @ !0K0 @(00 @4K0 @y$04 @s8K0 @m 08 @g@P4 `804 @ZPU@ZT,B(0bp; ,4<H -LMU 0P00$0 P P@$pK   -Pxt`9pd 0 0 $0 ]$Q< 0 S0(K Q(,<H8P -<1L(M44PK0(  "(` U1V H0 &v0@0 @P @08` <0 @pKH@ D 啌PPL  LK0P00P@@TP pL@ HK )PVH( 0L[R0(l qx -L M`ҍ6p0@S 6  +FP610=S 6p1S&P ,0AW2PHP@FF`FV6 1 V囍@ ᘍ0@@@61SF @0@$S `S<~0T\ : w@ t0@p6@@ 0  h鸈< 0-6P0LS@ 6&016P1S060-00S ^0 0-S_0 000S0 0 p-0LM0 S@PTl`d0P@ܻpT 0s 廻帻ڈ00prqqD -LMAP4 8 04 8`{@U\""\"""""""""","\"\",""\"\"\"\"\"\"\"\"\"\"\""\"\"\"\"\"\"\"\"\"\"\","""\"""\"\""\"\"\"\"\""\"\"\"\"\"\"\"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"\"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"d"\"R@TdpW 08 0 Lpq@- .0R) .R@" .SABaB00B\Q T00.T\ABaB 00B^Q S ^Q00B-R S T0  0-LM@P P00B.R S 00B.R S0S0 S0 S K .P 0 -PLMpQi@'0T1* Rr000000S  0RQ 0 eP`F0'S"S $S `S \S`F\000`F0@0T:V00$ԉ p-L M`P᥉p P ,0@؃幹嶹峹Նӆ PK0  ` 1Kņp@O0<ST 0 'pq  -LMRBy "ŧ" 0< 1<  ̌001P  001` P \001K/ p!1`p 0l|0 00P10!D1  81  00P@ ,PKr0s  h8Ջ`P@H0S bH0H0S4 0Hb.]0H0 6S LPPt$ ,, ֘0H0 VT0Pq0, r $\4P- -LMp@+d0P@ K r 40R ,#wq\T -LMP pK`@ @@IP񟗹H+\,\,\,\,\,\,\,\,\,\,\,\,\,0,\,\,\,\,\,\,\,\,\,\,\,\,\,\,\,\,\,\,\,\,\,\,\,\,\,*\,x+++++,,\,\,\,\,\,\,\,\,*0+\,<,+\,++\,\,\,** +\,\,L,P 0 Pl 0 1(P 0 P 0 1W \V ,,+U<K,r  k0VMb@;P 逊 Ԋ -LM@$`KpA?@0CSP ABAQ 0($yUP# :R :P $p l0Ph  $ RPD$y(Dd -LMPp`$K 0PP ڼ0p  PP@ 0$,P @T T @` V y ,P ;P @Y,($PTsЋ -LM@ `KpV 0P ,H0PS[ H0 6Sh C {P h%OX e r }R H0 &X( ( p-LM@POPpp|`@T ~OP @T\P@@  \ 6 QO00@p$-L -LM@bx0PH0 Hb.hx p-LMPPH@`c H0 64S H0 H0 ph鄖0 -LM@ `Kp {P <PP !ߤ00 0 00 $0  0s$ KP }S b $P>H0S W$ H0PH0` @T 0 S  PV$0 H0  @TW$  H0 00H0 PH0P 0 S  0R ⒡P$0H0 H($0H0 0 $0H 0 0$0H0P4Ȍ -LMP `K@p$  @@:PlX5,55555555555555555555555555h555555555555555555555x5555545555D5000001 0P' &IP!, ($ 48 K ;P  -BML M0&K0`HL ,0 p PP@Pt p PH!NPP  .P@HT s p PP@p PM;T p P\AkAH PHQ  . 0S 0AS B0C2S9;;;;;;8;;@9;;;;;;9;;;;d8;;;;;;;;;9;;;,:;;;;;@9;;;;;;98BKAA+g p K@ 3@PHD@0 S BK@@ H媔p0P4 CNK@D@DUP @$@ TBK@@py K@ 2@P CCNK@D @DH  0_  K@ 2@PCNK@D @DH 0L  K@ \2@PCNK@D @DH 09  K@ 2@PP1p  PPPU g;TK HH)P H)P1 (K H)P H)P1( KPCKA At 0S K@O ,P00ARPPU@;P 'Q' EP4 @PLA 0L$10S. L$ 0BK1AA ۓ 0Lq0 ,0Sp,4.XT-xč؍;< Ph -LM0pS`P P0S P0S(K 0P( aP@ (  (LU00@@ ,P00Z00SP;P ܎ -L M⼠0p(0 <@K0S $`V t@P0@K`0P ,P ;P <d (0S (,4 -L[ P  -LM@NP00@E -L0Mq0@HK 0 S-PtO H`VA 0PU:KP5 0S 050P0 %S$ DK<@ 0R D0S 0PP  gK  ̒@0DP00 0K@K40 Ò`VD0ST 0< ,Hb. 0S iL`ZHC|0  -2LM@pT @pT\P` @TP 1 0R 00 !00@0c|!S0"c1QP@T Q  D1RT0S000000@T^  p ,0#S (0S1K ,K@T P0  0Q0  d0RT0SL00S@PT,0 (-0- HC܏ -AMLMPzK @(pG F0S 0 0 B 0S 1S 0 l 10@  ,h鸒 -L M`V Q0, `*V 0X  Xxp000 0 STAT1 D1D<1 0R,0$ 000o08,0Q4Z㔛P@0  W4@0p0P@x0 40 D0 ?00 000 4<4@00`V S:0,  0rTsԒrLd -EMLM`PR P, *Kp\1@ P 1S  Ƞ\E_LPE 0S@PtR UZ#VK500600300V800 Q AUK0KSJOX 0KSJO ܍A Ս0 Z@E⩐0 yKP:K(H\!0HV?K c0EPx1`0  ᲍@T @0전0µBz0P40 00 0 ᝍZP @dTl ᒍT @0Tl0  @0Tl0 きP0 V00S @e, u?T  @0?Tl0 @0?Tl0,0 S,*PTcSc -AML MP, BK0 @+44 8T U\4$84p!RP BKL1SK`\ 01200tS< ` < V@T 7  V00U@0S0e 0U 0 S 0e@00S@T,$<4Sp@ T 1 F ,0 01 `VP8 Q8 Ts -L4Mlǟp, XP T Xp @gY@8Z,\   G \ "00 S T0S 0 X 0LKX 0 0A0C3SgY|ZZZZZZZlZZZlZZZZZZZtZZZZZYZZZZZZZZZ|ZZZZ|ZZZZZZlZZZZZZZtZLZX 0 BT0 X 02 QP0 0R r50000S  Q QT  x0: p 0\ T 0T0 t0 0 K0K p pp0  "0 0Sx W4  0T|00 W00S4 gTP ሙT TQڗ Q@4 aLT R ZT Xp WL K0B0C6SX^^^^^^^]^^]^^^^^^^^^^^^^^^^^^^^^X^^^^^^^^^^]^^^^^^^t\^^^d^PP"00 0PET1* Rr200000SP 0RQ 0"W`PE0'S"S $S `S \SPE\000PE0P@ 0T:Q"00PE00P2 8 #" J  DPb 1  0!WpPTP`@/? 08C8+ 08#8l!WpPP`@<0D!0K0C 0C1 BS 1S@T0 ,0S,\Ĕ p-LMP`×P@  `pP0-H0@0 80840400,0 D-P-<-?H-@- -0 0CS00LӤ0 ^00# P 0 000t0 00p PQQ8 00C 0000H-<-? p-LM@l1Pd1` PP10S Q q041 0000S#Q"Q0P0`pQ q0 00000S-Q0P0`pQqx0 00000S X0PP0`p80< P00`,0 00p4-L-8- 0-PL0@S| p0 h0R`0 X0 T000y40 ,0 T(0 000L-<-@-8- -LM℠0SxpxxPx`0 0 S@^L0 D0 @Y(0008-L-H-@- -LM@p P p-LM@`Pppn UP\PP "P H0D0@T80T0Z@D0   0p $ -pL`P@xP000PP px0000D0SX0 L0@T<0T4 @D0  0P -pLPBo@xP -P_P p0 00000S0 pt0 000D\0Q`T0@TH0T@@D0  , 0h X p-LM @R`pRx90000ӑa0CSTiTjjJ4 <DT`t/Ȍ)E Ě-x ė% 5 --LM 0 /0@l !0S X)wP 㑕L ㍕@!0S 00)4("q wЏ --Lt r0\ \/X0XH !H080S v$ Z  V wq --Lt I0\ \`/X0XH l!H080S v$ 1  - wq --Lt  0\ \7/X0XH C!H080S v$    wq -L`@Pݾ pR %R0mS 30@ QPD"`@`PT@D ń R00 w --LM@a 4A010$!$Q$`P0 !. p  0PS00  c 00S 3v 㛔 㗔)v 㑔t ㍔X0d  B⇔P ეH0 L-D-  w@-8-Qsqs P- Mp-L@M`P@ 0K e DKa0 D0RX QX 0 00T K0QXK000 S p$ Mp-L@M`@P 0K /DK +D00P0X0 XKQ  0 0 T0K Q00XKX0 000 S p4 M-L,M|@  (K  <K(<0 \$K8KoP 0 S D M-LM@  (K σ(0`S X$ 0S880 T< 0SuL\p@-\@ * "48<#P @"@"\:\* 0P @"@"00#  p-SLM@P` (K 0S  z0 "KS  m 0(K 1Kc000p -LM<[ @qq/P@ ,q, 888 0`0U8Q" ?P ?0> `qB8 8 0@8?>qG388@ 08@T 霨Ȩ, -LM`-Q@TpP00S xR@ Rr100000S@0w @ `RW B @R7 B/R0 BhhR0&&SX0 E0220CVT T !X  X X BX U U U 0f0fifii(U U U `!ii$X0vd -L0MPTpK@PbT`080 P@VTT2< Pv>@ 0C<0 Ş/P@XGP@`<?T=0@@0 /P@4 P@-T+0D0 yP@"T 0H0 n:P@hP@T0L0 ^:P@ hVP@ L7;T`T`0P0 0` 4` B;P@ #M<@E0L!!!?!C!c,B^ B^DHL@PP 010000012c12c1 C @00012c12c1 C @lЩ@`xT p-LM`@T0 |PUP0`0p 0-L@0SP ~0000 p-LM`@ 0 cp 0P0 0U_0PuY0#S U0S R5;mk0p -LMpP` P@X t`Pd00S ,0#S t  V15 1;  -MLM%0KA ,0 `hQR Q *Q 'd8 SiKAA ld8 S:qZlPP <PPXO l(KA Al K+B 0d(0Rp8:s8pP@ P@- p({">K0C0C#8 Gd8! Sl5;h#cKA A]t(d8!M@S:rtP P t( DKA ?xd(0@R:qxP ŊP| x( &KA A |(d8@S:r,|Pp 㧊Pp |(PゎKd8H@ HS( ;KA A01(81(Rd8@S|:r{0P1P (PUڈ< 8 9 75P(1S>K0C…-PU+d8PSjr 0 ( hX d8 ZP@^ KA jPVKA A aP\MnpDF<C0 ,0S(,44,<HPt 1 P-L@' 1a 0Qc 1 EPVP Qxh!0 'PTP ?3@ 0O  q0 Q@L00P 0@0CS0@0 03 00CS0p@0 02< 0R2233D -LMP)PpC 0@ S 0 S`ev 0S쀟쐟0 xPP 2i :`0$0O` P4f@002(2 C 鴫233īD 0-DP@L,000 @@0 0 0 05l4d0 S- L 0S S 0SP S  2ܫ p-xQxALM00P06T1 P!QP3VU00GUX $ 0nS` lS0 P 0 R0 ,000gPc `0pS`0  qX QX} 0qD=0  00Sn _Pph L= R|QP=- PT 0nS` ElS0? P 0 R03N0S!\  \0S \>TTTWU 0d HP0P > R > RqXG ?;`0pS`0+? `|? R$! 0nS` lS0 P 0 R0u|?`0pS`0? ? NPD010CS0 0nS` !lS0 P 0 R000  Q0 P|`0pS`0< pP0000  \4x4 l4̯ -`0` LRTLL0<SS,0 0Qڄ0T4P4x4ܫl4 -LMܠPp@* W* 0 0S@@T0TbW`CPP l0 R   0埙P 0#T 0EE@5l4d4 -LLM0 R8Ÿ" 0 q00  R 0  R1 A0 Sd KP& 0!S] 0SWʬaQQڌ 0  Q @0 0 0 S 0  {P,q$Q0L00P 0@0CS0@0 $0 00CS0@0 0`00P @@0@E\4T84DX4 -6LM PR,P l,K6\@Pp P,0 Q@i0! ( P0 S 0 !R %R  Qd 00P0\ST 0 R Rʤ5 $e5 P %Q00!Q`uTş0 R`l004P 0 0CS`0e0 |80x"00CS0D0e!0 0 Pdt Q`l000P 0$0C`$S0d0 =|00S? h@ P4 000 S/ S- @PP pP `0S P@` @@ -oP|0p p0PL@oT,@P0$ \4'DX -LMq@P0S S  [Rb \RZ 0S  S0匡Pc Q| ^ `1 @ RD1 0o(0 Q`l00P 0`0CS0`0 000CS0@000 SH@P@(\4d4Dl ^R ]R 0]S S [S  0]S S]R.Q =Q:Q R]R 0 S 0R]S -PLMPP0`@p T/ 7P* 0 S0 S00 10BS gR  00 p00 PP 0P0 P \46 -SLM p 0%S 0 R ࢟ Qx0  P0 pg \PG 0 R Q0"plR Q@L000P 0,"0C@$"S0B0 000CS0A000 R0 pt1 RlA8P X1 0R S 0`00P 0S0BpG0` Q@L000lP 0 B0R@ q@0k ho0lY00CS0@8h0SL(@00Pi0F\45 66D`4TL4L -2L M0r0l^L@4 , 0 000 00,qP`0 0bZ4 @R  P8(PnP!0@00`T@T# U T00CS0@0 4 @ 4 0 zPP00CS0D@0 0P4x456 -LM " P2 P@" " q ğ0S   ?KُPW"R 20R2 84bPU$0S4 >\"0S \ 2 1    ?K媏P 3 `d 0Q,V,K 0S 2Pß0SH#  \030 \\ 0 0%rŸ0 QP\00P 0"0CP"S0R0 W0SP00CS00B0 B0 0o࡟0 Up|00P 0!0Cp!S0Uq0O L0X00CS0$b"P U" 0S  v[0 K9P0x 0uꬠ0 Up|000P 0d 0Cp\ S0Xp0 0" 0Md466D -L MH0 @\, P40 p( 0&S \S~ 4@TM0 P0p 0cS3 Q 00c Q@L000'P 0t#0C@d#S0\C0 n*0j(00CS0C0W0Ȃ T`l000P 0"0C`"S0xb0 30/<00CS0 00S|9Sz400CSv02 @`1 d Q Tq, 0@TPgꔡ Q000塿P 0\!0CL!S0D0 000CS0x0 `@0 dQ T2, 0@TP(꘠ Q000bP 0` 0CP S0H0 e0 6 666D -LMؐԀdP`01 ^, p@P+P@ @q0@0 A0@0,A0 00j(@@8<4D -LM"0 s8 < 0s BВ0S2  @0T00@D ڄ0r 0S$p&&&00 00 0 T0@D0#0 N @0?T@Dڄ0qa4PK0 d 1 0C 0 d 1 0C @D /\ `Fʀ1 R!PX D0 80!0C,!,<S0(A0000 00 0@D0 00 00 00  00 00 N0G@5l4D<H44`4 -`L0 0Cs0 p001 R 0p 0Cs0d0d 00T T00@PT P0@޽T<45l4@D -LM@`.먃0#sP 1 0#{wpP H0@*SHd))))t)))))))))))))))))))))))))))))))))))))))  0 1 "P00Pp2W00X2PH2D2 @bTaz("0S "0S n ! 0 g!0S ZY OV1 Wt1@DStQq+ PP*I0S0E= 0 0!K⻸pp-0S?T%w  r냿!0S 0S  BK➸1: S 0S 0S BKVp0: S.  0 0 `eJ^ H_J <fv$6 6,6̰T8646ذ(606T w -LM/@8P 0SP :0/S P:0/S @P:0/S@P:0/S  -0L|MD$ yP  00 zPP 3S S 0S4 3S0S$   ` 'P$ $  0 pi/S @ 0T/S/0000a`0 SHD7f0 V`Kp 3S @0 Sr 0: S 0: S  0: S> ( S  S QP00x2 R QP Q02 R Q S  S S- egQ\1 R1 R 0S 0: SQ Ȑ00t\!ePAPDLe *{v 0S e@ 00 0: S, {'0: S#0 R0S @0f@PM3S0@0g tzeA S00 w0S<W6 1 R,0  !0S SCQCPH4*pKQP  0R1 !\P p P(C&Cp|CCTLQLx@R0Sa  (D,$$6,6T6 w86(606 -LMMpA^K PE0PE` @ 0 >p 0T0 PxphP@BV;   wP Ď0S @0<0V$ RP @㮎0V0 LᾏP 0-S xl@pL0S LD>4d IL ߒ@6Mbdp| -L 89@Ps0 R  Ē 0-,@,PL $ 0Բ -BMLM;;BK@(L; L , @0gS0*K`t[K⼐帐 p00\0PH P40 00(;  0uS0nS0 0 0BMK(@D @D P  P[K@ @Z 0(K 0BMK(@D @DP B}K0(pG(KpGp 0v3P@ ?hB]KBK0T(PE(L4 PEL # %-*01`3P@0C0B-K( B BS1`@ 10DES񟗾=========>>>>>>>>>>>>>>>>>>>>>>>>>\>>>>>>>>>>>>>>8=D===>==>>>>=>=>>L>>>>>>K@@ - 0DqobnBMKxX(@D @D 00Sa DE8 /'P,(NK@@ Mȟ0 0 0 @ 77BK@@+  P#%* K ,7 (dWKBMKL(@DL @D0.S 0.  0 l b 007   ''000 &6PPqp@060Xap6(K0&SBmK(`F6`FK00Q0 6   U@!0-S 0<S46 10005 @T*K R 50XS5% 0X0KQ000 0SڨJE0%0s 500 tP0ia3P0C SI@AAAAXEAAAA40Sa  v0S'. B=K(0C 0CP KAA> P NK@DK@DLL$0 P *@P@00: SP X  0Ha@00* R 30S R30S3#3P PC0S 30SP a0S BK@|+@ $*K R 0BK@S@ +P20S`rNK@D"@D0@I P! !%*Ÿ0S#BNK@DK@DAA♲T2Ppp0SP8: SNPI KW  8: S:Kq0S 10S10S p p1BNK@1@DQ@DL! 0 P P $0S3H!0S/@H10S(RP$ 0SdX:K0S @P 0S 0S 00S ˏ ;` tP``00S W0p:t:`:$ؿ(|@MH\C l:X:|:\:h:Tx:оܾ4PvpؽFDF - L)`\ -LMK ӱP @0S  [0R 0[S 0S -ML4M4ğ p0, )KP0 `N P@30 SJ30S |PP 30S P 30S_M>xß0 PR  0\0P Pp 30S2>3@T KL" SN)KPL20SKL| `P t20Sl IK(@D@D))KPL Uʥ?Z00S 20S v0S  q> f_j0SYK(PE PEP Z10SxP_|1 R1(K0|AS KPP1(0,  0$   0S H P00KLq =P Z00SZ#00S (K0S KP(K(00  h00S )K( B0 0C00(K B0  ,0 SL,׷\: wl:xp:\|:ȿ`:X:Կ -LM<0`Sp (10S$,0!(PϠ ?BlD3c0K0 , (P $0 ]9P0S k0@_k00 0lGP 0Sl0;0_PDLQ 9P x:p:Mb| dp 0-@LPOP!  PD|000CS00Ӥ0,F Pp@ 0@ 0CS00Ӥ0F PpyT0T -pLQ  P@ XP0@S P`PD1SQ, -Lp@`PU 0 0f0@L0Sr00a000 Pr0000D0 -L$MB0, S`20SŔŶː0, P i t\2P, 0 , S 0 S0 00000 r 0< 00  P0K m$n/ ;0 W$P^$ @0 ?@S$0 :0 <,P@0K0<0 p50( 0@<0@ 0@00S(R&SŤ:˰0000P$T :P@ $0 ;0P@ D0pY@T6\:P`<6D6L6 M-LM01, 0p`S  o00S P# n:P@ #0 |;,0 txp `0pS  0S P@P@0 ,0oY@|:x:t: - 0LM@ x0  -`QLMW0rSwS ?RPPU Xχ00E[P@> 1,PP00PP4PPPPPPDP s0p000wS  @0P` IJH0090囇`0wS  0  P  @X@H@L@P@T@P -PLM@P`(0S 00wS` rS`U l0 0 0\000T0000 V:`:kT@H@P@L@ -LM 0K# Q]P p-LMD0@S PH`U 'P)ѭP0 D0 ` 0C00  p 0-LP@@0D0HL0 -RLMP` @10@P]T@TSQT1Tq 00 @0D00@Dt p000 V@O@0P00 V4|p V00 0P00 lpX  ec8 000DP  O0 0dH@L@ -L Mp@  T,KPt $+K*K < ^' K)K&K%0K(K  ^  $ K` 0# KT, K< 080  4@ >0000 T  <K, 0 pS #L@X -LMD0PSp NRL @T 0@H@)٬P0D0@ P`.  gp0P  00P  00$ 000 P@D`  `VD0S0S$@  g0 cP@L@ȠQ0@-,Ƞ@P 0RO @!@1UQPa30 0  0  0  0   0   0  0  A Q @Q 0Q <0U'7cb2" cb0q 0S 000  b0 QŒ00 , P080!Q,000SHfX6D -0L0SDX6 p-QLMP@`p00SV@+00$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$01`FV$D#V 0 0$01`V$D#pDX6P@-P $ R΂R@ p`0P80 D  $04dH p-RLM@` @0S01RPPU pPp(0 PS00P(0,0S00,0| (PpVF20`f$00FPS0,0$0p0,0`ph,|@|0 0P00D0 0L00H0tt -$@L,0pS` P0 (P, Q 02 0$(0 `cV:,bwJ 0$00(0(0,PcUP!f hJ`V ,f aJ 0(` (0 0S(0$0(`S*0$0 -PL,M4 8 S $`VP 0SM 0S0SG0S00440@  < 04pD H L0 0S1@cd\dddLeeffgjk@lLmmnnoooo0S0  WZ 0JpW0(=à c0#22cPQ0S(0 0SpG  4p008WZ 0JpW(4<(<,4<04p8000 0S  40808 R 0S0pc80WZ 0JpW ⨀0 pGS ee$e,e0  00$<4 000(pGc0pcW8Z 0JpW;((8#"(R p08 08PU~ @ U P!UP!Uy  <iI80@ <0e e e@ < 801 WZe 0Jp W⨂⨂;  QT X\(pGP0`000`0TS*WZ@ 0JpW`: 0 Q6`威pG:`Q L*00 0R` R. 0D L0d hd0L PP 0L 0L` 94 094 000X0  `0S*L0 #D B ,K H+[0SZ0Jp[PW*Z 0JpW:+0[` pc8 VP0W*Z  0JpW:` +0[Rpc8 00P(pG*P0W*Z  0JpW:+0[8pc0P⨁pG0W*Z  0JpW:+0[8pc0 P⨃pG`X 0S|PEu  PE0u ` X `0Sw:0S6 R 0d@DL0dX L_h0PPL Gd0XH00P0\ 0PhPP 0L 0 64  03L 02D0C0,@K -H+0[SZ0Jp/,0[S ,000 /[0 [0 20C"[0D3  H/ [+0[0SZ0Jppb82[+ [80,0[pbS80  0@54 00@0 00@Q W*Z 0JpW:018 0C0 8 pa8 00P 02H0C0,@K G+0[SZ0Jp,0[,000 /[0 [0 20C"[0H3  G/ [+0[0SZ0Jppb8,0[+ [@pb8&2[ <0,0[ 0@0@Q W*Z 0JpW:01< 0C0 < pa8H$0@< 00lR0034 0f@Qt H <0PaS<8P c ( PeU 08Pb,0e0eU P@80UP!0ee80@ 0<PU0< 80S@ RK 80< B0< @ 030S4 WZ< 0JpW4H@ l0@H 0Q00 < H0c 48(4<,(<4 <@SH  14 000p00 L 0L0 <4@ 00S4p0S0H R 4H>P 0040<@4p04 HpPp`De0@ Hp D 0 0RW0 4 H g408 DpHQS@004 p8p  W 043R40 LPL LB̿ -PLM@ $ R ,\ ,0S0 0$,0$0 P-LPp` $@T 0S  a ^0P P 00 ,VbAF 0$0f 9F$`0 0@-0@SP*S\\0 ^0c0SP:0 -PLM $X0S40S0S 4 00 cR0004 0 ,0K 4 00 B#4R004 0``0,K `0@ `  `0S  @`p0P000P0 $ P 0S40S  0 -Q00PppLMW@$PU (\ ,0S0  P` ,0S  0(Pp0,d tED0H d0e ee0 WD0H d 0 ,#`E,p$` -L|Mp t x0 0LK X R *t0  0 Z00: | |LK00SP| |Y!Q@x ,@K0P00@0,0K|0 2K+PKEx0 00E|P00S@TY100cQ^XQp RW 4[ 0cSS06KlK 0 Xj0K Z*t00S 0 000峠 Z:p\ \   #3̠ 0 ll  90 L3p\00x Q00 S0p `0    00lQ0 +0K0,0KK `0,0KպKځ 0,0K0 "K0VA Pd7 ,K zDU H0B @T0DLK p0p0Cp0| XB 00t 0ᲀ X0^ \  0&`l|0 R0 *00cQ`|0 R:L1p Q00R00S Cx0 a 00 0bC10}@0 W,0K+K"K# \ 0S x  +K07  ,K D H0B @T0DpppWx010 JȼP 0`H -LѨ -L4MP`)' 0oS000 0gR   L0 0mS000 0fR  p\ X T0 H0 &[bp@H0@ 0SB~H~H~H~ ~H~H~H~~H~$~H~H~H~H~H~P~H~H~H~H~H~H~H~H~H~H~H~H~H~0~P~<~H~H~H~H~H~H~P~H~H~P~P~P~P~H~P~P~pp pH  L 0T0 0SD Lş1 -R5 0PcUa.H QP T0S4WppZPp P @T 0 000CS}00,K 0@|0S0 ,0 R0 l @ 4@ `P 1ePP `5fP@ 30C S,L\\||H RK 0S 0S @ R4 @4 L00L0@8 L00L0@ L,P X`0S @0SD RP LQ 0S0ST R X\ P.P L0SX\ C:@0<2 fF x`mQ0S: H`aQ0S}T 0!R0[|0Sv "Q4K8 K0KG-P0 #80@ 080 WPU+ P000CS>|,K@ P@5|0S ,0 R0D@ @0 ; \ 4L P"|"002P< @@ )0S :@PpP b\ 5X .P@ *pX pL\ o0S0S0@0e0@~4iv0:::: wG 0-LM0@SP HP 0K p 0 R U 00U zP F4 wT -LM0@S :0SK  dp 0 R  TP  4 wl -t0LPd0 R X0XP PP00L!@0( 4P000(::0^$: p-LM` `P0@0@\  0S 0S 0S pA -LM"00Qp,0 w$Ps_`0@0 P`O 4d[$K4!04  PN \P4 T勏K` A0S0 0 (P  !0S0 R0 0  0@ f@ 000'P0S d0 ,0S \,囨0S 0QOPAAAdT -l2LM 40pF ;;S0SQR0SJ R, 0,0  0++PR- 0\ )0S(dP! ?;?00clcQ/\ 0 8&,0 X0000000S0S0.P@0S0 & 0 X@0@@@080   0 0S}zPAp0@-@ 0!?;?0c\<`?* Q< R:8\0P0S000 0SP P Q!0/S0S*U 00SS 0 S /S R0S00LAA  -MLMp0P@AnK 0 `F`F O 0%U0 U 0S l c@!0S D 08: S0   LAX -L@!x^0hFSP7 !0Q0 0 : SWFH` d|Q0 R TQ 0S 00g0hxR!P hz _OXP 4hAXAm@ܼм -LCM0`,$0 (@0A/ K0 0R00P00 P0eS&0eJ/K0P 0 0p 0S0  0A? K   , >U 0SD0 R0 0  $0 S $垦Ax@A 0-(P, L@ TJP  $0 0 S0 000Ax@ -LCM Ml$E~KpGpG 0,           `$ \$ ` 4* R@ R  d$ 0S3 R 0 P, 0S Qy뤃0SZ3 (K 3P\4 4 XT @T40 @TP C0@: S< 0,_ P,0 S ,3 2@.PP 2 P2R( K"\$ XD @A08"X2 R0S @fBNK@D@D~ P@6 qd4 S00C0 {y !0@00e 000p9y `X{ 0000S M0,xs !0SPY 0 PQ 0 QP@ d0SE ~xB< @0S: M7PD X Am@Aܮ(TtAAؽ,DLX -T0L8M<0 0  8 @ 4 0K0 , ( $   H@K$ -CML M☡0PP,0  1Q  0P1#\Q:,0 S @,EKI I0 0`$ @( K@X d 8 \ `0@0 BNK@D@D 0"P  @00@$;D+tLAd܎ -0#LM0$,0 P`P 0 2 Pp@(0S  0 2 ,0S ,劤8!P4 42((0,00h0O0 82 008"Č Rh  0P1OP5~:\z:00/0SIOK,<040#0PS<,< 00L0TO:0082 S0,  0P1OP57:\3:000PS e<01 R -w@@ZP0, P( ,P0h0QO 400Lh08 "i 85@0 L0P 1<0 0L T: 85@0 L0~PAlpA 0)-Lg1!1Q@@ px`0(40PS ; 04L0T;:0000eW+ A 00CS00 0S 0`00D`0` 000`0 ``< ;0 4L T:A(PAAA -@LMT x00C0h@-p0\ ` L00n^@` 4K0CB4  0D0 04 01@DpPÏPoD \ 0 ?00S00X W 0t/1E $$pWR`P1 ,0S ,凢 0 P  `0S@uP1)O  0x Ppz@0 `( B0B!O]u0pt00 S 0l X 08  [D@ 0(@_R:0S:P h0SPAľԾA -MLM0lC\\#, 4 @(  P@[,4(0 B04(  3<  400T` t00\F" $p`"0t/AV#1%Y X @0 0  \2R_ Q01 D@!T  `,0V04 @@U@T Q?>1 D@!T 0 T0 0̀0P( X (0KP L H D @ < 8 4 0 , pF뜠0 0P,0`U0@T UP@XKP 0 T `,0V00rPAAA@A:@ܾ -LM0 0,0 0p:40  6 6< 00`<0 @0R)0S&6 RtF p 0d 0dP 46 ,0S <,0 /  L2 o4 0S R1 < 8 0 B ? `PP@404 S S` Q V@1(@Q0 T `FV@ 0%0tP?P`@T1X@QzTP $0000 00SW4 Q4  A 4 4" 4  R 0s 0 p00t 00pSd4d$00l4 00$4040$0h Rf   #0S l 0p$0h0fPR <0 00x3t3   jP 3 l hP3 R! Ho2 R4 3 R <0 R 0SR;Sh0S)|0<(œ R:0S:\4h0S1<  0@#? S`& @CT`0t0@DT `4"80d a( Ÿ.bP^1 R  p ('1h0<0 0<  0 0Pn,1 R 0tnlP  0p4< <0/410u($0 {<P X u<P0S 0S 1 hP P0  } D 0N [ PAA@A$|@A@AAx@A::"X@ 0HAd@x@@4 wv -LM@P1Ppe`VWY!?> DR.000 0. $0`F0V$0@\ P0 S00*<P ,@ R0 0  0R 0S R0R0S OP  0 R kPd `\0 S00Hō<<< AAD:At@ A: wv -,0LM ,0  @9PA:L -1L8M1q1!00( T (0KX P L H D @ < 8 4 0 , ,0@Q 0PU `TP@  @0U ,0X00P @0P@ XK0S Y t@:PA@8:A -LM`VPڴp崀4@PT 0S  0T @T R 0S `FVP 0  0P 00:AD -LM @0 @::d -LM @0 @:: -MLME0,0   BR0t,<tL HCP  8%PD0 %0S 0%000$EKI4 I q0ğğ q`$aA4( Kxx$x4xğV`$ 0d *MKJ J0P000Ss`V:ğ($`0V0 * D0P00\'`V:ß0 q`S00*PP V:RP,0 S ,|0S 0 P00S 0 S s S ,#P# 7  00C0 "P  000 00C0  SV;;S <\"9(K00MKA@AKK@ $@a.0 \4  X$ iBNK @D@D0%1 R" 0̠  A0S0?0?00 R<P0 @hh0̠ T@z @N((/ 0 _ PPQ PP 0:0 ) l AAx@h@A::p@ADm@hAܼм$ wv,Lt d -ML8M 8Rp, (`  Q h8 Q`853 575$\E0S 4SP $ ȟ0 41 R8 8 (K(K  (K0AO0KK,!0S7(K (K(K ( K(K0 00RP^^>KMK j-XmP$ $\0S,  R0.S $0&$00\ &+0S \ 0S F 00CS񟗜XX$0SX T6 ,0S h,00 H& Q@"0S E0 S &? 00 P%00C0 80S$ $\NK @D@D0|S^K PE0`0X%T4P5 R DgP $\00$0S0 R$ 4 R4 R$ P 0: S0   p$00^p$0 0 Pc0SM$\6R$ 0.S/000 41 R33 (K(K  AO0(K0KK,L0S@3(K (K(K ( K(K0$00\P000 Q0hNK0ᴀ$00$02  0`0C0 :@@\+0SP $00$0P l"00C0|"O>KMK ,P<"?8Y00@P \ P !(A0l!00S 0S 0D0 P}>KMK Pe+$00$0 1  0`0C0 A:崀\(^@oPG T0S 0x0 P\0 RD 0SA <0050 ALAx@W8ADA\hTtAAm@4h $$0c -LM @0 @A: -`!LMX0P!1pCH1W0:<000@`V Q 0 R 0pGW* 000 R PQ 0 R 0 UPd`@`Pl000`0  00C0K0 0@0  Ah@@:ABAA -LM @0 @#A:, -L4Mtq lPhh!0$0 @P T0 L0 H0 D0 @0 <0 80 40 00 ,0 (0 $K# a Q @L@ 00CS6$H 0QP 0S P0@T000  00奏xTK TKw 0STK@ <0 ,A@:AAX@4@ -`LVP)P>1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00ETAt@A -LM @0 @c::D -MLM0Oϟ ,0 KK(A@ 8KA@K  8K$? toR@X\$UU.K! U5U3N8KAK^, P0@@?|\ ``N A$e @M7?AV@0p`A7/110SoK $ULqK Q8K1PTPK XP5\@@?NA`@ 0|0l(K07?K!d $5dKS@B@h@$5A@l@0` | 6?8K1Ad@HKAK\ d0T@b@aK0=KKP 08K(0CCHK  7<K(@0@ SHKAX4 ZK(NN 0K 0  $08 00C bpX L?>1 H!X ,;+ ,0(KPK4K KTKKK K `HK @0 0 ! 0l  K`0S 3S 8K EHK@K0 $K0P ,00C\P(K;!1a HK@Ke$5S8C6KpHKAK  $  K,(0S0@0^ TK (0, (K!0000@8K1J K0RP04080<0@0D0H0L0(K!KT0K !7L5(KsK pX19Ϡ 0.0CSHKA000KK 0IQ0C  0K@\00> 00c# XpK^K(0SK.!0\00> 00c# K 0X0C 08K0UB8p WG?>1 AR!?> p W ^' ^"KG$0KQ0$0K`0.!008 > b0Q0cKP! 08K Z $5S,Kl p@h0PX`P ^ $%^ࠡ1(K01!p@0SX^ $%^ࠡ101f(0K( KHKAv0(K(K$P@K1ܥ(0KHKA 0 (K(K(K(K 0(KK!P3P B 3P5 R9 8KHK 'PşK,0PK_PPL5@s(K 8KP% 2P,0 S ,K P K0PP0K(K8K 2PHKA`ğ0(K SK T0@D0KSKTT08K 2P HKAh P3 R KXK8K1 SQKHK\0A00RHK@pK\000?000S @@T8K1HK@XKX(RRKHK`0@00QHKApK`000?000S @C@T8K1HK@XLHQHKAK\0RHK@(K \0K -2P' (K!4& P HK@0(K SK!\0A0SK\0|A8K 2RKK0?\04000S4K0K RKK0?\0000S4dK0K YKK ]KK Ap@X`AA::@Pxm@APAU (PAA<XDApAKK8K &HK@X0(K SK!T0T@0SKKT08K @%K{ PcK@000| U3K!0pSK0T0T 0 000| '3@P=30 30` 3PE/3K!0SKX02000000$%R83(K!?l>1 @  KK 0d2RK`00 ?> 00c# 8bW 2K0HKA"0#P>1KKT K 0 A ͠HKK,0 P54C0SPXP 0S (KpP0@@?|`N A@2?$%ARP `A2?AP=L0P4@ P $4o UTM$5SDT0S Pf0S`P Kt4$@@X\: 0 0 @H0@0D --L }I p-PLM@P`l0l R  T D0 Rp800S 4](0SbP 0(<Q  <0(5<(0S ]$0SKP{  hH080@_Qn d H0S.0O 0S \'0SV+PR  gL0@0@_QE p L0-0O@'0S \(0S. P* 7 W0S0,%R0S0L%r 0S 6 R @/P `P3S x 0pVPT085"d@00PgS0$PP Ve 00 pWD&00/>10@.\6PPF 6E.46P(@ .6P6 .P5& 0%@U5 @.E00.0%S P 4|5    d^ L``P` `$h R!(4Lwa(0S? $0 00L 0P5?T5 V>X5pP0@@?|PN A@.?$%AR㰠 `A.?A=`L 0D#D3 P 0S U0 00,%0S><0(5 H0S.0O "L00O\P p"000D5SL000<5S,2  2 }000a45 SJ]H0S0O L0-0O021  1 *1  1 |000h1@@4P  0<0|P 00t!0S0][ 0t0P]=Z  d]5Z H] <<`l@AAT d@AHAtAAAPAAA A0Tp@ALA 0TAp@A A0x@A,ABAh@\@m@PtDAA(l,(PPdt| wv -LM PUŸ ?P1q :P@V:` 0P\%1R x,Qaڴ RєڒS0ARph0 S\8Ad04!-00-@T 1 , 0 B0 0!Ph 0SP 0 R,TZ@Ph00`T*0 QPd@T:aA\< AAd@PAT\pl@A@(h -PLM@ 00 R$hZ\A -L`pP@u Pa0@S p$2@  0@T{ q10  00S2WnC` `F R R1!![!-@4@ P8P00 $ 0``,008 (V,|0 @N,@J, V0 0`V00 |p0B000@B,8@@=,P`06,$01,@-,0W`,d0`V0d0( 80 ,Pr?dA -0LM@H HP0T oX< >edA 4 0R  0R 0R 0R 0R 0R, ,0R0 00R4 40R8 80RH H0RL L0RP P0RT T0R` `0Rd d0Rh h0Rt t0Rx x0R 0R 0R 0R 0R\5\%R -L: S  S  S H0 R4[ S S  S S@ -1L `RdP@@ .Tx1 ROl1 RK`1 RT @1 R 8N[,QXp$G[d00CS0X0@ӤX0) T 00CS00 R0 0  0 yTYT nTNT -YT00yT  R 5 PXG1@@ [40@,A HAA1 1FR#  800g\0 8 a@T^ 0/.!1CQT^@P'0 0 ! 0!S 3S 0'^P @ ?>1 A!  ?Q>`0 0 ?> 00c#^ \0008 W0$00C0g0$0^APAAAU A -L8M0@K00 ,  -RSL4MP @`t pq\d1  BRP  T 00c0Q3@T TX0X  0S  R1 018ĠH@ -80L0CS%( ( 4) ) 4) 4) 4) ( 0S0 #Q00 L0 R0St -80L0CS!) ) ) ) ) ) ) ) 000 10B0  2 R0  00 -80L0CS!H* d* * * * * * <* 000 10B0  2 R0  00 -80L0CS!+ + \+ @+ \+ \+ \+ * 0S1 S20#B1  0S 00w -L U@>U @b 00cSkNK@DEP m0SXi PP>]0S  /tUKP  = R K| t]0S 8NP r KPxx:KKAx Pi?: S ]0S[ cKP  P`PK`0P p<  0P *Kx ZK:KPtqt<0  00SKtjK2t`W~Cp pG0S 0 S 0S00 S0S P-0SZKtP4S0>0Lm0SKt00S00SKt,0S00 0SKt(0S0`,0sZKtP40L,0SjKt`4S000[0S0S0ڴk0S 0 QڄK0S@P+0S010; RʴK0S ; rq + 0sKt[4K00 q *Kt 400t`80P )0 8 )唽*\ 0S0^K#10iPE \  [ʟ@<0S*<00L$Y00Flj00@,@*7ɟ0 S0RS80X0S AK(AIoP X8(`K 8(K0 K|(0(K K .:*K0KZKjK|0x K$hP P0 S 0 G0S *KWx0Sz p@{ PG ~KpGpG'0nK`Fg$ A]K0(PESPE, 0STZ H0SD  Kp P)A4 u PjK`V) XNK@D@D0|&W{yw`T0 t $8 0(8 (( 0 ,H  >K0C0C G ZPG| KA xP0SkK|EgKK t | SZ<SRP0OK \\ƟLV0  4Ɵl5, @P`0 4( 2  B0001 S90^Kt(0 S;30Ml/`!T:K0 < 0K  xc JWG$  OG  ~AjKPt Ktp  *KP|:A}K(pGpGGP`) H  7P `VIJP @,0Sr0@00S P  T Y0`Vj?0Z(Gͻ  LFŻ  dDh"X2d<KTAmp @84"2.$ PNK@D@De/f K>K| jK0C^!t@P(`K1( K,@0) 9 !1 ɠ$ (PKp , +^KPEPEd!0BNKK@D@DP@!@1KI!1*KI t P0C,ClHCC\GD %\CL,hhD? <8CC$ H 8\CCpCC(DCXlC8(,CC hC<TC Cx>K0C0C``1L0 K00``41P@F0P!`h1Pt`1P`1Pڰ!000,aџ1PPaȟ1Pta忟2Pչa嶟,2P8հa孟H2PTէa够d2Pp՞b囟2P(b咟2PըՌLb剟2PcPo|b}2Pw0S 2#CYb.P#000M<#PD3D#D PA(cRd3Ppet34TcG3PՐAxc>3Pլ83PP c,3P&c#3P d4P(,Wҹ 0D P 00- L@PpP`0 `R\ 000>P@< 0-1I(,BedA HDh0 p-d0LM0`S@P p84 S0S IphDgd -0-LPP@'r$0  0 0-PL0@S00  5 xl0 R 0TST 0S S 0S qCh0P|lB -LMPp`p@? P. uq$PK` Gp $0 P  30$0 ZW$C40S$0 l!d U PDFP$  % w -LtMK@jPx0  P P P   -LMБ 1, ! 1 ! 1!p1 !  p `PP6 KZ C/KjU@! WT ,0S H,q ,P 0M HoP GP GꈀKZ2@Kl p'0 ` P@ W  P 0\I DG;P (GtW\h -LkMl0`d$0 PP@ 0S@AsK*P $A1" P 6^K P@ P1*$0 S $q  P*0 S/R ` d P*P< ,\(0HTp -LMp0PK 0 Bt0t `h ,@0X @1 B` 0S  pHHH -LM T` , p 4 P  ?Py>P >P NK0S l_.0AU0ʤ> >p  h> d>R`.`p  $0 ,50(5P ( > @) M^00 00 Rڨ R= =$ $RӠռڰ$RӐշڌ000 0400 Bd40AP LL0Q 4 R(:R8ëR0H0400cL0 H0S.0O L00O PP00Z4\ʠ ZP00P0 0T 4Zʠ ZT00T0˟ T00S1800`0 8Zڠʠ Z`00`0ʀ P80Sm; P%00#1t0 003x0@P+4G|0d0 |Z;ʠ Zd00d0JX;\` 4@,8@帊@&ԛ0P4@8@@00" 8 000P|0@ 8@@000 夠Zɟʠ Z000 0B00000S010CO 00pǏ| tSΌ/1`G P$p`Z`Z 00 0` |02X3 X3嬠S  ʠX30X38 X3S H܈P0`x@ @ⴐ 00)1 @@ ` TBP 0|00  0  X@ @z 0 H 0S S0$5P㸀 0P @@ ?|`N A @W?$%ARp0O`AI?A@T0 S< R4`P0@@?|pN A@(00$/>AQ@0P`?P?T0 0 00S000ʠ $FP 剐X3 0X3@ 0 腟 80080`00`0 80Sڴş4 00RR 80080 `00C`040040 |00|0l0 0 E0 PKOP?0 UpxP开 0Eo0 $50 0ЄH5P0`x@!@@^Y l 80 Si  Vg  \Tb0$C<4@ ɐ00 000@80080 `00C`0y0 PP0@ @?|`N A @e?$%ARp0N` AW?A@TLßPp @ PK0?PxP0Eo0 500 0000000 x@83!R@@$ऀX ʸP B0#C CP帀PP2 @B 0 P @3 RRR0S C聟 @ @0 R0hŸ  Hp@ PK0?PKxxP0Eo0 B5P0P10`x@!@@@Tڴ00i 0p@PK 0?PP0 @?|pN A @?$%AR㰀D` A?A@Ti0 Se` Raڣ?/0 0 HHHHCCCCHHCC<p  CVUUULpCDlCCC<CHtXCC CH,CCTC$HH w4g H(J(`P0@@?|pN A@00$/>AQ@0P`?P0@ @ 0P0i0p圁PK0 P?UxP0Eo0 M50D@ 0|0@ `|P06 T DHR0S T0T p" 0@TA0A0S0p P0@@?|PN A@?$%AR㰀 `A?A=`L0`d 0S2$0@$ |0hP| $ Q0°0Pè Ű RA3 3  3 0L5 @5LV>00h0Ph0 S:h0PŤ0S0X36 Xc0PE`0|p+TV V> T5T50X5 ^ @`=LP0OOT0p$$0 $ A4 0X3@,@P,00,0@`0xQ0000, B` PZ0 "@p0`S$0bZ/0A P+U 8@P  @0|  @ ,00C,0`@@`@P 0|$ d$0t&10XFP0SPPU p0Sg `00 ,@5L20000# jl 0Zp0ڴʠ Zp00p00V3&P> 7P'\50\'@0h'<l7P0X0'\@/0"b7D 0 0 0 0 0000@0S 0S 8P )0, Z`(\H80pKS(d d ,0X0Sy 8 R P  0 Pf(0X 0 8\łI  (9\5 0Z8( P,0X \00@ d0|  ,0X) I9 P0 0 ,400 80 0 + 0Q  ,i 0 T@0d jZ Q  00 Zl 6Z00@`T#d0>A RP  ? _ pPC :< <9+$0| 0 _?@$P4G>. 0,0p`P4{6/  0 9?x긓pß0 d|P  B H0lc&?80|00$!8P@ @d ?0" ?h S|0` 2Q@500h0 X3X#B P5PBL%00r/ P5T%  lŸPP0P%PH X3X0 I80Jp|0P @P0 0` PEL5` sT5Z20P000s, `A\ L5sX500VL5sP5T%2 0 / 00n0L5sP5T%2 0  80ZZi0 L5sX500V. 00V3?T5 V>X56TWX>LCX 4TtCHC(D0 0Q 0\\8>0d40 S$||-> (>%>0S nWP T?/0 0 W0 0 ,5<0 0_:0 004 Ϡ΃` -LM, ,P@, 0p0Q"0$ `,0 V` e0e\0 40 40@ 44 ; :,0Œ8 ʟ0p:0 , ,00CPʟ+0! * 0`e<` ;pʟ1 <0P0 `$5S@8 p 0T0T0 1X0 PX00\0 0\0/>`$5SYڴ 0|a /`010Ch0 h000h0h0$%10l0 @0`|D /l01d0 )d 0R<ʸ 0,0\ 0,p8.!Q0σ\00>00c 8p W 00C 0pd(@`0xQ W%00PUDh% *l 1 D, '&0000| 66 ƟRT000T000@|0嬠  ~ P` 0 t 0p p Pe <@6Pp Ri  | 00050 80 Y0 (00(0%540( 0l ( 048@? Pp- | `!40040\%4800` \@4 45.!Q0σ`004>00c 4  P $00$044 80<0 SlP 8 @4 R`0 \0$%R L$?>l 1 D, 4$0000| ß3 RT000T000@|0嬠   P` 0  0p Pe PT3Pp R   000 3< 800 S<Y#0i14  4 "2.!Q0σ`00>0 0c x2 <$0 Y0$0L0$%R0<0 plp h@\P@" \ !0$%\ 10 10S1p p0W\ 0$%\ 10 1tt!0 00T1T0$ <08!00 001 0008,0 0 0@ dP0oU  X@@@V  X@@@ 0| /`01d0@ ]%HHHU Hh -LA^ p t00 000 R6Pp04WP㌠(p`͇L|0P` 0O;h0d4 ND400`p[tCHCxHHHA -0`A VLP|`A@00000 0`VpcPBO ` p     H -L M0 d@Π , ` t3 R 7@T 0X3 _R`0@P08J  P0 8XP43 03`R`0XA  $5S ?l >1 D,  00C0 00C0"00C0 000000|2 0000|  D2<2 RT000T00C0@|0 4 40 P` 0  0p Pe P1 pRU 04 00C0@, 00R> 4@ P180 0` @80 0` 80$ 0` $ 800`4  4 08 P ?Q>`0 0?>0 0c0@8 T0 d 04u X@@@ 6HHU H -LMpQl0A d  al1 RO 00C 0@0S\0000 10 d0 l 00C000C0P`,0W** 0 0 0$@x `0d C0XKB$PE 0x 00 6)   HHU H  -0LM`pQ  X0X07!hm<0@ L 0PgP " CCCHD -0LM`\0p l0 P X0XN0P P ,0007 h2 $ CCCHCd -8L0@S%@ h | , 0S0 #Q00 L0 R0S  勩 -8L0@S! 0 p L p p p  000 10B0  2 R0  00 X -8L0@S!ܠ 8  8 8 8 Р 000 10B0  2 R0  00 & -L M@H K0s4 A[TP d@TP@ht@X -LMP@8p1匑匡`p!pP@6 "P/Ģ ̢ Ԣ 0`00``p0 PbUAY0Sl0a\0W 0 RvHHHHHHH -Lbp0LS82 R,2 pRp 2W R PPw 졟 P@i #0B SVꐤ ̤  t ԥ t 0=0S@ P  0S P X  0S R R 0 R P -9P 0S7f30S%RP0S@ >P #WK30S$HHHHHH w -LtMP@T ttpKVPK 0SP H1 R 30S (r70S@: S( `0S : S  P : S  S 0 R )P 8P 0SX0 RH0S 㨧 $HHH wHHD# -LM쁟0Q@(0 Pp`i 0: S (0 S (` 0S  Ip` Kp 1 S!3 ]PpE 8@ IP P 60  ]0 * ,P hP0  P VPw] MK{P   wH$ -LM@`P  Vp@0V U@0 @=PPU`VUU -1L$M℁PUp$ `Sd1 R 0: S P$0 S $$_4KG@w+[ Q003 Kp另@`D00CS00Ӥ0 PpP @00CS00Ӥ0 PpYU00yUol ,bHH0vM8TT p-LMP`P @B@P0/S+ /=P0.S P0S@p0S .S0S`V d 00 Q P0S0P,`  @@P0/S H` -0L ^0 -LLM0`@/<,#P000P 0p0R" p fPp "0Sa@a T@DpTW :Py0SRb 0x"S00QS 3P@?0S. 6[8c8Pd0 0`0 dK0S [iPm0So^6 xhK ㊐` 0dKPh0 R k0S .gXPKp ]PH00S0S\, 5\0K ߻0Qh0 S@0 Sh  h孠PP@:p@0p0Pxpl0DSipPp,`pI0 PDHAHܚC hؚmm8@ wؙ( 0-LM0@P R/ AR@ 3 0 ,00CS00  ä0 $@ 0d@34@0( ,0D@30 $J$A0h3H?dh -RLM@p 0S   3Tc W@` 0S] |Q<0 CR P00 R%  B02? X 0, CR 100  \ `0 CR 00  \ R@0> CR 000Ri߃0 Rd \׃0R҃ R R0RŃ\d -40L R(0$0$   B]ܚH 0-LP.@jZ8P P-  00H` H - LbN  -L  -LMhq0S \\PPL s@!PD 4a@P!@0P P00FP@ @3 0 0@@Pp@K;0$!  P 0mP 0;C 0 0d@d @aˠ$0K $ @Y8\ta,HHHT -0LS \|0H0  00S_\-\0S d p-LCM``GOK0PL  80 Y 0S \p| -LM$@0 S A00hg 0-D0L R 4410P@@7T00L 0-LBMdP0FOK\0 P 04 0S A\0 p-LM`@,0 jPUphH p-BMLM`0<@KP0 B<0[ES FS AS  R0r S00x$;K/0 S X[pCNK@D@D 0<0[FS 0   -$0LM K TP [H p-QLMP`@00H@ph0PE S U@00p -LM`PS2ဋᨋh!pXq mP pP 7P@(@ X!0AT3 T`7 O@P0/S Z  1P0S@!`MP X:p`1  @@P0/S Q@   Zv,C  wG -LpM`@pKs.@I- 00RPPSP0: S/0U0   X57-0S U P ,-0S  ~1 w -0L ΡZ00 -\@LM80(0( 0_____ -LM` 2P( S l  Q Qq00  R( \ 0S#S 0P00 `  (0npPpp(Ȉ0S 0H00S (S 0S(0 t0W0 S񟗮< 4 X h (0\(   Q Qq00  R( 0000((0\(   Q Qq00  R( 0;S`( \ oSf  ,da(0\(   Q Qq00  R( 0\S  G(\(   Q Qq00  R( 0S: * D((0\(   Q Qq00  R( (0`S0Z00 0Px(0\( h  Q Qq00  R( 0S 0(0;Sp  ( Kw (0\(   Q Qq00  R(  ( K\ 0S (0\( D  Q Qq00  R( , 8k(0\(   Q( Qq00  R( 0S  3 @T00u#(pn\+)( 0phe`d(( ( 0\SS. (~P(  L( ( 2P(   Q Qq00  R( 0;S /.(|)(0 ( P(   Q Qq00  R( 0;S S ( pIQD>(*(YP( p4  Q Qq00  R( 0,S00\(   Q Qq00  R( w(%P( pd  Q Qq00  R( Z lMDTL\hx_ (\p 0-LM P@U W \UXQ UM  0S 0[S: \S1 0\S \R 0S 0 0 0S000 00\S  0S  0\S0nS 00  0[S KP@ ($0@-@000^S00]S00 R ]R0 0[S \S 0 R ]R00]S 0nS 00.^ =^:^00 ]P P 0]S0PP -LMMpNK @D0@D` 0 BPU 0 K0S0 t U P T0S5 0S 0 qW _ -L M@X, 02 ,0 p1 100 ,0 0;P0S4P  \S  RE ZQ@D0S4 0bp00 g R AP\0 00 P \00, 0 S0`B 0V, 0S`:\Q&Q\00 S SP+ 4  0bp@, 0_U4@\ -LMr ` 0 ( P0 (PpŸ  Q Qq00  R( 0gS} 09S,1SUK A A pP@P@(S S (0(8 0 S  V;SpSF wSP( <  Q Qq00  R( 0NK @D@DS  S ( 0(0S0R0 w0PU ( p m(: 0tydu00U0P0h(_  -MLMh P( 0\SSN ~KpGpGPP(A jK$`FP@ `FPP5 0Q Qq0  00SP@T 000S0S   0S(0 S H(U8,,T` -ML MD!D0 ,0 낮KJp`J  P@Q ' Q Qq00  R ^ \R 0 R0hQ` 0f Sʉ kp00w@0 ,0S <,oU 0S S 0-LM0@9SP$0S$S /S  0P@  00Dt 000 K) \S@  R-`L@ ( 0pS S ;S p0 0 0 S S ;SR 0gPV@ @ڥ \20pS S 8p0 0 0 S S00@ p-PLM@P& `0a0CS 000@Tp 0S0 C0S40 Q _T - P LR` 2P R 01@pT 0S @Tm0@00` 00 eP ]l p-LM PR` 2P RT0 AT 0S @Tp0 <P0 0p] -\pL`AT 0S<P yQU@`V0 `] - rLMP@`! p?@H /P<( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (  ( ( ( ( ( ( ( D 1`1`^ 0}S00 0AQ0S 0S|0jpP%垚P n@C ____< -錂LpP0xSM @:S=d0SX20 #R. @U<ŸPE$ R R 0 0  00 0 0 0 0Q00 00 00 00nS1  paP X1 0S7 S Ha |P@  00M@ 0Q 0#S0nS0@0 ㋷P0 @0  | 6d0P@ 0X 00h%0 0%ꀝ__D___ _8Z_H\ -LMb0S!lRhPdr 0SX2X0{ 00CS0r2  p0 40S 00,K⇂0@ @C,  02!刁000 00CS0 0Ӥ0,pXqHQ$0:0CCSX X X \ X X X X X X p X X  X X X X X $ X t X X X X X X X X X X X X X X X X X X , @  X X L X X X  X X l X X X pepU 0RdE !0 0 !0@0 A000E0 004&y0DSx R  B 0P 0iL Z00bhDQ  40tV D0n$PF#0S yP0S30S5 R3}Y@00* B P 0 0c0@ 0p0 0S D3 R 400 30"0S0S B2P00290Sh21X"0S 0S02#(R(Ÿ0 SB !0 0 !0@0 A0000A0<0A000!0S 00@Tp ^0P B" 0<N ,,!p2" 0>Ԁ0S P R" 0pW ` 0@ ,0 S0 ,%NF 0S P; E~PJK(@DP@D *0/\ 40 0___<\ -LMr0@s `PR |R0VQPq`20  00SG \PD 0, CR 600`0S0$ CR "0000CS00  ä00@0S  \s0Rs0R P(s0\ CR #00KP 0 C0 b\ 00`0\ Ps#`0Rsti `vdP {yfL$ KP2[S<00Zꌝ<  Xht@ -PLM؀`pP@) T 0 S R@D @00U00  0 P P #D <0S1___( -LMP, Up & &U0 \Ud 0SDb p9  0r1 P`0@0S*,0   000PU@0S*00K@ 0@ @K @ 00s0s\U @0S*P000K@ 0@ 0&S\SPq(00  00S00@_ -LM@P P`p W00 ' 0 0  N P0-L@P 0wS! sS @T0 p P 0 0P0 d[{Sp P007 0Ca00 0-PLP @CIT000 0-LPIP@0 0R0 @@0GT 0-SL@p  P`;IP@4 U@@V@G hTP @\0000Q00H -L,MS @D ||#kp LP ?PPP4#0SA $G儈H 偈L Q 0S 0S"0S P0 "PPe<92p D 12`b`" @ 82@ $2$ ; 00 , G00 080 4 3E`W00S!0(R00S k>Xd R $@K`P $0ASA2 A$ R20S`!?1S2 R hBxR` R PdBd`VZX ??0D,0  P5?BQc U`, (` ,pKPB0 R,0 PPV`U ,@0!@dWpp@R 0%S# $K0`P $p`P`AT剉 >>CP  0p00  00S& @ wPp6 P`7dVP`2 $$,lLgfff @,; 0-@0PTL 0Qjb@@0 l -XRLMP"@eb?P 0A`V PU / 0S ۃ0S =1 LPl 0S0@  $0 S  1SqQ0S 10Sly= @P@"b?0P0P00S` 0+0 0K@KKV0?0 0K00K?V00~0@ ;0 QP~ K40P@@ RV  0!  @, 00a=($l l -PL@p` ap lP ?PmPp`t 0P0 PPP =:0P0 B0PPS$0fP p-0LM` P@}a?P 0AT K02\0 S0 1 !0l p$<p<$ -LM0@P,0 #Hap ?P SPP,0 S ,A3 AT #0 P 00LS!00LS0B \L =i<7p5\ p]  Qf` ᠑XIP@PR  Q8 唑P3 0X0C S( X' X' X' X' X' X' X' X' X' X' X' X' X' X' (( X' X' X' X' X' X' X' 0( X' X' ( X' X' 8( X' @( ( PI PQP'SP0-V +V ,Q@ NP \ \ =V1h0l;P 0a0CSH) l) l) l) l) l) T) l) l) l) l) l) l) l) `) l) l) l) l) l) t) Ispmk@hpU @@K`Pp 0 0=00 b200P B\,0000D<:<3$p , p-(QLM !@9`?P< 0aV< 0 0K.P( 0Q0 R 00 0 S   0S  0XPpĆ PT;P< (J;p鳆p$lZ 0-PLM @_?P 0PPKPKX@P 0Q@0 SR R 0$ -PL4M0p @P0 TP XP $ _p, rP' ?P pPLK<PX L:sP uP`PX  L K"<PX L <:0T0 0P0 0!R40*Xy;$Xc?@ P` 00XPT0Sc 0 00 , 0 00R080 4 x 4`u U 0S C0 P0ŵU u 0  $0S tP0;0 T0S H00c RHKpZpP800c R8KfZ`Y U u P2 P$ R X P oOX2 IRP0\U00Su US 0"0  40VG 0S 00{0`71 R,4 }P# 0S~@T 38_)P$P -LM\` PW  u`ONFd`@>ePX OD%BddW_N( FVe $P @'eThv| -LPM@lPK`ᄀdK 0hp 0 0 0M -LM`SK@P [lKK0S@ #3````0SS?KS?K0C0C0`"S?K0C`VK@9KgQKdm 0h  l0R=9B\! =C ` \1 `! 0` d 0Rd! =9B@Kh ZK KP T1XbL1Pc=9 A =X T X! T1 PVK0 A0@.U A 0@#U A 0@lQahX 0 P< 0  40  =Ch! d1 h0  cl0Rc=9 =\! \1  A0` `! \10`! S \1 =9C`! =C `! \1 Ũ `0 cd0Rcd! =9 Ah =h! < d1 d1h!0 SKZKh! d1 w=9C T`?Bd$lt| -LM -0LP Q@@\p 0`S 0S 0S!P00@S| -LMP\`@p 0A#S'B B C hC C C C C $D TD D D D D E HE lE E E E 4F XF dF pF F F F G G G G G G \H G H 0S&0S0!SPPU@gUP 05U  P001 KfPK2K[P0: SKOP0: SKCP0: SKP0: SK+P0: SKP0: SKP0: SKP{x0SKPo0 KPd0 KP[3| RpKPJP0SDT0SAR KVP0 00P  LKP)0 0  V40  V,߉PىԉPAK 0K*P000BK 0?*P 0FS |G G G H ,H DH !1RK1P@ K1Pd 0RP@!1R!1R!1R!1R!1RK\1P@KV1P 0R 0R@@KG1PP K?1Pd 0RPPlD11 p-LtM`PP@P0 RKp1P@ : S I@@D 0-L@0P 0 0S(  0U0 -L@P0pWP`  0S@ PW @ -L@P0`VPp  0S@ P @V@ 0-0PL@ 0h  0S P0 -LM0@P`  Pp 0`  PP D! PP  P  ` 0 P"  PP 00p `  Pp(   0  -LM @R:Q0ASQ <0$PP000  R04 5: 0Q0BMЍ@-1S70#@0\  0 @2 @2 w -LMğ0PSp H00CS0a 0 0  S 00 R00f`#Wp?0@/ "S(O O O O O O O O O O O O O O O O O O O O O O O O O O O O O O O O O O O `BP 0S P 0SP S2p2 `P`V Y0S H 2@rPnY. 2@P 0S 2w  ?}p20Sxy28PKŹ 00K0S V w  ?Tp0Z2xT28PKᠹV 00K PF0S B}1k00K<K 0|'P[ <\` 00L 0 pǏz_$      ,,  -`@LM0P! L0 l0 P303 0 h\ꠃdS ,_0 _ 0-LM0PS 0 0P KP 00iPA[T| 0 p T @3P@vP[nt[\D 0 vP [`t_hht@Xl  0-0L PR@j` 0S0S @]00S@ .z_l 0-LMPK 6WP@t 0S 00 R 8j4T[0Z$-, 0SC00]$ p-LM@P HP`0S C  0  0Pp@\$ -!LLMt 0t,0 QH PQ `pPK @TXK01X0L=E[C@[@P[?`[Hp[D[X0 0bX K70K0L 80K@ P`p:K9K0pKS0S 0S0 S0S0 S P tD,0 S @,4 0 _P@  -LM/`KHPDp`@QvP@T iP@-\0#S" R@0 S@ R0S \ J#0 SA0A R0Z# 000  R0S0 0#S 00 S00 R -RL Mp Z0%Z10d P`WZ Z PMUV 0 S/R `FV00S/S,A P@@U,@ 0 4  4,0\*1P00U4 4,0\*004 0 @`DA A@,@ 0 4 0 @`DA A@,@ 4 0 PPU ` -RLMy0SP  \SR00  Sp㘁pA`B0PP0; P \`L/`81@0K(!( 0@ ,@ 0(0^.*p, ` 0 `@P @1ST T000JP 0 R@K ,P, @`DA _A@(@ , 0 H   0-@P  LP 0c0 -RLMp80  @. #PP34`K"0,0 0 4 """0@T  L@T"0 3xopp2P 0 (4 K 0B0`CY | 0X 2 Z P< p@10W 0 P9 pPU @< 1Pl U<  01PUX!<4,0^ *00,10 ` 4 8  00@` DA A@,@ 0 4 tP PpI  @ __` -D0D L0\0 P ( __` P-L`N \ RT LR0S0f0QE$@F0t0f0Pp F@Dtp 䀟 ` 00H0 0 c@BTT@@DtP @Dtu@ @Dt00X0 0PPu0U,`__` `` ` -L -L -LZ 00_ -LNy - 1 LP@8 `00Cs0䠟p- P P r0 0  R0_S $S@@PP P  q00 0  R_S $S@@00Cs0SW__` -1L @\7 `00Cs0ࠟp- \  r0 0  R0_S $S@P\ q00 0 R_S $S@00Cs0 __` p-0LM@P: 00P:p0@ph`P0`P* 0B0R0T:pp00U0T_`_ -LM@@t @Dt 0-@PPL 0PS0 P0 p(0  0 P00 -hP@L`f P Lp0T*0V  0S 0T*0V `` - PLM@ pH 0 0  R ^wT@?hrh0 -D0D 0L0Q0 P`0TY__` -D0D 0L0S0 P0<A__` -p0 @L `P00Cs0 U0 T 4} @R 00Cs0(0$}P@__`_ 0-0PL@00Cs0 tϠ Qd0AQ 00S 0S0@0Cs00_`__ - L 0   _ -$0L; 頃 -0L?d -0L6 - 0L0@*`$` - 0L0`$` -D0L R80000 ,00@`d` -0P LU:0` pUhh0P0@  `v| l0 h\ \0 0Rh?h"d__$`__ `_-000 0 0 bL1C 00Oꔅ$`(`000 0Q 0 R M__` -LCM`0JK $0 @ PTJ P/,1 P0' )S S1 S (0KU*0T0`pP@ g0^S@ (@T$0 S `$+U 00eU@  4`_   -pQL@@0 @dT` :%PP 0@DT*d0 XD0@坴@0@^S@D~ $`d_ 0- L^RP@ lP00d0} lP0 -p0xP @L@b\`00=D0 <0 40,0 !___` `_,` -0L-_ -0L$_ -L -p0LMqP 0  0Ra a1 0@0b!0C01R0 RሑF PU"x 0@S0P0cPcT<0 0CR& 0R 0R>P*Pt @DtP@0T 00t0T 0R P

