ELF 4tB4 (   BMO fr4D$$4D$$4D$tУ$4D$ $4D$$4D$ $4j1X PX1%Qu.UU1ҹuD$4nD$4_X5 PX1% QurD$4UU1ҹs#D$419ҜYX1ȩD$4"# "İ"#1T$4h$4l$4 p$4t$4H$4L$4 P$4T$4|X$4\$4 `$4d$4=v`x$4|$4 $4$4$4$4 $4$4$4$4 $4$4&4$RN_Ё$RЃ1󫿰N_ hR} ~ 0)1Y. 0) B hR 0)  ` hR^0 hR 0F 5$4" /"hKË hRЍ^hR 0$4ЍУ$4Ѝp1hR 0P  @$4Sփ_^][ZYXύv$t6T$ t&$tT$ tD$PPg̀̀WD$|$ ffL$L$f_ÐVW@L_ЋǀLЋt$|$L$)9r&L$@L_Ћ_^1ONL$@L_Ћ_^1ÐVWt$ |$L$)9rL$_^ONL$_^ÐL$L$L$vVWjt$|$D$=:Wu\tXI @L_ЋǂtGIy|$D$Q PYt@L_ЋǂL󤏂_^1ÐVW@L_ЋjǀLЋt$|$D$4(@L_Ћ_^1É@L_Ћ_^ÉVWt$ |$T$=:Wu%) @L_ЋǁЁ  uRWZ)s1Ixu1u?@L_Ћǀи)9s‰D$BJtuJ1|k?iVW @L_ЋǁЋt$ |$T$)9s‰D$BJtuJ1? @L_ЋǁL$)ыT$t _^ÉVWt$ |$T$BJt uJ1?L$)ыT$t _^ÉD$؎иXXjPˍvD$`hp x$P1ÐD$`hp xP$1@ËD$dUЍՀUЋJPBAHËL$QAIJQ9u dUÍvtXVp,f