R0@D?R0 00p\0 T 00 0S< ^00,P@0 ?00 00__ P0-L@P T h$|0 0h S`0 ! XT0hV$H0<P$40 I$ 4`8`  w -LM∢pQ, S d,@01Q 0H 0@:T$Pj a ,dP00S SYT 0S@ WG@01 R;0@:T;T 01  lV#00 RPq 00@ ,0T1 ?> 1 @  ?>1 @ p 0P xP B@, < ,Pd00@TTPUX~WT$ "4` 8`<`_  p-LM<_8!00( k$A 0 PP Ġ00 PPUP` 0P4GU  D@PĠ 0PPUP@ DxP80  p,xP_(`4`8`<l@-?>,1@LQ 00<`4` -LM@Q  Q Q Q Q$ h0 _,` p-LMP` R @0@0R@PcPbsS@pt,`_ -L0Qh0 Y,`_ - LM0 0 p` P0@@cP0 PPSt 00p 0>L0L H0@ @0@p`E= T T_____ -Ls -Lk -Lc -L[ -LS -LK -LC p-0L$M` 0K K$K a0a(@K @@PP 0@ 0K @T$0ͯ$0P 0S@@TPph___ p  -h1L M`` 0(K n0n4@K0K,K @P@P? X04 ^00,0KpCfP00T0S`T XU U 04 fP00  0R/S \P(0K+00( e PF___ p -\0\X0X T0L0 L08\000 5 h( ```___ `0ᘝ -T L0LS00P0 S  0S0ꘝ` p- P PP0PLM`0 0@R 0 R R00CRphp0DS ĕ , < ĕ < < ĕ 00C000` `` p-LM@,`PP 0S 0U p` 0-L@Pp0p0  0!0S 00@C_ 0 00000t0 @P`` -LMPp0` ` K"`8@T 0 0@0@ ET چ`_____ p-1LM `Vr 1 RPC0S S S "S 'SP0S0C00 R R R "R 'RP0S S S "S 'S00S0C0`@0S S S "S 'SP00@y@pP@U0Օ 0  R R "R 'RPEU  R R "R 'R0u0 S S "S 'S OP``ULC -,2,B L^P r00Cs0e b^  q00 0  R_S $S0^ LUT  r0 0  R Qp!B00X0^2  r0 0  R0_S $S#UU r0 0  R Q 00000 r0 0  R Q 00Cs0R000 r0 0  R Q D__`x -LMtQlh0h @ PT *Tp0Q`iTP*0U@00 ``__` -tt`0@0LpM2@@PP{+ P4pz0mMd -LM0@S`p) P$ ( +*(0  (0 P (PK x0S( 0Q *00 $0 `(0 $ @`DA A@ @ $ ( ` $ (  p-L Ml`0P0@0 $K 0 $0 9$ K 0B #1P Pp p-L M`0@0P 0$K0 $ $ K 0B C1<@ S@  @ p -PL`M@ ` `   /0S 0S0S @0  00 , |00p(0p 80 4 P@ Lp p p p  `K 800c R8K=PW񟗩D د  ( Ԯ د ` V񟗜ꌡ ȧ ا  `X 00 "" " V  R X V X 08.0004, `8@[0T. @0T* @(0V0 0 0  00 , 004 080 PL=@` DA A0@0@0@0T * 00 ᤫ  < @`DA A0@0@+ 40 0c0 0C Vm Q 0 R00S 0S,0[W 剐Q   l!0F]Sh̥ x ̥ P ` x ̥ ̥ Ц   0   0 00S 0  0 0 0 `0S0000 > S<   0 0  00 @ {V @ 0000W(  0 8K KP ^P 0 UPuX p=40UqP  @0T*  0@8@` DA A0@0@hp0`0  `   $00(   0 S 8  b R8K<P00 0S )00 HKPp Jq  000  $00(   0S 8  b R8K;P00 0S )006 0 | dK@K 0q000 G^0@S 8  b R8Kڦ;0P00S00  00@0 p KHK 0KPp~ WX  PJ ([ 3[0cഠ00@ 0 R00#0C S-P P t 00 ?00A `@0  (CXUl4p8Z C0  0A 0  00#0CSO갬 | | | | | | | | | | | | | | | | | | | | | | | |  | 00)  000p 40Pu]  H R000 0p 40P#"@U 0 ]P]0p00 0 40@U  e  X 0 ` t0|`0 r)` np H0`VH0 f R 3[SD0 RD0 H p00C0 1`VQ 3[S ` RD 3[S0p0 >QA ` :D  0SC' D 0`0V V    0Svv  D C3[SpJ0DZF `A 4F`pN 40 U B GH0`VH0 `Pク ,[ l,vT(8HL@D@ Y@P08 @WPL -L MPpQs 0#S  `P@@:T 0ş00 `@ 0`S VPT`0@@T*TQ%XJ K#XG (5  0S8  @T000@ ğ0 @" 0 R +X 4 R 4R 00 @T+X lg@-X=X ?X @4R44@T0@@Z0=X[nP 0@S*S0]S =X Z[@00  #0HSꐲ 2 0,0 0 4 BbZP 0/Z40 0`CA 2020@S@@^,0\ *000 4  @0@S000MŸ  10,0 0 4 4,0\* @ 4 z[0 @` DA A@,@ 4 0 0 T`V T0S@`@@T 0`SFP[nP 0@S*S0]S( @T*T0 @ T00Q00S V 00 U80i80Z![l0`P`ަ@aZL0 0`S`Z Z ,lp -d1LM`p+DQ``@NP`@ 0S $K $A@AP P  ' e2T000@0 R0PU 0S 00S 00`@P@P,0 U -L@PYm@%Tp? #T U@` ':P`T`T TU@ :P@T0e  m7P@:p`p 9P`DT*P@: 9P@DT* p-LM 0CP`CA)P @0T *00 TpX0 @`DA 3A0@@0@`Adph;8  -0LMpH`C 8 @1Sx;,8KwK/Y&] Plh , @H($ w -L,MH, \00 p4 L H  0S 0@S \ |<kV iT,0`S ,0 R V 0S ,0S ,0   D 8@ RD00D0  1S4 `0 7# RP Tq 0ǟ0 ^7 0m>0 0 R^ D 0`!VL@Q D0@ 0J 0!RPU7 ,0S 6 R /bfP0H, , 00CS ,4 0044 |6 ,/, 0@3,0 R,0 R @ ,0S\00 ~040 0,0 0-PLH P 0, , 0 @@ ,0  00x5 p0S 0@SLUD0 ,0  ağ#080 , ,0#20#0 ,< ,0<0 00LJP@> @48|$,,#0< <00, 0< S 0DS   44 4 c. 0\.a,0 , 00, 000,,0 1P,00 3@  00 0@(_[, 0T F,0  ,0 R  : ,0[.B\ 00 2,  0 p00 0S B @JJ <$T,0 R X0T9NQ`R$ <PV ,0S ,0 R ], 00D L0 W ,0 0H0 1RB ,0! Q5 ,0! Q7@P4||!U4pP@ p*TH  0 R H 01` Q H0, ,0S ,0 R 0` l0S00p000 PU  , ,0S,P |4l|$@(@` lZal w? D> $ p-LMP`PQP@ 0ST 0S`@0 0@壟Z0 $ 0 0@4Il 0-L@F 0FPP$ 0h 8Ѕ -0LMp@`T P FP L 0V0R00S@R F 0 0  -LPp`CF  @0;` 000W DM0  0S;0FV0 0N p-LM@`P0=S\ *SZ +SZ@F F 0 ` pЅ -LM`pE2/cPP` @0T00SK 0 H PTF 0S 0 U @' TL2L2@ 0P ,2U( .0 00 OP2P 0 PQ000Y @ @ Q0000 F0P9U&10T00S 0 PU10T00SPPU00S U EPP 0  P 00000 0 PP 0`BOTPX0P 0 c0 E@Rll  a`d Ѕ p-L M PK`pEEP@  V 0 /R 0(00 0Kp` -LpMPK`@ PpᴜP@U WV 0Sp : S  S pp@Ip -SLM0@< /0bP < P  ᏛH1  000 , 00PT080 4 4 :4@zbpW7 `eW 80 0c S8K-@ @֩/0080  cR8KP-@  Ʃ<4 zP 0SPU4,4`, =p -x0tp00lL @`0PP50D01 @60000ą$ -LM0X pP `ᐣ $ Q jP  L (P d -0LMP8 ,0 < p AF/ @ 040 4 RO  , ,0SG1 0 *قP@3<0S48 810Q 800: P  00  4+8)4 5p ,,冕 V@0 W 0 |04 ),tV4@ XP0L  H> 40S 44$5 l| ( 0-0LSP@ @1SQLM0S9LMt lh(PHLM R ;P00P00S100` wt 0-LMP@ 0"80 -LMpPP`@ (0V`SP U@P0?Bc P@,, (0K(p $` @ 0gfff$ -LM@ 07 w -LMp`PP@ 0UPS` 0X0$ p-L M8a0@0 PR Q0 S p0S 2 0AR  SR $K0S 0 0PU000PKP*00 R^:QP RP 00_PP R  -LM0\ R@A 0 T  騝MЍs0O  0-L MP  04K@4 0@ (000 -L$M@L H 80KD , <@ 0@ a(1+P@ 0 R050k( T+,0S&HK@0(S HKpHK@0(SL 0  8 [LML(JL, LL'0@0 4  'HK  -LM0@00Q3$  &0BS H | 0 0} 'x0  L`0K 0 K0K < 4 , $  0Dp -QL MP L@!0DTS.T, #T T&0DS``Q 0`T P 0`G 0`$S$ ; *!T 0`0 "T T 00c 0 0S00 A0 @`pDWX$01 RT,`  `0D S40 TT T 00DTST W!0 H \ l \ l | < 0 4  R,  0   ,L`@0DSp`"01 R Y, KT  0R 0R 0 0R 0R 0R 0R 0Rô 0S 00 00n 0 S 0 S 00C 0 0S 00 00V R 0 S R i J 0x 0ct 0p 0"l 0h 0pSpW 0 0 0W 0`0C 00%S %W 00 0 W`\  C 0S 0S0 0( ,   -LMPXp@ t00  RPTP(0 00+  @0 [T 0S 040&00PA ` '`&IgPPl!7 P 4 _T 00#T0S @_T0 000#T0SA PE `f'`{0<000 ` cKP ,'0 0`V T  0`V )00 ,0 NP,0VP, -LM`p@FT 0 0@ 00C 0 00P@   KX @ pJ -0LS  0 0!   0! Z -LM4@ ⁿ?0000  -0LS@ P0 R  pJ0S0e@050]I0 050`  -8LM$ `Rᬀ `ᰀ pᴀ 帀 开 r ا'^+p{ 00ACSh h h h h h h h h h  ( P[Ppᢔ|6@  1& `Q P3PPP  RP  (?   000 |0WaB YX@00 P 0S R P0S R  Pp  0H0S0 `=@[PP 4%00cP@@X 00P0 P S R  Y PP R Y Z 0 S P Y? pR p W00W030"#P``S( 弃0 gA!B2@ ZP\ d0xx 2@ d2 RpGp W00W030"S /2F/sP`U pR p W00W030"Sc/pY G ?HRX@"P@  0-PP= K 庝P`0 2 $00 峽0@ d 0Pڨ@ 0dSʤ00c0l SK %@ .00`<+i$vP x.dhPL $ 2 RpGp W00W030"SPP Y "Y  0S  S0 0 R00l$0D<<h=Xa`|h -`LVP |p YP@  0S@00 T 0P0DP@!@Xa -QLM@< @0 W ᴒD <屒\1  000 , ߼00p0@80 4 J`g0PP 0*8K @\0S 800c S2$@D0 @p< @Z.s80`P cR8K$@P ֠4, `௼r0# p-LMPK`@&P* P1 000c0 P*U OppPU )pVP pp0dP?SX0 b@@0@ P 0pXad, -H0H 0 SL4:QSC d@ -,0,  LQd@ p-h0LM`@ XPRT`: 0DRC 0/00C0 pdXa`0Ha0La@-T0T @0aC P  /4 00 $ $0@dLaHa -LMЀpPQ@Pl`}EQT00? @AT, :0TZ,  IP 0 AT:0T00cCIP d -X0LMP 0 cBA3 P0 P @ P  d P-Lx@0lpPh 0af0lCQT a8 j1@0Pd` p-0LM @R! 0S`0PSpphpŒX0XPPaH08 <0 B PPXPpTaPa@aXaDa`d -LM8@04S} $0}/ 0 @ d`0 -LP@9" `WP000 RTpP@01Q*`P010CQ*00 010CQ:`@ad -1L M R!001CD밁P !-bPat 0c`QPG : 0p@ 0S 宮S0SQ(pA60 P SPᔮ07 h Bᅮ, 0pP oylTaXaTPa` @aDaAq  R  0 8 @ H 0S Aq 0S     -GML M(q(1IKL 0 $ 4 @FPP! P 耟BnK`F0 .P@ 0P$4P t$0 S d$X0IKA˙P$*\{Pa`h@a@-@@ P0S @ P0S P ^ @ P0l0c0 -RPpLM@` PER    0 @ P 0S  U@PE0S0 0Q : 0FS   ` g0 l0 h0 d0 `pd p-d0LM\@00cC1@QP 0`Qa0(S{ pid` -LMl`4 0 DP@P+ n0 8 p`墜p`  0䠟S8   /400C0X000 `@F̠F00K FD00K/K.K-@K,`K4夎 4 0㡝@00姇@aDaXa -LM@囇R00@a - L P頝 --LMT0T @0S4.*Po }- s,ą$ --,@L^ l- b,*$ --LM0 @0 S)0 |0 R   h0  0L0L 4R$ 8- .,,ą$l --L@<<, ,-$ ,)Tt$ P0-L@ 0P PP |0x-S ,T T@Q  R 0<S08, 000PTP ꔅ$ --,0L \,y)\a$ --00L R   ,ą -LpM|KȗPt0: S  -H@LM '0 '0@D ' 0 \a 0-LPP@00 S U p- PLM` @P わpPPV0 S  P0-@L@P UT  0h0($ -LM@wP0 -LM@ֈhӈ p-LMPq 1@ 0 00S  R pP0S T00ppho0`@P 0%0P00S %10P00S00P00S T 4 P0000ppT0 $<0     H -LM,@0SP h00H -LM4@ P0SR T00H -LM$@0SP D00H$0 0PQ 00HP P0-Lp@ h@0S 0SP!000,PP00P00H -0LM`0V`P5@@ipP,@d  0Pp+#eP &$0  00阅`h -1QL@P` @嘧0Ǡ) n8Vpp 0S00 i&0 S 0S `P@†0 0 0N8@TZ0S40 Rh=hixa@< la, -\1LM@`THQHqH 8Q8q8 0R @TV 0R 0S00i;@Q0: 0S S0 0S 0S0R`P 0SP dalh -LMRQ$ 0"Sxrxb@ hrhb@ 7@TZ 0S i= 0# @TZ73=0QS 1 R R @qa@ 7@TZ0S aA0S 㷹PdP `1 00P P8i0MH 0 CH 00z0P0S  L7@崂 R0R g Gt l00GP b00la,LahP ,̊Ll -L Mp4 0  x, K,o` LDP @$0``0($00 :PP@ 0#SUP3 RTPPU @0S @Q 0@0 3 RT  40S '30030 4U3C ,K ϥ    8 000  0S  )0`V (`V +(%" K,K 㜥0S  @b@R@ k6@TZ0S@ @2!@@@ @@G<50xT 0S C6 ?6_P@  NጅVL1f΃81 K(1 ` A 0,  0(  00008 P0P 0`` |m,K h@ha`a!ȅlaH$ ,talN\d5 -LM@K @8 R 000"@ha 0-LMPK Ӥx0p\ 0d 0 P  }0 @㸤0@ha $0 -L M$`K@  ᤤpTpP, (KP 0PS  @ ㊤T0d0 つ {( R p0!h`0\ @0 0S \ 0S\@Hda -L M$pK` PL(KP@$  R 0S TP 6E hNUU=  (0! 8@ -L M, KD0K PPP 0S X0@ pT `0ŸS0``pS" @T$W0 0qX 0SB0S  z0S pB hPW00H0 U00 0S X 2 R0">0,K 㨣 P_X`A00 R  0S AQNP ,K ㆣE X < E 0,1!O0  ,Kf$D0 h 0 } 70< 1}9K,K Clc,K <T00 !H@TalaXadP 0-0@ LR# P0\$ 0S 0S0Q RT p0phTd  0X00\ 0S@ 0S@dalhvx 0-LMPK@ ٢80@0S 0@S ̢0@da -L M,K`PD p㻢V`pUF 0KP@3 X XT ,40#00 V  @  00CS0<0U@T@T 0 t@T   w000!(@@da -LM pK` \@T P0S 0@  00CS0<0@T@T 0 H@T0k" 5da@l$ -LM@K 8"00 \000 0@lapa -LMQ@P 0= S< 06 @`쀟40 0Qp@Q Q 0  T  0R@QT t3 0R0   0S 8)@,i$$lataxapada D00 000S  0S$4 0S000|a -LMP00좟000 SQr`宓0 SV Q  Q  00. 00 R} `2 Ry 0Sv QDbj @B)PY 0SN P 0S? "9 0S0;004 S 0S# ( 1 1`@ 0S Q !|f! Q 0S V PP 412  00S0  凓 0  <B0 `E}P0h;0l`0P@j 0`00@0000@00Za Q_MlaaP`T$,< -LM0` V 2 0S{ `VpK᫯뼠K  PPhڸpK៯`V 0@T 0S @T`VH yV (0\Q=9A =C 0(l0c (( Q=9 =p 0( 0b @(( Q  =9A =C0d0  ch  Q=9b @ =  0H 700 0S0 0SS0000000 da?B|a p-LM P 00S QT 0PS4 0S 0 S0000 00CS A0Sa 8 R 0RS  @ a 0S0 * 0SD 0S$ 00S D1 R 0S 0S RA & C 0 0S 00S p 0S 0 U  ,00 000ppphP00CS000$phHlalatadp -L`\MD0V ,0 x 0 #@003# Q Yt +0 0Y 0-0p0 0PU5 0@SDB 4D pD D lK@ JV 00Ul t "Va VR tŸTp"p Q0l KPx "U 0S UxQ1 ,0S ,"0 SVt  V  PU 0S0 S t\h10i"x 0P@LDT^"l0[S (!T100l Kx` Q" L" p0F"V 0SlK~ lK@ C"{0l0Kx @VT0 SS 02f 0lK2a R4P x X"da wx, -8#0L` %^0?SaF G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G F G G G G G F G F G G F F F F F F F F F F G G G G G G 2P Z0010S P %1 @T 0S @Tᨂp1@PT 0 ;PX@TX Z 001@T 0PU p:P XPU@TZ 00Q00$p @T 40S 0S @T@T 0S S @TZ0,da -p LP00 X R 0S R 0SRlbada` -L,,0@ S00 P a`0SS 0SSS  000Q  0Q0 0  ` 0ST 00C0H0H < P000P00da$ataahala- RR  RRR00Q00Q <R 0S  R 0S da p-LM0@`TP 0S@Tp2PP -/LM0尟,0  ?@ 0@ t2 |" 0K/KH" 2 x pB 崫|20 2 ϟ? @p@嚯K`!200`d"  `` P\P ,ϟ 0S  X X #X  0 0 0.0S 2   hb  P\P Ο0S00 X V V0D.020c RKp VM O xW ] ] 4^ l^ _ X` La a hb b = R 010!X00Sx P\P ͟0S0P0 PUf U00 UPM!UH u ,00 P -U u ,00 PF u,00 @KQ PK P\P ̟ 0PS  U PU U U  U  P-0KT:"0R0 KIP; AT 0 !R 0$000 8 H [X @X*X~ ?X+X{ !Xy 'Xe P"X? \X \X$X   - P\P D˟0S00  (X {XJ [000@* 00X  " b RKp P\P ʟ 0S  00   00X    20c RKp00X  @00 00$0000K p P\P ɟ0S00 :X %X#Xf 2 Z 0`0 K W 2 Z 0 K    P\P ȟ0S00 i  P\P ȟ0S00 Y (X & 2 Z 0 00 0`d K 2 Z  0 2`0c 0{ Kv `X2 Z 00p7 ` R< R 0S BR RB B+R ' KK  P\P ǟ0S00 $X "X 20c RKpX  \0000\X `X00" Z@ `@ K \X P\P (Ɵ0S00 X 005 2ş Z  0 K  P\P ş0S0P0 P(U 00 ` n2 Z 0 K "`X 00 7Pc)KP 0@S " b RKdp  00 R<4q0$20 00 8  K0  @ )X (X0000S0C P\P ß0S0P0  P)U0020c RKp/KZ V`>X<XBVPW U V00W00SZ x)X O&X+  X"t2 ,0S x,k(XT2 R P\P lŸ0S0P0 P(U  P\P Ÿ0S0P0 PU |X&UF ;X |X 1&XK;X |X0x"`A|q0FSGLAb@T *Xl (Q dȚX0A0EA0US2 " / AE'2`A2&  ]'P@ 0 0S 0S 80S 0$ @ 0, 80 `ldtՄ܄ ,aaD(AE 'P@  P0R }R\  300T*X 0S0 0 0☧U0`00C >X000 P\P 0S0P0 PX< <X>U&P 000 0x婧l1E` P\P 0S0P0 P-U0 0 0&U >X00  |U00S @0<X00>X'X2 JZ H ` 00C0 K"X|2 JZ `00 K}X`2 JZ `0 K0S ^ h_ H_ h_ p_ (X( "X 'X @TV2 JZ `@ K p 00000)X \X  00C000"X \X0 0C'X0000C`X  " \X P\P H0S00 $X "X X\0520S\X `X2 JZ `# KZ(X000 )X00CS0 P\P (0S0P0 P)U b@P a6000( `p 2 JZ `  K\X 'X "X 0 0m2 Z   &`000 K"X \X P\P x0S00 $X "X X  \00\X `X 00` )X |X (XO 00  2 Z 00` K 0 00T}X |X (X3 00  '000 P\P  0S  CX X'00C0D p-LM0P0`0@V:`p0T: -LM 0, !B0001 < 40 0 圥408 0<0 @ 80,` pcP\P 1 R0P0 PUR W U p0U <00c R<K @P`S UU( P\P 0P 0R0 P U<K U$ <  b Rڼ @P<00c Rڳ @P8 0 08 @@0 `M0 00C00,aaX --hLM 00CS08 00CS0$@@ T딅$ p-LM@<`0DSl0P B    8 $`4 ( , 0 p<004`00,(ꨝ p-LM,`,T- X 1 R$ R 00S  RXij  0S 00S 0S 00 (1  BqX0001( dP  0R@ S ,0@(0c aR( (@@D0S #   $0S R;T 00S $<0 0 qalh,܅ -0@L MTP@ T R,d-0M,_- 0, 000 < b0SH0@ , G 0 0x|܅؄ -!MLM ʟ` ,  PT( X8 \ d @ 0 S\ @0S - !KLLl Yh O \ SL p\P` !P@0 XH XQ ` R$ 0 B 0d(  h8S`` 0S XQ T(8R ,0`S ,f@!P@ 8!mK `F0`F(0 wxXPXQd( h8S` ((XePh` @Q 7 R!0AVS񟗆q Xr q r Xr Xr Xr Xr Xr Xr Xr Xr Xr Xr Xr 8r 8r 8r 8r 8r 8r 8r 8r Xr Xr Xr Xr Xr Xr Xr Xr r r Xr Xr s Xr Xr Xr s Xr Xr Xr Xr Xr Xr Xr Xr Xr Xr Xr s Xr t 0t Xr Xr Xr Tt |t t Xr Xr Xr q Xr Xr t t Xr Xr t Xr 4u Xr Pu Xr u Xr Xr Xr u u v ,v @v v B^KPEpPE0K K,0L+ Aw`XP@p06B^K PE0PE0&Rp6B^K PER$0#0pPE00AS00@SB^KPEPE%0 0 B^K1PEaPE0%mRpl&?l+B^KPEPE`%0D$l?l+B^KPEPE0%`}> P00{RPPU B^KPEPE0$@R~KpGpG+>}>PPl>l{+B^KPEPE0  $}>@p{B^KPEPEl>lb+B^KPEPE$$B^KPEPE+n>u*+LoB^KPEPEB^KPE0KpPEd8 ,LPB^KPEpPE\0EB^K PE;KpPEd( ,C@l>l.+B^KPEPE`#yB^KPEpPE0,B^KPEPE.)>P0p0#4B^KPEPE0*tP oP@ B^KPEPEB^KPEpPE B^KPE pPE 0` K,0A+K0+0BB^KPE` pPE 0H2B^KPElN>l*B^KPEPE"&B^KPEPE w =P  =P B^KPE@PE+= =Pp)+@)*v`=P h)*=P B^KPE~0K+KpPE,0A+B )* /P0/S)*B^KPE0PE 0B^KPEPE0 -Q0 S Sh`  p S \S0p)h8 d8S`00`8 $lD a!p  0X 0T -LM䡟䁟p@`P\P 1 R0P0 PV(x y xy Pz dz y #U` 00``` 00c R@P000  V[U(K8P/ P(0PS  b Rڠ0@00S(x0]P\P L0 R0P0 P0 `딅,a -1LM  0((0 $ (0p000 , P`P\P 0 R0@0 Q@000c R0KKP[T@` ]T`FTV T00,$ `ߟV00a p- LM0`S0C0Px0U  Q@@T0 AQ 0p$ P@ 080a p-0LM R 0 0P 00pphP0S`  0 0R@0 \T 0 0R0 P 00p@(0  0P 00paa 0-8 P0@0L A @=00 -LM0@=C0 0 c] -LtMJ< 0S00cS0P@$ T P0 0@TKPx0: SH K 0S 0X S `0S X ,'P 0@@aaaa0a 0-LpMP0@S|0lS`0 TK  P|0: S\0 0 00a` -LMp@:``PP :b;`PP%[;P@ 0T\S T 00U0L0 R T??;@&   @ 0@S P@1PSlg@0S P@1PS4g47 0_yP& -(000s0@:Pv&00  6 ! P PP @0 @*0SwmpƟp@P0PP T@)H*Dy&`'0@/SP< P 60S,6T  ' @`&7(\& '0US kUe%5Q00H&0@ 0S 0PP P5P` `PP"0S"P@T $@@)4p0S d ̀PK}P2: St 0`@S@` 00DSg#02 e0L0  媦$P0``P 0SK 0S8@T 0/%& R$P PUY00 0SH3   6p/00`%&zP  00 0@TL 0갲 0S DPw @$@  0 00 k1p00 } P P0c 0X1o1pSP00S 1SPGꐐ@jTe&#%9P  &0S 0S0S H!0SmKPdK P!$2R! 2R,9Pu 9Pptn@\ P wPPd0`.. [먞`܄ЅP 4"l8IĝB  ha̅D؄ x|W -TL$  @0 <0R4S0 h8%0wD(\wp -L$M< @ D0  00, 8 PH s @ R1@000  000  040 1VZP@. ,P,0 00S X00 4 0 0DS괌 ̌ ̌ ̌ 1D R&0 R  "@0S 0 @000 <00PU, ,0H 8 ,@,%,0@ L00S 00 40 -,0LM@(@@h -LM, 0 ,0#  0S 04 80  00S2 < @ <0S2  2YP@) 0@S񟗙 ؎ ؎ ؎ <0S@ \2 P 82 R ,0 R40S, 00,0", a2 Rh,08 R0S, ,  0 000 0<0SR,XP@. 0S40S* 0S' 800C80 8 R!d, 00T 0S ,0  g$1T 0S <0S 0S00$40S P0SP ,0  00Sy0@ h0 aC,Lgy@  0 ` ,l$@ P0-L@ 0S PP0 R @P 0S  XT 000%0S TT l,, -P`LpG P@pP P00 Q @ -haLPp0S  0RO" \ @0 R@BT0S80S W p0  h`V#0 R!0 P0@CTT WU_ ^h0 P\  0P$ : ' lh,$ p-LMl`PU \ @0 @Rk T ᷙ0 0PU 00p -(0LM@T @T -,@LM0 01hG P0-L@ (P 0R @T0 -LM/@P@r5P0 A'0P0 - LrL- X 00Q0000Q0  Q, -La 00zQ0A 00ZQ0ھ;\0;LD<4 ,@$h,I -H`0DpL0f@PM00fXP@a p-PLM`0P un@ᩘ@P u50p 0Q0-@PL0 00h|0 p-LM0`S0 00@ 0PᔘPf0P00p p-LM<`P@1S@$TpN5Pp 0-LM@4P,,P$ 0 0l; -PLNMP! Rp0PH1 `AT P$UHR?K kmQ?K-KAQH1`PH T0P@<`0S 1<SP$U(" $ l 0-L0M|P0@@Ktt0  R 0S $Q@000* 0S 0l - qLMPP0` 5 PP* P( 0S0P00S R 0V0U00S00 U 0HSx0x 0Q$`y`@s׋ʋ8{ȋöV 0000`QR lhD -L,MS0L0 0H S pP T W㸓 DK   pPO 40AU00#`B $?U sU00WP0P0 <#@0U @$T %T  0  koU<PP@ 2 V 21   R<V<0  L0 T 4D1S +R-R0S-RG D H R T0 SD1S  H0 T R L 0S $0S LP0S D1@S @1S``!T RDD L!Tr'D1 S 1 SD  0S0#0@0-S /dP 0-S 0唐 @6@( y3nll@0* Pp3elLT@0@S 00$T000aal(8 |>8 0-LM@P KB0 S  P00 Q0 Sp 0 0-L@PP 0 -LDM耟0QP`@$0 P$0 S $:l0plUP!P0dP@UdpK  X3P40p 0e@ -PpLM`@*0S @T:X00 S WP*U> ?U< [U) ]U" |U )UX IyWpGY00X00S |2P X pX Y X R0!S@ R0]S@ -RPL MP@p`R *0U5#SP QT:U0S d?S^ *S 0TQ T PE0 P0PS:< S P, 1 0TPES% ,0 S Z0@00  00\ , 0Z,0XP , 0P,Q vP@QSSڿ0CS P, 0TPES,   U0@00  00U\ , 0Z,0XQE\  D0x U ;P r, 03Pk sP, PEU0  g 0@ P ,0X , 0PGZp@-@^P`D R6 R0 ^ R 00 Q00S @^0]STp0-S0S \ Rp0 \0]S[Qp0  R   R( !^` P-L@Pp`*0S @T: `)\ 0W0|\00S V  1P``Fv1 -LM, ,0 i?B10Q , ` P@BpU<:T P @DU 00 00 P  00 U 00 6HpG@ , 0hC1 iBS, ,`   P 060  P0 0 0     -LM@`Q 1 PU$ 0Q-P0 Q -P 000#0+P0SPU00 -P  0  0 0:U?U0r ,U00;UppWj#Uh P0Pc :P. ;P, ,P# #P 1\ !000p01S 0!0 00! 001 p 10 R 00%1S00! ;Pp :P 0 00 P 0?00P000:S00P 0T HD0L0-SX^U0 00 ,vtzXt 0-LP0 S@5 0  0S0h0S 0\@ 'Se U 0S C  0  00SU0<0hPP0, wI -LMh4 4  , 00 @妒4q8 KPPP@DTX` U`V`P40c4p0S0W<0 ^ ~,@\8   00@T pNWP8o顒, 4 0, T < 0LT -QLM@ uvPp `PP*PU e*0S dv0S0@e PUp:0h0 -L`p PPZ /0#S+0@P$@ -LM @iP 00 iP00 p-@LMTP` wTP pU gP0  P000[đ` -`<LVM`0 0 /Q40 8 , P80 0D .Qq 00pW8p  8 R 0 S:S0 0S:S0S0g0 080YS 0/S , R 0S38 0RY 0c0 0 @ cRP @ u 0 SP/R/00040 *g @0 bRP u8 R00 4g0 cR@P ,wu,  P0 S/R/000.S0S/S  8 ꨝ0@-S`G /SppW @/P/R7 ^/ .^ QP R/R0 00S/S /^^  .^0/SSQ000 QP@ Q AQ0/SQ.00 /R P-Lp@` fP0 Ulp uT X0T L0hPϐ0P@@̅` -LM@mf|0     囐00 K 0  P 0P/0000 ` -MLM0ܑ0c0SpP, @ PT? 0/Sb S: /.-P`dU VO V> 0/ c 0 0c RPBNK ` P@Dt@D` ]P0`(K P/R P PP X@,0 S ,@0S 0.S0.S U0u/S U0.Se`0/S X -LM@p|0`00 0,0< (p0P qP@20 P00S 0`` S`` og gp[aW@, -PLM`lp@82 T& V`0 0,0$ (` p ` P gꘀ[≏x0\⁏00@0P3 ngP PP PPPPh -pPLM`l@*$ T P (0S0W< 00$  `  ,g\ #gP P PPpPPP -L^M\pP`@)T0㠀 0WB , 0 E 00p(Ppp PPP $0BRU@Pkplݎ@ 0- 0PSL@]P _`PP0 , 0, 0- 0PSL@ BP D` 0P 0 P0 0-0L@P  0S0 0  00 0,Îf 0- 0PSL@ P0 , 0,媎 0- L @ 0  0 0S[ :Q0a0 /"s0 P0    0h c$0 0  -@L P 0 Sw p   0:0@ #  = S , *@0  d0d@0 0 90   0p``V  "Pp``V@ 90 000S@ ;0 0W$ 0  }000@٫$00o@ -LM @   0S9 / &:0  uP 0S0 0S0:00;0埫0 00$ 0:p  鋫$00"  -L @\`PpK C :  W  0 0 :0  0rQ^0 ;0$ V ?SR0 e00  0Bu ? S Rp 0$00+0 -LMP `p* V# @T T@ /q0 `d d0V0 pX f0;-p @T 0 -P Lp7 WpG2 @T p) @T!  pP @0a@T@` ppW00 V dP  X@DD -LM @T 0S  0C 0 P 0S $X 0-L@P8 50u  0 Q)  Q000  0QS 0*A0 0 00: A0 PA 00 00p  0S p p-LM @`A v" + 0`KS" PK  <P P0S   ;00 $0p  $0 0\  R 0 B `0p    P0-L@P a 0h0 -LMP `pZ XS@T 0PI T@ o0 0 d0 `dpV&]p" VQ@ !}@`T`d  Pp@`TV  o 0 0f0 鐩0S 0 ;0凩 00$ 0X  --LM 2 -p-PQ LP@4MH`KH 0 0  @p --L4M@@K0B  u -L`M0VPD ,0 < @  @T %T  R 0 B @0D  D @T0D |8 ,0S l,@T 0DLSh d p P @TYT A0DS 0@%0DSSkX X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X 0 X X X 0 <0<00 <0 d0D,pK< S/ Q a@ @ 1!10A00R0guT @P-0+0 0(K0gC Y @Ѫ30#0 P0S X i @ = ShC @ @0@X+YD D I0S C  0  0YpIXDD 0S C0 @0 HXʨ}D00hD0 h0S C0 @0 Xj-P+P/ P- 0P 0@0S# 0C0 00 DIYpD 0xS0S 0C0 00 D p ID 960S 0C0 00 DpID $0gX0000gQ 00SN 00!10 ! g@ \pGX0x00<0倠 8pK0<0 8 K:<0p (1Wp< ^08@K8pK,}<00@0 <0@0<0 t@Xqhnlꀠi@fd0 b 0@D@@ @0  @10@00C @0 0@`FQ@ @E C$, 0-0@ LP0 SlPl0  R0S RR 010000 딅,b b0b -L!PP@`p 0S 0|R0P 0 T  0e@aP00|P,b0b -LPP`p 0S0@0 p0T d0T 0P <T2Pr@X,b0b -LMp, PP0@07 T`( U FT&T &T 0PX W  0pV000 ;T`,0S U(0P @,b0b p-LM@0S( 0 ER p`0P0 Q@@Q$T00 0h 00`S000 L0RP4 5*p000EP,b0b0 -LML0@S 80  Q 0P,b0b -LM$`Kp@H P 0b -(L  P 0}0DS L T \ 0  0  0i 0S|  @t t ` X X T L L 30#0P !  !P!!!!!! `0-0L@P^$$@0hS^$? -LP`p@ T(  , d    0 |    W@ `T"T $T \$(P 0S)P$((P 0S)"p"p${P @T }@T}P(|) -- L 0 -- LP4M@@K B 0 0 -P LR`p %R k R ;0B:S ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` `  ` ` `  , D ` ` ` ` ` ` ` ` ` ` ` ` ` ` |  ` ` ` ` ` ` ` ` ` ` ` ` ` ` \ `  p0  ;R   Z @T @D Tʜ @DT  pa@p  p@P 0Sx ?dRX`-X@-00dpPg 0S` -PLM`G y p 0 S P !00P @0S`y@PP200P @0S`y@PP00 P0 00000SP p-LM`P@e{y ph] p-LM@`P0 SD L L     T h    0S Tdp@P0SVU@ PEP0TVU S! 0-L0MDPK@ B 0 P$   0 x     ( @ l w0$(P 0S)$((P 0S)${P P P}P(| -Lp@PUjx0@S Px`00 R 0S0S1SP01  p-PLM`P5 P0P 0@S xPxP 0@S x0Sx P phxxp p-LM`@PT P 0S 0S{x0S@puxsxqx -LMLapPI00,Q, pYP@, PPP PP XWiI[#  oI00 x c@@ T Y[Pp[P@ iL갞LP"0"T"|" -LM@0SaI00鰞 p-LM`Pw0 0Pw0@0S000 L000 D@H@ 0 L 0Pp  -pL `L0P0A@TJ0S 0 @TZ 0 (Hnwhwj  \  p-LMd`dd n0PSpAW ,P1 S0 0$b` -LM@pP` 0[S 0S@┐ 00  @̟P^w g ~0p,K ᄴ,0 S*0Kw]# -L MB0( K!KP` 00Po![P`r00000  0   !0 0B0\0;00  710 R 1! L0R'8 H X $ H H H H H H H H d H H H H H H H H H H H H H H H H H | 1 P 0?00 00<0 0@ PpL0PS !0[pS 000P0<0(p!0[S(嫽,tbhP -LM@0, K%K@p`@00  Q ! 000 TP 0@L@T " P  0 00  0000%0[S 000P0<0,:P\,tb -LMp B a8    0`3 0 @ 0O#ODP0`U0 P`g00fkgP@ U 0 UBa1#  f0E  f00f 0S-00f C`rꨝ#D#pbgfff -LMK @p  p-LM@,50 R00SP`@B : 0Q(*u0 V0   0 00 0p0 00`K 0V0 H 0 0㿲P  㪼T p兼l## 0-@0pPL  0 000h@80/   ~0tb -0L @P`iM    RG  0 l!@Up0 00SB Q/ 8Q8-Qp% #Q, 0 % q0 0  R0Aq00  RWAq00  R7AQ00?$QW@d@T00S$T@` R XRxR00`_0ꨝ, 0-0LM @K{pPh  0 R  R0P  00 t0 -L M`@,J0P  0S082Utp   ` P P q00  R@PdU0n@P 0!0!!0eP@ 0S pL10  00S Q8!0000ӑ0Q 0S p00  00S Q 0000ӑ00S q00  R@ 0P  0L @00S  X,##x -LM0p }I` zI0P00s@ W@=  0 0c0 WZ os -LMP, 00 AP` 0[S =S `@3 R  % 0U p[0  , RV0 xᱺV h3s,  Q 0X40 @L , 4 @ )80 <   0T0 V0 S   v ,0   k 0 00 008 0 R00S@0    0T0V0S  <0S0  Y%@T4 R} V 0   h0S0 ?S 0S ) R MP 4  00 00400Z  s s NNDP PIP ,0h  `@P  @QL@00  Q 0 չl#"|, - L`p%60W00S PU 0@PrU 00WD0<0 0h> r r ! -PLM@ 0T0   R0 0Q [R P@,-0S00 0\00 Q\0[S 0S0 [S ]SQ, -LM@P0 0S00 -LM@P  0S 0=S   -1L M q< ,0 0 4 Y ap`VJPU 0 0 S" `VZLY4,0Q *00010 0 `40 q0@` DA qA@,@ 0 4  L@T   P000L@T0 4,0Q* 004 0X0@` DA qA@,@ 0 4 s0<0  0 Ri?괞 -LM@R $P 0 b -LM@> P h b -LM@@P: 6 h6 6 6 6 6 6 6 6 6 6 6 6 6 6 0<00<0?0 b0 <00 <00S ?C!0T <00< <040 0<0b b p-LtMPy@P 7 7 7 88 T8 d8 t8 8 8 8 8 8 9 09 D9 d9 9 BPt00リpXpp@ 42 p0<0 @ "@`@0<0p0<0Azpp0<00<0>!0<0w)psƇp<\0 ! P 0Ӫ0p p0  0 S0`PO0@/SFPK P0: S`}pLjp000<0D0 b< @0<0kl`b"hb -LM@@P-: ; \; 4; ; (; \; \; 4; 4; 4; 4; 4; 4; \; 8; \; @P0800h鷩t"pld0 hh,<@P  p00hl ` -LM` pE0W:00pPU 0SPU 0SU 0S  o@  k 0 A?U0@0 pP0@ 0 P]P [P P]P Ra -LM[@2 0Sd 0  h -LMpPH0`KW1S~ @1S勶# -LM Q#p`a0S  @T 0 S 빅@t 1 R Q 0T2 0T/ 0T! :Pą ą …뾅t @ XQ ^ 0  0 0  R X0 Q\@X뙅 Td{`{j -|XL0@ S? B B pC C ? ? ? C HD G 8h0Sr P0^@0[P\ XpR 0ǟS7 S 00BS7 0GSWW0 iP@ t@ @ @ p7 R cQsQ CQ  P  700BP@ A @ @ 6 R6  00P0S P 6  B P00 P``V10@<&SL00@``0  6p@p P 0 Sx @ @0 @C   5/T ` `  P{ p%0 0  R8% 01000C0E0 %0@00};10@S0 D0 0$0@0T0 $00v 0rp$0 0  R$LQl4h4   PY 0 $000 w($0  #0 00 B3  7 P00 PppWP  0P``V @T 3 DTS @ 0 0b 0  00 m@0P 0PV 3'QP  2H 2 RD 0 0S: 0M  0 0-0 @0 TT 0 0S 0^  0(" 0@$ 0 0 0 00  0R 0 @ꠡ괁1`V P q0@0  R`Fp1XV P q0@0  R`F PPEU q@L 0PE0`U 0 ` 0 0` 0? 0@T 0 R`@0 p0 l( 0 00_`{L{b{ {b sjb\wbsbl${ p-|0LM@`@Pᬰ\\0P P0D D0< <0@#ph`{ sT{s\{X{P{L{sP0 0 .PP  p-xLM P00PPPU@C H4 R < P ,ğ0S0C00@0 00C 00  c [ 3 ppß0 Q #0S0C000C0  0P0 0 ӷ0C 0 p0P 0P 4#0SP(3PT-DK K K K K LK dK K K tK @h0 Ru M00 pW-00Ĵp k  0pWur{jt{p{{l p-LM`@PT# 0dR 0@P0@pv0S0C0 vt 0S00v0S00<0 P bPv0S00p{t{ -PLMpA0S_ PWa$K@0 (K,K @zPPB H1($01 $0T00 (0@cT  R 0000 0 0@@,0o5,0 t{0S @TYP p300(Q 0ppԞbjX{L{P{ {\{i  -PL$M@`P㼒 r0S㨒 T0S PV0 ,K0K4K8@K @yyPs Ve `FVV80S940q 5`@M,03,0!0{P00SP 1T0 S/R  P4y|1|!x1l1l!@@4@Py1UpU 4@y0P PU48 v4y540P``pyx0 @ x00qQk D0@@ P[  00bԞji X{L{P{\{ { -L$MK0 K @KK @xP@ Yvay6 0 RPPl -T0LM @R 8 TT^h1u0u@@$ D9 P@91( K ! Q@10 `P00CS00Ӥ0 Pp @00CS00Ӥ0 PpyZYZe_773PQL 8 w,$4$D$T$l$MvM8T -0L$M@  H0 < x>H0PPD0 <W@-n>Pp cPdbY0SP| H b@T PP @~@bP..@~Y.D0S>-P5z00L{P!( 08K@8 0 40 ,0 *P-P @@~<-P$<~@~cz0-S @~L0S @~SzH00 0 R@~@~0;0<`H0P0!Pz~0z0H D0 i@~| w$$$$$$ -LM0 4 "{P; ,K }p# ,0.C4 {P ,K }p ,0 C4 NNlx=~l@ll 00{\2~8,$@4,4 00{%%%H%h%p% wt% 0-,@,PL $m i=0|%% -LM@㒤P 0lN 0-@LㄤPU 0SYN000 -LM0@S h頤垤p@-0PS00p-\@@T \ P`r00 P 0 R0ATap -LM0@SK P b 00 0-0@SL PP  0{ 0(0M 0-0PSL@0S00 RP0P 0S 0- L0@T  0P0Q 0S =S Qh0 `0 00S<Q  !Q >Q  PP eꔌ% -Li1% 0-XPL0S S 0@ S0 00똌 -LOM\0X,0 0P S ,0 S ,,wOKKK`VT NP W?K+!rPW?K \!QH1SD1 L1@X0P S Tb818S <+ 0%v w -Lp`@T TT#6P0S! P T0  0S T K@T TT K0ꘌ%& -Lp`PU U @0S P U0 0 00b0bPU U 0똌& -L MP`p@T T T TT T$KPKP@ (KFP; 0D Sꌔ X l l l l l l l l Д $ (0Rpp`$ (0Rpp$ (0Rpp$ (0pRp$ (0Rpp$ (0RppGE0D St X l l l l l l l l ؕ &Pppý&Ppp&&pPp&PppӤ&p阌 p-LM^`P0S p.T@0S 0S uP0S ꘌ p-LM``@0S pP0S {@0S tꘌ -LM@`y{X0@@D0@ R0S$|zjwv -@L8Mp` M\l2` N\X2@ L"[p5&LKTpK`H P K0T L` ;P@P00P0 厡PP;/ P 1K0H P0 T @@;P |XK<K <P800 pS080 80W@:0T@Z >\)<\00S#\! D`K 0  \C0[SD[0 CR 0R P 00xmly0 pW@X D00CS00  ä0 VC $&,&D&l& w -L 㬣& p-0LAM @P` Zp sP` /0 @bTQ!P -'PpっGOKPP Vv.PPJf&& -0L [0& -LM0p (0 g9P@/UoKK/gPKU  S?K\ 0SKK,L1 H1 D1 @1 <1 81 41 01 3J,KL0I< K)(0 S (d'$' -LaMb>K0C 0Cp( @%Pv$6: Sg  S-PW(0 S (8TJBnK`F`F|!|1,0S,@aD8PP$[NK@D@D  P(2W>C R0 RW W(ryu0S ,@8PPW d^yBnK`F`F+J0)0KW ,'D'edAtP't' w -LM@X {0s 0[-[*[T0G(at -SL Mp@Pt00!1/dP`!  V8Vx t0S@ 0P P* ?8W@t?00 \@a` X0P P* %8W@{t?00\v ' -LM@ K K 0K @@h9P -LM8 < @ aP`pm 4KP@h 4 0R SB *P`Z 4 W:40@#P0PS ,KL PP 0 1P@ U10 ` PP 00S0 K6\P 0 R ;;S PP 8P xPP 0< @0T lPP,V (\((0(D( -ML M0$ , pp+ P`:s?000!1 ,0S ,厡AzP@ IP 0 ^1P s0S08s0S !0BKHH F90@C/{PP- ~0@S" C0S =0S+ 00L? \ 0$ 0:]s?000, 0z$H((T(d(h(|(W( -L,MQP, p0K0 `ß Q Qq00  Rp0+S-S-S +S 0+S-S QN QLq\30  00S.^A0.S7 Z0PC Z48 "O1@K 00K @0KH@L P P K 00K`V 10(O @/r "00Z r 000S 8OSl,4`( &"0K`PP, P0 Q!000ӑP PUr"00 P pl1  0PX1@@K1`M% <0 ,,< {p4@0 KX0 8 Wm0K J80K5 B"4@Z$$ `JPU *0 K0 VP00KU:@ K00K ,@ {0@T0 {'0 0R00 00cPE: UcU pP/ꠐ(*C C , gfffQ p-PLM@`PC ph10  00S H100PC r0 0  R1.\P' *\\ 0SU 0B8 S('08C?PxAPPڌ@PEUp pT00  0<0S000PC r0 0  RC ڢC -LMp`#0P@ r %\P @\0 P@ -"P@2L MR0@K0 p` UsLz\Ō\pG   a 0a>Ìp4G6pGƃ??p`F R bЮ?Ф@A P 00Q00S Q b`.^L2a?@ C_`0 Px 0 P0x0Ńƌz(p , 0 KV10U0 30 P@,0 S 0 70 ? -L Mp`@P@2<K4K0H0S񟗦 t $ D 4 \   \  \  h D \ D |  P D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D t $ D 4 \   \  \  h D \ D |  P 8D3#cX Q0@ 0 KD0  DK5P0S 5l!000PKp DB*l!00CP3L#cX Q0@ 0 KD0  DKP0S l!00 !Bl!002cX" 00D0 ?0PKQ@  DKP0S k!00h Ak!00ŸH2D"cX 0QD0 @ 0 KH0S DKPk"00k"0020K00!1cX! 0QD0 @ >0PKA0S DKPpk"00lk"00ht10 KdQ814!cX 0QD0 @ 0 K(0S DK|PLk"00H{k"00D00K000 0cX @ 0Q@D0 00K DK\P,_k"00([k"00$GH*P*X*l*t*|********(D*****+++0,+0+@@0D cX 0QD0 @ <O0 KX@0S DKPx0 R k!00 ,Ak!000"00KP0 cX 0QD0 @ O0 KA0S DKP01 R j!00l @j!00x1!00KQ1!cX 0QD0 @ kO0 KA0S DKP1 R j!00 @j!0002!00KDR\2`"cX 0QD0 @ O0 KB0S DKPb2 R j!00Z @j!00Q2z!00KR2#cX 0QD0 @ O0 K8C0S DKdP4X3 R cj!00, t@Zj!00#3L!00KS3#cX 0QD0 @ 0 K`C0S DK6P@3 R 5j!00 F@,j!002!00KR2"cX 0QD0 @ 0 K0S DKP j"00j"00d20K00T"2cX" 0QD0 @ ?0PKB0S DKP1 R i!00 ?i!0010 KQt1p!cX 0QD0 @ 0 KdA0S DKPD1 R i!00 ?i"00v0 00KP0 cX 0QD0 @ 0 K@0S DKPY0 R i!00QL ?i!00HD0q 00K+4+<+D+X+\+d+x++++++0++?G?h!00,(24"cX 0QD0 @ .OO00K0/O %.O P@[PB0S DKPh"00h"00~0 IP O0 K00K0/O /O P@,P0 *P 3#3cX QO0@ 0 KD0  DKqPAth"00=ph"0093#3cX 0QD0 @ O00K0C0S DKRP"3 R Qh!00H b>Hh!003:0 KS3 #cX 0QD0 @ 0 KDß0S DK$P$3 R #h!00 4>h!00?0PKh2d"cX 0QD0 @ / Pځ?0KtB0S DKPg"00g"00o?Ÿg/ 0jP0 K0P@Q1!cX 0QD0 @ K0 K0S DKP1 R g!00 =g!00{S?0PK,0 cX 0QD0 @ 0KP0S DKPa0 R g!00Yp =g!00P 0@K G+++,,,4,<,D,L,`,h,p,,,,,,,,,- -0 -(-0-4-8-**$@h0l cX Q4O0@ 0 KD0  DK?P0S ?g!00 P=6g!00@0 cX QO0@ 0 KD0  DKP0S g!00H -=g!00 0&L2@-O@d4xB 02d @-M0Ѝ@4=> 0'2 /5. -L MQ@0K00#  0 p0T0P00S00#0 -LM K K!12P -LM K K!%2P -L 0KM#<$ -L@0\M0 0 L0  <0 ,00S00 K$ K+P$C C -LM`Rp @t%  P`F @pT`P0AS Q)0 0  00    p-LM @0`SPR0 S    0100p 0S Q0 S  0S0 .R@- P@0@ .\Q00Q0S@@ 0S0 .R𠁢Q00á? P ( 0 8 @ H P X ` h p x  plhd`\XTPLHD@<8/$/Z P" 8PP 0SB P 哵P 0S $481!`)! X0`X0 `0ᕯKS/K ڜ1S9 ? @T  0(KQ QMK0SMKPO L "3@(K0SS SQ u -o -iOK @D- b~P-?(K R!  W~0S -?(K R2S "R K * K*姂WO0 4.  MK0iPMKs P+ 1MKi P\W)  b RW0S NW L* 41`?W LD O- h3W0#S /W  R@\K 0@,"|@@"2@@埳P 0S"2P2tat 222j42D2p2222v11 -L,Mp`@ KD0K< 8 @ 4 0 , ( $ zPDP@  0`4PP @TDưD°L -LMp@P `p08K8 (P , 4` p7K0 8K (0S (m3 -MLM Z,   4 `a V $ 0P@Q iX1X1 - #Pp' B^KPEPE0$!@ }b`}V INK@D@DrP 4: S  R 0 50 ,0S , Pt $R 0R\ 4 L 8&` 3\303C L3X3p333 -LMh@pP` 04K4 $@ ( 0P `3K, 4pK $0S $ǃ3 -LEM@pKK, 4! K081 ጳP@  #R 00T-* R+ R) R' r0 0  R r0 0  R0 Qh#0000ӑ000\*0 S S S0\*0 S S 3000 \ *0 S S\*0 S S  \* 0 S S S R r0 0  R> \*00 S S SP\P 0S `` Pz0+Sd -S D 4zP0+S0 -S  PPUb ?? UP[|,0 S t,0S @S P K?K)`0S @S K?Ks)0SP @S  4.P`8~ 81S  K?K[) 4t8 0SP @S 8~ 81S  K?KC) 4\8 3 -LM8KKPp <, PP `P@ ,0 S ,卂P/K%>KH D LB @B KH L @B  -h@L0PSp`LP 0S0S  sL9f* 0-LPL @T PY0 -SL0S8P C P  PhC 00CS0 0Ӥ0 P p$ß q00  R@P#P Rr@ 0@S00  0Sw b ɻP q00 P 00_h 㹻P q00 P 00O, 㩻P q00 P 00? 㙻P q00 P 00/ ㉻P q00 P 00x yP  r00 P 00< iP) r00 P! 0 0 0?0@S0#S 0#S @0S0 P0@0| P P  9P0=SO0@ST @R$X@ ; >>>$>0@- R @P"R. ^" ^ #R P R R R 0 R00L0 P R R R R R R \Q0"S  -=LyP00 -LM8@04S0 ȨP$,>\ -LM,@0 S00  $ -@P Lp`V  !` 0-\@0A/LLZPUA/0 P@00pJ0@,( -LM\0XK,0 `PKȐK 8 P@D0z W(V2 i 0@*PP* 0 K0 0 0 p 0K K P@ 0FRJ`0 ,0S X,w"  0J8>H> -LtMPpQP@* #U\H 0R0S  KpP` 0R 0R^QZQ"VQI*A@-@0gS@ -S S +S0 XS00S 0oS$ uS= #  030100 030100 80 I@ -L$MPP 9 0(K0@K0! +< + @Pt< P 0< `H0  p50 0@ 00S.  4K40P R>0S bt?I"0 0V:`|tP@ `<$0=80` 0Dt 8 a0AS"N 4O 4O 4O 4O 4O O 4O 4O 4O 4O 4O 4O 4O (O 4O 4O 4O 4O 4O 080 8 C. 8 800p+WP -W=W80@ =W  0-0PS@LrPPr PP0P -LM0`Sp (KᖤPP (QC 0#S@ S> 0 S RA(  # P0e(0 ( rP@} (  (0PPPP@ P0 S S0 S S AP0P0,K M,0S ?R0Sp0PB U 0@S  R00 RZ@ T 0S 000 ! BX @P@ qPP 000  bRF0@NMF0@001qP0LP 0V\C 0C -L>0SC <\k*;h* -LM,4C8̓ <.K #h, ?KKK@D3 0# p @ |> -BML Mؒ0,, 0@p CnK`F `F nB2(K R 0PS 0fS bS PU0S,0 S ,rXZ  CK@@0A"$1Q ` a @a _ BK@44!@oPp BK@Ƞ@ 0P @oT 00Z00S  "$00R00S o8BK@<@44@ BK8>>>>,- -LAM⌡0,|( 0@KpQ BnK`F `F n|<1$K R@ 0@S 0fS5 B^KPEPEbS  @T0S(0 S (qnpW0 ȠN0S PoU o*P, !I D ?,- -Tp`LP6_P@ 0S 0S0S >C -p`LFPP ^P @P VP 0S0S C 0-@P@0LS00$ 0000ҡ\?C -LM(@0S0 u00C -LM0St (K "Q@`Tg ( 0 S RL0L(  S *u (0#` @Rq PU`@0S0T`ÅܢPP `0 S S0 S S ͢P@00TP@ 0U ` 0S  R00 R@@TP U 0S |00x0V:\堢PP 00PP@Ņ,,PT0S3 0CS/<=v@1 ,0S , k KI  : 3]KP=KXKL00L0 60[S0X K60K#@<00Hpp< 0 xC 0<0 -L0Mp0P 0 `@ LKL@KD00D0 Q Q <00 0 S 8 j, HQ"t,t,t, -LM^8K- 7<K@ K0 <0 =p` P" PDK@ @ `@KvD@K  @K0 8K?FCB 4I*: Sb0 d Sc0 ] Sp0?0 0r0-00w0-00!=@SL CS-0> d! r0-0 0w0-0R00 &R-0! (!r0-0 0w0-0R0 R-0 00 0 R 0Rt0T0x00 R 0Rs0S0x00 S ! Ss0S0x0 Sd0 Sl0  S-0 Ss0  Sw0d'*K$*!*%* M-L(MPP@0P HK;0D0 ; Up` T LKP:L0P p`R 0S  0SH K1 0;D0K!X p`PW UTv W Vw;0"S{;0"SC -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K 0KP@@K 9<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S N:"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`Io * *R0S 0S0S0  R00 *' * -MLM00ANK@D@D+_P WHD -LMM|pANK @D0@D`P+ 0 HP 0@ $ 0S  RdTD -LMM|pANK @D0@D`P+ 0 P 0@ ( 0S  *d\\D0PP0 Br 0 B\0 r 0-0@SL 0 aPU ,0 S00P03a 긮 0-@0L@PT ѴP @T00鸮 p-LM0`PU aaTP00p鸮 p-LM4R0b0BP`(` 0St 00P 0S\ 000 0  0 1P0 0S8 00P 0S  00 P 0S  0 0$0D!$0<1p0`E  0 ` <0`8  0`/`0`)  0` `0`  0``0`  0``~$v   -L M0`S$ p  :S0 $0 0pS PK%t8l8\8P@ (K (0S p00R0S 8P@  (0S p00R  R W1 $ 0 0 z8|v8lr8d Q T1 R 0S0<00  00  0 R 0 R0 0 0S 0I8E8P@  m(0S p00R0SP X.8P@  V(0S p00R0SP$|@uv  -4L  0PP `H@T T 0T,S 0S P cW_W  0PU  0PP  0PPPE p-LMP0 S0 `@0 P P0S&W0X S0L@0Sp00W W W̮Ю$ -L MpȀ@0`SP(@ &\0  巭P 10$ KtP(K⼇ῪP  (*D0  $V|̮$E ЮDL@-0S@ @ 0 0 0 Ю -LM`Q ^( @`p$ 4 0cPB ( K10 P; (P6V00T00S(0V0T00SW WP P0 $%@4$ 02P $ 03[V$K,$E  --LM -L@`p#+`0 XXPПT  8ҽ8 $0ޟ  忟X0tz --L 0-<0@ PL,,妟T 婽 0h0 0-0L@P 0SP0 CR 0P0 00R P~* 0 0 -PL4MPL p` 0 SU@P X 0 S L@P L0@KវP\!H0KQ, < 8 4 0 p4@HP D `` @0)Sn6 0  ./ }+0U# >E0CS <0pCaH0S  j H N a 0H0 L0U 0R*0 0\){} 0-@PL0\*ql0  0!0S T000@CT00^00S 0 u -LP0SPp:qP`\&*0^S00p\*0]S -S \0* ]R S*-R P0]S-Rx \*0]S :0SS 0 0@SJ0  t0`2  00SH@TZ 0S?W"  0SJ 0 @@000l 0\0Z 0  00 0 B 0SP  h hb  P  000  00 -00-0 -  Pz00 -00-0 -  h00 ]00]0 ] h ᤔP & P0S1*8  㗔P+ 8000HLPL -@PP050#-SL [S0 :Sa =S1  pR*0-S `WW  0 00 \  X\*0]S -P0`0 `0S0%*00-S]S P*0S*0=S .0]S00$P*0S0"*00-S]S 'P *0S*0:S 0]SP*0S05l:o h -LM @$Ap\ *P q00  R@ `ePi ΐP0S PP PP  000   PP0S 50PS -LM@=>0 00  0- LR@%*0S*0[S 0 0.Q00PQ*0S*0.S [00]S00Q R* -PL@  R)* P*0PS 0]Sp`ePV , $P0 R 0S錱px0   0 R PX 00p , 00  RP x p-LM0K KP` 0 ]0@K0K KhP`p -0L `@8pP Put00  00S P h ]0S04  4  p-LM0K KP` 0 ^00K K]0 @0K K$P`p -LMP`@p0SGT1 T00W0 W00Si      P T       $ < ` f 00   f  f5"  A,  i f0   f  f"  A    @`pG f 0  f  @D @D`q0 S ( -LM P p0 0@W` 1R VL@0S P0 L0S 0S @`P  R Ϡ>1*!">00c # Ϡ j ,@ LP@ 0^?>1  ^0L0@LP@ 0@0Lp@-0`@  ^R *0 00  n^ :0E\  00C 0p -L M, p0 0 S@"* 00T0R00S P*`P0 00 R0#S P: P @ T:`@ T*,,0p-0 R*0 R:@-0@P*0  \: -LM@`p0 00R0KPU@  P g i速 0S  PiKL- 00/>\ 0S0\ 0@- 00>Q\@ 0R0\00 -0LS8p`0S PU`P 40PU040@0 S @TP -`RL@PpR 0!j000 p-LM0@S`P 0\ 0  !p/ p-LM`\P p@  A 0S0 0H0SHP Z  e! B 0A0S 1>3 01 0-0@SLP0 :K0S @ 00h 0-0P0@L &K0S 0 0 00 0- LR@00>#R0 (R" R @0Q@PR@P0JP< @Q >3SAQ 00@0QLR RRL>31>#R R "RR R(00(000S0 0>3S S S\(00(0 P L -LM 0R  @T p0R000PP P<PhkJjJhJfJdJeE -LuMp0 (, 1 JP`` JPPR 0@x1 0$P}K@{K 0 oK. ́ ȑ q 婗uK "P? 1 pIP@ oK 0 ,0S ,L0 10SII H0 @pI 0gpD ̴LL -LbM⸠0JK(0 xp @)@KpZ_K`P TjKjK11 P 0S(0 S (iLL -$0L!00  -LMp|# 0 0  R4 УP n@j T#1PU%0\ \|t3  00SXH3 /\00\0SP.\ \|3  00S0 0/\P- \ W u0i U ډ>i1!X H U r(00 0S PSPSPPP0i!UPQQ20  00S W䡟`P @j T! 1\P \|1  0 R\ Uڶ][i0XSxSNQKq(10  0D0SB X0P` 0\7 \5|00  0D0S, |  0 0  R \ 00ӑ@ ᙘ@dT0P0U0 XHm 00P02 p( UHE\OhOOHOO -LM0  uO -L M@ 0@e PR*Z* -QLM  0K  0  , 0-LP@p P'p U T 0\ $pP U)SN -L26\P< -LPpPpp,> -LM$0HPPp`=P@ 0 $ 0I00D @0(`0 -PLM@ @=T 0-00L@ :0S00?0 00=0>PP 0S P= R D0P00c00 R3 SD0Q00c000S0 3S 0-@PPL0.0UP1S -LpM$`@P R KHPp 0 0R, 0R ]p00YV@U@p  PP -LLM` d d@` @d@ h0 \`K$ h0 PpW:` <Q U@ * 0dR @T`05<5:T 0 00` 0 0Pp$0(0,0 0LPP d0S`@H0SW 0 P0P00 d\ Q D0^ "0D0^`H0S0 t `0L R0Sf R0S]  0_P@ E U 0 CPU 0; HP@ d\ 0hc/0cOdP^*hP@pD0^ 0  d0^p@P:PP<<TPP\< F<`@L  0%0D6<Pc`H0S[b<`<`@0\ PPp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0| -LM0Q, `Q0 AϠ lp 0 4 00XP40`l ^0p U40 @  U V  Vs T e42W  U' u "0 0Q_U  V v 00QF_VD  U u!0 0Q%_U# A?G0CS >2,0X  R 00  @P4  0  @0W  V v 00Q_V pp0  @@DTʎ0 00\@\ d0Wpp~ 0w0r ,@pn 0g -LM, 0 0Q0 `Q0AϠ l040 0PX`lp U@  U V  Vr T d02W  U' uŸ 00Q_U  V v!0 0QE_VC  U u 00Q$_U" A?G0CS4 ><,00  X^4 00  @P40  @E0W  V v 0 0Q_V pp0  @(@DTʏ0 00\@\ d0Wpp 0x0s ,@po 0hG-Q0`A $ P !>3Sy < S7 S S S Q@3"Zp0   S S0ZS S S0>#0S S S S "S>0!># R0p !>3 S >3 !>3 S&S S\0X0>0400 S2 aB0L~ -LTMd h h@d @h@ l0 ``K$ l0 PpW:d <Q U@ * 0dR @Td05<5:T d @@Pp=7P$ 0 0( 0 0, 00 000  4  0SPP h0Sd@H0SX 0 +P0P00 h\ Q D0^ "0D0^dH0S0 y d0L R0Sk R0S`  0fP@ E U 0 FPU 0> NP@ h\ 0lc/0cOhP^*lP@pD0^ 0  h0^p@P:PP$666TPPY6$6 t6d@L  0'0Dd6P^dH0SV66$6d@0\ PPp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P'` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0| -LMp, 00 Q,(P4 0 8 0 Y_0000AϠ0 P0P 4 < 0Y04 `O<0P 0 V<0 @  V X  X T sp2Z  V' v\ 00Q_V  X x$"0 0QT_XR  V v 00Q3_V1 A?J0CS$0, Y00R0S0 8y0 4t0 80P1P<  0P00 P P0Z  X x 0 0Q_X 긠00 P@DTP0y 00\@\ d0Zo 0h0c ,@_ 0X -LMp, 00 Q4(P4 0 8 0 Yw00 000AϠ PP< 0`Y V @  V X  X T 00 P@DTP82Z  V' v$"0 0Q_V  X x 00QU_XS  V v!0 0Q4_V2 A?J0CS$  0<S 4< P ,Y 0 80 40 80PDP< 00 P8P0Z  X x 00Q_X |0wX0X `0Z@n0h0c,@`0YG-QM@p(,P >3 S C S> #S S S P@Ѝ3"Y0   S S0 YS S S0>#00 000S S S +S "S 0>00 1>3 S 0   0S0 `>3 S >3` >3 S 0&S Sy`0\00 >00`0 S00h0S0`@Cca@-M ^@ P`pX\ Ѝ(@ \@Ѝ@@Ѝ@eE1* -<5L|MHK0 @K0PuAe/@ L L R *0S0L  L 0|S :S 00$@$@@L KPڄL̄PX00 LP`: @PX0L0P K@X0pP0<T K(@(0T0X K@00X0\ K@,0\0@L K40PL d K@p00, d0h K@80yp408 h0l K@<0op6[>lp K@4gp7[0Pt K@4_p7[04x K@4Wp7[0| K@4Op|00 K@P0Gp00 K@T0?p0: K@07p0,K: 0' 0K# 4K!PPPPPPPWEVܷP p-LM@PQ` qX0  0Ppph^O`P 0S0fC 0 ጸ p-PLMP`@ 800s/PX0P D0 P p0S0@@/@-0@P :P00P  P@^ :T ^0@S ^:^ P 0^^ -0ML K0 -!ML M@ ^@ , < D8 h( J0SX tV P .P' HH 0 ST( k D8SP   0X(P L B^KPEPEX( `X ``8 U+D* R$  0hK Vph:%/P`X.L8S  00X5 ,0S H,1D;V0V\S`F P0\00#SS iPh^ P T( T8SH0SH T^.X(R0\8 d= PPv @0S :S@00DK@KA @H(D8 @FpEPPg pNP\( p:0\( 0d0 4HdH 0S :S@d8(0l c8( 4H @0T:S:008( 0f Pa8( U 0h0K.P0hh h 8(` p@  i48(dM.`DXG.L^dB.KD啶L^9.ED勶L(Rh@0AZ0\<(^\2G.PX' Do)P@@`H PL\ T D P( ).DX^KHPEPE0!' P@*|1 R H oPD %X(L  P 0塄Pp KAA CXPX -0V`@-PP  0P@( @<8PFPy`` q-P  00`HH L (Q0Q4Q -LM@p$ $`K ,PK 0 p P , 0S0$ 0C0 00 R  \ 0 S @0:SS|S0:S|S S  0-L@P0h -LM<@0S00( (0 00 -ML8 M00ß0c S0, S8  sP "0S0@04 KAA_P@R 08 0 C0P  |20  00S p0 S\R000:S #S <Ÿ ^0 S\R00~KpGpGP0 S 0:S  \S 0S0g d;cR0( *08ZP KAAJ_P@ 080CP 0@~81@\ 1 ,0S $,S/eBNK@D@D0 08 0KA80 A@/0S@2Pn 0@H @00P `S_PK08H_P>. 0 XRxR @@00 :S0-LP 0:S0@0~@0- 0 Sn@SC -LM K"占vtO;*$8* -LM0`=S`pPጷ,K;P@; U逷 P:0P00@S=S 0S=Sg! P,@*P 0 ,0RA 0=S 0S0 0=S=000P0 @0S 0S` `00cC Q*P@ 0 0S 0 @0@, 0B  p-L@`M@PKΏP 0! 0S0 pB -LM(a0Sp=QQ 00 !1Q耟@P"0 !11j?0**P  01!0P0S00F*@ P P 0-L M@ᶶH0P (0 $ 00K K(0@  0  ,P P 0=* B9*A`4*#1*@-@0S  S 0Sd@*(*Q0 fA 0bA$h *$%* -LM< 08 rSwS@T 00  ), ,0SZ 4K٠PTpPH P < 0rS <0@4,0@, P,00,  4@00@T 0@T< 0rS 04P 80ME4б0@4̱T 4ñ0,i),e)4II -LM☀@`T 0S `@TT #$pK pP0S V00007)u$ -0-LMP0 S@   R1 00 cQ  R!,0 ŷ 0S +0B R -0-LMP0 S@   R1 00 cQ  R! ᐷ 0S +0R -0-LMP0 S@   R1 00 cQ  R! 0S S+0R -0L MB -BMLMh#0P,0 0L4  0S X00,3 ,0S ,*+/{PL$H$ K܍2P@@00 cBK J JH {MK@DPpP 0Srϴ`0CK0A S A P2D4 H2@ K0C0C0  A  Զ00C=S񟗗H~}}}}}P}}}}}}}}}}H~H~}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}H~H~0 S  1S!00 c0 p{C0L4 dBPnL$R 060S3/R"4W R,RB 4I@-@^  0 S SS00N0 --L  0-LM@P|0S 0}0S {0S  {\ 0 @@Pp -LM@`P{P pWW0S `U @YT :0S ''000@0PTP:@T TW&PP  w 0{S -PLUp`@: PP@ U:` `       --L p-LM@P\0X T`EpT < G000 &Sp ph3p0tz -LpP4B,BP 0S20ZdWBbPq  PzU0S(Z @PP zU @Z @P PP@UT mY m|  yZ /yP@ P& 0/S! `g0 S 300 R @pP /P 0S/SPU U @P yPU @ZZ $0 偋Pz vSX S p-LMxx yp@P`\yPP @U8p @`@P 0F$ P @P` xS -0LAM p@P0` 0 uy0S 0 S v(ey0S _y0AK @S@l  :yLL0Ό0FS X <SS< p-LM`PP@ 0S@T 0S@@T 0S$@p/xP <S< * -GMLMⴒ0pP@,0 ֽP.00ŵpŵA0.S +x P?@#2*/P P@8 @P0/S 00ɪP0S- IKAA-P`%4: Sp Wʼ!\P`ŧ0@Uc@,0 S l,'>00 SA BnK`F`F+x P0*IP 0/S+ p1(K R m@jР@@ TW +n P+n P *P@?00Sp RP4@@ 0R@cW8Tv -PLM Q    0@+ @CZ$PAp .0@0K +P@ `00  X @ K|P@  Q00RPPU<0S :   $Pn 0g`0p00 .000PP_ KPZ/000Sx BPUh 0.S\   .K7P Z 000S0 S0 @c0Q00TQ4  2$0P a 0 0@b 0 @ Q /00b  00b0 M00 0rQ#XA #"00 0S 040. S0SZ 00PP 0 S/00a0 a A# 0 0;0 q#P    p-LMP ζ`V p 0@ H##ܫ`ỶJ 0-P@L"wPe0 -#LM0,0 H pp KP@<2: S ᮫500(3 ,0S ,& p! #P ;#;SP "P@ P 00p"#vuKlPDK hPP 1  0L2 PP2 ` UP L" P L" &#L2Pe@P `k  0sP@P``POP2 0Pb@V*0f0  R R0S Y@V:Y0s"P 0L"0c 0 0 8 !0@ST"  PT2S [vP TR 0@S 1SP "  HppP""9P"Rf "cDT -L4Mp, &$W, Q< , R0, & BX 0BX0 嗃#(R@40 T P?4 P0`Y 00  Y 0AQ0 X`P&TP @0P UR PUJ P"0Y<0 00  Y 0L\0 `g@g' 0L\0 Y 00  Y 0L\0 P@g< ' 0L\0 < RV 0 b0hP,0P㗃#40 Y0`; 0@P0 4@d0fgP!P Y0` 0L\0 ^ T 4 , d/  0  0L\0  0@P0 ʿ,0T`P0 0V*@T%Pg PY 00  Y 0AQ0 @' 0AQ0 P`0V: 0Y<0 00 0 0  0 P Y0 0L\0 0' 0L\0 ' 0AQ0 4 4P4 P4 40P01@80  8P@ Ph PZ 800cD0 @ 8PP? P10@4 ` aH 84 HPa P4 P4 k4H H 4P4 PH4 40H P D D0P0 PD D0P0 P   P P  `0VL *@T%Pg PY 00  Y 0AQ0 @' 0AQ0 L`0V: p-LM@ ^<0  00S 0S0q>  0 0S 0 0C`0P %T 0S 0S0 0C` 8t= ,0S h ,!ҰP 8\ @pxT5$,8888888888LPP@(DPPPPXd| @j| 100Cw+@@# 0<3 0S_@0q:  0 0S 0`0CS0 P LTPZ @ T *000P d X1 `0 j 0 0 43 0P4C8@4C `8 Z KK @0S 0 0CZ @ S0 RT `ʯP T4#0KKQ 4# @ 0Z0C0   0S 0 R@X 0083083 ꠯P XZ@&43@4C @0q48  00S 0Z0C0   0SyP 80d`08 0[0q7  0 0S0Z0C @0 SXP d7JZ!3Kg @+0DMSaԫԫh((<#R0<3  @00CS0000CZ 8@XXTxT/  3K0l`<#3K@C 43 4  43 43 8C@8C 43@ 4C  43 043  43 4 H3>KXXᡮP 【<x$00<3 <`$00S<3 ʦ<3 S  3K0X <#  4JZ!3KL @+0D:SF꼮̮ttttttttttخخ@00CS0000BZ   2@xeTET)8 3NK0d>3K⑑ MK 43 @04 8# 8#  43 MK 43@ȡ44 @x3.KXx3>KX P 【  <  S<խP P!@0@# KKN@p@@@@@@C @< ylP 43 43 `4343  @4C 4 `|@"@C @UX@ t40  0PD B$ @0T8  @-^R  \R n-\ @\00]\0S  R\ A]\ -LMP pR0 0V@ ံ000,P`dp@V p 0 f0 0  f -LM`0@0P 4p净PP @ O4@0P PP _;040Pp0@  pWZP p0-LP@= @1 RK 0 90000PS  40R 0B0PB0000P 00 0R0 \0\S  0B@00< 8040BP00 L0 0ᔵP0000<D 0-P@LT a DA0DSR0D@TP0 \(PnP.T.Q0HU -EMLM@H$ 0,, e'H4 YL h Pl4 Y t7 ,0S p,Q!4 $Tǟ8(<,"(S\$ D ` 0 l APpDP 6 0YY`  \4`$ P T  S\4`$0Cd$ \4 V:l6 D 0 l APpXD(PR `V)*C` VX !* C`V H*C`V x*X4S TJ `\4CS\ d$R00V0#02S`4S T PY? L ""`$00R00S Y! 0S L0  CKA A$HsD4p cWHtmD4 0D$ YYX^ X$ YR X Q ?;@ 7;p X4;p0% H$P Y\ YY d^`` D/JPD3 WX^/ `P" D4 0b3 RD :dd nl3TP:hQh ecT4  T4 妥`D40D4 D40D40D4 <K h<0S80S40s?2 D4%P8YDlIP%D4|H$D 0 l @PpDcPdd ``QD4!0 2P^D45p#04P 5wy D嵥pCNK@D@D 0h@Pp:Pd40d4 ᜥD4` cpWwlD0l D4 D1PP*CNK@D0@D 0?@PpPd$ d$ D4P0P mD4`p0D4 fD4p cWdd ŲdlD$H0D4 DSD$p0D4 0H$ VYI D LU$D %XUxU  0-0L@,|_0P   0S 0 0}C0s0I D - L M0P,40` X X0s. 0kP  q30   00S 0@T td3  00S.Q q0 ,3  0D0S}:\D ,pKn a,0[S6 `S@ 0fS+ "bS @TV0S P Ƞ 0B(P 0R` ySX`  k,0[0@T t1  0 D0S:R .R 0P.S a GP, ikt!tt1T @0 @`@D1  :JkPz0P.Sl  ^GP܀,@k < 00 @@0 0@v+t0K r(PP'h0 k/00c0rBp XI D ,-$(D -BMLM38 0,, < 08t XZ80S XZ8$0S R80s R S  0S S 8$ p 8$ X X0 SB>K0C0CX@4 .K Xt BnK<`F `Fn J2(K Rb 0pS@ 0fSU LbS @TW0SH2 ,0S @,P Ƞ@ 0&PP&@$ 0/Pp Q  8!0X0P 1 <$0  0 0 ySX8 p8  p$ Jj@dP f0 ,  }P@`PUZ f5ju~00 0 @0@ P@}bk/00Q00SS (lAp 8 -kI D U(D ,-UU> 0-8P@0LS((LI0@0}Iꬿ\U 0-,PLP 0@T 0 @ꬿ -L M0,똂4 0S ,K HP@ ,0 S R@0@,  S*H  ,0`` @#R #iP` JPP q` EPU, 0S ,0Q1 p 00 S S0 S S 1hP0``JPP 00U 0S  R00 R@@TP U 0S @@4 0 0@+0K 0 0VP4/JPP @ WEPv4 0 0,0  f H0 DDHP _I D $*pIP@P7 P %D0 S S0 S S yIP`@ 0 SP P`+U`T 0S  R00 RPPU@ T 0S PX000 R X0W@4EIP@ PqhP $0W`4\XΞ    t@@0p!lL0\S@0 !$ 0^A(Vp0G-@M`@<T8 40 ğ0,`0#0c0, `0cC 7?04 #/(00 ( ~- 0 ~ " #~5 ~ !~7   ~9 / 00, ,: "#:0:"&!*  1 !00H,x P `@p` Ph%%),%\P0!ē @ 1 )Wh _)| 0* 0 ` 0+p0 `08000 @`@1p0lPz0p[0ˌ0 00400@Ѝ0p0P  p -LM`0(K\p@P.  0($ 8 ( #"., K00K, `0@,<4 Ġ̌(<"4!Č <.̌ (0 $ t -LM0`$S@ 3 R (PK0000e@SP0m _Rl zP `P;@ ZP@P5@9P-P.@0zS `S;0C ZS@S50C9S-S.0C0p 0@SX, K00KUPP2,pŸ * =? 0 7?0  ?0 4 [,  9?0 &?  3?0 ? 000  6?0 #? ?00P 0zS `S;0C ZS@S50C9S-S.0C0 Rp 0zS `S;0C ZS@S50C9S-S.0C0 Rq0S  0P0S 0 e0#R0L@0SP0SH@ b᪛@a 01S 8@-!P.*@0 S0ԧ S ԧ RQ 00C210P*0SԧQ <0 C120P *0 S ԧ R 030P:Y p-@L$MaP2 ` 0( uX%X@ ph\Z -LMp0@P 0 0`K 08#HT UPUP#08  0 S  Su8dZ -BMLMr0D`K@P ,0 02S0$S aS@ t,0 S d,,@0$SQ= KR K0Y@ P TKBܚAK`Z0(H K:K4H  K@TK 0i TN:B]KAKx1 (PE(I(K @PE6I @T@ @?T@BKCK!"41"",!1AK1@TPZ$ @20@0  @*K0 'uTK { rK @TK  T:ktZ<Z\Z(0@-"Q*|@P0#!0\ "0'*0#" \ ! *0##? 0 \0:00000YE-0``&&&C&̠O 1t@X 00#0P 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 0$0#0 0#P%%%C%̠O 1@x 0(0#0 0#`&&&C&̠O 1@x 0,0#0 0#P%%%C%̠O 1@x 000#0 0#`&&&C&̠O 1@x 040#0 0#P%%%C%̠O 1@x 080#0 0#`&&&C&̠O 1@x 0<0#0 0#P%%%C%̠O 1t@ ̐0@@0#D 00#P%`&P`E-D0``&&&C&̠O 1t@X 0@0#0P 0#P%%%C%̠O 1@x 0<0#0 0#`&&&C&̠O 1@x 080#0 0#P%%%C%̠O 1@x 040#0 0#`&&&C&̠O 1@x 000#0 0#P%%%C%̠O 1@x 0,0#0 0#`&&&C&̠O 1@x 0(0#0 0#P%%%C%̠O 1@x 0$0#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1t@ ̐0@0# 00#P%`&P` 0ZH0@-@P!0\#0 0(S"Ƞ0 -L0M($@KP"h0dp 0 8#x "W 0@2K,0 00 p,K0K  H,0 0("x00W0p@d  608 0#H,0T108#xW -L M((KⴠPp@"hh   0 8# "Y 02K00 40  z000# 00 s40 0#0K4 K40 00 0("04 Y @  X000# 00 Q40 0#0K4 K40 08 4#H00T108#Y p-LMH`P*$H ph? (-"xPUL`@: 08#XU@: (-"xPUL`@: 08#XU@: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 a,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 d,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`5*0K0 0#0P0 8 Ƞ<̌ Č40 ,K ,0 0 ,00 ,@[0P[p##Ġ"" #8"(W0@ P`: -`CL0V Mp@CPC,K0K6,K0K08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0Q`FVPE@D08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0QR-D?0 \ !Z -LM@t@ğ0 8`, y MP 00 0S$S 00R5:0PK c \ V K I  ? 'D\@ @'(`@ ?0(LX\ @c@@ '<@<@ (H<@ [H@ @D@ - K(DH [P@ @L@ . K8DP [X@ \/ KX [@@30K`0T@ 0 KP@ L40K, 1K2PK 84K ,0(S(h , 0k 0-PL@U !", 1#80!"$ 11PX 0h鞰0 -LDM@@ hK p0(h0 0'00 * 霠 d0  (  ly 0)pgz p`00* 00H '臠\  )  $0( jX 0 0'00 * 霠 T0  (  x 0)pgz pP00* 00จ '臠LP  )  0( jH0 0'00p * 霠 D0  (  Lx 0)pgz p@`00*00)COH臠 0'<00) 00 ( j8  '  ܗ0* 霠 40 0(00w )pgz p0  *  0'臠,00)00pd  j0*00(00LP 靠 0)00*00(w< p{ p 0'0 0)00hh0(0 0'00টT  j0*00(00༖X 靠 0)00*00vD p{ p 0'0 0)00th0(0 0'00T\ j0*00(000H  靠 0)00*00 vp{ p 0'0 0)00셟4h0(0 0'00ȥ`  j0*00(00कT 靠 0)00*00uH p{ p 0'0 0)00\h0(0 0' 00< j0*0#00 < i 0)0#00ud pz p 0' 0#00Xh0( 0#00 ꤠ0*0#00औ4  i 0)0#00thpz p 0' 0#00dh0( 0#00H ꤠ0*0#00,\  i 0)0#00 tPpz p 0' 0#00샟D h0( 0#00̣` ꤠ0*0#00ଓ i 0)0# 00spz p 0' 0#00t h0( 0#00T ꤠh0  (  0 0 i *s pg{ p00)00舠T0  '  ̢0 ꥠ( ଒\ i 00* 00r pg{ p  )  l 舠d 'H0 ꥠH00( 00$ i   *  r pg{ pP ) 0舠400' 00༡ ꥠX0  (   i <* tq 0pg{ p`00)00P 舠D  '  (  0ꥠ    xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ*#** -LM0p@ LP ϭ00 00B S0`Ba0B\W`BA0B0S7`B R Q\S P Q'(,T88@TTT0U0P:0`d00c0CV0`ąrppp0d0C0pp -LM 0@Q`pPT*.X0 R0""00 0PT:400  0 SP:00H 0-0L M P4 Zx00 p@, S0(0 $@ N0 0 P I4K0 0 ?$$0  B 嚫0l|`@ 0-0L M @RP0 R|0 4 #l00 , 0(0 $P 0 0 @ 4K0 0 08kD0l -@L^PF0T$p`0@έp  0St0t 0$&bRB`0` @* P  % 0 0(d  - ML` Vp0 q郝pD@0 !%10@ 0($ -#LTM0,0 3 p RpW W Wp3PUP 0SM X`<0C>S񟗰$,4<DLT\hpx000P 0SpWB0S2  1 P@01p& 1  @1^+ 00t1& <1UpP@1P ,0S \,(P0041,A:0 1011 10`0`000000@`@d `DPgP2l`K? pPPp){ꛬD X\$(hDkPkLPDHTpkkk p-!LM>t0> `0\@P 0S?*\0S@c$1 R U  㨫U$F% 0 %b0P 1* 0P:0 R V 0S`pH&3@PP PR0 `00 P0d 0 ,L$\h0@S P-L @ <0!RF 0q PRQ @`@` 0 R0!0  B8# 010 g!0`BQc R0̪`hᠩP`VP@@`@PP$\ 0-0L @R& 0P$ t* TP|0 RU l0 RU0 ㎪@<P 00@Xk -1L@PT`r1 RO 1 b Qf1 QE!1PC P? 020Cp5:#:32"!01H*0@!0!HVSV00T0S 1 R f.yPp TV T 1 !ᨛ.:#:S0JS `0 VR:DV0JS 8r@k k$l,lH\Dl\lxlPh0 R` \0 RP0 b QD @0 Q40 !RJLk@xl $k -LMT@0PS HH0  B0Q0  00鲪l` p-LM`0PS@$00 S00 0CR@0` T00PQ00Sp2ꀪpz`llT p-LMl`0hPS@0X0T S0 phm0 0CR0pphUS`ll -pL0@S`+P0 0S0T 0 0CR@0l T00Q00S@!kQ`llT -L` PpO :36021V 0RP!*FPPe VY0`0@0@0001300p .P?@\ " @0d!ST 21 @!T 0U 0'6cQ 10 QX@ڤ21 Ln!@X @*02&60 ` p$ -RLMP@ R oY:#:S#0 `1dßS \3 RL3 R@#0S $301 3 RcP P0 0Q=0 0@0pW R 0Rb 0R Y o;.0S0 00 0DŸ0@2  FbT` !0 `V0D0 0@S *P p 0@S*pW R @0  0@00 0S R Q0 @00@00p00P0pW  0Z0 P0 0p@pyc e Z 7E ᤧ< 0`$0 1S +8lDl$\PLh,d l\l p-LM0<@0C*"*2dR!0`36\|1 RV \Q \0&H  04 R% 0R p R 0S 0 0 a01 R PUphIG  R \ 0S * R 0S  0S: @pphl\$,l -LM\t0p Rd0`V @@TJQ 0PES@TZ`mV9t(L - LM0S!P0,0 % 0( 00 ,K0pK` @ 0``p@ PUU00 0`0` p-0LTMP`XK <@KhK0 0h0 H0XK< Kc4@0 dK`0 \0 d0 f뼃;sHmdm p-@LMP` 0P@0@T0PJX @TXPZpp -0LM R% @00SJ R 0SXZP @ P000H      00 4 D  D \ -LM#L@0cP0S @0cP0SPږ\x@ -L$ 0 ,D  -L0M0 @00 R/-<.X.`.l.x....../ //$/4/@/P/\/h/t////////////0 (0 $ (K, K00KGp, 90 0KPd 0 K0 (0 $ (K, K00K"p ,0S  0 0 0 0 0 0 0 0 0$0 (0 0 0(0 0 0 0 0 0 0 0 0 0 0 00! 0(0 $ 0= (0 $ z M-L@M@ 0p`P{ 0 p`dPPk 0`0`KX0塵0S   0nJ R 4 40  1@ 0 (@\`$@TpPb`8@ X0pX L H T` Pp IXKHP* <0 0PS` 00G0 @d@ h PI 0d Kp@@ 00E00UbX_0 D0D֒ ,0$@(ϒ 00,00~fD n M0-LM00 0 PS0`" -LM,ş `,  (q 0  0  5 $0 K0 0 0 8K 匠K┐K80P800X0K00 P  0P   P 00 0 X 0vP0S0S 3`0K KP L 娴 32a/@#b! P pj `@? B7c011N0 d 0!T 0 L0L " H/uEنJ00P 0-0PL,84@0, ,ڕB@0S0I D D hD H -0PL4,ŕ0`Sp- S  0@W0 0 R@ 0T0\ 0S 0S0S0S ^Pp 0@W0 0 R@ 0TP 0PI D -AMLM,48 <#h0V,0 4  P`F&B~KpGpG 00PSPq@n ZH00$H T00S4P 0S`F00 ,0S $,5P4p -AMLM,$p(. , "h  V, 4  P 0 ,0S , P`F%BKHH 040PSP@H $H( 0"(lP0P`F SHp -LMH L p ,0, ɔ H` Z 0!d2 L2  S <\t" h l | p 0Px xD R" P  P |2x.X0S @㒟KoK%KK  0@P񟗢tvtxv)TQ t"R$ 0Tȟp2 0 S@0 S 4XD"0S 0@S D2 咕P|00D"rPOK?K@DuH2L42  70 K0C  0C P`  Rh 0H|T 0B|< 0;|$ 04|  0-|0 '|00 |00 |00R  ypI D |ttttttttu uu,uDu\uhu|uuuuuuuu V -ML MȀB^Kp PE@0 $ P`0 K R0. CR 00$0 S <$0R5 -u0, -LMP ` @`d pW0pP0 0S.S Q `070W -LAMlpANK @Dd@DP0 P` - 0 S  u -ML,M?`0p,, 刍0P@p? UKH|ϟH  0P` P- `08# `08#H `K { `!` 8KKR0`    :K #-`!R    -  -0JeSi@hPPhhhhPh@șėș,@ԝPԡP0PPPTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP\T( T& *K `00CS00  ä0:K0K c R  0l,`D< ,0S H ,  MK(@D@D oK\ KQ `P@ Ƞ,Ƞ 0`],  `U,0  CR T00  P` 0  CR >00  P` 0 zy ` (,r @f`0 ,h @\`0 ,^ @R`0  ,T @H 0``,]0Ri 0Rc KQMMK(@D@D }n" *K0` @l 0+@ V*P X 0 * +0  CR 00H@P V:0) CR 00 0R 0 R y0  CR 00  P`0R 0  CR t00KV*"0 CR _00@T 00V0#02SP"0" CR 00V*0  CR 00V:0R 0R `75P 0\ CR 000 CR 00V0#03PEU00S0R P 0R 0R"| 0Rv 0  CR 00  cP`i 0 V0R]  0xK @T 00V0#02SP0" 4P 0\ CR 000 CR 00V0#03PEU00S0R P 0R 0 x:K0@T 00V0#02SPX0" CR L00V*@T  Z0 llx# 0\gxH 0axTVP*f4P 0\ CR 000 CR 00V0#03PEU00Su0R P 0R 0R H14P 0\ CR 000 CR 00V0#03PEU00S0R P 0R} R ("(`*m:K   )K `T;  ` $) X)@JT 0 )' K  P )` S` ) K` ) ("(l`)  K K(HH `D1 OPU@? 0% 0 CR 00PU 0{wTz ` 0pw0 R \ewI D D uuvv(v,v@vXvpvvvvvvvvWvwww$wt,w!4w(`P$`@ XH%X$H Ƞ,Ƞ0 `(4`@ H0$H8 `#8h(@t 0`(@ 0`(@0 `( 0  CR 00(:K0`0RK\< (` p-LM0@S`PU00paP @0SU00p -LM@\ 0Q 0S04 0ET$00T00  -LM0@S 0Q 0S00 ,ET 00T00 p hp @P-L@ P P P 0( EP P P P  P P| Ppl P  PTPHD@<p{~x{{{{{{{{{t{{ -PLMw a0(⢢ 0 "j@0ࢂ"h0@!#RU0pQ@ 1W!(03E(PHPF`U W 00 V>*D1DU @f 00 0@   @xP| -QL MP`@3ȁ0,0K ,[+K!1* K00K+ [*[0p[ 3""" 1??W/ K.0K-KPEW/ [?RT.[?QQ-[?PN ZJ0 0@ @U@@U4 0S *0K+0K,0K*,K00 R:,[+[ 100K* [0[0"#!!?\/K. K/ [?R.[?P0 SXU 0 0@0 =0@0@=00@ T*002T| -@PL`P p20  00S6 P=P UUXP p0 0  R P=PP Pp00 Q PV 0S=P q,P U񟗽HV X*0g10PV  \*0 gB2"0 PV  \*0 gB1#0 PV X*0 g00PT|G-@ 0SPPRp 0 SZ0h0? 4@ 3 #T #R p0`W RZh0 0 ^ ^*.000S*0 RpJ\`0.\0 \\ T* RZS*` -SL M, p`   Z 0 S 0S@TP) Z 0E  0 pP020S 0CX03`505 `.T$ \T V*@@T0bST 0@>S TV*00, bZ00`F@T@Q*@$?#<-"-0 0c`0, bP *0S  P*0SPlR Pp4 0 0  RP 00ӑ -RL M00 , *,p `PU 0 S0? 4` PU0S 00X: iPUJ0.S \S@TpPUZPU0S .U 0@- .R .R .^ABa0B" Q00.Q^APBa@BABa0B UT00B SQ 00\S0@B-R T0\S0B ^0*S 0.S S0S !0B]S.R000Q\R R.R0S !0C]S0S0 0   < 00 , 0 ( Ġ P 0000ӑ 0-0 L@ P  RoP $0bPP00C0P0P 00 U00S jqP 0 aqP꤫ 0 000@ S7@00 -PLp\` V * +\00.\P \ V:/\ \|0 0 P \ 00ӑ|0 0 DP @\ \` 00ӑ|0 0 DP B0`p xR@-@@ P^0#2 S007000 0 S00700 \.00´\ 00P 0000ӑx 0-LM0P [[@[0[ P@P=0 U -PLM@  Th7/00h -L M⠠p@P8`K0 (P Pp"=P030#P0S  {) (0S $(黪00LX -LdM0p ,  |0 x0 t0 p0 l0 h0 d0 `0 @`P|K 0D0c!1@#T!pP@1SuP``@Tu w Vpw Xp.K\0K S\`K@*wB T@0T=T4 V0#03@T00Sw 0S 0 S*\ K0b@S@\K (L1 ,0S 8,>00 R*:00` R:0305`1:T  R*:00`T Pf1 k<PP`WX Xh h0R f P a`uw w VpPodij -MLM 0, , ~0, ~ 0S    000S0005 =0004  0oY/0`000 `n`8 g(P Pe  Z(< (K K AVPPJ ; @REnK`F`F o4@@# ;P@(K R  P&l+(K0 S S Q0P S S \ \ \00\``V`@,(P`d  `P1*(K0 S S+Pn/Y 0 SS S S ,S PPP 0bSyS fS P 0bSyS fS|z (PW)(K0 S SQPk0P S S \ \ \00\@@TY`p,' 'P@`0DpSPH` \ V!* \00 \PYP\ V: P P P 0S S S 0 0 Pyt((K0 S SsPp 0 P S S \ \ PP P 0  r0 0  R0SFKL LL@K '50t | x :G.K B0 B0C P0S  R4 |n4 R 2 P X4dn,| JP&(K0 S SP ^ʌ1114  \ \ \ \ 0 SSz ;S`w 0 S &P ;Q Qq5  0P G~KpG pG  4PF 414 @4 h1&PH`4  Q;Q Qq00  RP  P4 l1 $004h1 0l!$  $  ^@hl\@K wP00ώO`  Q;Q Qq00  RP &Y  ! /P P PP0`30E R@$4 $0$$ 4 p .P( kP#(K0 S SY?Q    " >``0S= ^`0` D HSDH`P 0.\@SPpVP *T.@D%PPV:00LP0:0 000 ,0S ,7PP vENK@D@DP.%PP ,`%7PP: `@,%`0d SD@PH`☔ \V!* R R00 R0SY $ P\ V: P P P P 0S S S S000I D D hD l,t\,-tp|ḱЁ -0LMP0,\{0pSD Y@ S S@0TP S S  ~P`3$K P$Q |H1  00P0S0 ^00 0 0 00T R R R @0TP R R R0S CP  =P0:0t 3P0; X +P0; < #P01I D ܁t{{{<4<("4 <1QS0  0-L@PP@ T0 0-LM@ P K 0K  P @@jp0 -LMKPA-M `p |20  00S3 0\ Pt A\ |0  0  R#0CU\|0  0 D R |0  0   Ra NA N.\ 0V54:Ѝ\ \| 10  00S 0hC10S x^*0S쎑W <4<("4.<0^* R0S8<^P0S R8<4X\x\PP P-L \hB&/00h -LMP@`T,`K,pK #P 010jP VX`@TX ,K k0V0.T00S` X   -"L$M0K 0CPcT RL K0 A ,P@)t W~ { 0  `P`K> @>K 0C1Kc@@2AlA H D< L @L }CKPќ07S  K A 0P@07S  0\KclA18 A 4< 0 < NCmQ T00%Q00S  `@Dvr `W!X< .PPD@`PeX R 0AN 0 .P PJ `81 K@@  0| P PJ ` 1 K@@k#@ ,T`0 w~kht| -LM0@s O0000 -LtMp0|@ $0 " 0jP`KS  $0S $pth KPK叀K OpPOPrp U| -PLM@R  ?  000 -LM@UO 0 0 0P0 -LMB -LMp@`P0T@$K P,0 P00g Z@  -LLMd`\, Pp 0%S U 000S ,0 S ,bpzW,Tl4  4 <t  ( 4   $ , D P X t |      D | `Fmşp 0RPg0S1| 0 Sş105v `p 0p`p 0H 85Ϡ l0BP  @ N 0C` R   00b0 B`xv  0L(P 0S \4 0S$1`$p0 p 0PR v  l Rg#>/2b11^3b11^ZCl| ` !$0/C!b?@1c!bb1cA0c0cs00\?\N0S 22a11^3a11^[ό[ό 0a Ba4P P 0VS? gS}\2T`p 0N000 S50S ,B P៕  1Ϡ%0 Sň!ըŤ dK8@KdK !0 &,tlP`P 0h hK hP\ph 0\!p00 v 0?2c11@ 0S$@T @dfPϠ0Bl4? 2cc1D1̅\wQd|*$I nm$,Jh=80 D -LMTp,@KP` 0  + & 0S 0L -LMTp,@KP` 0  +  0S TQ *0S0 Q*0S00 S0 R@-` 0R00 m̀   0P1PP0Pmͅ@p@  011 P!  -#ML M$0PP,0 `  P 0:S /S .P PU 0:S0/S tW pP@mP@@ T*BNK@D@D+k+ + .WPP ?QPE\p@ #\K(PE PE`#F LPkhe 0a$0](0Y 2R,p\ \^2^P2P ZZ0Y0 YQ001001 0 e b 0R|Q @)Xp@X 0 0 QcX X`@pL0SP7T0T7 @SN XX 0X0 `1QuM@p0Xp@ X ZX 0SX7 X X  Y\ 0S\70X l0 ,0S t, XPU/xP8P0ȈrL܈0S0 C,S R-S+SP@-@  00L S 100C^00L S^ 0-LMPK@ 0P 02c2c20 :R 0 ;0P 0 2c! 0:S<0 P0 00 0-0P-SL@P +SP  U0 0c00 -LM0@JS: MS 00C S00 0P 0/S00    00  0qP 0.S 0fP 0.S 0 0 00 m E-P@p "22a11\3a11\p0Sl S  W02c2cZ@]E ;RPS J^P WXa  102c2c^S,! 1?0c0AZ1`L ` !Ϡl  B 111F/N!b  !@!A! B 0C`aR0B S B^ W 00T` 010S^ 02c2cS002c2cSQ`*gfff$I -RLDMP\ `  Nd4\@ R !`0@d T0 DmP00 `R&T00c  L7PTdY 00 0 0 SmM @ \d Y0@ ``@ m` @bY0S,S ;S XKP@ 0V0R00SC ;Q,QM Q@Q` 0011P'RL7`c \\%0011P'R\\tr01u.00\'RT0 0f  P'L7R`c\T0X d0c bL7`'0 Td7 Phu@<KkP@ 0,SPKbP@ ^|d0TX]~0ph al0 0`p LP7`Tdh 0 < KhX0@ hP KT0@000@000 0`"`!!Z1Z0 !h0 "b"b3h0 x0ZTT0>CX0 A\@aQd %0S" TKP@Q -@LM$N0S h\ -@ 0LS0 008Phx? -@LMihi? 0-L%P@8 P0SP. LPP!\ 0m ,TǃPǃLǃ 0hhP 0:S H gP 0 ,00hx? x> \ -@LMihi? -LM`\p  0P"P7 S@ u RA @0S@ALx 0 K] P` T70m= 01(0 R0P R0  A  p-8@LM`PEi] ?ip? -LM(@, 03iP h? p-LM`\@P iP P0S 8i0, 3U$0$0(0p00? |?  : -LM@  -LM(@, 0hP h? -@LM ? G-p^@EJ1삟@Pu 0`T^PE@Z2 l Bha02c2cSDPzJ2UZE]EU`p2O Ed2d2cREP2Ϡ%H">?lA1c "l1c0c!E S@rB000 D21!/2aB1ca?@4cVP/2b13b1T1T1 !VVPEE0d!"a1@!ba 100h`c@v.D\(0 B0 0`0V0  1`aV 0$ 0Z]U`F~p^p\0up^Nb 0 0R]0 0R@pA T0\QHE.Qų$IQ` -Lh -L,M@<K0 Q 0 Q  -@p0T`LPf0c0hf -@p0T`LP|f0c0hsf 0R 0R 0R 0R 0R 0c -LtM0 00TK0SPPK L@K< PhHK Pb@P儀KDK P PYD}PTH^DńP 4^$4\  “Ϡ2l1Q`3l1R1R`3!bH XP/H3^DńPDP#O2d1ap3d1U1UpW 004# 0A0d^ \D H0 0D0 )PH !PT0;Q@0 v>" 0ST Ŝ p00 @ K K  TK@P T@DT00CP0ň0  4C4Ј0 4\;`0 S8 "Y 0@S1P1P}R pRJ0 S @TpG4UZ 0`S1PQPJP7 SK `VPE4UZLǕ0 00n0  TKP` 40R00 ? \0#S K    00:TKPT;0 T0  pPkDP0\  “2a1H`3a1R1R@0!^H PPKTK< xP FlnQ`,   -LMp@P`\ 0  -MLM 04( S0 0ł>K0C0Cp0 D8 ,(RJ 00S1 P1!88 8( 80QBKL !80Q8(0@ SJBKL@8( 1SA0@(K@1 @( QZ@0S<8 <8.K B8(  0 P1H P'R <(@8 R<( @8XH8( 0>K0C!88!aPǖ\04(D8@X PLLGdUPP P`,8SL'L 0 `bS00 0,   0-4PL@e  Z@e0? , 0 0 L! 0 0F!@0  R J1u  0Q R@Z -LM@K$0c -L M@K$0@K 0 `RA 0 `RS  0 `RS A -LMPpP 0娐 R0⌠0@` QPvΌt   0@D P`"00P@@T +00/*` -LM0H @0$dPH  h? ? -P`LV@Gp0S  SP@D RCA 0\R#R! B`0 -L"ɠ2l3c13@"c1MP 1K0  d C -QL\`M 0LK KϠhKT0 `0 X Kh l"h0  -LMp`WRQ,K@T , 0SZ@TzP@6 0 0     0S01@P< P5`P [PP %  p`U  UP +P0 ,000tKPEP fPb0 0^00T@  -LM@`pPP$K3@T 0S @T P `P $0S 00 0 @ -PLpٍ0#S LA xş,0 S l,娻@A?TP0s S <`V `0S@@׸`T%00l4PSl00h$R 0S`V i P `Vh$l~P` l "b0 \0h p hPU 0S1@$`0Q?p$@\@\PH0 IP`h@\ @Gp pP#00l4`S` 0BKßN N8 pß@(K< CK @E>KTP(K@0CP@ 0C4 d 3 P@o 3( K!$(,"( R`*R^ 2Kp2 0 IF>K0C"P pt0,^0S 0t t h wdh$`0 K@P@ @ S$"(0K!48<#8 S*S 0H T H0L P J I@R  LRh@hA  Hp\ 0p4Slap PBNK@D@DhL!L1NPp@) c=pP0#SEKEKALK 0 LAIP4 \ X T maX4P$0P ?hP??p$RhPV0$K Њhno(4 -LM` @0 0\ `0V -pp`@LTP  P `@T` 0V0000hN$K -LM$@0 S  0@ -LMPp`P@\ 0,K,jX!0Sp\@T`B,0S CCC|C|CCHDCCHDCCCCCCCC( 0/00,(0 $ | p@T` (pP0P (0L 0 (0  H -Lh\P0DP -L  hB -LM`ZPpP 0 S S 0d  0 0 @0$ @,D 2l -LhP0ጋ --LM  -LM@$ B$0K K 0   M -@LM 8@ 0-LBP|@ 0S L| 0SPeT 0S \00LS `000B0 -LDM@ d ݵP dصP`} 0Sh 0S0J0@ @@`KoLpP dP00 H XP L T@ fXKP0SVߵXܵ ->P0P0H0STTA 0@81H  `P =P0@ 00儊00p0d  N X%4 40ᒵᐵ  `0X@\M 00c00 00(@,L 00W00N P4D  -LTM` `\ h0 0Qd 0p KLP0|0 pK0 0Rx0  x 00$0L< 4 00hJ   0-LP@P0  P 0S SP 0h0 0-L@PP 0S S 00h0S 0h 0-LM@P0S0P  \02 0h 0-0 0 0LS@P 00S 0S 0S  0S 0hPtTPT|TTTT000 0 0 0 0 0 0P0 P 0 0 00 0-0LS@P S 00  0S S 000  0 S 000 000 P0-  @ @-0@SC @<4(<"4!<0  -0S C   <4(<"4!<0   0-LM@0 SKCP0 2M<4(<"4!<0  -LM0@SK C < 4 P` K 0S\0SP  R ,3 50S( 0  2" 0 2 2!0 201P  0B00 1P0 5A1@O`DOw_@0S 0 y;P 2 p 0  29 2  29 20S 28 2\\" 0;K 㪢PwPO02 R 20 2D 20 2 0 0 0[ 0 0[ [[[[[@[P[`[p[ۀ[0 0 K0KKKKK@KPK`KpK妀K0 0 0 K 0 0[ [0 [[[[@[P[`[p[[ K0[ K KKKK@KPK`KpK嚀K0K 0R {O0!0S 0[@[)[*[ 0  1K+[, [0C7P #XZ P \*T@KXK 0K/[80[#Ƞ T 0 0 00T [ 0X0  00  X0[0,  0\0 Y [ Z0[0[ [ \0[0 ` ]0[0^ [ _0[0` [  0d0 a [ b0[0c [ d0[0 h e0[0f [ g0[0h [ \:\*D@KHK 12K-[0.[8#Ƞ D 0 0 00D [ 0H0  00  H0[0  0L0 I [ J0[0K [ L0[0 P M0[0N [ O0[0P [ \: -LTM 2E Q !t 0B 7R#h R9 0 \0 Y0[h x0 e0[` l0 f0[d Z [[[\[][^[bp[c[d[p0 _@[x0`P[a`[0 @P` p l  p0 0t h["K1g [3K-[.[/[00[ 0P*DPKH@K 0! 0D0 00 0 D[8 #H 00  00H [ ,  0L0 I [ J0[0K [ L0[0 P M0[0N [ O0[0P [  0T0 Q [ R0[0S [ T0[0 X U0[0V [ W0[0X [ 1P2K+ [ ,0[0:!t hPe*4PK8@K1 4   0 04 [ 080  00  80[0  0<0 9 [ :0[0; [ <0[0 @ =0[0> [ ?0[0@ [ 1P2K)0[0* [ :p@-0 M0  0@P`0 @P`0 0 0   000 0 0 00 0 000 0 0Ѝp -LLMP, \\0 + 2$\Q :Q Bx004 ,0S |,w?0 R d Pw? R\^ 1SX@K P` \` Q`崐 X0S 2   0p@z  00 0p l0Rc:0L7#(Y@!S: g0!1 @ @dI0 @I(0 0S. 1S 0S10C00CY{?   88\ Q 20 2{` 0 6!010SY{?㳐  0R1 S0"1!@ i EId 0RP H 7BX0S{  797X@K 0YP` VN W7P`ḑY@@K  5p 4K 0 T P0 I0LK 0KL0 HPw? dRTKd @@K 5p <0K D H0 H08KLK L0 Hd0D0HKd0 (00S#w0  700 -LMPp@  6P`E {000   ` Q:1S 0S @T P@A W7@P0000S0@0 0CR P0 0  0  p-LMP`@QR 2KTD T=`09    p6P  10C0S! 0H@10C0  P  R PT 20 2 T  6K Pov 00@ev 0 600 -LM0 @`4 400 80 68, KPr @4 0R] Yk  6p,1P CSP! U 6 P@R 10C00CPp6 0 8!#ᴠ101pGw 0!0P0P01 01s6 5PpG@ w d6  5P@ 4 0R T64  500PR  A68, KaP 40@ 0S Y  .6p,1P CSP! U 5P@ 0 Sp6 0C 8!#ᴠ101pGw 0!0P 6 u5PpG@ 1!0C0P0C8!#ᴠ1w01 5  Z5P@ 4 0R -0L MP00 , KP@n , R`c 0 0S S 2 0 ?0N\* P 0N\ L\ 10C0FP  5Y  Z 0pp 0 CS  v510C3<P f5 a5]500#0\ -, L M`, 0 10 S0C@@1T,  4PP ሐq@0g10C0S10S yPj3P 01v?0 1  5,0 R ,^P@ @,K3P 50 0p a0F0H!8#8 S! 0C8 R#8 1S!0B0h88C#8 0C R80#8!0B1 2p 4  -L(p \`W 0!@0I  2p6 0 0P aE88C!# 0 Q! 0A8R# 1 Q!0B0h88C# 0AR80#! B!(0 0S  0S1S0C1ǁ t2p 0 ^\P  -LM@ ` pP X Uq10C00CU^:UQ@10C00CU Y0p RK 000 0K0PQ 3P 00 K0 2K{P 000  400 2[0  3 h3P 0 10C00C0 K2KTP00  300 K2K0p DP0000E0 K2K0p 7P000K 00p RK P p 0-0 S@LP0 S003P0 003 3P 0 003 -LMP`Q@>0DS54ܧ4ܧܧ4(ܧ((0#(pK0 .P@  (0 g=rυ @I 2@ (00 ( I3(pK mr0 0 :300 p-LM0C`PS1X  0S 0Sr0 0p 0K @ 2P 10C  10@200 2 @ e2P 10C 0  10@210C00C -LM@0P0`  $0KO :2P+ V+ V p0 00@@pW0G 8#x@ 2T 2P10C00C0`p!08#x BW@ 2T  1Pp -L M0  @, P`` @TS 2  0@ p0 Q%8 8P  O20 RQ 0R  ?2 1Pp 10C00 0B0 ,P   R  !20 0 0S  2 10CR 0 pP 2U r1Pp@ p-LM0@S`P( ` ( (0Q0(0p錜00 0 -,0L Mp1@, 0  F1Pb 10C7#H P00 8,#h+0 DP8(C X#8#H 0Z0J8#h `00!`101 @1 2 Z0S10CZ 0 00张0S , 00P , 008P 0 0 0 0 -LMP@` p00S$ K$0  02KP  G1 K 0 $;1 -LMP@` p00S$ K$0  10C00C2KP  1 K 0 $ 1 -LMR`Pp @  ]Y 2   0 0Q PM[P/ 00 B0 0 Z: 0*Y 2   0Q P:P 000  A0 邛  00 000 4.P0 j  '.P00 p-L M@\P 70S4 0p 00   0 0 `K p `KQ r?sτ -P1 0  p0 0  0 0 `K 0@-@T010!0Cs 0C\sd b0@-P@U1!L| 0LR|T!200P@-@p `0S0S=S 0S=S PdP U 0S  0R^ 0S ^0=S P00cC10B -LMK -LM0K *P - LMK0P -LM 0@P@ -LM 0@P@ -QRLtMp` 0@S 0S@b@DT*o00 0P0XR00S @(@D  0IZS& 4<,<HX<h8\.(K0S 0(K0((  00A SPڅ 10 A0 R0PC$^ 2PSP1$2 $20P 02 02$"S 0c$" 02 i(( e Pb\ PR \$ $2002 Pb K T/K!>K  + >(K *Y 00I SP100PC0 I R$Y 0U@@2 2PR SK T/K!>K   00A SPڅ 10 A0 R0PC$^ 2PSP1$2 $2PP  0U@@$" PB\ PR \$ $2PPB K T/K!>K E (20(2 P100PC0 I R$Y0R (( ( s $2` $" VfT(DB ( D 00\0S,K% Q: &:Q 8O#`>(K DVRH H ("H20H2 (@"0HPaUU&0 !1 0RPEK1 ! pUʀ6(!1 0R1 ! p>(K R b?K 0C0 10Q1  pʀTo DPfUUgE00@!1 0RPEK1 ! pRU0!1 0R1 ! p?(" n`!1 0R1 ! p\(" 0"H2PcUUş00!1 0RPEK1 ! p=U!!1 0R1 ! +,02H"R1, S0~K1 K]P P ?KP @0 2 ,0@,0 S ,峘K?P ;P~K K4P~KeYT K- $PQ3@!1 0R1 ! p>"2R( @4!1 0R1 ! p$2PCUoUC00@!1 0RPEK1 ! pU0!1 0PP~K BKP~KKP{~K"R2RS20!1 0R1 ! p>2P`UU6A00@!1 0RPEK1 ! p!U0!1 0R1 ! p(2 l1 0 1Q01  KP0~KP~K )AKP"~K20!1 0R1 ! p!ʰ0 0 10Q1  p K 0C0K@!1 0KPP~KKIP~KWLE 0@!1 0R1 ! pL@4" !1 0R1 ! p92PcUU1ڔ@00@!1 0RPEK1 ! pU0!1 0R1 ! p 201"0Q`KP~KP~K \AKP~KKP~K2Sgڤ1. (K yK0 !1 0R1 ! pN Kz/O P 20C01"00CQ1  p e?K0@!1 R0 KPC~K2PCUUڤB00@!1 0RPEK1 ! p U0!1 0R1 ! {P~K $CKrP~K(00! 1R0K_P~KZP~K C0H P`UU'C00@!1 0RPEK1 ! pU0!1 0R1 ! plK.P~Ke)P~K lDK P~KU(R yK00$0(0K0 !1 0R1 ! @KP~K(P~K %L >&B`Ph( K0h`C1!`P0h(" 00S00 0hV0 0h0 Q`PV P00 U- >(K Pu`(2(" ("  2PSP 1$2 $2 PoP $ w("@ 2PSP 1P $2 $2Po 2SP"1$2 $2$ P20P2 Po$ W((( ("  $2`0$2  >(K F( 2PSP1$2 $2 P P` $" (2 ("  2PSP 1$2 $2 P`P $ ("@ 2PSP 1P $2 $2P` 2SP"1$2 $2$ P20P2 P`$ (( (  $2` $" (2(" ("  2PSP 1$2 $2 P`P $ ("@ 2PSP 1P $2 $2P` 2SP"1$2 $2$ P20P2 P`$ p L ("  $2`0$2 (000S(" (" [( 2PSP1$2 $2 P P` $" (2 ("  2PSP 1$2 $2 P`P $ ("@ 2PSP 1P $2 $2P` 2SP"1$2 $2$ P20P2 P`$ 2PSPbK 1$2 $2` P $"  >(K ct@ GYgYT@(y 2SP"1 -K$2 $2$P20P2 $ -K6P K/ yăP- >(K `7 -K4P㘃(2bKL -K<KK (2 GYgY|\ggYEeeY"fY \ ( ``2(K R- >(K \0l``\`T `( 0`L eK  2@ S``(2 2 KSP1P$2 $2P $ (@l\("  (20(" s(  2PSP"1$2 $2,2P /$20$2 3( 2PSP,1$2 $2 P $2 "(@ 2 KSPP1$2 $2$ P20P2 $ ( (  2SP"1 $2$ P2,0P2 $ $2 2S P1 2tSP(1x$2 $2 L P`P" 0P" $2 ( ( 48(( 2PSP1$2 $2$"80X TP $"  +P `hV`w`(BL NY bK >(K`1S01 KP ("+CKP~K0Sw  $"e 00 -LI,M4PK, < `@0 @8P 4K3K2K1K0K/K.K-KQ %Q Q %QQ p @ 0AZSdddddlllllllllX (LX 00B SPԅ100C0 A R$Q <0Z80 X 8K<K<0D P80 @ X  Dp8K<K*Q 00A Sh00A Sc 00B SPԅ100C0 A R$Q<0H P80 @ X  HB8K<K` <100C0 A R$Q 2/p  <0Z 80 X 8K<K@ .  <0Z 8K<K3 <0Z 8K<K(@ <0Z80 X 8K<K<0Z 8K<K<0Z 8K<K pp  <0Z 8K<K@ <0Z 8K<K<0Z 8K<K<0Z 8K<K <0Z 8K<K<0Z }8K<K @p lR p p  <0Z h8K<K <0Z ]8K<K@ <0Z R8K<K  <0Z G8K<K  <0Z <8K<K<0Z 38K<Kz<0Z *8K<Kq <0Z 8K<Kf |A  O \ <0Z 8K<KTQ"X:P8 0a80S((((`P^ 4PK^ @ 9080 l0 ,0S \,@`@ 40 P@0( {< -LM`PQp0 @ 0 ( @4@9@  b7p( _ -LM @`PfT40 p ETeTpG/  P090 ,K0K0RtgTGTp400  fT@ I P0@ 0 R*00SC 00 0:0 g 00S 0@8 a P0h0-0`P -LNMp0Q 0 P-0 +0a0ŵ0ť \00 K0 ` l@,/C!bL0 Rn000n^*0^0: 0eR  _gfffP 0-L@!0RP0L1 0 000U 00B P 100B -`Lp@P8#8S"!"81 ("((^ XU 0V1`P` !@ O(p -Lp B/ bR@P`0ڃ0Rʙ V0P0 P @@ 0 BPU@UPe 0 BPU98 88S00000P0   0"108#8S2 "$"""!    -LM@;00@ -LMp`PW, `pP 00 R"0 0!@0 < 0@ , R40 @*004 T:aPX8` 4P @9*0h&hV 4@ p(8#8"(2, !#, T x:p0#h 4@ pP %82! 8"(#8P2! T, x:80X:0 @0R<  0>S000CS00 0>S 00, 0, -LMPp&EQ @T` P 0`S @c0`\0p0J@`0 1ppB q$ -LM0b 0PUp@ڂ Ul R0  R00@ d 040 Q2 :RP 0E0e0Q0: P!0 <01R\3# -L@PP`9 @P``!p0@P `a(8#8"(0b! aL8U0CȠ: T * 8#8 "(L8 T0CȠ:0>S0>pGS p00`@-@0!"** B\0l Cʠ\7SL l0\20 -0pQ`5L@B 0` P0U 5 \ lU2><``6> U ` 6> 2.0 -L MP@4Q6%z00 600 T`,@ ' ,KP0 ,0 `100 ,02 0 000S  @0 W 0C>C5 `0C0 C>@0C!0B@`@0K00 0 @ -L MP$K`@0(Kp{ 0$KP N0bŒ\0 :C -L\M8 4 04ޏxCPLP PP T T0  q0 0  RT  T 0-S +ST T 0 S/ 0Sw T0`/RX0 p9R 10W0C10W0`CT@p /RT@ 9RRHp  @EReR@@ 8L04T  T @04  +RT0  -R 00B S4T #0R 10BST0B0 /RT0 9R T@10 0C/RT@ 9RT@!0aPS^@ ` @ W @@ @lH@@ \W  H D > ZD0 SD@00 HLR+ VP@ 0 Wl aD@@0dPU 0 1PV MU-^"00p0lP dwhupslqto8QT  P0 SN\0||@??ER$ U@ L`@P 0 U`ʄ5I1 0 a&j0jV0Vἐ5XH 0`l l l0h  ! $ , K00K^d @@p T@,`l0L! 0P`PCP`P`^CN@6@lpP`U࠱ࠡ^ࠡ^pn`nPnQpdp @dd@ VdGd Zh h Uh;h Wp5p hdt 0< 0pcP tpM/O P@P).O ZP@<p`Pp`zP/O p`*3 Z] Z/O pP3.O 6 <p`\p` x0  0 a&jjZ dhhfpdtb< 0 P@<PX46S / FP/ 0P - 7P`K5I /0  0 1#:x":S5h2\ R `@t<\ O0p`qX46S X N0ndYc]l"0y\0zi/ P . P@CF[O0<0S, 4`!6S \ <@T 0 aJ/ P@PH  0 =>x1#::646SX1#::C (< R%X#46Stpt 4P5?55?5???|<\AMPe ,  3P@ ERUlU@ p`@P 0 U`ʨ 1 K 0 `K O P`` K@K0 0 .O P@P5 P@P Pg@0QtA 0 @ n@ 0 @A 0 @qt@  L }/O P@[/O {BL  40T0 T 0RT T@ T@ TW T 20R) 10BS0BT PX QP U EW !p₠1W`^W 1p⃠W1Ѓ`PT0 T0 00B STP 0RT 0B Q@L@ T0 0ST S}0T@P T@ q -LM, 0 0 S0 J 1P,  4 pf/P8P - ` 8#8!"(!82$8!#80a("(40 (bA(U $Bh0SpG W 0SpG WJ0S , 0,P1`8P 8#8!( 8 H!#80a("(40,(bA(U $Bh 1 pRpG W 0SpG WJ0S ,  -LlM4 \80 p`@W00qdz01#:H":S !. P  002Q0 0000K, K0':ც᪪Zp T K J%00ƂJ0 KZ/ l c . t W/ I P@ JR/ j 0 = i P PP QX 0 PP00CP0 X 0j@SP0S@dB C`@ U< U<@ E` ES`@ d0 ` 4 ^ࠃ^4 N4 40P\ PS%?aCoc?`(?yPD?L,B (B \ PR b-  \ 1<20 0 \ ?\"00 0QS@-@0c  \1<0   \ ?\0 @0 @\ PT0 0 -RLM@8"x8S,0 `x)hȠ,Ƞ*H&$!PQ # 3(!( '#P020cY ! C2R `0 !8,0S&hhT)` 0 Q 2RhF0P13P1 <2 ἤ-(0(   8*<DP ;;( ;S0 0P0 -LM`PP0@ KpD0 K04 4K00M00Ѝ -LM@Pp`EUW 00-_u@T0-`P\9p T0 R @  S$0 -LM`PpP%J6 K`P`,K0 0K00CM-00!OO$P`0"&pЍ -LM`Pp, H0P`pY ,0 p-LM`P@@@`@p -1LM0S``V$ P@pSS PpR SN $8?S @ U=|:JUT!0000à@T  RP;?$ $  u00Q0SpJe\0 \03  0<$0 00P@ $0P0?45WCpSpp@D8 p-LM`P@l@P@` ph -LMPP@`pW P `034 `RE0E0BUPU0H @0`043P 0 00` -LMdß@TXp, 00 ` T W 0^0T3("S*2V ,P0;,P02S|5P3 T T00W00ST00W\ /O0`PP#>`P`P`0O/ <`PP`V%^!000P 0\P2 000 ,P 00 0O/O0`*0`@0@ P` 0``!v00Q0 S  P (1U:  |0#03  ,K0f0K "Y` ^X,P0W T ,P0^,P0T^,P0{0^0TD@D8 -RL@M@p $0 0 $ ` `AG P@U0e $ e0(0 21%$ `e( $0 K(K$K$P0 P O4  b p-PL Mp_@@` P0Q S0 U UJA>`o0OoPJ0P` P 0 `p0`S  0 S43"?S04# 0 0 p-;PLMDUEoJP V 0T0U00S pp~UPD 000p5 D" 0a4000V`pD -;L,M\< 8 * \PoO 0^8K< K`P80C8 <=PoOoPJ  0P` P`PD @ `Po4KO0^`P,0P`$+`P -;L`p45gSM 3^@$P 0 )V! W2 0 KN0^0 ^0n03  1>0$0 2 A$0 AB B0Q0UzW V2$0 n$Q0 Q03  01$0 0P0S;V V ?"0!P -;LˠP` 45fMà3^@p $0 $U V1$0 N$^0 ^0n03  1>$0 0$0 cAH0Q0\U UP` S:\: 0S00 lp'V U Kn<Q0 Q 03  010$0 1$0 0P0S ";@Ϡ\  Ϡ\  y -;@T;LM/UT`ᠯ", (@ 4P 0 H X9 T^(K, KV0X4P 0K4 KM0,4sL'h$H X!1"4 R0#038"8(!,6.(0\ ! 2\ 0C QCR ,p 5U`; i^0U0X00S; -;PD;LM0/EU"4 0P ,@ (0 h Sb ST P ?45(K, K0PU4P0K4 K0P,0454( S b4 ࠑ}~ ,0 4 p?0S`,Ƞ,Ƞ(XB[ 4!Q0#038!8 5"40P 20bP  CR`P`  0P0!02S `FT ^S ;T -;0LMS@ ;0S P  00 45S P{P c45S;0 S-L# ;0S ?S S 00 P *S S 45S 345S;0 S-L# ;0S ?S S0 0000P *S S 45S 45S -!:**@LAB14LM\?@(0R\0l0&03  T`PT P TQx 000T`0R@L0R000 000 l>"0  D -p`':@ナ7DL⨊ MXO<0KP  @KX@0H1@0 A@ 0?48@K5 0 ( -LP@K4MH)JJp,jP@ 冪 #T # 3(l0 $(h0.%pH(N.l # R2^P2t 3#S#3t@p#8$0 (, PP@2`3`#\ # 3(t0,( Ƞ##!@ Q020S ! 24`h@^ ! 2ldxY00RKAH D L0 *L`H0DK HKLK0D @T0 0` 0O/ l0T Y 00` 0O` -LP@KlM`K PP<,JXJ@ ,Jᄪ@|40 X%X "| t #[,Hs[2,.\0#03^#38,8 Ƞ&.x 8 "# V2R02 3#h00c bVQ0C2Y0C2S`h0 fh  00|00|0 H0 DK|D 0HKLK>L`dD H0h`Pxt@030# 3# h \|L| h|H ph0l@ 3 #030#0SPLh P DP t ` 0/O PP@Z ` 0O/A?O`PP` -p(  LMP`P' &:::S@ W @0 O00X64460 PP 20460@ -p(  LMP`P3 &:::S@$ ?S@ S@0 O00W VUS S X64460 0460@ -p(  LMP`P3 &:::S@$ ?S@ S @0 O00W VUS S X64460 0460@Q0 0aQ03000100P0R b0@- @P 1<\0 0 ?\4 00-b1R"  @-Sc@#0 401  00S20@-  3#@3@# 0  0bQ@2c0 0@-Pc0 @R#3 e d \@2 n0Q@20p@-X h%X ! $ T#3 Ƞ$ȌH.@!Q2pG-(!X  "(!& ' V#3W#3 Ƞ&Ȍh$a*'x%p,Z@2\P2 3 #P$ PG-ȠM!h,Ƞ !#8() X#3 Ƞ"( X(ȌPA*% ᑌ,Z@#@3H*H F' ᙡ&,QP2 Vp2` P@3@#\#3P, Ƞ%".p RP2 3#^#3@ .,$<0\@2@PTP28 40@0 PЍQPP  :Q00SP  :Q0#02SQP@-0 !-0S! 0  00 000 0$0(0)0*0+ 0,0!-"0.0#00/D80S40 00 00 tB   -LMK 0K! !cM0( 1S Ѝ0SM0D #2::S Ѝ046S0S P  0S Q  Q0 R0 P0000S0P00R 0S0  R R 0S0  R 0S  0Sb p-LM@PQ"%p 2`  @ -P`ppP`8P 2 2` 00 -L$MP@`Q{ Tu "; S  p+  0%0D K$<0 @ 2@K 3 LpK 0P p$ 0 q  P 2: 2r L@ T 0P /0LpK0 ,0  0P8K L04 80  L@ T 0P ? 00} 0-@LPQ*-p p PPP ArrP0r011r011r00 0 00 0-@PLQU "0S 0 p P 20 23G00 00 -LM `Pp4K 0 –H0AR 40 000 , (@ $P  }0b1 0-0L8@+ #80P$ 0S00P @0Pr000DP0000 0r0D0qPP PF 0 0 -LMP@ `\0 p 0Op  -LMP`pQ@5T0@TF0 02T 2  P`@D jP@  0p( 2` 00   00 -L M1"pS *PDFqP4 "! X0 , 0K!*`P!00CS0!0@Ӥ0&t `V@@V 0Pt X"55: X* 2< 2? @]q -L M?Z@8*Qa!00CS0!0pӤ08w W V 1PP`l pP Pp`F+q1w c00 ,  0 K 0OPw  Z: Z* 2< 2R |p -LM1"PS *P:pP"!' b1( ,0 V,KB r*T#*•\ \ 00T0#02S \ 0P`V:B?  2< 2p -LMR?UpB b*T*,@ 0S @T*0S,l, K0( PP U@:B 2< 2 -LM@pPQ` 2    R 1S *PpP` 21 "? l !,K, 2(0 V_`^P`P`d``P`P``P``(0$PP "U 2 B 0U 2<00 40 4K-0U 2 E 0]P  2 V: 2$P  04o 0DP0UoP4 "?0 4KOp "D000PU"P` 0PU0PU "Uoi0( ,0 ,Kz 00M -L$M<"w/, p\`t"V00X0SjV g LP0 VP@Y V 2XG:00` a0R1:0A7#(Uᅀ!!: f!0!0  02 "0 "2 1 ,0S , r酀 e  0 `P>P202 zp` 08#X 8 K Kp 40K@0 80 < 40  @K0 z p-LMP`@Q-T T C0 0p(0 2S  $AP$00C$0 P 2:0 20Q 2Q A *00 p-LM `Q0 @  PP 0p -pLM0!P@0  p< 00` a+0e7#88!8C#8 S! 0C8R#8 1 S!0B000`07#888C#8 0CR80#8! B!20C2 -LM@P0 0C0 0 0 S 0-d1L @RR 0 P0#<2 %000S 0 $0P:0000 0@0 00 0P0P00PB 0@0000P @0Pn<00PS0 8000QqD 8f -LM@QPk0ESC,hi,iii8ipiii0PU6 P U 2 % P U  EP`  (0$P0(0 0? 2p 00  Pp}B0 0P 2  Rp (0$0P(0 $0PS 00 -LMSP @`p 1S PJ,mP4 01  K1 0 W7 00!P0# 2  00  0!Q PmP001 0! Nmr?sτ  P10 =m -L M@` p$KP(K (0S *P'lP(00 1`C$ PU (@X@1 s 6(0`0dS(0 0$0 l -L M10C`p0 40 ,K k@T" 4P,0UP! 0岁ᰁ?Z 00  0 0040`Vp  0-LM@P K@ K UP 0 1@C00 0 S BP00d0 00 -00 2 0 2  0-1 SPL@ 0hP 10 "0 "10 -LM,`pἑP P< 0410C7#0 8#P@ 0QP1@!Z101 :Z  X0 0 0C00 0 00e0@ZP 1@ C S@! T P Z0000   B   @P -LpMPK`pzP@ 0: S|P@  0Q 00 ZT0K 0 t{dT v@0 0($4 $ p-LM4@s`P( P$ U4404  04  0 00   0S0@0 0 R0p% 0?d -LA0 001R0000 00 R 0 00 0 0 S   5k -LMp6P`2 0 001R00000 S    0S0``` R 0 00 0 0 S  p0 0 R0```0 00P`  $P0P$P p  P ?0 0J000 0 0   0S0```p0 0 R0``4`S $ A0 00000 -LM@P  R 0 0 00 R0000jPj 0-@LTP 0@TKP0Np p-LM$ 4PR:@T 0` @TjP@ $ 0 0 404pp00010Q000 00R 0 00 0 0 S 0 0ppp -LM 4`Sp$0P0P4 P4S0 00$ $ 00 R 0S R0  -LDM@PKP@ 4,T QP 0P KSR0S0PK0 P@[[TK$P@KK ,PT@,83K#[$8KK[[R3KL K0KKK4pK@KX d0 d@@DTd@ 0S 0d@S@d`@ p0`SL` `` \JX0@\@ZXp3QPX h h P Uh R `0d@Dh \ l l偀 0 RPh H  `\ 8R \0`FP(*SdP\l 00 L cPe%88cP\X%X@ʷ0Pe%8P d`F\P l@00 L P\P%X@ʷ000l`X\l ` R" h0S d@\ c0 Sh0`@.L0#\ ʌ0#[[[2[P T PK $[[[4[P T P KP@&8#0H8#0H8#0H\ h   P T P0Kp@-^`@ Pb 0 2%$^ 040p p-LM@ P$K, ,0K $0 (` ` P `p -LM`V (  0SP@ p`@ V`pV@  V 1+#,PP 0p0`S0`` 0 @00, eV`pV@ B<B S=  P UP! 0 0e P0 0p0eS0`e0PVPV: ,PP 0 P0f  000yP P*0P` 0PU:gP 0 0c  0P0 V,` `pV@ ,0S? 0Y 1! P Q00P00S$ Q ,PPkY 0p0eS0`e^(P], P 0 0e 0  |000P E  eP0g0,0 J< 0 03 0-0L @R3 P+  0P @0P Pg 0P$00 0 00 QB< S  0  0 0c0 00000jD p-L M0K K@C 00p!`fPUhC 0 SP P000ppP` 0 0 p, p-LtM@PP`KP0@  P  Q 0 L P  p( 40R p; 0p0+ 0 p鄍 -LM ap@PP;T 0 0S.@0S$0 p@ 0S 0000 0E#10 @0!0 p0 OPRff00 BP (L  -L Mp@=PPT 0S @S 0ST  P pox`0Sd0 p@  0E #1 0 f9f@(L  0-LTPM@KT 0K  0  @@pB -LM@\Pp` h^\QU0SD R 0S=W00  00CS888DP\hpppppppp|0 0:00 1 0 0 ;00 0 0 R 0;S< W  4? : 00: 0, 4 -LM`@ 0pP`  0-L0MpP0 @0 0SDK@ 0S ,3h00@@ȭ t,@ P-L 0 h<: 00h*@ p-LM`0p@T 0Pd@00U0  ,PP`@Up0@00pp -dpLMW` P@PUJ0SX@PUZpW`\R @0S R@-  Mp-LM0`0 @`ep p-0LM`KPP $ P@  R 00RgP P0 0<0@0@ $0, 808 `(0  p90 0،$؍ -LM@6`PP/0:0 p-LMP `@0 : 0ph -LM@pP  0:0q0:0 -LMp` \0 P@ P@ -0LrS aS "90 0 Ϡ0+S bS 00 0+S wS ̠  -pLpMW@` wD PPN 0X1A  p  KP`N\ K 0SIWG  P`P5 Z Q X0a0 100410$1$cP@ 1!01 ! 01 !01  P0 80`8`8`Uc8Z 0S 1$1 !A/-_@{t AT O` 0R00CS  @0P0( @AP !D010CS1!N1  }H8`E8004lHpaH P0-PL @Mc0 -PLM0 0At 0800 -X1LtM@0 00 8p̠ 40$18p` DP @ V K^P H U P0S400S 10SQ l `0QQP700 00S 0 p-LMP@4? P @0 H$0D @0`D 6R@D0C ,0P0320<00@(@ 0  03S0php -L4!`PpGP/eP W& 1PU@8PP@UPP pubW0M70pkbibgb1B7p`b10Cs1 1!0C1Ub10Cs1Nb*7p -QLMP @4P  kP P0 70 0 -LBM`4P0 0  NKQ@pN0A/p p AP@18!0R@T,P 6O0060,1aH -LM@S0 h;600,1 -LMSS@0  \h!600,160 -LMR@ 0 h600,1~60 -LM4  4< 0 @ 80  0 PpZ 0@00P`V R0b<0lP @`V0P44 4 80 P00000@ < P 0Q[ꀚ4,@ 0S 800 0 c 000  80P   P 4 80 P  R   R< @0P`p(Kp! C  ,  0Pp @ P`~,p~ -LMSS`p@ S$!S00/ 0(1 !$! \W (0 RP0 0P E (Q0S R$1 !0$1^ 0S J?P0S% 1 P 0X 00b0 !0000  c 0 S(%*$1 0(! $1   0P $Q( UU0$Q $1ŝ 0P 0S( P0U(1( 650 0,1 -LM(0 p7b00VP(pVAv %P! @AdP 1!0 1!( 0P1D!D, W00  ,0i  -L`p@_PP   dx `P -0LM@ ,0( P00 0-@LPP P \ 031 1! \!0040@'40@p@-0P0 @ 0`0  00  00  00 0 0 0 0 00  00  00  00  00  00  00  00  00  #0 0" ! !0"0 # '0$0& % %0&0$ ' +0(0* ) )0*0( + /0,0. - -0.0, / 30002 1 10200 3 70406 5 50604 7 ;080: 9 90:08 ; ?0<0> = =0>0< ? C0@0B A A0B0@ C 1 G0DFEEFDG ` 0V0pG-M0 咀 0P0呀 @P`pL吠叀 @P`p0P0 0 L0 0 0 兀H儀0D僀@@傀P`p0 <偀8 0 @P`pH0$0D @00<8000tw|04vx 0u0 ~}|{@zPy`xp,t( 0 @!P"`#p40$00%,0&0((0'p00 ,04h jl0r s0pon@mPl`kpdq$i hgf) *(0+,-@.P/`0p$0< 10 @2030405080\ \`0be0a`@Xd c_P^`]p[ ZYX9:;@607 8p0T@?0 @0A0B0C0D0^T0 0TD E0FG崌⾉0 0 ZЍ -LM@p4 00 , 08 40L0 Ƞ< S,ȠL 0X0C8#Ƞ3 X0 08\<#X5 0<0e8#h < X0` 0n0C 00,`0 0X00 00C8#Ƞ Pp@00 0E8X#X4  R 0("X0e8#h 8H0`0l0C0 , ` 8040 ePp80 4 4P㌠!\/ X0 08#X\< " 0<0e8#h< `Ie00e0 `0@040\ 00C8#ȠQ00X @ -LMP @p`0B8S`RE 00Q 00lU@g PT3 V  0S 0Q S0ò000 B0 00C0C0 0 00T00 = UU800C802 0 R -LMP`  a("H T p 0 ʲ0S T0 fP  `ZQ0 Ppd`P 0 0b8#H Tʲ0S  0- LP@0S 0\P 0Q 0S 0S 0S00 -LM@ PQpl 0 RX 00 P) @Y 00d0 0S 0S 0P  0(1 P$1 0$1  $1 0(! @0 d Ƞ Q`ἠ,kP   04p  0 S 1 0 10 00 0S0GP 张@`0 0S07P 0S @ -LMP`  Q@ n, $ 0 0S0P  0Pp 0, S 0 i 00 0  pP![P Y 0(10S$1 0 ! 0S 0P  0P$1 0$1[ 0-LMP @p 1 00 -L M`@ A nQP, p'P"I[P 0 P 0, S 0  C00 0 ^[0 0S0|P  0Pp -LMP<0 80K0 Kp `P@Q0, 30 <KRp8#80CY 0@00PP08#X ("X 0 P L 00< 0@00Q<Y0A  P00<PP< 0P -RL M`Pp 0 @T 0S @RT ͅ0! A0@ &P@ V00 P V, 0 10 731 B,0  1@01S -L MQ 1pU, 0 1S{@`x 1Uu 0  \0D 0S0SZ 0 0<3Q B K  1F 0 10S% @ ` 0 Y \ಐ\% 0 Q10  @0 @00, S00 0 P 01-0Q0 P0P 00 `P@ YPP  l YP@ c1S0C1Y00! Q0PQX 0 AQ=Q10 -LMPpPmP@ R0 X 0W@ P  0YAT Y0CP @-0@0 @0!00  RCA 0\R! B@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  RQ'  0R!꨾ؾ̾ 2 2 2 2 2 2 2 2Q 0S !0S: 0-LMPK 00%0 @( 0ST 0S @S 0ST 0S.   .00 (L 10*2 C 0-P@TUL !P :WP@ / 0, 0 0@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -LM@0h,-R0 0c BSR48 R p-@P`x BRpR0 BRRR Mp-LM0`0 @`p2u*r*k*xh*Je*b* -LM, ,`\0 4 P u00  R-UP8  +U8 P4 RR0Uv 4@T0U 4 4@0K/0 @K @@K< pu 00Q0PEu P!0 0Q4 u,A 00Q7 EW EP4U%\ X  W W0 < U00S *p"00PD@ <B"D@p$$ŏ X008Q\pw0 R \,00F0XSxS0P40 `$P1 *  ,0* 0*0 -p@L00l8#hP 08#x `0 0c8#h08#x 0b0C`p`0 -LM@P 0S p7U0R G0`8U#h 0  b Rʂ0 S00@0@@0@Rڰ 0000G000A8  B8 000o -L4M@ 0< 开@ PD p <0Px D0@ 00  0 ZH P L *P0<S`R0000 l , @0g\0KH8 K8' 0080 0 c4 CP08#8P0 0ZpPP0n0 a B 00ഀD   000#8ᲀL  L 08# aL0 00`0ᲀPD  0<@ D   000 -LLMT X PpP 0L8#hL \\P ` h [00C8S 0@TL s \d `E0S@@KHKd0@ @ b 00H0 0L c@d@ 5P P3 0S 0 00S L Pp   00008#h\0 0S\`0S L'\0S 0 00S\  TLPT \ \  hT 000 0a0C0 h 0b0C 0X L0PX L` X0@QPh  L X` eX 8K TP X0LPbP4PT 8pW\ 0 RL0X P X -LM@p0Qs P`0 R=V0e S0 0RS 00P U*V0 00Q *^ 0P@  0Y008 8(40Po P0 00S"P@ 0S 0 00S 0P  Q p-LM40@SP`$ 000`!H 0 #Pp0000000 0 B@ 0p00S40040 -L M`pxQ  0 0C0ppSa <0R@W  P@0Pp  P P>Y 0S00C0pp  ,1R Y 0C\0K 1 00  0 !0  00[\002K)0[* [0 0\ʌ0 0"K+ [,[ \K'O0 0F@0@0<  JPPBJ@ 6@00@ -L MPx`p@ `  1R TI 0CP0K100  0!0  00[P0Z" <0W@  P@0Pp  P &O0 0@0@0< J PpBJ@ @00@0Tʀ0 0"K) [*[ Pڸ5P  -LM` Q0H20APP p0 1017  d2 020 0  崜8Q0 00P -L M  !4 0pD $0@SQ!P40 BU00 ,P 18aV U 0, 1 CU@  T pb @ TPU00ZD0 $0@0@@c TD ZF !4 0@  A@ D@ 010CY ?=2!I !U08#X&ʊU0 aP`40@ D0 T0D0Z 1@@ AU@ D 1 %001 %d@?=2D  $0!E!P@T$ U D0T P U D0TU1@ \0@bT5У 0$10C@/-"@dP`SP -0p8#(=1@0@A0C$0^^ 18a!$ BVLP ?=2!E.!h}` -LAMp0P 0 &ANK0AnK @D `FS@D `F) \0 0 AK A0A $4 0s1 + 8  0 pS $ *S` -L MⰀ0ሐ` 0cV8#Ƞ, F0@p P0 00 0c8#Ƞ 0 밀,000 0Pc PEP00@ -LM1@QPap O0 Rp8! ,5P8q8PpR0-P@ 0bR03 B0 -L 000CS?42[!0 h!!2[ 0H@00TQ/ 0S   2 0 40 p   0 4 "0 40  }0 y4 u2[!0 h!!P2[\L01 @ @ L 0 00L0P  L0 p2[ S000!! B  @@  2[!0 h!!2[0A0@v2[S000!! B  @@10C00  2[!0 h!!2[!0 B  0@T*K0 K40K"0@7[#(Q:0 1T  a )A 0 0TL $ 00X0 0S2[S1L 0C0 0 !<K0 80 < 0D @0 DK 00SX0%1P P0 %P  2 0 40 p0 40  @ 000@t*K0 K40K@qX) -LMP,K00 P`N ,0 1v?0 1 0 0\ 01 0CRC MPp8 !000 v?0 1 0\ 1  P@ 00 J0 !@wT@MP00`M -01P00` -LM@,Kpl`V0K% fPU0  , @0vϠ@ @ @@@`P -LMv` Lp1P0C@ 00!  B!1@1!0C 00 01  } -vL LP@@ ` R+ R:! p 0  0 n!!1 @ @ 0   0 !0 0 0w 'p!0 0 n!1!@ 00 -L$MP, ,@vAL! Ƞ< ^D 00 8 ,Ƞᰠ`4 @ pS*Z@  000CSPDt0 0 @0H0 Z@400S*<0AW Z 10d1 1 Ƞ  ,x:@ 0088@#8S@0 :HDP^ D <08W#h:1, 001  ,0 0R` Z00с,0g0< `W6*0Z8#h 000CSy0  @001 0d10@1 Ƞ ,x<08W#h:0<1Z0110100 0 0@ 1@0  R0"0! !R0%,%0%05,@5 g 050% !0F8#h|0!0 0 0@ H ?0!@080!@H@ 00@0 -LM @P0  0 0 090-10C7#\ 0* 08 #8S:  -Lᴃ%s: %s not compiled in instbinUsage: %s ..., where is one of: mount_cd9660dfmountmount_ext2fssyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigrtsolping6lessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfsckmknodreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shmvexprdmesghostname!̈`d4lD@@tdx| @@ ` ` ` ` ` ` H    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxcbsconvfilesibsifobsofskipno value specified for %srecord operations require cbsbuffer sizes cannot be zeroseek offsets cannot be larger than %qdcbs cannot be zerocbs meaningless if not doing record operationsbs supersedes ibs and obs%s: illegal argument combination or already setunknown operand %sasciiblockebcdicibmlcasenoerrornotruncoldasciioldebcdicoldibmosyncswabucaseunblockunknown conversion %s%s: illegal conversion combination%s: illegal numeric value%s: short input recordstdoutinput bufferoutput bufferfiles is not supported for non-tape devices%s: short write on tape device%s: short write on character device%s: end of device%u+%u records in %u+%u records out blocks%u odd length swab %s %u truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryskip reached end of input userquotagroupquotarwautoaccesstimeatimedevexecsuidrdonlyunionupdateegjo:Rcd9660%s: Filesystem not supported by kernelrealpath %s%s on %susage: mount_cd9660 [-egjR] [-o options] special node %s: illegal value '%s'needsdoes not need-o %s: option %s a value-o %s: option not supportedhiklnPt:retrieving information on mounted file systems%s mounted as a %s file system%s is not a local file system-i is incompatible with -Ponly one -t option may be specified.empty type list %lld %7s%-*.*s %*u %9u %9d %5.0f%% %7u %7u %5.0f%% %s 1K-blocks%-*.*s %s Used Avail CapacityFilesystem Mounted on iused ifree %%iused Size%-*.*s %s Used Avail Capacity1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fskerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdepasynchronousasyncexported to the worldAadfo:rwt:uvforcerqnoauto/var/run/mountd.pidsignal mountdgetmntinfo:@nfsunknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./usr/sbinexec: mount_%smountfsstatfs %s%s/mount_%sexec %s for %sno mount helper program found for %sforkalready mounted%s on %s type %.*s: %s %s on %s type %.*s (%sunknown flag%s %#xv2v3udptcpsoftintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregminacregmax, %s=%dacdirminacdirmaxprmounthardmfs%s%s=%lu %sadosfs%s%s=%u, %s=%u%s%s=0%omsdosshortnowin95gemdirexecnorripgensextattprocfslinuxversion %d, ctime=%s%s,%s-o[-Aadfruvw] [-t ffs | external_type][-dfruvw] special | nodeusage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special nodeufs%s: fstab type %s != disklabel type %s%s: fstab uses outdated type 'ufs' -- fix please mount table fullspecified device does not match mounted device%s on %s: %sfilesystem not supported by kernelusage: mount_ext2fs [-o options] special node $FreeBSD: src/sbin/newfs_msdos/newfs_msdos.c,v 1.9 1999/08/28 00:13:52 peter Exp $%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) %s: can't read sector %u%s: can't write sector %uNO NAMEFAT%uBSD 4.4%u clusters too few clusters for FAT%u, need %uwarning: sectors/FAT limits file system to %u clusterstoo few reserved sectorsno room for backup sectorbackup sector would overwrite info sectorno room for info sector/boot/%s%s: inappropriate file type or format160180320360720120014402880%s: bad FAT typevolume ID%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorswarning: %s is not a character devicebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: FAT type limits file system to %u sectors/dev/%s is mounted on %s%s: unknown standard format%s: can't figure out partition info%s: partition is unavailablegetdiskinfo%s: unknown disk typeioctl (GDINFO)%s: can't read disk label; disk type must be specifiedbps=%u spc=%u res=%u nft=%u mid=%#x spt=%u hds=%u hid=%u bspf=%u rdcl=%u infs=%#x bkbs= bsec=%u spf=%u sec=%u rde=%u%s: no default %s%s: illegal %s%s: bad %s"*+,./:;<=>?[\]|usage: newfs_msdos [ -options ] special [disktype] where the options are: -N don't create file system: just print out parameters -B get bootstrap from file -F FAT type (12, 16, or 32) -I volume ID -L volume label -O OEM string -S bytes/sector -a sectors/FAT -b block size -c sectors/cluster -e root directory entries -f standard format -h drive heads -i file system info sector -k backup boot sector -m media descriptor -n number of FATs -o hidden sectors -r reserved sectors -s file system size (sectors) -u sectors/track   $0    H:  (#038#@3H2P3X3`#h@p@T@x@  @@$,4<DLT\ dlt|   $,8DPX`hp@x@@@    @@      8 C$$ C, C$4 C< H T ` l t |             @ @   ! !!discarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntoption requires a numeric argument -- %smaximum option value is %d -- %sundefoption requires an argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:ispeed=%d:ospeed=%d %s=%x:%lxoflagospeedlflagiflagispeedcflagcbreakcolscolumnscookeddecekeverythingextprocnewoldostartostoprawrowssanespeedttyillegal option -- -%s%d %d TIOCSETDTIOCSTARTTIOCSTOPcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeottablet disc; ispeed %d baud; ospeed %d baud;lflags-extprociflagsoflagscflags%-8scchars%s = %s; %d rows; %d columns;speed %d baud;#%d disc; slip disc; ppp disc; strip disc; -aefgaef:gTIOCGETDTIOCSWINSZtcsetattrgfmt1illegal option -- %sTIOCGWINSZnot a terminalusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.11 2004/12/17 00:36:07 jaredy Exp $Ffhnslinkit%s: is a directoryusage: %s [-fhns] file1 file2 %s [-fs] file ... directory @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.94 2005/01/07 21:58:14 otto Exp $I\0?\0?Db\I\\?m?\H?h?\l?\\\\{sƑOJNH\u]iSwv\>i ȉ@ʇ~ Yɚ"1=3=ݿ~//_}$^n^^W{;mZ5jcFUGOGdo^d/^g_e2+Mflfo:UVJgyUwt^{wkUvo@2>.4;-"GoA~g=gz.7]x5יƯ#6,MЌ1:_gu:+xVqh~,m|_eUNٖS|5|O6{릀f诳l>>oLJQ^f/; @fgq-跗[XctztԜeg$w;xXRyяiLm}^&_|̇67T]/s}˼m[j@VLP0o\14(b ̋Uo`pa>>ZlTAš_aaz( *:jT^L >f`ECn,os[i;Jun٘n0[34o ,LyCaM!Q8Usevg(O8em;Z)&a]mx+B;>ҥŝNaO(/3RY9^NW[:lU_c]"7gbF`Bfl'v)$Z2;j1iy[Ȣ"Ʈ#4CRI{4.0 iP>6 ӊ^-i&WdA? 4{PI `sH &gi1ߴ$j&$,FoA2'S+< dk{Z Lb|ۭ=XlP̯ή.)WK:WW)/{^*XP8P@>r]@%-,I׷M=*xH-zB%Ӡ< [ A^TyÝ/]usg"ܩ IIn*`Y)cM:ݏ, VK'9c7ѣ=|m;F1o@DVZ7.<&Z;&QS|c?$5("$5 {V%B i ؊qaBh0S"P׀}^s^[ Eyجn3pk{Wz ƾk1Nt=Z0h-o[UVpr0j[[')FQ6~%-bMS]]7ۅ^+# Y/[ؽtB@POT~z37v/FAnͿ_U'׶UQnH]Hz8ϑvGN*{SZu'6 Py@d*E (ڭvP#BÑ Â<-^ߎGZ剀+J**7xޗt[70ʎ+-}Yޢ O#w3SOі!qfU?a3ZDН5YoP$nޥ9꒣4ᓢ{NΦ a= S+C_<=;3 kc7RvMD0ZAoٰDޚAKFBÔ*KB)0)Ǟk0|8cjz 0*CΊ "u#B%N<;Wpkr#\5! ]CQֆM)V3튠I74=ix\  xӅoc9^-Ni(nI "2vgsΙ%|Ξ:'C@O]gr}eCܑ3$E QaiJ#d"T{jZgPI0Z5' rV}1|blNP(_(D2)=b.ȃ8Fys)n}@Z'>ňo2J`'>IG@/=dۂ7ԈL@}Skk .y!2,ף1- .?jIJmtؐ@QY-f].j[<ʫvER,,ϝ25PCfuL42)%D㐛u|ˏn]7kxr#0_F (#<G~7Z'4_kUB 2 a&1cx  Ϛ|ϛ;?g}[W]DxF yC$!_FܖʹtneW*/;51/`!pOٟW)ʚcܴ nF,ZKdKS9;H{FZ6hIh8pb]H-8~BXV7 ԍ֩^e*b{iX}f ȷ}CwɚGvN;1(}qꔖ.B6>3 耑*CйBRMv1躶Ufg T:nRY2m:ߌ|;ZL1&$T{E tF Θh=더]:G[*YBgsrp (77W^k??:e 0#G_-s { nV82Fu15.u@ڈ4 f'Fη]as3gd|h˛Q:a_3\ Qqe</ ktk` nq׶UPWenM1A1 s @nNIQEʱ<;OTN\ŪX'V\ ^<}:ktإ'9 ,Lq.k3}Kyr|󒇫$ɒLYF0b/N Fp8EP#t,~%uGVOۅSp}[` >u~ŧ'>?#vT^rymهC 9uFQX,;MmU߹s$u:.ekHi/ ,z=c`d2o@U{'iJMAM>:{=(lrg~{xmj[W? +OʇM2pȤDt{.Iٖ*Żo懾t?pT[ *%( hh^1杯!8$*cI:R :]]lNXLR`2GHa.25P20գzi8cӄ?ɮ"Gn}*j7:qz tB~ 2NF\S@N~Q{ ,.0|9v`N%̉u#U{(T]Ɉh7X;־9d$1R` ⏵b/u3rnso@uYk \ZS:$x3g":%1US3lO`3uٸt1+P($:C.Cl *cA(|8Kmݴ3frQE0on"?>Y_ s_q>d;><"܉icZG>|k A5ޟHŅ% +~~ WԁÓ|SN4nqD~\ơJUT.A*kT@!,A \KWIM(c׸ޞͽU1)Xkʱu{TށGEy!Jv'inW+ޙA[y v&ѩNi3&#OadR,8y ES߱tIHzl:q!42*@WwT[C"M,i\[I C fQ[.5F]X3N/Mg4+=lAP۴ aV G1:p0=e&$[ OƄ4Tж IڤA\e]SEV~PD3-] {ή6B,-Ȳ=G+ܦEp=ߺ¥qhQM honVώpz~|CYoB o!8)BqDE=\.Z0./nEgn!媃UM{m|]B \{`9Չ9&^[-}A!r!|Kh7br51?-*>4(ڄ(2xʦ RG8ǸA$)Z9dA}}RN1IN"Saв VJt+/%#{$O!NPAvhk T1_kRL+eMQSzl%zdo* i|{%;M}SP%-Hve!nOErUܓZƽ|J#d+n U+*'*92r.mߎ`H-{Ʌĸ(6j/rhwDwû^KŎδ{@)S,8.f#XӪ;\Y,j0r*NȻf\k'߻58''i>Dx$2ؘu$(4ELNst'rjh2}lzR0h7if^deMPTSe6ΩcRI _;G6hR`rA™h6~Ha>jn!d΄"Q#C O]a4Y U*В8R|>S/onlg?;>t2Md5-+)Xa)!sEQ!.tJ]&#QÌ{4MwܞfrbSF{?L(h1#sqM~MA~b-8%{p32%(|nQwfR# W˅m?a\wQ]-&ˮ]]:8m.趰݌UU9c"7RQ;zkc$Az_*y@L<[c-W?_ԶEI7۳qYA| rf⹄%d| WRbsg_-W/ɌPbadosunknownSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSBEf:NRWb:cdenp:rs:tvwbckmgioctl DIOCWLABELunknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.writelseekwriting label to block %lld (0x%qx) ioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)no disklabel found. scanning.no disk labeldisk label corruptedfound at 0x%lxreading label from block %lld, offset %lld ioctl DIOCGPDINFOioctl DIOCGDINFOioctl DIOCRLDINFOBootstrap doesn't leave room for disk label\ :Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%hu:%sil#%hu:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:%sts#%u:%shs#%u:%scs#%hu:%ssk#%hu:%.*s| %c: %12.*f%c %12.*f%c %7.7s%7d%19.19s# %s# Cyl %5u-%6u %5u %5u %4hu %5u %5u %4.4s %c: %13u %13u device: %s # %s: type: %s type: %d disk: %.*s label: %.*s bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total bytes: %.*f%c free bytes: %.*f%c rpm: %hu %hu partitions: offset# %13.13s %13.13s fstype [fsize bsize cpg] interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d free sectors: %u total sectors: %u badsect ecc removable # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) re-edit the label? [y]: editNo changes.-cEDITOR/usr/bin/vifailed to start editor/bin/sh # line %d: syntax errorIDEline %d: warning, unknown disk type: %sremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: warning, unknown filesystem type: %sline %d: too few fieldsline %d: bad partition offset: %sgetasciilabelline %d: bad partition size: %sline %d: unknown field: %sline %d: bad # of partitionssector size %dtracks/cylinder %dwarning, unused partition %c: size %d offset %dpartition %c: block size < fragment sizepartition %c: partition extends past end of unitpartition %c: offset past end of unitwarning, partition %c: size 0, but offset %dwarning, number of partitions (%d) > MAXPARTITIONS (%d)warning, super block size %% sector-size != 0super block size %dwarning, boot block size %% sector-size != 0boot block size %dwarning, revolutions/minute %dcylinders/unit %dsectors/track %dcmplabel usage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) disklabel -B [-nv]%s disk [disktype] (boot) disklabel -Bw [-nv]%s disk disktype [packid] (write) disklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)You need to specify a type for this disk.No 'c' partition found, adding one that spans the disk. Initial label editor (enter '?' for help at any prompt) unable to get default partition tablePAGER/usr/bin/lessgunzip -qc|%sunable to execute %sEnteringExiting%s expert mode This option is not valid when run without the -f flag. Write the modified label to disk?Write new label?unable to write labelNo label changes.In no change mode, not writing label.Recalculated free space.cannot open %sFilenameName of the file to save label into.Nothing to undo!Last change undone.Unknown option: %c ('?' for help) can't run when there is partition overlap.Partition must be between 'a' and '%c' (excluding 'c'). editor_add Please re-enter an offset and size for partition %c. Partition '%c' exists. Delete it first. The letter of the new partition, a - p.partitionPartition '%c' already exists. Partition must be between 'a' and '%c'. No space left, you need to shrink a partition Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to nameThe letter of the partition to name, a - p.Command aborted Please re-enter an offset and sizeWarning, need %u sectors but there are only %u free. Setting size to %u. partition to modifyThe letter of the partition to modify, a - p.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk partition to change sizeThe letter of the partition to change size, a - p.%s: [%s] %s: [%u] Rounding to nearest cylinder: %u getuinthas_overlap Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE)."%s" is not a valid disk type. Valid types are: "%s"label name15 char string that describes this label, usually the disk name.The Numer of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.Not enough free space to shrink by %u sectors (only %u sectors left) The rotational speed of the disk in revolutions per minute.The physical sector interleave, set when formatting. Almost always 1.edit_parmsYou may want to increase the size of the 'c' partition.failed to sort partition tablesdrzFLOPPYxdhdCCDVNDsvndPossible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. Available commands: ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [b|d|u] - use [b]ios, [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. p [unit] - print label. q - quit and save changes. r - recalculate free space. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. mpsave%s%c %s %s rw 1 %d Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors Size of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. Error: block size must be at least as big as page size (%d). cpgNumber of filesystem cylinders per group. Usually 16 or 8.FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' noneWhere to mount this filesystem (ie: / /var /usr)Mount points must start with '/' Can't stat deviceBIOS geometry not defined. You must enter either 'd', 'b', or 'u'. Note: user geometry is the same as disk geometry. Enter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.[d]isk, [b]ios, or [u]ser geometry$OpenBSD: ar_io.c,v 1.36 2004/06/20 16:22:08 niklas Exp $$OpenBSD: ar_subs.c,v 1.28 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: buf_subs.c,v 1.20 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $$OpenBSD: cpio.c,v 1.17 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: file_subs.c,v 1.28 2004/11/29 16:23:22 otto Exp $$OpenBSD: ftree.c,v 1.25 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: gen_subs.c,v 1.17 2003/06/13 17:51:14 millert Exp $$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: options.c,v 1.61 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: pat_rep.c,v 1.28 2004/06/11 03:10:43 millert Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.27 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: tables.c,v 1.22 2004/11/29 16:23:22 otto Exp $$OpenBSD: tar.c,v 1.34 2004/10/23 19:34:14 otto Exp $$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $Cannot write an archive on top of a directory %sFailed stat on %sFailed chdir to %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %s%s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. done. %s: Waiting for tape drive close to complete...ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specEnd of archive volume %d reachedFailed read on archive volume %dWARNING: partial archive write. Archive IS FLAWEDWARNING: partial archive write. Archive MAY BE FLAWEDFailed write to archive volume: %dUnable to append, trailer re-write failed. Quitting.Write failed, archive is write protected.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Cannot allow updates to an archive with flaws.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to seek archive backwardsReverse position on previous volume.Unable to obtain current archive byte offsetUnable to backspace tape %d blocks.Tape drive unable to backspace requested amountget_physUnable to backspace tape over %d pad blocksUnable to backspace over tape filemark.Unable to locate tape filemark.Cannot determine archive tape blocksize.Unable to backspace over last tape block.ar_next ATTENTION! %s archive volume change required. %s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot open %s, try again Cannot save archive name.Quitting %s! %s ready for archive tape volume: %d Load the NEXT TAPE on the tape driveReady for archive volume: %d Unable to restore signal maskUnable to set signal maskcould not pipecould not forkcould not exec-dcCan't fchdir to starting directoryCannot chdir to %sextractUnable to open %s to readCannot mix current archive format %s with %sappend%s: Reading archive to position at the end...directory name is too long %scopyDestination is not a directory %sDestination pathname too long %sCannot access destination directory %sArchive I/O error. Trying to recover.Archive I/O error, cannot continuePremature end of file on archive readInvalid header, starting valid header search.Unable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleUnable to rewrite archive trailer, cannot append.Cannot append to an archive that may have flaws.Archive read error limit (%d) reachedUnable to append when there are archive read errors.File changed size during read %sFile %s was modified during copy to archiveRead fault on %sActual crc does not match expected crc %sUnable to obtain block size for file %sFile %s changed size during copy to %sFile %s was modified during copy to %sFailed stat of %sFailed write during copy of %s to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache tableTRAILER!!!cpio_endwrCpio file name in header is corruptedCpio file name length %d is out of rangeCpio link name is corruptCpio link name read errorCpio link name length is invalid: %qu070707File is too large for cpio format %sCpio header field is too small to store file %scpio_wrUnable to write cpio link name for %sUnable to write cpio header for %s070701070702File is too large for sv4cpio format %sSv4cpio header field is too small for file %svcpio_wrCould not write sv4cpio link name for %sCould not write sv4cpio header for %sFile is too large for bcpio format %sbcpio_wrBcpio header field is too small for file %sCould not write bcpio link name for %sCould not write bcpio header for %sUnable to create %sUnable to close file descriptor on %sA hard link to the directory %s is not allowedUnable to link to %s from %sUnable to copy %s, file would overwrite itselfCould not link to %s from %sUnable to remove %sUnable to link file %s to itselfCould not create: %snode_creatCould not access %s (stat)cannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not unlink %sUnable to remove directory %sAccess/modification time set failed on: %sUnable to obtain file stats %sUnable to set file uid/gid of %sCould not set permissions on %sFailed write to file %sOut of memoryFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Failed seek on file %sFile changed size %sset_crcFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:Can't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sIgnoring too-long pathname: %sIgnoring unterminated pathname at EOFls_list%b %e %H:%M%b %e %Y%s%2u %-*.*s %-*.*s %4lu,%4lu == => %9qu %s%s %s ls_tty%s: unknown option %c %s: %c argument missing bcpiosv4cpiosv4crcustarab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZ0Write limit is not a %d byte multipleInvalid write limit %sError count value must be positiveInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Destination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8Unable to allocate space for option listTAPEProblem with file '%s'Unable to open file '%s' for read-C-Iwrite_opt=nodirabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options format [-G group] ... usage: pax [-cdnvzO] [-E limit] [-f archive] [-T [from_date][,to_date]] ... [-s replstr] ... [-U user] ...[pattern ...] pax -r [-cdiknuvzDOYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvzHLOPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-T [from_date][,to_date][/[c][m]]] ... [-o options] ... [-U user] ... pax -r -w [-diklntuvDHLOPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory usage: tar [-]{crtux}[-befhmopqsvwzHLOPXZ014578] [blocksize] [archive] [replstr] [-C directory] [-I file] [file ...] usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list Empty replacement stringrep_addInvalid replacement string %sInvalid replacement string option %s%s while compiling regular expression %sUnable to allocate memory for replacement stringEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern list inconsistentPattern select out of memoryRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Processing continues, name changed to: %s tty_renameProcessing continues, name unchanged. Skipping file. File name %s/%s, too longrep_name%s >> %s >> %s Replacement name too long %s >> %sReplacement name error %sTMPDIR/tmp/Cannot allocate memory for temp file name.Can't open current working directory.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerUser selection table out of memoryUnable to find uid for user: %sUnable to allocate memory for user selection tableGroup selection table out of memoryCannot determine gid for group name: %sUnable to allocate memory fo group selection tableEmpty time range stringUpper %s and lower %s time overlapIllegal upper time range %sTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Illegal lower time range %sBad option %c with time range %sUnable to allocate memory for time rangeImproperly specified time range: %sCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %schk_ftimeFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryFailed ftime table readFailed ftime table seekCannot allocate memory for interactive rename tableNo interactive rename table, links may failInteractive rename table out of memoryCannot update rename tableCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesUnable to store mode and times for created directory: %swrite_optnodir%s=%s is only supported when writing.Unknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optiontar_wrFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for ustar %sUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wrnobodyFile is too long for ustar %sLink name too long for ustar %sUstar cannot archive a socket %s/dev/ttyFatal error, cannot open %s%s: @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.70 2005/01/19 13:40:47 mpf Exp $DI:LRS:c:dfi:l:np:qrs:T:t:vw:number of packets to transmit is %s: %sbad interface address: %stos value is %s: %s%s: only root may use interval < 1sbad timing interval: %spreload value is %s: %spacket size is %s: %sttl value is %s: %smaxwait value is %s: %s-f and -i options are incompatiblebind-R option and -D or -T, or -t to unicast destinations are incompatiblesetsockopt IP_MULTICAST_IFgetsockoptCannot set the receive buffer sizePING %s: %d data bytes ping: recvfromPING %s (%s): %d data bytes Could only allocate a receive buffer of %i bytes (default %i)setsockoptsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_LOOPping: record routerecord route not valid to multicast destinationsunknown host: %sping: wrote %s %d chars, ret=%d pingerping: sendtopacket too short (%d bytes) from %s unknown option %x LSRR: 0.0.0.0 (truncated route) %s RR: (same route) NOP%d bytes from %s: icmp_seq=%u ttl=%d wrong data byte #%d should be 0x%x but was 0x%x%x (DUP!) time=%d.%03d ms%d bytes from %s: %ld packets transmitted, %ld packets received, %.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms -- somebody's duplicating packets!%ld duplicates, --- %s ping statistics --- Echo ReplyDestination Net UnreachableDest Unreachable, Unknown Code: %d Destination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF setfrag needed and DF set (MTU %d) Source Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDesination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffSource QuenchRedirect Network(New addr: %s) Redirect, Unknown Code: %dRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostUnknown ICMP type: %d Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime exceeded, Unknown Code: %d Frag reassembly time exceededTime to live exceededParameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xpatterns must be specified as hex digitsusage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host $OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $lost+foundwrong type to dirscan %d DIRECTORY CORRUPTEDNAME=%s fileerror%s=%s DIRLINK COUNT %s COUNT %d SHOULD BE %d (ADJUSTED)ADJUSTLINK COUNT INCREASINGUNREFmkentryUNREF %s (RECONNECTED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATElinkupSORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY DIR I=%u CONNECTED. PARENT WAS I=%u SORRY. NO SPACE IN lost+found DIRECTORYNO lost+found DIRECTORYCREATE (CREATED)RECONNECTmakeentryNO SPACE LEFT IN %s (EXPANDED)EXPANDckinodeDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSiblockPARTIALLY TRUNCATED INODE I=%ublk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot increase directory list cannot find inode %d CLEAR (CLEARED) I=%u OWNER=MODE=%o SIZE=%u MTIME=%12.12s %4.4s %d %s I=%uBAD STATE %d TO BLKERR b:dfm:npyAlternate super block location: %d ** lost+found creation mode %o bad mode to -m: %o -%c flag requires a %s checkfilesysCAN'T CHECK FILE SYSTEM.** Phase 1 - Check Blocks and Sizes** Phase 1b - Rescan For More DUPS%d files, %d used, %d free ***** REBOOT NOW ***** ***** PLEASE RERUN FSCK ***** ***** FILE SYSTEM WAS MODIFIED *****The following zero link count inodes remain: %u,The following duplicate blocks remain: %d,%d blocks missing %d files missing ** Phase 5 - Check Cyl groups** Phase 4 - Check Reference Counts** Phase 3 - Check Connectivity** Phase 2 - Check PathnamesINTERNAL ERROR: dups with -p** Root file system** Last Mounted on %s starting usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... INCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED)LINK COUNT TABLE OVERFLOWCONTINUEUNKNOWN FILE TYPE I=%ubad indirect addr: %d bad direct addr: %d bad size %lu ndb %d:HOLD BAD BLOCKbad size %lu:INODE I=%u HAS DTIME=%12.12s %4.4sPARTIALLY ALLOCATED INODE I=%uDUP TABLE OVERFLOW.EXCESSIVE DUP BLKS I=%u (SKIPPING)EXCESSIVE BAD BLKS I=%uBAD STATE %d FOR ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYCANNOT ALLOCATE ROOT INODE ROOT INODE UNALLOCATEDALLOCATEpass2MISSING '..'FIXBAD INODE NUMBER FOR '..'DIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dDIRECTORY TOO SHORTMISSING '.'I OUT OF RANGEREMOVEpass2checkUNALLOCATEDBAD TYPE VALUEIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)DUP/BADZERO LENGTH DIRECTORYEXTRA '.' ENTRYEXTRA '..' ENTRYCANNOT FIX, INSUFFICIENT SPACE TO ADD '..' CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'BAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUPsummary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dBLK(S) MISSING IN BIT MAPS #%dINODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADpass5ino_bitmap:ibmap:blk_bitmap:bbmap:BAD STATE %d FOR INODE I=%ld %u: %2x %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /r%s is not a character device Can't stat %s Can't stat rootmalloc failedrealloc failedstrdup failed%s is not a character device (NO WRITE)cannot allocate space for superblock setupLOOK FOR ALTERNATE SUPERBLOCKSLOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THE%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d WRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead cannot alloc %u bytes for typemap IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULT** File system is already clean %sile system is clean; not checking ** Fstate = %d NO WRITE ACCESS** %sCan't open %s: %s Can't stat %s: %s MAGIC NUMBER WRONGBAD LOG_BSIZEINCOMPATIBLE FEATURE BITS IN SUPER BLOCKcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %ld, original %ld, alternate %ld BAD SUPER BLOCK: %s %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ioctl (GCINFO): %s %s: can't read disk label PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK bad file type 0%o %s? yes %s? [yn] %s? no INTERNAL ERROR: GOT TO reply()cannot allocate buffer pool deadlocked buffer pool CANNOT %s: BLK %dProgram terminated MARKING FILE SYSTEM CLEAN cache missed %ld of %ld (%d%%) MARK FILE SYSTEM CLEANUPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:returning to single-user after filesystem checkSALVAGE (SALVAGED)UNKNOWN INODESC FIX MODE %d benstuvusage: %s [-benstuv] [-] [file ...] %6d @(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ifconfig.c,v 1.131 2005/02/15 19:45:22 reyk Exp $sH\@H\\\H\H\H\H\4X[X[X[ aa dZ(_0h`4Xf<gDgLgTg\jdjljxjkZ[WDH]H]H]H]p]]^XH\H\ H\ H\@H\H\$s,t88u^,tDuPuXZdZY \ldi i@VVti ixWY  @@` |####$$$$ %%%$%(&0&<'D'P(X(d)l)x**++,,,---..//00 00 1(14C<CHDPD\EdEpFxFccddee $Lc,8@PT\`l   @@@@@@$`,`8<DLT` hp| `@%ddBm %sieee80211_statustrailers-trailersarp-arpdebug-debug-aliasdeletegroup-groupnetmaskmetricmtunwidbssid-bssidnwkey-nwkeychan-chanpowersave-powersavepowersavesleepbroadcastipdstanycast-anycasttentative-tentativepltimevltimeeui64destroylink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstdescriptiondescrinetinet6-a-A-ma-am-mA-Am-minterface name '%s' too longextra address not accepted'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRSIOCGIFFLAGSSIOCGIFMETRICgetifaddrsstrdup%s: no such interface SIOCIFCREATESIOCIFDESTROYSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCSIFDESCRNote: trailers are no longer sent, but always receivedSIOCSIFFLAGSsetifflagsinvalid %s %s: %s%s not allowed for the AFinterface index is already filledcould not determine link local addressmetric %s: %sSIOCSIFMETRICmtu %s: %sSIOCSIFMTUsetifgroup: group name too long SIOCAIFGROUPsetifgroupunsetifgroup: group name too longSIOCDIFGROUPunsetifgroupbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xSIOCS80211NWIDsetifnwidmalformed BSSID: %sSIOCS80211BSSIDsetifbssidpersistpersist:SIOCS80211NWKEYsetifnwkeyinvalid channel: %sSIOCS80211CHANNELsetifchanSIOCG80211POWERSIOCS80211POWERsetifpowersavepowersavesleep %s: %ssetifpowersavesleep ieee80211: nwid chan %u bssid %s nwkey %d:powersave on (%dms sleep) (auto) SGIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sEthernetetherTokenRingtokenFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA1DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.83211a11b11gfhfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbackloopmasterEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %smedia mode %smediaopt instance %d physical address inet%s %s --> %s phys_statusno carrieractiveno ringinsertedno networkbackupUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu address: %s description: %s %s: no media types?SIOCGIFMEDIA media: status: supported media: inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime in6_alias%s: bad valueprefix %s: %s%s=%o%s=%xusage: ifconfig [interface] [address_family] [address [dest_address]] [[-]alias] [[-]arp] [broadcast addr] [[-]debug] [delete] [up] [down] [ipdst addr] [tunnel src_address dest_address] [deletetunnel] [description value] [[-]group group-name] [[-]link0] [[-]link1] [[-]link2] [media type] [[-]mediaopt opts] [mode mode] [instance minst] [mtu value] [metric nhops] [netmask mask] [prefixlen n] [nwid id] [nwkey key] [nwkey persist[:key]] [-nwkey] [bssid bssid] [-bssid] [chan n] [-chan] [txpower dBm] [-txpower] [[-]powersave] [powersavesleep duration] [[-]anycast] [eui64] [pltime n] [vltime n] [[-]tentative] [vlan vlan_tag vlandev parent_iface] [-vlandev] [vhid n] [advbase n] [advskew n] [maxupd n] [pass passphrase] [state init | backup | master] [syncdev iface] [-syncdev] [syncpeer peer_address] [-syncpeer] [phase n] [range netrange] [timeslot timeslot_range] [802.2] [802.2tr] [802.3] [snap] [EtherII] [pppoeac access-concentrator] [-pppoeac] [pppoesvc service] [-pppoesvc] ifconfig -A | -Am | -a | -am [address_family] ifconfig -C ifconfig -m interface [address_family] ifconfig interface create ifconfig interface destroy getifgroupsSIOCGIFGROUP groups: 1ACFLRSTWacdfghiklmnopqrstuxCOLUMNS%s: %s: %s: directory causes a cyclefts_readdisplay%qu%*s%*qd printlong%3d, %3d %-*s %*qd %*u total %lu %s %*u %-*s %-*s -> printlink ls: %s: %s %*s usage: %s [-1ACFLRSTWacdfhiklmnopqrstux] [file ...] mainifconfigmake_packetrtsol_check_timerrtsol_timer_updatesockopensendpacketrtsol_inputinterface_upinterface_statuslladdropt_fill)get_llflagprobe_initdefrouter_probesendprobeadDFfailed to open a socketfailed to initilizatoin interfacesselect: %sfailed to setup for probing routersfailed to initialize %skernel is configured as a router, not a hostkernel is configured not to accept RAsadDfFm1memory allocation failedinterface %s was already configuredfailed to get link layer information for %slink-layer address option has null length on %s. Treat as not included.memory allocation failed for %sNew timer is %ld:%08ldthere is no timer%s status is changed from %d to %dNo answer after sending %d RSstimer expiration on %s, state = %dset timer for %s to %d:%dstop timer for %sillegal interface state(%d) on %susage: rtsol [-dDF] interfaces... usage: rtsol [-dDF] -a usage: rtsold [-adDfFm1] interfaces... usage: rtsold [-dDfFm1] -a <%s> %swarnmsgprobing %sreallocmultiple interfaces foundff02::2inet_pton failed for %ssetsockopt(ICMP6_FILTER): %sIPV6_HOPLIMIT: %sIPV6_PKTINFO: %ssocket: %smalloc for send msghdr failedmalloc for receive msghdr failedsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketfailed to get receiving interfacertsol_inputinvalid icmp type(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on %s, state is %dreceived RA from %s on an unexpeced IF(%s)invalid icmp code(%d) from %s on %spacket size(%d) is too shortfailed to get receiving hop limitrecvmsg: %schecking if %s is ready...interface_up%s is duplicated%s is tentative%s is readyget_llflag() failed, anyway I'll tryioctl(SIOCSIFFLAGS): %sioctl(SIOCGIFFLAGS): %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS) on %s: %sunsupported link type(%d)get_llflagioctl(SIOCGIFAFLAG_IN6): %sgetifaddrs: %ssocket(SOCK_DGRAM): %sshutdown: %slo0defrouter_probedefault router list contains a non-link-local address(%s)ioctl(SIOCGDRLST_IN6): %sprobe a router %s on %ssendprobeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftinvalid namelen:%d/%luno nameunknown qtyperefused???unknown, type 0x%xrefused, type 0x%x%d bytes from %s, icmp_seq=%u hlim=%d(DUP!) time=%g ms dst=%sfailed to get receiving packet informationa:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW-R is not supported in this configurationinvalid source address: %sinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit -- %sillegal hoplimit %stoo small interval, raised to 0.01illegal timing interval %sillegal preload value -- %sMust be superuser to preloaddatalen value too large, maximum is %dillegal datalen value -- %sgetaddrinfo failedsetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_HOPOPTS)setsockopt(IPV6_DSTOPTS)-f and -i incompatible optionsUnable to allocate packetsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)%s: invalid interface namesetsockopt(SO_SNDBUF)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified recvmsgpollsetsockopt(IPV6_HOPLIMIT)setsockopt(IPV6_PKTINFO)setsockopt(SO_RCVBUF)you need -b to increase socket buffer sizeUDP socketUDP setsockopt(IPV6_PKTOPTIONS)UDP connectgetsocknamecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't set the last flagcan't allocate enough memorysetsockopt(IPV6_RTHDR)IPV6_MULTICAST_HOPSgateway resolves to multiple addressestoo many intermediate hopsgetaddrinfo for the gateway %s: %sping6: wrote %s %d chars, ret=%d sendmsg\%03odnsdecodeinvalid peernamepr_packunknown code 0x%x, type 0x%xNodeInfo NOOP HbH Options: Routing: Dst Options: -%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap %s(TTL=%u)pr_nodeaddr(TTL=infty) no address truncated --- %s ping6 statistics --- round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms %.1lf%% packet loss+%ld duplicates, IPv6 addressDNS labelIPv4 addressSuccessRefusedNo Route to Destinationpr_icmphDestination Unreachable, Bad Code: %d Destination Administratively UnreachableDestination Unreachable Beyond ScopePacket too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Bad code(%d) pointer = 0x%02x Erroneous Header Unrecognized Option Unknown Nextheader Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dNode Information QueryNOOP, invalid, oldfqdn, subject=%s(%s), no subject, subject=%s(invalid)Supported qtypesDNS namenodeaddrIPv4 nodeaddrNode Information Reply, %sVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphHBH RTHDR FRAG ESPICMP6: type = %d, code = %d Unknown Header(%d) DSTOPT IP6ff02::2:0000:0000nigroupusage: ping6 [-dfHmnNqtvwW] [-a [aAclsg]] [-b sockbufsiz] [-c count] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-h hoplimit] [-g gateway] [hops...] host ?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURELESS-E-G-LMOREWARNING: terminal is not fully functionalCannot allocate memoryticdcmsomdmbvbbc|^srget_termraw_modeLESS_TERMCAP_ltget_envLINESlicokrklkukdkPkNkh@7kDTERMhcxndadbsgNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunseek error to 0ESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off (P)+ [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found help(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Command not availableBrackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%sHOMEbin_file%s %s %sLESSOPENLESSCLOSE...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSplinenum~ Calculating line numbers (press RETURN)Invalid mark letterMark not setMark not in current fileLine number is required after -lless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThere is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesAllow help commandDon't allow help commandCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeBe less helpful in promptsBe helpful in promptspostoalinenumtoainttoaiprint_intiprint_linenumap_posap_linenumap_intNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned off tdsh$t |@hh @bgdumbtimernfsv3rdirplusmntudpresvportnfsv2ac23a:bcdD:g:I:iL:lo:PpqR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sillegal -R value -- %sillegal -a value -- %sconflicting version optionsillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %sNFS Portmapcan't access %s: %snqnfs 2bad MNT RPCCannot MNT PRCcan't resolve address for host %sno : or @ spechostname too long [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path nodeusage: mount_nfs %s %s %s %s [-23PTUbcdilqs] [-a maxreadahead] [-D deadthresh] [-I readdirsize] [-g maxgroups] [-L leaseterm] [-o options]8QP<MX<"`<l<@x<unused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB HPFS/QNX/AUXAIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech Thinkpad Rec Willowsoft $NEC DOS 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootBSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT ZmoJW,pc'C'vZ;=;h@^+iaVtr)Zɵh?Dq9gՇ˛}F׍ݜoZ}ԕ^wSAdr]egń-E6>ٽzίoT]k[[Wjm՚JWQN'ή?epy]E,{+.%YeYfY54_g9nl;YfyEۼˢU¢vβ:>y1~nK[ϡ׳W+^꾪7^vUgq_GH^+ۗj{<#r4z T{3|ŷU;/⟷7^SavD3]UOyWK߯tAxS"! jEdj(@} Y@($M=RV;eGikRR*(ndwʂ7퇟  3>P'AY _ Y涐|B50TyӯS:|1HP08%^.dV";yK CJ|%v u>0@, E5.~pƐBI!Cj'_<wW7D_s+C(i["%`K n4(g ą`n.$u1xcpJbЋ Gam֮VjJD15ٶiu@"z>Nz,/)Z"$+̐ =Ek/ld+H~=gA݆^)>xےnA@\}M#H Byg]iJAM*6Dh"Y*ST(5RfM x"C&D$])[m$uu+G;wR#R7(.\rQݑvB4"3w"=X_GJWːxI5@O$T5F8TgﯳG;ή\LpF ogb>NM;Qe]8 Z k,gٟESnjjĽ (`l\ eJ.(%1BRV"Vd7۝0ŋ8AMEJaoC F։)4}eOg&Ah{z q"G3Ď( V~ 'Cw(Aj9va yݕElZl fDD~7ڛ yJ"GNeD=tn)m@pSOx}$s`eZl .$~le( T2orceExh0WD;aL3xIϞs5bo}e9;Xo!~2Q5F0Kl\hZ91aU2,LkO(Ou߅qrHox7p&>Kÿt8F cx(4[y|0SD:V |LG"u}>8Ȍ[qMb~.WG$i@{bDH:8 >:ۯv4$F hA_y#՝M`{ h(0<BhI;`G9􎗰AQ/)v $h>*2;>rk>@J}R6DtDWs:ߡ$=")i#M|vdɼ$\/g5G}:A8aB&8իnyzNpWǥGbUl4 4mx&n$XbXLC"GG,tpGuS{J`0;^4oנTDAK:X, 9$V(+EKN (%j,!Ty`LFeJԇϜ!EÏ\i,C*[p&[Ð\ԡsN-$"NF4?Z گMR >ӌ  OƨUQqxBn!`zo  d;zw4{OODy|]zA+: ׀3÷O)Mw<͂h$5* LkeelwZ1gOS|)`1GDyooOZ׮m9"N_QJ" _NՋ/'mQ&usage: %s [-ieu] [-f mbrboot] [-c cyl -h head -s sect] disk -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry `disk' may be of the forms: sd0 or /dev/rsd0c. /usr/mdec/mbrieuf:c:h:s:Cylinder argument out of range [1..262144].Head argument out of range [1..256].Sector argument out of range [1..63].using builtin MBRCan't get disk geometry, please use [-chs] to specify.Please specify a full geometry with [-chs].Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statsEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tableWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes ----------------------------------------------------- ------ ATTENTION - UPDATING MASTER BOOT RECORD ------ ----------------------------------------------------- Do you wish to write new MBR? Do you wish to write new MBR and partition table?USER_initMBR is unchangedEnter 'help' for informationfdisk:%c%d> Aborting changes to current MBR.USER_modifyWriting current MBR to disk.Invalid command '%s'. Try 'help'. Offset: %d USER_print_diskBytesSectorsKilobytesMegabytesGigabytesask_cmd%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) ask_num'%d' is out of range. '%s' is not a valid number. %s [n] %s is not a character device or a regular fileDIOCGDINFODISK_getlabelmetricsDisk: %s geometry: %d/%d/%d [%.0f %s] geometry: Signature: 0x%X MBR_pcopyChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s Warning CHS values out of bounds only saving LBA values Starting Ending LBA Info:%c%1d: %.2X %4u %3u %2u - %4u %3u %2u [%12u:%12.0f%s] %s #: id C H S - C H S [ start: size ]------------------------------------------------------------------------Start of partition #%d after end!In memory copy is initialized to:Use 'write' to update disk.XreinitChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsInvalid argument: %s Invalid partition number %d. Swap with what paritition?%d same partition as %d, doing nothing. Invalid argument: %s Invalid partition number.Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorLoop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Partition %d is not an extended partition. Writing MBR at offset %d. Xwrite %s %s Machine code updated.Partition %d marked active. (standard input)(fd %d)invalid file type^%s[[:<:]]%.*s[[:>:]]%susage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxybinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpbinarybyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetscontext out of rangegrep version %u.%u without-matchUnknown binary-files optionBinary file %s matches [[:<:]][[:>:]]%lldaFfh:t:v%s: not a directory or special deviceumountfsBad MNT RPC%s: unmount from %s %s: not currently mountedusage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist] Gsl9xu:g:m:o:not an MSDOS filesystemstat %sunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-o options] [-u user] [-g group] [-m mask] bdev dir $OpenBSD: fsck.c,v 1.19 2005/02/03 05:03:50 jaredy Exp $$OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $$OpenBSD: preen.c,v 1.14 2003/06/26 08:01:54 tedu Exp $start %s %swait %scheckfs%s/fsck_%sexec %sCan't get resource limit for data sizeCan't get resource limit to max data sizedvpfnyl:t:T:%s: unknown special file or file system.fsck_%snoInvalid option stringusage: %s [-dfnpvy] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sCan't open checklist file: %s/etc/fstabBAD DISK NAME %s pass %d, name %s Unknown pid %ld%s: %s (%s): EXITED WITH SIGNAL %d done %s: %s (%s) = %x disk %s: %s in fstab more than once!mkfifom:invalid file mode.non-numeric major number.non-numeric minor number.major or minor number too largenode must be type 'b' or 'c'.usage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p @(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: route.c,v 1.83 2005/02/18 04:00:21 jaredy Exp $$OpenBSD: show.c,v 1.40 2005/02/18 04:00:21 jaredy Exp $UGHRBD M@dmCXLS1@2 3c0123456789abcdefold usage of trailing 0assuming route to if entry in usenot in tablerouting table overflow: gateway %s (%s)netmask missingold usage of trailing digit, assuming route via gatewaybotched keyword: %susage: %s [-dnqtv] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtv/dev/nullroute-sysctl-estimate%-20.20s donewrite to routing socketgot only %d for rlen Examining routing table from sysctl(address family %s) actual retrieval of routing tablemust be root to alter routing tableinet6_makenetandmask128%s: resolved to multiple values%s: bad address%s: not a network%d: bad address familyinternal errorprefixlen is not supported with af %dactual retrieval of interface tablegot message of size %d on %sread from routing socketwriting to routing socketso_labelso_ifaso_ifpso_genmaskso_maskso_gateso_dstRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departurerouting message version %d not understoodprint_rtmsg%s: len %d, if# %d, link: %s, flags:name: %s, pid: %ld, seq %d, errno %d, flags:metric %d, flags:if# %d, name %s, what: departurearrival route to: %s destination: %s mask: %s interface: %.*s flags: label: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8lu%c %8ld%c sockaddrs: gateway: %s RTM_GET: %s (errno %d)message length mismatch, in packet %d, returned %d locks: inits: sockaddrs: %s: link %s; sodump%s: inet %s; %s: ipx %s; %s: inet6 %s; label too longRouting tablessysctl of routing tableGatewayFlagsRefsUseMtuInterface%-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s PortProtoSA(Address/Proto/Type/Direction)Source%-18s %-5s %-18s %-5s %-5s %-22s %-*.*s Address%-6.6s %6d %8ld %6ld %6s %.16sp_rtentryInternet Protocol Family %d: XNSX.25AppleTalkIPXInternet6Encapp_flagsroutename(%d) %s%u.%u.%u/%d%u.%u.%u.%u/%d%u.%u/%d%u/%d%s/%dnetname6illegal prefixlenaf %d: %s*.**.0x%XHany%XH.%s%s.%XH%02X%02X%02X%02X%02X%02XHlink#%dblackholechangecloningdstexpiregatewaygenmaskhopcountifaifpipxlinkllinfolockrestmpathnostaticproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xresolve KMGTPimagetenexusage: %s [ | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.We only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] APPESTORSTOUlocal-filesusage: %s local-files Continue withmput%s: not foundr+wusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files mgetand logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Macros: usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdDELE %susage: %s remote-file mdeletefrom-nameto-nameRNFR %susage: %s from-name to-name RNTO %susage: %s remote-directory local-file nlistLISTNLSToutput to local-file:usage: %s remote-files local-file Try again latershellusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. PWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameMKD %susage: %s directory-name MKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1SITE CHMOD %s %susage: %s mode file-name SITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. usage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". |%sCan't allocate memory for $PAGERaccountbellbyecasecdupclosedisconnectepsv4formgateglobhashidlemacdefmdirmlsmodtimemsendnewernmapntranspagepassivepreserveprogresspromptpwdquoterecvregetresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquetraceumaskverbose'%s' macro not found. domacroRetrieving %s/%s auto_fetchExtra `@' characters in usernames and passwords should be encoded as %%40Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sReading from filehost %s, port %s, path %s, save as %s. (unknown)Trying %s... r+Requesting %s (via %s) GET %s HTTP/1.0 %s User-Agent: OpenBSD ftpRequesting %s Can't allocate memory.GET /%s HTTP/1.0 Host: [%s]:%s %s GET /%s HTTP/1.0 Host: [%s] %s GET /%s HTTP/1.0 Host: %s:%s %s GET /%s HTTP/1.0 Host: %s %s Writing HTTP requestreceived '%s' 301302200Error retrieving file: %sContent-Length: Location: Redirected to %s Can't open %sCan't allocate memory for transfer bufferReading from socketRead short file. Successfully retrieved file. Auto-login using ftp URLs isn't supported when using $ftp_proxyReceiving HTTP replyWriting %sImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'*?[]{}Can't allocate memory for URL decoding:/ftpgatehttp%s: bad port number `%s'connect to address %ssetsockopt TOS (ignored)fdopen failed.Connected to %s. hookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command.%c%c%c421 Service not available, remote server has closed connection. getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s %s: not a plain file. REST %ldnetoutsendrequest receive aborted waiting for remote to finish abort. receivednetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. wrong server: return code must be 227 %u,%u,%u,%u,%u,%uwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode AF mismatch. Shouldn't happen! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s runique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssu-r requires numeric argument46Aadegimno:pP:r:tvVRetrying... FTPSERVERPORTFTPMODEunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERftp> sorry, input line too long. Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadegimnptVv] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] anonymous4K macro buffer exceeded. Unknown .netrc keyword %sError: .netrc file is readable by others.Remove account or make file unreadable by others.Missing macdef name argument. Macro definition missing null line terminator. Remove password or make file unreadable by others.ruserpasspasswordpasswdmachine%s/.netrc: %s%s/.netrcstringlist|%.*s%*s| %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterAlready connected to %s, use close first. usage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. %s@Name (%s): Name (%s:%s): Password:Login failed.$initftp_loginsorry, arguments too long. (%s) unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %scan't find list of remote files, oops.can't find list of remote files, oops. remglob%s %s? n, y, p, a, are the only acceptable commands! Interactive mode: off. Prompting off for duration of %s. confirmSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. %3d%% *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d ptransfer/etc/rcWARNING: some process(es) wouldn't die(can't restart init): SIGTERM processes/dev/consolesetsidrevokeSIGTSTP inithalted (with powerdown) by %shalted by %srebooted by %sdlnpq~usage: %s [-dn%sq]  D@H<t,reloadfilesystem must be mounted read-only; you may need to run fsckusage: mount_ffs [-o options] special node mediumreason/etc/dhclient.confalias_routehandlerc:dl:qucallocInterface name too long%s.%s/var/db/dhclient.leasesasprintf%s: no link ... giving up got link cannot open %s: %m_dhcpno such user: _dhcp, falling back to "nobody"no such user: nobodycan't open and lock %s: %mPREINITAF_ROUTE/var/empty/chrootchdir("/")can't drop privileges: %musage: %s [-dqu] [-c conffile] [-l leasefile] interface ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.BOUNDRENEWREBINDREBOOTold_new_bound to %s -- renewal in %d seconds.BOOTREPLY from %s rejected.DHCPOFFERDHCPNACKDHCPACK%s from %s rejected.BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSENDdhcpoffer: no memory to record lease.dhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.dhcpoffer: no memory for option %dInvalid lease option - ignoring offerDHCPNAK from %sDHCPNAK with no active lease. Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. EXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %dcan't create %s: %mlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } buf_open: %mbuf_add: %mbuf_close: %mscript_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbinip_addressnetwork_numberbroadcast_addressserver_nameprepend optionappend optionno space to %s %sexpirypriv_script_write_paramsunexpected msg type %ureceived corrupted messageREASON=NBIfork: %mwait: %mexecve (%s, ...): %mpriv_script_goscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sdaemonInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xoption_as_string: bad code %ddhcp option too largecannot fork%s [priv]poll errorno memory for client state.no memory for client config.Corrupt lease file - possible data loss!not allowed here.hardware address parameter %snested interface declaration.expecting a statement.semicolon expected.expecting string or hexadecimal datastring constant too long.expecting hexadecimal constant.hexadecimal constant too long.expected option name.expecting semicolon.%s: unexpected option name.%s: too many options.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.Insufficient memory to record interface %sno memory for state on %sno memory for config for %sno memory for lease.unterminated lease declaration.expecting lease declaration.expecting identifier after option keyword.no memory for vendor information.expecting identifier after '.'no vendor named %s.no option named %sno option named %s for vendor %sexpecting number.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.expecting string.option data buffer %soption data buffer overflowout of memory allocating option data.parse_option_declExpecting media options.no memory for string list entry.no memory for reject list!parse_reject_statementexpecting IP address.getifaddrs failedno space to remember ifpdiscover_interfacesCan't allocate poll structures.No live interfaces to poll on - exiting.poll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %mCan't allocate timeout structure!can't allocate protocol struct for %sCan't create socketinterface_link_statusCan't add %s to hash table./dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfsend_packet: %msend_packetcSclarger than bufferoption %s (%d) %s.Many bogus options seen in offers. Taking this offer in spite of bogus options - hope for the best!rejecting bogus offer.Can't allocate storage for option %s.Can't expand storage for option %s.cons_optionspretty_print_option: bad code %d%s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of arrayUnexpected format code %cpretty_print_optionDiscarding packet with invalid hlen.do_packetno memory for cons.eof in string constantstring constant larger than internal buffernumeric token larger than internal bufferlways-reply-rfc1048llowbandoneduthoritativeackoff-cutoffootingoot-unknown-clientslassiaddrlient-identifierlient-hostnameomainenyefaultynamic-bootp-lease-cutoff-lease-lengththernetxpireixed-addressddiet-lease-hostnamesardwarenitial-intervalnterfaceax-lease-timeediameserveretmaskext-serverne-lease-per-clientrependequestequireetryenewebindeboottartsubnethared-networkerver-nameerver-identifierelect-timeoutcriptupersedeimestampoken-ring-host-decl-names-lease-addr-for-default-routenknown-clientsendor-classexiting. %s line %d: %s%s^^ subnet_numberbroadcast_addraddr_eqpiaddr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetssubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endpaddhcpCan't allocate dhcp option hash table.value %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dfilename must be a stringno memory for string %s.expecting a network hardware typehardware address too longExpecting numeric lease timecan't allocate space for numeric aggregateunexpected end of fileexpecting numeric value.too few numbers.no temp space for number.can't allocate space for numeric aggregate.Bogus number: %s: digit %d not in base %dBogus number: %s.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.short write: wanted %lu got %ld bytesconnection closedbuf_read: %mshort read: wanted %lu got %ld bytescorrupted message receivedreceived unknown message, code %ddispatch_imsgcannot read temp filecannot seek temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_ciphercbc_decodedecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiter& no previous commandunexpected end-of-filecannot close input filecannot open input file%lu newline inserted newline appended cannot read input filecannot close output filecannot open output filecannot write filecannot read stdin \abfnrtv\\ warning: file modifiedinvalid filename@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? script, line %d: %s number out of rangeinvalid redirectioninvalid destinationno previous substitutiondestination expectedcannot nest global commandsno current filenameunexpected command suffixinvalid command suffixunexpected addressno matchfilename too longshell access restrictedinvalid mark charactered.hup/ed.hupno previous patterntrailing backslash (\)unbalanced brackets ([])infinite substitution loopnothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: name too long (not copied)cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s and %s are identical (not copied).overwrite %s? readlink: %sunlink: %scopy_linksymlink: %smkfifo: %smknod: %schown: %schflags: %sutimes: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source_file target_file %s [-fip] [-R [-H | -L | -P]] source_file ... target_directory dSZ[U `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      inflate 1.2.2 Copyright 1995-2004 Mark Adler  #+3;CScs !1Aa  0@`@@vdpv%s not a regular file%s%s already has %s suffix -- unchanged/dev/stdout%s: unknown suffix: ignored%s%s: name too long%s: input: %soutput: %sdeflate.gzzcatzipunknown program nameGZIPGZIP is too longoption -a is ignored on this systemillegal bit count -- %s-o argument is too long123456789ab:cdfghlLnNOo:qrS:tvV/dev/stdin-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchangedcompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errordodecompressZgzztgztaz.-_method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out usage: %s [-cdfghOqrtvV] [-b bits] [-S suffix] [-[1-9]] [file ...] 1.2.2put_headerfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionneed dictionarystream endHLPRXfghorstuwxinvalid flags: %sinvalid flag: %sthe -R and -h options may not be specified together.%s: invalid user name%s: invalid group nameusage: %s [-R [-H | -L | -P]] %s file ... [owner][:group]usage: %s [-R [-H | -L | -P]] [-f] [-h] %s file ... $OpenBSD: dir.c,v 1.17 2004/07/05 02:31:54 pvalchev Exp $$OpenBSD: inode.c,v 1.26 2003/10/11 01:43:45 tedu Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.26 2005/02/03 05:03:50 jaredy Exp $$OpenBSD: pass1.c,v 1.15 2003/10/11 01:43:45 tedu Exp $$OpenBSD: pass1b.c,v 1.9 2003/08/25 23:28:15 tedu Exp $$OpenBSD: pass2.c,v 1.19 2003/10/11 01:43:45 tedu Exp $$OpenBSD: pass3.c,v 1.8 2003/06/02 20:06:15 millert Exp $$OpenBSD: pass4.c,v 1.10 2003/10/11 01:43:45 tedu Exp $$OpenBSD: pass5.c,v 1.17 2003/10/11 01:43:45 tedu Exp $$OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $$OpenBSD: setup.c,v 1.21 2003/09/25 04:19:39 deraadt Exp $$OpenBSD: utilities.c,v 1.20 2003/08/25 23:28:15 tedu Exp $?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@dirscanexpanddir blk + cnt %d > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listSIZE=%llu CG %d: BAD MAGIC NUMBER dfpnNyYb:c:l:m:conversion levelusage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) phase 1, inode %d/%dcheckinodebad size %llu:convert symlink %d(%s) of size %llu bad size %llu ndb %d:cannot read symlink phase 1b, inode %d/%dphase 2, directory %d/%dphase 2, parent directory %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %d (REMOVED)BAD WHITEOUT ENTRYphase 3, directory %d/%ldphase 4, inode %d/%dphase 5, cg %d/%dCREATCANNOT %s CLUSTER MAPS SUMMARY INFORMATION BADBLK(S) MISSING IN BIT MAPSALLOCATED FRAG %ld MARKED FREE ALLOCATED INODE %ld MARKED FREE FREE BLK COUNT(S) WRONG IN SUPERBLKCREATE CLUSTER MAPS%sING CLUSTER MAPS DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSUNKNOWN ROTATIONAL TABLE FORMAT %d INFORMATION; SEE fsck_ffs(8).IMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKcannot alloc %u bytes for cylinder group summary area cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead CONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATIMPOSSIBLE MINFREE=%d IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKclean = %d CPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEoffset %d, original %ld, alternate %ld NCG OUT OF RANGE%s: NOT LABELED AS A BSD FILE SYSTEM (%s) UPDATE STANDARD SUPERBLOCKreturning to single-user after filesystem check catchquitcatchinfoffs_isblockffs_clrblockffs_setblockffs_isfreeblock   init: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated, restartingsingle user shell terminated.single_userautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modesession database close: %ssession database open: %sinsert %d: %sdelete %d: %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %dcan't exec %s for %s %s: %msome processes would not die; ps axl advisedNOS:T:a:b:c:d:e:f:g:h:i:k:l:m:n:o:p:qr:s:t:u:x:z:P:T:a:b:c:d:e:f:i:m:o:s:%s: can't figure out file system partitiondisagrees with disk label%s (%d) %s (%lu) Warning: calculated sectors per cylindermfs:%dNumber of cylinders restricts cylinders per group to %d. Warning: changing optimization to space because minfree is less than %d%% %s: no default sector size%s: no default #sectors/track%s: no default #tracks%s: maximum file system size on the `%c' partition is %d%s: `%c' partition overlaps boot program%s: `%c' partition is unavailable%s: %s: not a character-special device %s: getmntinfo: %s%sr%snewfs_%s%s/newfs_%s%s not found%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count %s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad sectors/track%s: bad spare sectors per cylinder%s: bad total tracksinsane maxpartitions value %d%s: mount: %sabnormal terminationioctl (WDINFO)%s: can't rewrite disk label-N do not create file system, just print out parameters-O create a 4.3BSD format filesystem-P src populate mfs filesystem-S sector size-T disktype-a maximum contiguous blocks-b block size-c cylinders/group-d rotational delay between contiguous blocks-e maximum blocks per file in a cylinder group-f frag size-g average file size-h average files per directory-i number of bytes per inode-k sector 0 skew, per track-l hardware sector interleave-m minimum free space %%-n number of distinguished rotational positions-o optimization preference (`space' or `time')-p spare sectors per track-r revolutions/minute-s file system size (sectors)-t file system type-u sectors/track-x spare sectors per cylinder-z tracks/cylinderusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s: exitedchdircannot stat %s%s: not a dir or a block device-rw-pe/bin/paxcopy %s to %s failedunmount %srmdir %smount %s %s/mnttmp mountpoint %s busygettmpmnttmp mountpoint %s too longmntXXXXXXXXXXmkdtemp %stmp mount point too long%s: initializing cg %ld/%d siginfopreposterous size %dpreposterous ntrak %dpreposterous nsect %dillegal expected average file size %dillegal expected number of files per directory %dblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dno block size to support this diskminimum bytes per inode isWith a block size of %d %s %ld With %d sectors per cylinder, minimum cylinders per group is %ld CylinderWarning: cylinder%s groups must have a multiple of %ld cylinders panic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %ld cylinders!mapcramped && !inodecrampedBlock size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder (not %d) File system performance may be impaired. and ntrakrotational layout tables with nsect%s %s %d %s %d.%sWarning: insufficient space in super block for Warning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. mkfsfsinit failedsuper-block backups (for fsck -b #) at:%s: %d sectors in %d %s of %d tracks, %d sectors %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) cg summaryWarning: %d sector(s) in last cylinder unallocated filesystem must have at least %d sectorsinode blocks/cyl group (%ld) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increased%s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment sizeWith %d bytes per inode, Minimum bytes per inode is %ld block size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %dpanic: cylinder group too bigcg 0: bad magic numberinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic number (0x%06x != 0x%06x)fsinit: inode value %d out of rangerdfs: read error on block %dwtfs: write error on block %disblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d dfiPRrWrm_overwrite%s (inode %u): not overwritten due to multiple links%s: malloccheckoverride %s%s%s/%s for %s? remove %s? "." and ".." may not be removedusage: %s [-dfiPRrW] file ... bsfbsrdensityeomfsffsrofflinerewindrewofflretensionweoff:%s: illegal count%s: unknown commandioctl MTIOCGETWriteProtectMounted76543210%s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) %d: unknown tape drive type usage: %s [-f] device usage: %s [-f device] command [ count ] Lost connection to remote host.shell/tcp: unknown service/etc/rmtwho are you?invalid user name: %sO%s %d rmtopenC S I%d %d ioctlrmtioctlProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pusage: %s [-p] [-m mode] dirname ... $OpenBSD: compile.c,v 1.20 2004/07/10 11:41:26 otto Exp $0123456789/\$invalid command code %cextra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandunexpected }branchempty labelread commandw commandfilename expectedunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashextra text at the end of a transform commandcommand %c expects up to %d address(es), found %dcommand expectedunexpected EOF (pending }'s)\ can not be used as a string delimiternewline can not be used as a string delimitercompile_reRE error: %sunterminated substitute in regular expression123456789\%c not defined in the REunescaped newline inside substitute patternnumber in substitute flags out of rangemore than one number or 'g' in substitute flagsbad flag in substitute command: '%c'compile_flagsno wfile specifiedunterminated transform source stringcompile_trtransform strings are not the same lengthunterminated transform target stringtransform pattern can not be delimited by newline or backslashcompile_textexpected context addressunterminated regular expressionwhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'$OpenBSD: main.c,v 1.9 2003/06/10 22:20:50 deraadt Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s ..."$OpenBSD: misc.c,v 1.6 2004/07/20 03:50:26 deraadt Exp $sed: %lu: %s: $OpenBSD: process.c,v 1.12 2003/11/07 02:58:23 tedu Exp $\%d not defined in the REflush_appends\ \abfnrtv%03ofirst RE may not be empty8     $ (! 4 < DH y h H T ` l t x 8$ 0T*  % ? 4 ? 4 1 D> \3  % $\3 05 88% @8 H,2 P+ XL, `? h % pN x& 6 -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$l|x 0wD tX fh c| d s l m n~p$ <:z   L  p r p r  4 ܀ @ z H Lz !l | X  ̿4{ h Dn x m  L ,  L hd | D w  r   ,x , r <  z L { T | d  x z  x Xy  } ,   8  L|   ̑ 4  D 0 P ( `  p  | T hb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /.&.&_606162636465666768695U5u4L4l3C3c[O%A"BCDt`++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }"|acte$0iDkzl<X`mHCnTf\dblutprshhvlxletxXg  @   O ! {}x L  ||&&!()]]<>X | """T " I " """"""@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBunable to allocate memoryLPrestricted shell - can't cdOLDPWDdon't know current directoryCDPATH%s: bad directorytoo many argumentsno OLDPWDno home directory (HOME not set)can't get current directory - %sRnprsu,-p: %s-u: %s: %spvVpv is a reserved word special is a%s shell builtin is a function undefined (autoload from %s) tracedn exported%s is *GOK*exported is an %salias for alias %s= is a tracked %salias for not foundL#R#UZ#fi#lprtuxfunction %s %T %s() %T %s: not identifierexportreadonly%s[%d]typeset -U -u -l -Z -R%d -L%d -t -r -x -i only -t, -u and -x options may be used with -funalias-tadprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzjob control not enabled%%%*d %*s %s%*d %*d %sls:bad signal `%s'Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %s: arguments must be jobs or process IDsmissing name argument%s: is not an identifierarguments changed since last callOPTARGc_getopts: no argvmissing options argumentlm+alias+cd+command*=export+fc+getopts+jobs+killlet*=readonly=typeset+unaliaswhence+bg+fg%s%*ldm%ld.%02lds%snothing to shift%s: bad numberc_umask=+-rwxugoXsbad maskaugo%#3.3o ugorwxprsu,%s is read onlytrap -- bad signal %s%s: can only %s %d level(s)%s: cannot %sfv%s%*ld.%02ld%sreal user sys system user real :ptime: -%s requires an argumenttime: -%s unknown option*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unset-tmissing ]internal error: unknown opunexpected operator/operandmissing closing parenmissing argumentmissing expression operatormissing second argumentexpression expectedtime(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)ulimit: %cunlimited%-20s unlimited bad limit: %sexceeds allowable limitinvalid limit: %sx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}*&;#|<>"'`beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-fileprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcommentx_search_hist I-search: nothing to yank yank something first%s = '%s' %s: no such functioncannot bind, not a ttyPOSIXparameter null or not setexpand(NULL)%S%s: bad substitutionsubstitute%s: parameter not set%s: cannot open $() input%Rfunny $() command: %s*+?@! coprocess already existsPS4%s: can't find function definition file%s: can't find function definition file - %s%s: function not defined by %sCFUNC %d%s: can't open function definition file %s - %s%s: cannot execute - %s%s: restrictedcommand -p: restrictedbuiltin: %s: not a builtinEXECSHELL%s: %s: %sshcomexec: %scould not finish (dup) redirection %s: %sdupcannot %s %s: %s%s%s herein: yylexerror writing %s: %scan't %s temporary file %s: %shere document missing-rPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)%s: unexpected `%s'end of expression%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )missing :zero divisorhistory functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,-%c%scan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e%.*s ${FCEDIT:-/bin/ed} $_error reading temp file %s - %scannot open temp file %serror writing temporary file - %scannot create temp file %s - %s-16substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrinkinternal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againillegal file descriptor namefd not open for readingfd not open for writingbad file descriptorno coprocess/tmp%s/shXXXXXXXXstoppedrunning and You have %s%s%s jobs no such jobambiguousargument must be %job or process idwarning: won't have full job controlj_init: tcsetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcgetpgrp() failed: %sj_init: getpgrp() failed: %s[%d]jw:last procchildexchild: execute() returnedexchild: XPIPEI and no last_job - pid %dcannot fork - try againwaitlast: no last jobjw:waitlastwaitlast: not startedjw:waitfor| jw:resumecannot continue job %s: %sfg: 2nd tcsetpgrp(%d, %d) failed: %s1st tcsetpgrp(%d, %d) failed: %s[%d] job not job-controlledjobsnotifyzombiej_async: bad nzombie (%d)j_async: job not startedj_waitj: tcsetpgrp(%d, %d) failed: %scheckjobcheck_job: job started (flags 0x%x) Running (core dumped)%-20s %s%s%sj_print%s%5d %-20s %s%s %s%s%s%s %5d [%d] %c DoneDone (%d)remove_job: job not found (%s)no closing quote here document `%s' unclosed PS1PS2dopprompt\%c%r%l:%M:%S%a %b %d~/%smissing ] MAILyou have mail in $_typesetKSH_VERSION-xPPIDOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccdatemailmakeprviwhopdkshENVSH_VERSION$ /etc/suid_profile/etc/profile$HOME/.profileCannot determine current working directory-c requires an argumentUSERinclude: %dUse `exit' to leave ksh shell: %dalloc: %s%s%s-`%c' requires argument%s%s-%c: unknown option |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEFallexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivemarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextrace%-*s %sCurrent option settings -o %sgetoptionsparse_args: `%c'%s: bad optionA:o;sgmatch'\'%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_reopen: missing read/writeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: bsize %dshf_read: flags %xshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: no fdshf_putchar: flags %xshf_write: nbytes %dshf_write: flags %xshf_snprintf: buf %lx, bsize %dshf_vfprintf0123456789abcdef(null %s)too many <<'s for%s: bad identifier too many redirections %s: invalid function name thenelseeliffiesacwhileuntildo{}[[&&||;;((|&unexpectedunmatchedsyntax error: `%s' %s ?%dsyntax error: unexpected EOF Error handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-args# #no-vars# ( %T) %T| %T%;%T%s %T ]] %Sdo%N%T%;done in %;for %s select %s case %S in%N(%S%c%;%T%N;;%Nesac %s %T%;doif %Telif %Telse%;%T%;fi then%N%T{%;%T%;} %T& function %s %T%s() %Ttime %T%T|& < >| <> <<- << >> <&>&wdscan: unknown char 0x%x (carrying on)j_ttyinit: can't set close-on-exec flag: %sj_ttyinit: dup of tty fd failed: %sNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorOPTINDPOSIXLY_CORRECTHISTSIZEVISUALMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENO%s: subscript out of range0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZsetstr: %s=%s: assigning to self%s: is read only%0*s%.*s%*s%.*sy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-%s: destination pathname too longdo_moverename %s to %scan't remove %scannot resolve %s: %scannot rename a mount point%s: remove%s: set times%s: set flags%s: set mode%s: set owner/group%s: set owner/group; not setting setuid/setgid%s: waitpid/bin/cp%s: terminated with %d (non-zero) status%s: did not terminate normally/bin/rm-rf-PRpusage: %s [-fi] source target %s [-fi] source ... directory |&=<>+-*/%:()syntax erroreval5division by zeronon-numeric argument_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: dmesg [-M core] [-N system] sethostnamegethostnameusage: %s [-s] [name-of-host] $Id: logout.c,v 1.7 2004/05/28 07:03:47 deraadt Exp $/var/run/utmplogout%s: not a device nodereadlabelfs%s: bad filesystem type in label%s: couldn't read disklabel$Id: login_tty.c,v 1.6 2004/05/28 07:03:47 deraadt Exp $%s%s%s%c$NetBSD: getrawpartition.c,v 1.1 1996/05/16 07:03:33 thorpej Exp $/etc/fbtab(null)%s: bad entry: %s%o%s: %s: %mlogin_protect/*%s: chown(%s): %m%s: chmod(%s): %m%s: opendir(%s): %m$OpenBSD: fmt_scaled.c,v 1.6 2005/03/09 09:27:57 otto Exp $%lld.%1lld%c%lld%c0B$Id: logwtmp.c,v 1.8 2004/09/18 19:22:09 deraadt Exp $/var/log/wtmplogwtmp$NetBSD: getmaxpartitions.c,v 1.1 1996/05/16 07:03:31 thorpej Exp $$OpenBSD: fparseln.c,v 1.5 2004/05/28 07:03:47 deraadt Exp $\\#TERMPATHtgetent.termcap /usr/share/misc/termcap/usr/share/misc/termcapTERMCAPOOPS?Ynacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error yn: DOMAIN error ynynflgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10: SING error log10log10flog10: DOMAIN error pow(0,0): DOMAIN error powfpowpow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanh: DOMAIN error atanhatanhfatanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error 0C0longjmp botch. $OpenBSD: sigcompat.c,v 1.4 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: bsearch.c,v 1.4 2003/06/02 20:18:37 millert Exp $no errorunknown/invalid errorresolved protocol is unknowninvalid value for hintsmemory allocation failureaddress family for name not supportedservice not supported for ai_socktypeai_socktype not supportedai_family not supportedno address associated with namenon-recoverable failure in name resolutiontemporary failure in name resolutionname or service is not knowninvalid value for ai_flagsxxswfstabscanfstab: $OpenBSD: strtok.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: heapsort.c,v 1.6 2003/09/08 16:24:05 deraadt Exp $$OpenBSD: nice.c,v 1.6 2003/06/02 20:18:34 millert Exp $rcmd: socket: %s rcmd: socket: All ports in use $OpenBSD: rcmd.c,v 1.51 2005/03/08 18:34:42 deraadt Exp $RSH%s: %s rcmd_afconnect to address %s: rcmd: %s: %s socket: protocol failure in circuit setup. rcmd: accept: %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: write (setting up stderr): %s iruserok%s/.rhosts.rhosts lstat failed.rhosts not regular fileiruserok_sa.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owner/etc/hosts.equiv__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopgetnameinfoip6_parsenumeric$OpenBSD: rcmdsh.c,v 1.9 2004/04/01 04:14:29 marc Exp $/usr/bin/rshlocalhostrcmdsh: socketpairrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: execvp %s failed: %s -lrcmdshrcmdsh: setuid(%u): %s rcmdsh: fork failedrcmdsh: unknown user: %s 55556Resolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with nameResolver internal errorUnknown resolver error$OpenBSD: rresvport.c,v 1.6 2003/06/03 02:11:35 deraadt Exp $rresvport_af$OpenBSD: killpg.c,v 1.5 2003/06/02 20:18:33 millert Exp $$OpenBSD: strcoll.c,v 1.4 2003/06/11 21:08:29 deraadt Exp $$OpenBSD: rand.c,v 1.7 2003/06/02 20:18:38 millert Exp $%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%u8 88c88 8(8,80888<8D8H8P8 X8\8d8l8t8|8888888DC88Signal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2$OpenBSD: strtofflags.c,v 1.4 2004/05/18 02:05:52 jfb Exp $99999999: :: :0:8:nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaque ,%ld%s-blocks%s: unknown blocksize%s: minimum blocksize is 512maximum blocksize is %dGBLOCKSIZE%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethers+ ethers.byaddrether_ntohostethers.bynameether_hostton*** unknown regexp error code ***REG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routineregerrorREG_0x%xsecurertsctssoftcarwindow/etc/ttys/var/run/dev.db__ttyname_r_basic/etc/protocolsgetnetanswerIN-ADDR.ARPAgetnetbyaddr0.0.0.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa0.0.%u.%u.in-addr.arpagetnetbyname/etc/networks$OpenBSD: swab.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $/etc/groupgrscangroup.bynamegroup.bygid$OpenBSD: strsignal.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: __strsignal.c,v 1.8 2003/06/02 20:18:38 millert Exp $libcUnknown signal: 8@@@@@@@AA$A0ADATA`AlAxAAAAAAAAB B8BPBhB|BBBHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2$OpenBSD: readpassphrase.c,v 1.16 2003/06/17 21:56:23 millert Exp $readpassphraseI$OpenBSD: system.c,v 1.6 2003/06/02 20:18:38 millert Exp $$OpenBSD: strmode.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $h=C""too small$OpenBSD: strtoll.c,v 1.3 2005/03/02 12:24:26 millert Exp $$OpenBSD: strncat.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $glob3g_opendirg_lstatg_statmaster.passwd.bynamepasswd.byname__YP!__has_yppwgetpwnamgetpwuidmaster.passwd.byuidpasswd.byuid/etc/spwd.db/etc/pwd.db*netgroup: %m(%s,%s,%s)$OpenBSD: getnetgrent.c,v 1.15 2004/05/18 02:05:52 jfb Exp $netgroup.byusernetgroupnetgroup.byhostnetgroup: db getnetgroup: Syntax error `%s'netgroup: Cycle in group `%s' ,/etc/netgroup.db$OpenBSD: yp_first.c,v 1.7 2003/06/02 03:48:42 deraadt Exp $yp_first: clnt_call$OpenBSD: creat.c,v 1.5 2003/06/02 20:18:33 millert Exp $$OpenBSD: strncpy.c,v 1.5 2004/11/28 07:16:54 mickey Exp $$OpenBSD: xdr_ypreq_nokey.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $alphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzblankcntrl digitgraphABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~lowerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ punct!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefalnumABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789NULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL[:<:]][:>:]]$OpenBSD: auth_unix.c,v 1.17 2005/01/08 19:17:39 krw Exp $authunix_createauthunix_create: out of memory authunix_create_defaultauth_none.c - Fatal marshalling problem8@@@@@@@AA$A0ADATA`AlAxAAAAAAAAB B8BPBhB|BBB8@@@@@@@AA$A0ADATA`AlAxAAAAAAAAB B8BPBhB|BBBoption requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %s$OpenBSD: getopt_long.c,v 1.17 2004/06/03 18:46:52 millert Exp $$OpenBSD: inet_net_pton.c,v 1.3 2003/04/25 19:40:25 henning Exp $0123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 9n >= 0 && n <= 15$OpenBSD: assert.c,v 1.7 2003/06/11 21:03:10 deraadt Exp $assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" ipx_addr%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x,%x,%x%3x%3o%3dPPb0b1ncdtscilhssbpxbxfxoxtxdxsimulated$OpenBSD: getcap.c,v 1.22 2004/05/18 02:05:52 jfb Exp $getenttc%s.dbcgetnext|:$OpenBSD: strcspn.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: setenv.c,v 1.7 2005/02/16 21:20:22 millert Exp $$OpenBSD: strspn.c,v 1.4 2003/06/11 21:08:29 deraadt Exp $execlexecleexeclpexecvpexecvp: : path too long $OpenBSD: strsep.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: authunix_prot.c,v 1.4 2001/09/15 13:51:00 deraadt Exp $$OpenBSD: xdr_array.c,v 1.6 2002/08/01 01:05:24 deraadt Exp $xdr_array: out of memory $OpenBSD: rpc_commondata.c,v 1.4 2003/12/31 03:27:23 millert Exp $LC_ALLLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_MESSAGES/usr/share/localePATH_LOCALE%s/%s/%s/%s/%s/%sloadlocale%s/%s/%sLANG$OpenBSD: realpath.c,v 1.11 2004/11/30 15:12:59 millert Exp $realpath__opendir2$OpenBSD: qsort.c,v 1.8 2003/06/02 20:18:38 millert Exp $$OpenBSD: rindex.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $__svfscanf$OpenBSD: gethostnamadr.c,v 1.60 2004/07/29 03:09:40 itojun Exp $gethostby*.getanswer: asked for "%s", got "%s"-_/getanswergethostby*.getanswer: asked for "%s %s %s", got type "%s"gethostbyaddr%x.%x.ip6.arpa/etc/hosts%u.%u.%u.%uhosts.byaddr_yp_gethtbyaddrhosts.byname$OpenBSD: bcmp.c,v 1.6 2004/11/28 07:16:54 mickey Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$%s%.*s$md5crypt$OpenBSD: md5.c,v 1.7 2004/05/28 15:10:27 millert Exp $MD5Pad warning: malloc_initmmap(2) failed, check limits unknown char in MALLOC_OPTIONS MALLOC_OPTIONS/etc/malloc.confallocation failed malloc() has never been called junk pointer, too high to make sense modified (chunk-) pointer chunk is already free pointer to wrong page modified (page-) pointer junk pointer, too low to make sense recursive call in malloc(): in free(): in realloc():page is already free freelist is destroyed $OpenBSD: exit.c,v 1.9 2003/06/02 20:18:37 millert Exp $stack overflow in function %s$OpenBSD: getdtablesize.c,v 1.3 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: clnt_udp.c,v 1.21 2005/01/08 19:17:39 krw Exp $clntudp_create: out of memory clntudp_call8nLn4nHngethostby*.getanswer: asked for "%s", got "%s"explore_numeric# _gethtentipnodes.bynameres_querydomainNres_query%.*s.%.*sres_querydomainHOSTALIASES__hostalias __res_nameinquery__res_queriesmatch__res_senddwhwpwtw|wd ykwwwwwwwwwxx xx $x(x 4x>HEADER<<- opcode: %s, status: %s, id: %u; flags:; Ques: %u, Ans: %u, Auth: %u, Addit: %u;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: __fp_nquery ;; ...malformed ;; ...truncated ad UNUSED-BIT-ON ra rd tc aa qr__p_cdnname__p_fqname %lu;; packet size error (found %ld, dlen was %d) __p_rr %s ; proto %u, port %u ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %s %s ( "\ ""?" ;; *** Warning *** OS-type missing ; LABELS WRONG (%d should be %d) ( %s ) ; BAD BASE640x%04x %u ( %u %u %u %u %u %u "%.*s" ?%d? %uINCHAOSHSHESIODANYname serverMDmail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authorityMBmailboxMGmail group memberMRmail renameNULLnullWKSwell-known service (deprecated)PTRdomain name pointerHINFOhost informationMINFOmailbox informationMXmail exchangerTXTRPresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressrouterNSAPnsap addressNSAP_PTRsignaturePXmapping informationGPOSgeographical position (withdrawn)AAAALOClocationNXTnext valid name (unimplemented)EIDendpoint identifier (unimplemented)NIMLOCNIMROD locator (unimplemented)SRVserver selectionATMAATM address (unimplemented)IXFRincremental zone transferAXFRMAILBmailbox-related data (deprecated)MAILAmail agent (deprecated)UINFOuser information (nonstandard)UIDuser ID (nonstandard)GIDgroup ID (nonstandard)NAPTRURN Naming Authority"any"?0x%lx?usevcigntcprimry(unimpl)aaonly(unimpl)defnamdnsrchstyopninsecure2edns0insecure1recurs%ld.%.2ld%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %sm; error: unknown LOC RR versionABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~QUERYIQUERYCQUERYMCQUERYUNOTIFYUPDATEAUPDATEDUPDATEDAUPDATEMUPDATEMAZONEINITZONEREFNOERRORFORMERRSERVFAILNXDOMAINNOTIMPREFUSEDNOCHANGE  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~%u.%u.%u.%uinet_ntop4inet_ntop6/&/etc/resolv.conf;#lookupsearchnameserversortlistres_initRES_OPTIONSenvLOCALDOMAINndots:$OpenBSD: atoi.c,v 1.3 2003/06/02 20:18:37 millert Exp $01234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~$OpenBSD: strcasecmp.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: _yp_check.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: yp_get_default_domain.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $/etc/services,/$OpenBSD: fgetln.c,v 1.5 2004/09/28 18:12:44 otto Exp $$OpenBSD: strpbrk.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: strtol.c,v 1.5 2003/06/02 20:18:38 millert Exp $$OpenBSD: strtoul.c,v 1.5 2003/06/02 20:18:38 millert Exp $syslog_r: unknown facility/priority: %xvsyslog_r<%d>Error %d[%ld]%h %e %T syslog: unknown facility/priority: %xconnectlog_r/dev/logĆȆ̆ІԆ؆܆̆ (4<HTX\`dhlpẋ܇$OpenBSD: strftime.c,v 1.14 2004/10/18 22:33:43 millert Exp $JanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %YAMPM%a %b %e %H:%M:%S %Z %Y_fmt%Y-%m-%d%H:%M%04ld%2d%03d%I:%M:%S %p%e-%b-%Y%04d_conv_lconvGMTmn/usr/share/zoneinfotzload/etc/localtimeposixrules,M4.1.0,M10.5.0TZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec%.3s %.3s%3d %02.2d:%02.2d:%02.2d %-4ld %.3s %.3s%3d %02.2d:%02.2d:%02.2d %ld $OpenBSD: strstr.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: ypmatch_cache.c,v 1.11 2003/06/25 21:51:56 marc Exp $yp_match: clnt_callyp_next: clnt_call$OpenBSD: yp_bind.c,v 1.14 2003/06/02 03:48:42 deraadt Exp $/var/run/ypbind.lock_yp_dobindclntudp_createfcntl: F_SETFDYP server for domain %s not responding, still trying clnttcp_create%s/%s.%d/var/yp/bindingp̌4Pp̍8|Ȏ0$OpenBSD: clnt_perror.c,v 1.15 2002/09/10 05:39:07 deraadt Exp $; errno = %s ; s1 = %u, s2 = %u ; why = (unknown authentication error - %d) ; low version = %u, high version = %u RPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolRPC: (unknown error code)%s: %s - %s Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)$OpenBSD: strerror.c,v 1.6 2004/05/03 05:07:34 espie Exp $$OpenBSD: strlcat.c,v 1.11 2003/06/17 21:56:24 millert Exp $$OpenBSD: clnt_tcp.c,v 1.20 2005/01/08 19:17:39 krw Exp $clnttcp_create: out of memory $OpenBSD: auth_none.c,v 1.7 2001/09/15 13:51:00 deraadt Exp $$OpenBSD: rpc_prot.c,v 1.8 2005/01/08 19:17:39 krw Exp $$OpenBSD: xdr_mem.c,v 1.10 2004/09/14 22:20:01 deraadt Exp $bindresvport_sa$OpenBSD: pmap_getport.c,v 1.8 2005/01/08 19:17:39 krw Exp $$OpenBSD: pmap_prot.c,v 1.4 2002/02/13 22:36:52 deraadt Exp $$OpenBSD: xdr_rec.c,v 1.9 2002/02/16 21:27:24 millert Exp $xdrrec_create: out of memory perror$OpenBSD: strerror_r.c,v 1.2 2004/05/03 05:07:34 espie Exp $Unknown error: _catopen/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LNLSPATH$OpenBSD: index.c,v 1.4 2003/06/02 20:18:38 millert Exp $0D\x̔   <P\tĕԕ,L\lTA4Ttȗ,L|Ęܘ$@\xؙ$8H\p  8Thԛ$OpenBSD: errlist.c,v 1.7 2003/06/02 20:18:34 millert Exp $Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not found$OpenBSD: strlcpy.c,v 1.8 2003/06/17 21:56:24 millert Exp $$OpenBSD: xdr_ypbind_resp.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypbind_binding.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypbind_resptype.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: strdup.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: xdr_ypreq_key.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_domainname.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_mapname.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypresp_key_val.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_keydat.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypresp_val.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_valdat.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypstat.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr.c,v 1.7 2005/01/08 19:17:39 krw Exp $xdr_bytes: out of memory xdr_string: out of memory $OpenBSD: ypprot_err.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: db.c,v 1.8 2003/06/25 21:15:04 deraadt Exp $$OpenBSD: rec_open.c,v 1.9 2003/06/02 20:18:34 millert Exp $$OpenBSD: bt_open.c,v 1.11 2003/06/02 20:18:33 millert Exp $%s/bt.XXXXXX$OpenBSD: bt_get.c,v 1.6 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_conv.c,v 1.7 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_put.c,v 1.11 2005/01/03 22:30:28 millert Exp $__bt_put$OpenBSD: bt_delete.c,v 1.9 2005/01/03 22:30:28 millert Exp $$OpenBSD: bt_seq.c,v 1.9 2005/01/03 22:30:28 millert Exp $$OpenBSD: bt_search.c,v 1.8 2005/01/03 22:30:28 millert Exp $$OpenBSD: bt_utils.c,v 1.7 2005/01/03 22:46:43 millert Exp $$OpenBSD: getenv.c,v 1.6 2003/06/02 20:18:37 millert Exp $$OpenBSD: vfprintf.c,v 1.28 2004/09/28 18:12:44 otto Exp $__sbprintfbug in vfprintf: bad baseInfNaN__find_argumentsexponent?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZh@P&QQQxz\RjT ,B8D(<9D9L9TX|\X|dX|l~h+ xXF     p X X X  T   $OpenBSD: args.c,v 1.14 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: conv.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: conv_tab.c,v 1.4 2003/06/02 23:32:07 millert Exp $@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.14 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: misc.c,v 1.13 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: position.c,v 1.7 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.16 2003/07/03 22:41:40 tedu Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.43 2005/02/20 01:34:56 pedro Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.37 2004/11/13 21:45:50 miod Exp $@4DLvtvvvvvv v@ v H,, vvv<8@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ext2fs.c,v 1.12 2003/07/03 22:41:40 tedu Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sync.c,v 1.6 2005/02/02 19:23:17 jolan Exp $ @@ @h  p p  p  `  @   $1м|^t0 Non-system disk Press any key to reboot NB:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:qr:s:t:u:$OpenBSD: cchar.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: gfmt.c,v 1.6 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: key.c,v 1.12 2003/06/11 23:42:12 deraadt Exp $PA< T(08 @D H(T@\ d(` dd l tx X` t  $OpenBSD: modes.c,v 1.9 2004/09/16 09:55:09 deraadt Exp $$OpenBSD: print.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $?? ?(?0?8?@?H?P?X?`?h?l?p?x??????????????t???lh?x?@vvvvvvvhL'vv v ?vvlvvE/tmp/EdDk.aXXXXXXXXXX$OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: editor.c,v 1.99 2005/01/07 21:58:14 otto Exp $?? ?(?0?8?@?H?P?X?`?h?l?p?x??????????????t???lh?x?@vvvvvvvhL'vv v ?vvlvvE abcdfiklnoprstuvwxBDEGHLPTUXYZ0ĚdX<hTC|Ld80<@hTC̚nd0<PhTCԚn0<PhTCx(dGh~dG\~t~,ܚ(̉\Th~\~t~TC8> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)MMTaN$\bN@ܙBNcN4`dNAeNę fN,DFN̙`gNhNș0LHApiNjNJN!ԙ4TlH0LNlmNnN"pNHPNqN(P|rN"sN!Й0SN!P`uN",pVNwN"(xN(`lXNA xyNzN"N4~N!ؙ@d?N#N(.NA< (press RETURN)... (interrupt to abort)<  381@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxU@O 8Q48\84Fd88L89F8H,I88@P8O 9MD9?Gp9yN94AN99O9|O:<:OD:CC@CCCA DBHCDDE,DFcgc0/`c@gc,D[ d4dg\d,^dDgd2e3Zdgdgd3aeg؝T.?x.@d.Ax.Bx.C(d.D@d.ELd.FXd.Gdd.Hpd.Id.Jd.Kd.LȞx.MԞT.NT.OT.PT.QT.RT.ST.T(d.U4T.VDT.WPT.X\T.YhT.ZtT.[T.\T.]T.^T._T.`T.aȟT.bԟT.cT.dT.eT.fT.gT.hT.i(T.j4T.k@T.lLT.mXT.ndT.opT.p|T.qT.rT.sT.tT.uT.vĠT.wРT.xܠT.yT.zT.{T.| T.}T.~$T.0T.<T.HT.TT.`T.lT.xT.T.T.T.T.T.T.̡T.ءT.T.T.T.T.T. T.,T.8T.DT.PT.\T.hT.tT.T.T.T.T.T.T.ȢT.ԢT.T.T.T.T.T.T.(T.4T.@T.LT.XT.dT.pT.|T.T.T.T.T.T.ģT.УT.ܣT.T.T.T. T.T.$T.0T.<T.HT.TT.`T.lT.xT.T.T.T.T.T.T.̤T.ؤT.T.T.T.T.T. T.,T.8T.DT.PT.\T.hT.tT.T.T.T.T.T.T.ȥT.ԥT.T.T.T.T.T.T.(T.4T.@T.LT.XT.dT.pT.|T.T.T.T.T.T.ĦT.ЦT.ܦT.T.T.T. T.T.$T.249:;<=   !"#$%&'()*+,-./017>?@ABCDEFGHIJKLNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~;Zx0N$OpenBSD: buf.c,v 1.16 2003/10/18 19:15:43 jmc Exp $2$OpenBSD: cbc.c,v 1.13 2004/05/08 07:05:19 deraadt Exp $@ $OpenBSD: glbl.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: io.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $h$OpenBSD: main.c,v 1.28 2003/06/11 23:42:12 deraadt Exp $;H$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.8 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.29 2004/12/13 20:25:34 otto Exp $v$OpenBSD: utils.c,v 1.26 2004/12/10 10:23:30 jmc Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.18 2004/07/01 18:25:47 otto Exp $H ... ...?? ?(?0?8?@?H?P?X?`?h?l?p?x??????????????t???lh?x?@vvvvvvvhL'vv v ?vvlvvE\wdddd@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.36 2005/03/13 13:53:23 markus Exp $1 $OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.50 2004/08/12 07:53:50 otto Exp $ D@@@ @%s: can't read disk label; disk type must be specified@hHXp8h$OpenBSD: mkfs.c,v 1.46 2005/01/06 08:57:30 otto Exp $......@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.17 2004/06/02 06:58:54 otto Exp $@(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mt.c,v 1.23 2003/06/02 23:32:08 millert Exp $d:  0?$<@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.17 2004/07/01 18:25:47 otto Exp $X{}abcdDgGhHilnNpPqrs tw xy !:#=@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. D_H_P / P" 4l|(44HLT8PBth>X`hplptb _@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.30 2004/12/13 20:22:52 otto Exp $@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: dmesg.c,v 1.17 2003/06/02 20:06:14 millert Exp $&@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: hostname.c,v 1.7 2003/06/02 23:32:08 millert Exp $?? ?(?0?8?@?H?P?X?`?h?l?p?x??????????????t???lh?x?@vvvvvvvhL'vv v ?vvlvvEBKMGTPE@$OpenBSD: termcap.c,v 1.8 2003/06/02 20:18:42 millert Exp $$OpenBSD: tgoto.c,v 1.3 2003/06/02 20:18:42 millert Exp $$OpenBSD: tputs.c,v 1.3 2003/06/02 20:18:42 millert Exp $5MS7) $OpenBSD: setjmperr.c,v 1.4 2004/05/18 02:05:52 jfb Exp $.$OpenBSD: signal.c,v 1.6 2004/05/03 17:25:00 millert Exp $.$OpenBSD: sethostname.c,v 1.7 2003/07/15 17:32:41 deraadt Exp $$OpenBSD: vis.c,v 1.13 2004/05/18 02:05:52 jfb Exp $$OpenBSD: fstab.c,v 1.13 2004/05/18 02:05:52 jfb Exp $01$OpenBSD: asprintf.c,v 1.10 2003/06/17 21:56:24 millert Exp $$OpenBSD: inet_makeaddr.c,v 1.4 2003/06/02 20:18:35 millert Exp $1$OpenBSD: getservbyport.c,v 1.6 2004/10/25 03:09:01 millert Exp $x4$OpenBSD: herror.c,v 1.6 2005/03/02 12:26:24 millert Exp $$OpenBSD: wait.c,v 1.4 2004/05/18 02:05:52 jfb Exp $T6$OpenBSD: sleep.c,v 1.10 2004/05/18 02:05:52 jfb Exp $$OpenBSD: cfgetospeed.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$OpenBSD: vprintf.c,v 1.5 2004/09/28 18:12:44 otto Exp $6$OpenBSD: alarm.c,v 1.5 2003/06/11 21:03:10 deraadt Exp $6$OpenBSD: tcgetpgrp.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$OpenBSD: basename.c,v 1.13 2005/03/02 12:27:26 millert Exp $7$OpenBSD: ftell.c,v 1.5 2004/09/28 18:12:44 otto Exp $$OpenBSD: ipx_ntoa.c,v 1.5 2003/09/26 06:19:25 deraadt Exp $xxxxxxxxH.xx:xx:xx:xx:xx:xx.uuuuu$OpenBSD: setproctitle.c,v 1.10 2005/03/08 15:38:46 moritz Exp $$$OpenBSD: signame.c,v 1.3 2003/06/02 20:18:35 millert Exp $$OpenBSD: getbsize.c,v 1.9 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: ethers.c,v 1.17 2004/02/16 19:41:12 otto Exp $xx:xx:xx:xx:xx:xx$OpenBSD: regerror.c,v 1.12 2004/11/30 17:04:23 otto Exp $;;;;;<<(<@<lL<X<x<<<< << << == 4=D @=L=p=|=====v|;$OpenBSD: getttyent.c,v 1.7 2004/05/18 02:05:52 jfb Exp $$OpenBSD: ttyname.c,v 1.10 2004/05/18 02:05:52 jfb Exp $$OpenBSD: setmode.c,v 1.16 2005/03/01 13:51:47 miod Exp $$OpenBSD: errx.c,v 1.7 2003/06/02 20:18:34 millert Exp $$OpenBSD: verrx.c,v 1.7 2004/05/18 02:05:52 jfb Exp $$OpenBSD: getproto.c,v 1.6 2004/10/25 03:09:01 millert Exp $$OpenBSD: getprotoent.c,v 1.7 2004/10/25 03:09:01 millert Exp $$OpenBSD: getnetnamadr.c,v 1.23 2003/06/03 21:09:00 deraadt Exp $$OpenBSD: getnetbyaddr.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: getnetbyname.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: getnetent.c,v 1.9 2003/06/02 20:18:35 millert Exp $$OpenBSD: inet_network.c,v 1.8 2003/06/02 20:18:35 millert Exp $$OpenBSD: confstr.c,v 1.6 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: getlogin.c,v 1.9 2003/06/11 21:03:10 deraadt Exp $ ?$OpenBSD: pwcache.c,v 1.7 2004/05/18 02:05:52 jfb Exp $$OpenBSD: getgrent.c,v 1.21 2004/06/07 21:11:23 marc Exp $??$OpenBSD: siglist.c,v 1.3 2003/06/02 20:18:35 millert Exp $$OpenBSD: tcsetattr.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$C`CD$OpenBSD: glob.c,v 1.24 2004/10/07 16:34:04 millert Exp $$OpenBSD: getpwent.c,v 1.32 2004/05/18 02:05:52 jfb Exp $E$OpenBSD: err.c,v 1.8 2003/06/02 20:18:34 millert Exp $$OpenBSD: verr.c,v 1.7 2004/05/18 02:05:52 jfb Exp $$OpenBSD: warnx.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: vwarnx.c,v 1.7 2004/05/18 02:05:52 jfb Exp $$OpenBSD: fputc.c,v 1.6 2004/09/28 18:12:44 otto Exp $E$OpenBSD: fgetc.c,v 1.4 2004/09/28 18:12:44 otto Exp $DF$OpenBSD: cfmakeraw.c,v 1.5 2003/06/11 21:03:09 deraadt Exp $FF$OpenBSD: putchar.c,v 1.6 2004/09/28 18:12:44 otto Exp $$OpenBSD: regcomp.c,v 1.14 2004/11/30 17:04:23 otto Exp $HHvGGv@GxWxCW JWQWZt _fq44~za  in}of!NI u p + & d _afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3dLGhc" 8 3 r _ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmspfa#A< r m & ! P K  _ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"NI  i d   _ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/csh2_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/csh3proxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T vq ~ > 9 j e !  _ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin"vm,%KB k f  u p / * Q L   nobody*Unprivileged user/nonexistent/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/csh1root\Vpk-( Z U    z + & _tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplg&!72 N I  _rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd . install.md set_term() { [[ -n $TERM ]] && return ask "Terminal type?" ${MDTERM:-vt220} TERM=$resp export TERM md_set_term } welcome() { local _q cat << __EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD in a simple and rational way. At any prompt except password prompts you can run a shell command by typing '!foo', or escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C and then RETURN, but quitting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat << __EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat << __EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat << __EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat << __EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat << __EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it..." } get_dkdevs() { bsort `sed -ne "${MDDISKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}" /var/run/dmesg.boot` } get_cddevs() { bsort `sed -ne "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}" /var/run/dmesg.boot` } get_tapedevs () { bsort $(egrep "^(ct|mt|st|ts|wt)[[:digit:]]+ " /var/run/dmesg.boot \ | sed -e "s/ .*//p" ) } get_ifdevs() { ifconfig -a \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_serialdev() { local _devs _d _bd _td [[ -n $MDSERIAL ]] || exit set -- $MDSERIAL _d=$1 _bd=$2 _td=$3 _devs=$(sed -ne "/^${_d}\([0-9]\) .*/s//\1/p" /var/run/dmesg.boot) _devs=$(bsort $_devs) set -- $_devs echo "${_bd}${1} ${_td}${1}" } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } get_partition() { local _drive=$1 _fstypes=$2 _part _fst disklabel $_drive 2>/dev/null \ | grep '^ [a-p]: ' \ | egrep -v "swap|unused" \ | sed -e 's/^ \(.\): *[^ ]* *[^ ]* *\([^ ]*\) .*/\1 \2/' \ >/tmp/parts.$_drive disklabel $_drive 2>/dev/null | grep '^ .:' ask_which "$_drive partition" "has the $MODE sets" \ "$(sed -e 's/^\(.\).*/\1/' /tmp/parts.$_drive)" [[ $resp == done ]] && return 1 _part=$resp _fst=$(sed -ne "/^$_part /s///p" /tmp/parts.$_drive) ask_which "filesystem type" "should be used to mount $_drive$_part" "$_fst $_fstypes ffs" case $resp in done) return 1 ;; $_fst) resp="$_part" ;; *) resp="$_part $resp" ;; esac return 0 } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while : ; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while : ; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [ "$_a" = "$_b" ] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [ "$_a" != "$_b" ] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file > /tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >> /tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" << __EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null DEVSMADE=$(addel $_dev $DEVSMADE) } addhostent() { sed "/ $2\$/d" /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$1 $2" >> /tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action while : ; do _action= cat << __EOT The following sets are available. Enter a filename, 'all' to select all the sets, or 'done'. You may de-select a set by prepending a '-' to its name. __EOT _next= for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "\nFile name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while : ; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat << __EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat << __EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.* /etc/dhclient.conf if [[ -n $_hostname ]]; then echo "send host-name \"$_hostname\";" >> /etc/dhclient.conf echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >> /etc/dhclient.conf << __EOT request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT cat >> /etc/resolv.conf.tail << __EOT lookup file bind __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && $2 == "0.0.0.0" ]]; then ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 fi mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" > $_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" > $_hn fi ;; esac } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while : ; do ask_until "$_prompt" "$_dr" case $resp in none|dhcp) break ;; esac route delete -inet default > /dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } isalphanumeric() { local _n=$1 while [[ ${#_n} -ne 0 ]]; do case $_n in [A-Za-z0-9]*) ;; *) return 1;; esac _n=${_n#?} done return 0 } enable_network() { local _netfile for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} if ! isalphanumeric "$if"; then continue fi ifconfig $if > /dev/null 2>&1 if [ $? -ne 0 ]; then continue fi while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|""|"rtsol") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= ifconfig $if $name $mask $bcaddr $ext1 $ext2 down cmd="dhclient $if" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) continue ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $(< /mnt/etc/mygate) fi route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat << __EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" "${_get_server_list:-yes}" _get_server_list=$resp if [[ $_get_server_list == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while : ; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp _passwd=root@`hostname` if [[ $_ftp_server_login != anonymous ]]; then resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _mp=$1 _dir=$2 while : ; do ask_until "Pathname to the sets? (or 'done')" "$_dir" case $resp in done) return ;; *) [[ -d $_mp/$resp ]] && { _dir=$_mp/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." ;; esac done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { local _drive _part=c _fstype="-t cd9660" get_drive "CD-ROM" "$CDDEVS" || return _drive=$resp if [[ -z $(disklabel $_drive 2>&1 | grep '^ *c: .*ISO9660') ]]; then unset _fstype get_partition $_drive "cd9660" || return set -- $resp _part=$1 [[ -n $2 ]] && _fstype="-t $2" fi mount $_fstype -o ro /dev/$_drive$_part /mnt2 || return install_mounted_fs /mnt2 "$SETDIR" umount -f /mnt2 > /dev/null 2>&1 } install_disk() { local _drive _part _fstype _fsopts get_drive "disk" "$DKDEVS" || return _drive=$resp get_partition $_drive "$MDFSTYPE" || return set -- $resp _part=$1 [[ -n $2 ]] && _fstype="-t $2" [[ $2 == $MDFSTYPE ]] && _fsopts=$MDFSOPTS mount $_fstype -o ro,$_fsopts /dev/$_drive$_part /mnt2 || return install_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 } install_nfs() { if [ ! -f /sbin/mount_nfs ]; then echo "/sbin/mount_nfs not found. Cannot mount NFS filesystems." return fi ask_until "Server IP address or hostname?" "$_nfs_server_ip" _nfs_server_ip=$resp ask_until "Filesystem on server to mount?" "$_nfs_server_path" _nfs_server_path=$resp _nfs_tcp= ask_yn "Use TCP transport? (only works with capable NFS server)" [[ $resp == y ]] && _nfs_tcp=-T if ! mount_nfs $_nfs_tcp -o ro ${_nfs_server_ip}:${_nfs_server_path} /mnt2 ; then echo "Cannot mount NFS server." return fi install_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _z _bs if [[ ! -x /bin/mt ]]; then echo "/bin/mt not found. Can't $MODE from tape." return fi get_drive "tape drive" "$TAPEDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while : ; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d cat << __EOT You will now specify the location and names of the ${MODE} sets you want to load. You will be able to repeat this step until all of your sets have been successfully loaded. If you are not sure what sets to ${MODE}, refer to the installation notes for details on the contents of each. __EOT while : ; do _d= cat << __EOT Sets can be located on a (m)ounted filesystem; a (c)drom, (d)isk or (t)ape device; or a (f)tp, (n)fs or (h)ttp server. __EOT [[ -z $DEFAULTSETS ]] && _d=done ask "Where are the $MODE sets? (or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) install_cdrom ;; d*|D*) install_disk ;; f*|F*) install_url ftp ;; h*|H*) install_url http ;; m*|M*) install_mounted_fs /mnt ;; n*|N*) install_nfs ;; t*|T*) install_tape ;; *) ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done < /tmp/fstab > /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat << __EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the ${MODE}. __EOT exit fi done < /etc/fstab } check_fs() { local _dev _mp _fstype _rest _fail echo "Checking non-root filesystems..." while read _dev _mp _fstype _rest; do [ "$_dev" != /dev/"$ROOTDEV" ] || continue [ -f "/sbin/fsck_$_fstype" ] || continue _rest=${_dev#/dev/} makedev ${_rest%[a-p]} || continue echo -n "fsck -p ${_dev}..." if ! fsck -fp ${_dev} > /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done < /etc/fstab echo "...done." [ "$_fail" ] && exit } get_fqdn() { local _dn _dn=$(hostname) _dn=${_dn#$(hostname -s)} _dn=${_dn#.} echo "${_dn:=my.domain}" } donetconfig() { local _dn _ns _n configure_ifs if [ -f /tmp/resolv.conf.shadow ]; then mv /tmp/resolv.conf.shadow /tmp/resolv.conf for _n in $(grep '^nameserver ' /tmp/resolv.conf); do [[ $_n == nameserver ]] || _ns="$_ns$_n " done set -- $_ns _ns=$* _dn=$(sed -n \ -e '/^domain[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '/^search[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '${g;p;}' /tmp/resolv.conf) fi ask "DNS domain name? (e.g. 'bar.com')" "${_dn:=$(get_fqdn)}" hostname "$(hostname -s).$resp" ask "DNS nameserver? (IP address or 'none')" "${_ns:=none}" if [[ $resp != none ]]; then echo "lookup file bind" > /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >> /tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _bd _td ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >> /mnt/etc/rc.conf.local fi ask_yn "Start ntpd(8) by default?" no if [[ $resp == y ]]; then echo "ntpd_flags= # enabled during install" \ >> /mnt/etc/rc.conf.local fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" yes if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf > /tmp/sysctl.conf fi fi [[ -z $SERIALDEV ]] && return set -- $SERIALDEV _bd=$1 _td=$2 ask_yn "Change the default console to $_bd?" [[ $resp == n ]] && return ask_which "speed" "should $_bd use" "9600 19200 38400 57600 115200" [[ $resp == done ]] && return echo "stty $_bd $resp\nset tty $_bd" >>/mnt/etc/boot.conf sed -e "/^${_td}/s/std.9600/std.${resp}/" \ -e "/^${_td}/s/unknown/vt220 /" \ -e "/${_td}/s/off/on secure/" /mnt/etc/ttys >/tmp/ttys } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /var/run/dmesg.boot DKDEVS=$(get_dkdevs) CDDEVS=$(get_cddevs) IFDEVS=$(get_ifdevs) TAPEDEVS=$(get_tapedevs) SERIALDEV=$(get_serialdev) DEVSMADE= THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="bsd base${VERSION}.tgz etc${version}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat << __EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b 0123456789abcdefI])h+,8++E,I]((p,((I],h7(((4((`(I](-L.---6-7-I]:@+L.---6-7- +, ',I]<+I]+L,I],x+I])@(L.-6-7-(I]@(L.-6-7-I]gt,L.-6-7-I](-L.-6-7-(- 4,G]I] &@h++@2X Xd$`J] J]L]L]L]L]L]0J],J]L]HJ]LJ]L] ʚ;5ym8@ E82(@AAA==(A*I]I]I]I]I]J]I]I]I]I]I]I]J]I]gQ L]L] :4$ax'4 $a:4$a:4$a:4$a:4$a:4 $a:4$$a:4($a:4,$a:40$a:44$a:48$a:4<$a:4@$a:4D$a:4H$a:4L$a:4P$a:4?_C-:4?_C-:4?_C-HN]`;4\N-pN]0Q-Q-,=4&######t## .P..<.|.#t########t##].@_.d.d.e.#t########################t########t########t########t###########.P.##.###.################################t########t##!$!!!ܓ!#!#|!######t########t########t########t########t########################t########t################t########t########t#########H##0#######t########t########################t##0000\0H0 0H# 0 0u0u0 v0#v0#|0#########0P0|0#ę0#0#000##0#0#F1HG1pI1XJ1|M1#M1#O1######t#################H##0#########################t########t########t########t########t########t########t########t########t########t########t########t########t########t########t########t########t########t########t########t########t########t########t########t########t########t##################acG\b@%K@p0A @ @ 0@ Z4 Z4,Z48Z4DZ4TZ4dZ4tZ4Z4Z4Z4Z4Z4Z4Z4Z4<M.M.N.N.N.d40hZ.[.[.[.].ܪ4``.a.c..@....ԫ4..Ж.,.@H.P.4`....Ը..b-._-_-_-c-`-<`-d`-(e-a-,a-Ta-f-_-`- `-Xd-`-`-`-e-|a-a-a-g-g-h-4h-hh-a-b-i-8i-li-`b-i-j-ܙ-t--<-8-X-p-- -H--D-h-0..4<P..4@8H..\4..4`....Ը..b-.t.|..c-..d-(e-,f-`f-f-f-...Xd-..e-e-f-0g-dg-g-g-h-4h-hh-h-h-i-8i-li-i-i-j-<...Ȳ4D.l.t.l x{x8{4 ,.x.0 -44dddh4pt//c0' c'c055$s ?/ 5t]t]5t]@u]=t]t]=t]@u](u]v](\v]v]Pw]w]Uw]w]w]w]l4t44w]@x],>??  ` ~ ^ "' AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy00x0d00<0Boldface.iso1 \]wfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp ]\]  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ްT]T]2U])]a]]#]Ĺ]Թ]]]]]$]  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~̺]o]]]]$]  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     ]a?]8]H]4]&4]!X]]xG444444 00@4<'1,(101101  % 3u Du u <u 8u 2u 0&'u 1&u 0&u  44N1N1N17"444*44# # \44P40w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-4{{44C2E2PH2K2L2hL24S2TY2X2\Z2Y2Y244Р22224$2P2224<2h222<42D222X4@2l2224d2ܲ22242 222<422224222242ܾ22242 222(420222x42 2224D2p2224\22224 2822204d2222x4242224X1#$NetBSD: blockio.S,v 1.4 2001/06/02 11:15:56 bjh21 Exp $.symtab.strtab.shstrtab.text.start.data.sbss.bss.arm.atpcs.ident  ! =(5(.]=4]=Xg9=D=9=K=``  ,??5  5]]  \65l H$<%$/4"8:`G!Rx1$[+t |P2XB5<)5<(D-80%D/l'z!l0 l]*t$(#,,2L@03#lS̊-4``&n |*y]8>5(#5T{-z1ܕ"C5d#Y2dQ]\#%$h4{]C+5Y&\l8 < -lp;5 "\4S2$$$51'3&p%D d0@C,d*#X:5Ap.TY-#xc`pX]y2T 2d.@4R- /H!"\0Lȵ&4+T() _9t"hDY'T f1y2<|% ,5$$,)858"1X2. `1 ) "\T d"<;5+t <=+DM45TBu3kp0<z15T!<!$4&`-o#<0.@xO- P $4%2d3+?`"<G]P\;5a2`n$G 8w3H>5<&P%TX$_Ƚ/\_ P_(%__#`X5*$'0t3]H|A.HV7"cu/lk#p0|x%X' - ,L h>&xX h%Db __j x$u %P~ X 2 `_ [+\ 6" ) 6"X X2t p"p i2 & .P6 $5`? @/# I !t] [(o <5#p~ 2  .H XR#  "s3h P40T ('D "P $ ] 4 (D B1x h&$. `C5B 0p\ (/\i F"Tv . \:54 81 +P Ѕ%D p!  P_ h# (/ .<  m#l +<!\&."5>Q-J>)W(0TlJ& w"@'d!q1dv$2(*̖%.h!+|/5$*&l2%H1_8*5>w'DWTb#dgb%lr&lL!7!8y' ,| D _] X*,0@ 0`0q# .`03KD_Vh3$`!l/-\`0$X#<*2pP"s-0D*&`!0_ ]H&45X20$E$a[tJ$f/s-h#h&L^2x2a\2aD,d/&a1h&a 1x-$>5C@1&hL55T1jB)#"\|J$$192T`1@1$P>5T%<2-2h0)t'L1_K83V%b-\}h`H'Ā%@*!||]'.P,aj-8_D!$ ܲ21'$P'F5LR1\r0hP]u]~0.5Z+{"0X0X$a|S-1 3#,0$7)Ny'Ti%@v"\__ܖ"_$|_@!*,"P*.( S- .D S!(?57|"E #5Z&d5q%.@{<*5x{ T/hP`T_P_d(52l/hL]4>5\>5*-;_E7.Q=*L[tW)j)v@5X'V%pS-b# #5H_4& &#l.D2Hk0  \` (X +d;T_J2Y@K+@a0&TpLx1 /,&<H`0_$52\;5p-O!x&a0" .|00&*80_E1$S2aC-4rX7#T~r1P]|!]`]8"tY"!#!5""x L]*'52,@d-S('$(c "l<*}',J#G.$`"T_(܇ ( f1x$!@P |05& &9H1D.dM``$"<fp$o/`(H8"(p/$#!TP0p}0&a`f-<` |]\Z.)|.4,`_ C0P<(b$k(L01pr% ,i(8N'845"(D5P .c-(0(&s)l62>=5OP.xX/5$i0L}p>0(!8A) _2\x ( @& /41N#/d d/1&h%W#. -$ 7L"E Vl-XaT14q"|\+0_45_$!<-T!H! c!Y2ds!85!8!P!&x!H0(!$+l!'!*0!X5+!Hu(" 4""D/T6"='?"$F"H]P"5S"v0X`"-<p"t!"l %"̽ "1$"X $"#5"&a"1"l&"$L#\Z2`#8-#`/#&,>#o]H# Y#2`g#r]q#P.Dy# -5#`$(#%$#H"#"#U!#+##3#",#$`$S*$5.$5( (-)(% )d )O30+)%| ;)z C)\+O)41%Z),-h)D,5).)!,) )#)t28)J]) ))HN]),*"\) p/|*$L*-`**.B*]S*h@5a*/Lu*_~*%4*1x*.d*h-*" *!*`K0*9+X*`,+A) +L 5+5;+3aF+0)U+!g+V z+ܾ2+X,!`+O1+%8+8"+U*+P1H+p++t&d+`&!,.,e-$,)51,$]2`B, &M,l]U,(@1c,e-v,2L|,\# ,|#,p3 ,$$,܏2,l !x,W2,F5,7*,1,w1-]-C5)-)5-h.I-D)xS-0`d-'r-2${-&-l#-h%L-'-%-1---D-3-T0 -k1l-$$.T,a .8/0$.,`..0<._G._5(Q. p[.5e."q. h.̩-\.&.%.!0.<$5.+h.t$.*$/k* / //ܓ!'/$[$ 1/R#:/ 5D/M3W/' j/_q/ 1\/ 0/L.-P/A)/8o]/X$/\0(/./&/ %\/5"P 07!$0dz1T)0,>590_ C0&#|P0 -(b0XL$ m00$z0P00Ly'p00Y&0/0P'$0$0i-0)\0p,0%03 1̏3 1| 1-'14"t3181D1/pO1/|_1+l1P+h|1'p1f-1$_1_(1L/1 1011|%<1,&#h1O. 2$2h>522$:2D)tG2d'5N23AS2A!a2$]j2 0px2,$5}2-(2*X2a-2_2L)"2!L2̊3 2`222&52/3853#)3J]83xz'HS3To]b3|^*,o3#u3]|3530X3G]3- 3<3 3P]3"3@0 3Q24 240*04k0D=4/I4hn]`V4.a4.h4pu%t4x 2(4>"4X05$4x(4 H4|=3x4 R!446.\4+&H4 05#H5p105t3,+575750LF5X5<N5h'"U5 Z_]5]g5"5 v5T !5l/5$$|5P]5M*5z3 5ؑ/ 5d0a5d) 5(X%525# 6Է"d6@.2x%6Ru356 %D6|;08Q6(/Y6H*j63r632|6T-6# 6U#6@6!d6 /6 ,616(-616. 7|3 7!p#7:157T2C7Q2W7h.@f74"m7L]y7`7( 7x#71a874'47!%h7 2`7T}1X7@'h7T"7&P8] 8|$X+8,_48X] =8`0P8t't[8`2`83 l8+y84"8#8!8H1p80/L858 84_8@18 $87!09,&59__@9 /9`&.:90xM9!Z99#i9z_o9a98859$9 $9H_9,.L9k_9 )0`9-9t_9H$9)D :̈$x:2%!:"`*:$t1:`E-?: (pO:011[:+k:,5:*5:TY/h:k)h:t0x:}] :D=54:0:2: $;o"X;1$;1p);F.`0;-#D?;%J;@00Z;>5c;p/(n; 0p~;\%;l>5;!L;L';lj#;@"8;P%a;|.;Z_<$`"`<83%<<0(< 12<H1A<,O<h*_<L_k<!r<_~<w) <m)`<@5<Pq]< 2<XU,<D+,$<*5<H#=|%=F#l=\n"=4G.P&=!x6= pS=.g=B5z=E# =a-=P]=/P=-x=X15= <=1=)0= >1>X,a.>/F>z&<W>4g&Ha>X_n>d)P>w$P>$55>"5>$&P>h"> :*$>%5>2<>ܦ.?-?<+5&?!#8?D$DD?H1T?w,X_?dM q?p3y?@28?O,`?u3?`$?)l?do]?8% ?l5?]?H(%FHh!L[H,q-cHt2aoH`"LuH(HC1HTk0pH'@HU!<H)XH!Hx %H 0PH lI3I@.tIP])I15$;IL(<JI 1ZIt<0pIX`(I\,aIm)$I! I"TIt"I$.IO3 IaJH&J'HJT-5$/J";J@.<TJX;5hJ5{Jh/dJ|]Jx=5Jp'XJ&8Jl_JI]J*J.` K|r$ Kr#\$K/$:K'DKH*UK " jKt%uK-K&LKd0tK/K+Kh$lK#DK`K# L|",Lȸ!\1L85BLpQ0ZL 0oL_zL2aL4" L|U'tLaLȡ1pLl-LTQ$0L_L G#lL<*L!Mho#dM(H!X/M*@MxN]KMB) aMĕ"oM "zM!M<.MLZ&M1M0hM$/XM,0M75M4$M _M|] NE5"N0$.N+=NDp&PON_[N-rN18|N.NX%NL+!N$aN-NH%xN]Nhf&N@$Nl!N-NX%DOn'XO. O`2O( hCOL<2\PO!xcO4( oOp-~O4k_O]OX1O`O2O&8O-4O>5OG]P+lP{]Px0+P.\=PL]JP[.SPĎ#cP'pP0"Ps$tPĀ P`P_P$aPH!hP]PȲ&\PT*DQpU!<Q]Qd.+Q@M]3Q,@!AQ.TQ#]Qz_iQ}]QI#Q@3ZQ_Q%QX_Q01Q3Q`o]Qx%<RĚ"tR%#Rpk#|2R$aCR$ LR81pVR2amR.wR8J]RȐ* R "Rx2aRȍ#R#5R.Rlw-R&R"R\G! Sq1SpC5$ST280S(5XFy3XD(5X &<Yd#.Y# +Yx_7Y?0lLY] TY:*XaY@5oY75YtL$@YH%DY`Y`. Yl,YaY$:5Y.<Y$)xY`x.Z " ZI],Z0!(5ZP HZ-_Zx*mZ2rZ,P.Z""Z/0Z0HZ;5Z5ZR$\Zԡ_Zxa!Z,9.|[ć2h[!8&[$5/[2;[05V[h(5`[t/,m[_w[|q+\[08[< [ ;5[;0[!@[$a[?&[(K![2\0\0 \_,\%H9\ pP\.5$a\xP dt\ *|\$|\a-\P5\$2\(\|M1x\I]\&a\8"\s] ]0@&]$2\5]l0(A]$%dK] `]Ti%@n];$v]d.]D%]`62](]5]|+!,]xS-]L]]h7(`]$j$8^](| ^$^2 $^T@&d.^` B^t]dX^x&/Pq^f"Xw^P]~^LN]^%(^1$^ah^%0^0)^X%X^#t^_^H-^)L^( _"_t5(._.0<_`K_x^%U_-d_p[)m_1w___2(_$a_I]_0 _+_/_@0_Q!4_f(D `(e0`/)`4(5:`4.N`+ ]`@. h`1tt`.`,05$`"`.<`(| `l]`)`o!X` `T-a-\a̍'('aF52ah =ah]Ea! Qa:5@la5~a %da\5"8aS,ay aJ1a`ah2a`#.a  b_ bd`b81a1b,5i*i$ai $5i~"Di,550i1 jh/j/#j\o]6j%Cjܕ$Jj"VjЌ3 cj,/ qjq$~j*jpf!xjXR%8j /Hjx_j4#8j3j%5jt/5jĀ-k& k_k# #kl`|*k%7k o]Bk@,2pMk1[k8j#ok`"(vkf!\}kI1|k&akTE,lk3kx!k]kH(LkZ#DkE2lB0(l/:l.DlS+Ql *l_lY&hrl2XlT!@l!l@2,l*l].$lĴ(ll]l14lXn]l]l2lTt0dm("8mz]#mO1h/m-Em%DRm\`bmd"xjmm0wm'4mhl18mЀ-m]m0&dm"`m m`+md"mW!mC&x n\&n#%n80=nt& JnD .Dfn\F&8vn@-$nЗ1no/ n`nn/nd!TnP!@np_n=5n#n2<ot0Ho.|"o!d3o3:oB&xHo.Uo|_boL Hvodq/4ou/o"@o|.o8O!odq1<o5o 2(o)<o"oB)o"8p]/1p.=px?5Lp$5 Zp&4dp! xp? Dp#p(q" p&HpF5(p8)5p/p%Dp2ap̢_p#1@q?.q]%qH*|7q_Iq|2aYq2fqO2wq)pq!q%q%q<,Hq*Xq%-qA)r_  rp!xr_!r",r#Ar/Jr)(Xrt&-br !drrl/,rx`r_-r\-rH<)rV2r)+r"r v'rQ1\s}1sp&!s5p)s+5$8s43Bsx#xPs`>5esĶ-}s^)<ss%`s)@sXZ#dsL_s4-s(-s(`s@!s/s\"t$"t!pt+l't@#h5tv3Et`#0Tt8.jt4y$ttm"|}t?!td0t*0t0t؍)tp3$t}+@t2,t0t%t-u<*u*(uС"4.uJ*=u_Gu!<Qu$!d\u` 5du|M.$nu$zu#lu,#u"uO1Lu82 u&Pu$5 u5u@&up+5$v] v$`HvX^)$vh&T"v%-vl,a 6v$>v$|Gvp0Tv .0bv]#TvvH=)v.\vc%vp!0v#%tv8q]v02vz.v%v &v@+d  wTO0w #l,w 5Ew 50Pwx%YwDz$(cw5sw)&w$_w`[1w\0wD1w.w&w%wh+5w2 xt#Hx4*&x &@6x$pCxZ+Pxl.`]x/dx<2(qxE,|xԠ"<x/xLx2px-%xt0x`-x_x"5x%xd]y|`ydL$#y /5yZ.8=y .Lyl0gy.oy=5~yp&y0Ty8*Ty)5yj%yN2y#y1y0n&yr]zB* z #dz!(z|(8z~(\Cz2Ozh-`z/vzH0pzX)zs](z(z Hz14z|I)\zp&<z&z%@{8#t{ !#{&x5{D1@{h#T{ 7"^{#i{%u{({$!{_{Ԙ1{$/{%5{|[#{n3{pE&{@%L|[.0 |-8|@5T(|{'1|?5A|ԫ"G|!R|-$ Z|/0hq|h%.||5|f&<|0\| |2|^2\|%<|&|$/|,&|\ 2h }D%p} ]3}I]4+}82@}-X}("a}Xl/u}+t}M#}5P}&@}\&}2`}!}ز/~R_ ~/85#~0_-~8U*6~P/5$G~(&W~/c~̗-0u~|%`~(~2,Iq][5!g/ {܀&T-5A1%5ǃ_Ѓ% R__d042d|u1\)L*;(5KĚ_0TȤ.L[4o-b2l/u22<! 0&hh-˄4`߄Pt) d_</`,`2"i$+3 7/AD# I;5R\#[q#c_j 54*5W28\D) E5x,J]Ʌu-؅]h$5k!4 '#+O5 50|Dpf#W-nh-+%HH 020Ɇ0aچ8G&,J$Hx&.(x$L L95'h2p4*5?$G0_Rk!8_`.$m8%Hw(n/ )4_! \Ň.5܇$3a4~0s] %Do]".L71|A$/5$S*eШ%pK#,}M]x,a`' X%hX 0ֈt0|i/x' r]S-$- 285P4%<\D$dg2(wx/l`\G ?5,R1͉D`&ۉf%.|s `0'#T%L/$x7`0J/xZM.gX~%tp]2)D8#tD]#t NJI]ي[!@P] #d.l (p1p*`:_'LO#a\[/8yd x 2 (&T ")ċ\"|ʋ l֋%݋b&@a8|V!t 2h `+,غ_3`A05$V-5$fd.@nC5$&5X#\ T!1/h4*ی`(x10v--% k_-D3 92A<>5Uص2@c _oI]{c1.ȫ$0dʍ/&pX#,`%p+,5*ܧ+8*lD4N*Ow3_̱#k(\wh-|%S'X@"4; LʎN,Dڎj#-1P2`(_/H}-'| $1t`?Y%I!W@/xj 4|| @!X)2 $xh=3.͏TK]܏č%,#5z3 Q] %3 #f!/* ;%.F|^)S(^ ,w\e-(3 0`8:2%5Ȑ!ܐ0p.5$p3  k/x08&\1\11d?T$aK4_TD.hf4#nИ*|?5 5 .$/lȑ4Α,c&,ܑ02,r+T ,2 2!&a5.EPn]O|`0e*lb@#5j#.r@1~H_%545R!4L]J]*Ж`ۖ%4Q-$D82'#]*h%0P:t.El-[<&5k *s$|]1+5$!)<%ȗ$J.X֗Hz.Lߗ _R!0`4<{. e. P1&l&ȋ3 3@1,ID#$Q$X`a2$j+v%X-'ls&L!0Ø0$ Ә! -5$U20\_`0a"&a1)D:`(E%DQ0YL-Df$"@rD0!H4&H$2ag*Ι5֙y]+h2*5()"20,`%$9b1tET>5P%Ha8e#(zL,XO]1\@- x)<Ě_Ϛ1\ٚ40(-$4$""'^/9-O_V4K0,uf!T|0$Lx- 0TF5J#|"0ƛ"4қ t$ 2l. 0P/4h-B1LO-W$k__Z1k-s 5=& T 5|24%P604˜)LڜP$N$00s+p)&,%,(8.(86A5?r&K#YC"f\n]t@a"~J]A*3a#%LX1Ɲp'۝Tn]Tp$2a y' *'#>8"O`0_G*|q5i-y#${],154w0-ʤ%Tդl"l,1P0\$ &|0H'\$%d/75:. $H@%ND ]&an(h|!$1l )<>3  -ȥN*TڥH ,{ \ؗ',5P_'$|3`0F?5R_^%kz$(zK$*510/ӦT(5X2L8;5tC-.@$J]' 0#:%,E̲1pM/Xl%Tc1mTY)|" 50\F&_$ȧ0 8ݧT_ -M'@2!,*2 1T@+MXP,4XZ(f%s"h`%T2(d+%a$a*LѨt$ڨ!$ %5g20l024<#`'5&0< #> N1_@P3Hyp] (<2 `/#Tl"r$ͩ,]٩F5X1`(\ %@ r10)X1#6{_Bt0 W@-e%hp"~h$4;1l`z]8Ǫd{_xϪx_ت+DO*@%, -%@'z3 9ع.O5[|)d3 sp2L :+ 40,4,&ϫ$_ ݫX.@I&`!d$$T({]/l!x;$G,s+T9.a|) m&%\%0*,(`__Ŭ05̬(׬P+%j'hx",5 2d0&%=35$_Bz_H0\Y-ohP0j#-Lj2$1A-|)& ˭t# ӭ2aH&4A) $,K !*/`-?$HPo"pk/5T.@/@8_I"5]ŮĎ(ή/\ܮ&ah_ z!`;5(ܜ08x/DE5`[5k2yX%P%hQ-* &ax2Ư`$կ"lݯ|Z%x1tj/8 $'"4$(e-7h|]?2C80<Sc1nP!P~L1pU.(p, &|!Űd}/Ͱ, l װ0T2($58210(-\*E"l8=,Hd3(R`H%\ܙ/$f*r|&\ \H0a-1Ʊ/ر -$l+D350 40P -<|]61E?)R@>5g1p00280&!5Ȳ`/`Ӳ/ܲp$5$!8d 5P?!4 5.5 1y$`;-@J%0SC#`TL'Du"H||_, l$ƺ]кq(,! A15pt-t-$*'2%<9 $Dp2P !d8)Pu\"t~2P.<_%$%D»d"л_a&Z!_&< ;0@%+ ;0&lC``.DNT_X#ahē*p|5,_/@x80x/0μ|%Tټ@_. A%tX*.(p_j/._"|](&21#AX_KXJ1lUt-$i%q,G]py(:54d65@N]$! .@ý*Ͻ ߽D.$0d@_ ,_X 'p2$82B8n3PR0eA5@y\2,`1|D%Ȥ/¾)<˾D*5P d"l.؃*`_M#p`)|"$1.4H-hQ *Z@1e|&}#D:*HW&d(k_TT'(>&Ϳt}]߿.h +P\0_-d-1#X?@Z#S21Ha@'Lp_}-&lJ0p3$`_ + -, h ` 5] Pl/:'F!MC,Y$&e]q-10@%<Č3 *.5$ v0z$4#Ho]"/B)*LD#5%#hE2L8#x[0.xgtq)$sx |@"`t]\+402P/\N!2 0D'$(00.( S$p5$5$N"\H"ax1qԋ3  02,Ԫ0<'p1i!tt0D*X-'0l;51^!<T1P]Z.ig-|2S+,"5|%@! p33$,,<. #7.t Դ_pC*L|,a,*(9 55?M1H,&[L'hm$|$hxQ!,1t.? @!p2aH%Ԩ"U%!L Q-&p"?52-BD4* O"Z(2xkXD"dxH0@&al275"de-1.0#u)$$ܙ-#T62 1.89$ 1E@2P`#^_Hd1Xn) y3`1(1&T#0L/H)T0<-03$(. &H2 X$1hL2Chu1V<+4d.lr?5z(_ |14F!x "hP2$0"XI]Y#-d+&)%775Pe.XX, #d!@k2(t0` 2H-`\'P!hq]1*4 X)x`2TH]/(2"!T&D2_:%Ht.W-mP*hw>5p7!<_3"$ !,(1?5HS+`- b-)1@2_ ;5HC1ZP'g38v 1hv.$$u-h+4U!<X/(3_-8&D#/l9̿+FL_MN!^(i7# w!HC&|_>%`02̂38i-9$h1|'-\@)$* 8"2,%05$7$d-I6$PS %laĆ-mX%zܤ% ,h*'8/\29* \") "lh>']#`5X2B`-R`, dhA)~ )453a,*52tt/21*`Pn)$3`$"X/)(23 T?0Q)i_x"0%D`)h;50;5L%!$xe!8{]_($#dd] $( "p0p29]C ]RQ]m#vp#0,2~$4(V108., A)C-4 ',()$`$5'| 0;ę04F 0 c`/mD>5z7!p HX0_j(T(_*5|0 )Ĩ0(;,\$\)D11A0 Xt/h%sX#"|$!q]+T!@#2,f-v1dXt!0Da0/p+|> ' RX1L] }0dwQ]\y3p8@#,+ ]L#-%0T|>.4/1/` T"\$#F1,y%8`2T?~0@M$=%xZ:1\g+5|#D5D(\42`z+L_x]"03 xA&X$>)K-p]& 3\'1C`Q\N-c.0pu!T 3 (/p/p ,X -a*"d111 .$a &X,!X:/G+5$W2tl0,yl(0a|!p$'$0_ND_Z 2TjP)(sTQ%~$!Xd&T2$7/P\+<]D2.[%@ .Ж.\PN] $aL!& 6}]0C*LR{/\gp-r``0P ++.,"$Xh 5Ѝ)@X $%d!$3  n3̙2 *T&&H"d4d@5=@5KL&2p[ LpT5z*hh+x0t'K+@.]<(-tNc.0U1%ç%@n_{<) &D&*8-$ @%<T0 '0"L ?5'* &`52B0TW.g$#8q$!.2~] dn]/ ."D.5$k1TB)\^&| "42D#p]@6I]D$&+DZ$n$/<}. ^#/L55x- &"/+Hm0$9F1lC`/UP |f2atA) /T&<].@(LD_/$.(#&(038>)DN%<XH_co$pY/,%X-K0H<<*%`L!1 2h2aD%D%"D_%2-\ $=$&K *Z .e"vy%~ `/ ,d,,lx)2p0,<" t +,51 6.$>)$IS-X(f.xH_2(d#D+5$&p/,-*-P) `_!#P0H=-N,%LZ$Y!Dl1yx+| (58D0$d_'@@0j/(D $`|* `__`*-<2hNp0g-w%8*"__\J]T"0|a.@$(#`8_0,`!!0'L;2??1O\b0^\3k!("  5_[]܀- @*\\]<u0,*X2D-$ )#]%d#$_.H /0?x&N"4eP|]m2x.#+0 3t+4'D0080\0.*4 Aԩ0tQ`f/bd-\oP]~#585v'ı0Q'$%1(#(ؑ-,#P:A.PK,m0_(-,f)u 4|]82R1T &1l/P_d- @-, ](V2dh#.<`-.:58/%G$'T8&Pg/lxP85$5@9$Tp3DE1 C5F5~*d#C5(l#(915H"<d E (Sx/Paȟ,hrd3 ~tF'h1$\/ 5%` 2!_(_/a#8K2L0<]+m>5w*$t>5$&p3l/x'D0H&L<*X*&/5z]*h!`=3D0*5T/h#5q "~0*T"L%\"\"&(*T=5#Pi#/<".30#lB0J]Q4)5\@ #hpO]otF,@{X!4_2.1v042D<_$(* T_p.5H\2L0Ж1T?`0Q4&5XH-a(#`oy]}N2d._X_0](-̥*0@5$5&1dt$t-H#.5P]Mh 5 U|. f-v'+p-|4$!x-0k'2'/2a h Xo]+_-@<1aKO$Sx-0q"z$`$$p2@5z_ 4lK]L,Xd-x,5$-D6.t<$$$p3b!:4J]I:%SQ+bȢ_u|0P?5!$ab#@d $,C".!@ %541"#5/2,;5Cd2,Op0^2av H<2\,(!0`tX&`$! &.@.(x2$05z3# .LO$#5X!Pl'#(h2,1v$`$501&a8( Hn]2a`h&L̵.@)\ ""0",0_C5FF N2^ب%i&0vli- 5=5d_$,%LH-!<'1<L.\15&X/2\_>N1 Lx$U3$\p/xT.Tc-P+!,-,0"8\ # l!]2!0#,J$$9,!$IH(U0i=% t#aH-`f#r#@)#\(:.\A-@_ _`(+l2ah~*`6I"<G\*[x]#@h3am\m$0v,81*0!XY!$XB)D=0,\_#x!$D$'%`_a "l0\5܎0<H1^$n*x.@%t 2#C"d<%ش_`P/_#M)L\)(|+d4w3%pR05_H_O#Z,a c0_mܻ$up%<{]&a<` |f0l-(]0 \m#,a "$F!hPH2(17(0I]/Hj_s(}t0P _ !$Xz2A+D.(_.$00d-'@$5 $#.<~])@07G&$Hܦ$SP!(j?5Dk%@4_ ]p` J]28&$-T-s)L_* -$(@$@0>5Bl]J|]P 0P]|1f0v2r"$1z%$<ԍ"T].(--a.F5 +T * :(-xG0S`3c@`o̰.3#8W&L '<xx'_*_T/< z'" 60DK.4_S$f~x3vl"D/L& 3#@&0L0`@l!@ |hY!@0(-L,%82PM&WD*tg:0{t#L" |#"$0|;. `%d "L!$5-?5$5_"/@*+7T1CT=3R)e\0\wh/<5x +Hu+|$P`"$"5"$ā"#$Ը. lh& e% D5- 0,= p, M $*(V L$t_ 1o &a " h1 ) :5 tl# &a hC5 \"  B$ H1 1( @#  r] 5$  , 3a 9 w.A "R l1] @b(n ̍3 { %< $  5 d#@ L]   '/$ L] S- l!0 _+ -6 Ȍ!4G %2TW 5\ pN]m x3w %< 2 ` h_ 52 ܓ P #` X. H. %0 $5 o] tL*\ ė#0* )H6 '8@  04N \Y+W $%`` p&q /  P" . Ą& $ 5 Q-  &P $["d "| 0>5& 4, l6 &K %R $2 ` 0r $5 " hI%( % 8O.p h_ |]  ]. \* *t -_%,15$-*>*5$P2Y #m. 1x$0,%ĺ#Ԩ/dt-__TJ- 4E#l&"x%l,(z'PE`Mx/a`_q#!2HM]@0d`+%e0#J)lY!`c!p1$|]4!,Fl$pR,_d!s5p%!p=.7-x(3P]Y!04$4|$ 75)%17@V)4C%$Qd _t%jd_u D\*LP'y.d(B)"x#,b1< !T/@>5U** .D12(H;2I|'(X8k!Lk3u2~_F5 4-L0%T1XdX!#- LD2,(,4_x-50_d84]A%Hl2TU(Lb]kPy.w-\(N%!,P$\0l/5J!`Q.P|4&0(5x"\,.x P0,1H2#05h#l XT+3 H 0$y%8 l1G1)+;lC5J80Zh 0nt/p8e)$@q$,I],"(A)@!& (( *_&@&4-(C=5T̐#d42rS2Y.-̣!2<,2H~0@'5 L5p392(X>5#$x8! C3^]g.u$}&0l|/a v-83 %5_ĝ/H /@%0k_3a$*)5$'L!$5Dd/I(%|P_Z_e\-}(;5X.(! 0ly1)0LH#(3 8- |a-+2$24I-<B0pSH/5jd%x/P0d81$0  j#/ {- $5$r2 1h \q/D/(%a9h|'G.]H *Dq!L (-n%!D38q].d$|w$d"-5$q]d0d,&a@[.Kz&W*4dp"lo,.yȍ)'x`$#%x|g&(/,`{_dY , )%H xa1,&Y%/'=\&5D%.HJ%`-V%(#@`% @5n%`*|x%>1`%T;5%&a%?5%,%:5%0`%4+2 %h" &D2p&%T&,_'&8"p4&Ч-N&x'X&;#@o&=!tz&_&;0x&0&<+&`&]&(0 &f-&8P3'*P' %'d_-'|0H'@q/Y'|!Pe'Pr1Xx'(>5'(_'5L'00(' _'J$H'p 0'_'%' %|'#5 (T"(|?5,(HC%l6($5>(7!N(D) ^(\0Dk( %5x(x:0$()(o](/X(,T!(r](s3 (P]( q])J])`l/`%)D$0)Ft3@)le.,H)L-U),H`)Ԯ#$n)_w)8#4) )L-5)h/`)|0H) G*)_)g2)0*h'+@*&X*s3,*0X:*P$M**\*$&Xi*k'*&X*% *n/*L0*(*_l*p@5*+$*05$*J0,+`!&+ 8+'E+'Q+)\+0+hk+V&8y+ܰ%L+0h+0*% +((d+3+LR'l+o$8+t%,+,5$+H!,$0,i-!,,(4,@B)K,45a,ԗ0n,p-,R'd,&T,dg-,t, ,&h,Ln],"L,/5$,@1a -`$-#8+-@g!8-Y3D-h_W-(da-7(8"k-p&T|-*#0-h0-L]-%2`-o]-'-4*(- T-t, -1X-/ .5.0H9.(F.X2Q.81c.[#|u.\0.x"a.'.5. T.2.@5.+0.p(5.~".P2 /X,/0)#%/F5(3/Z)p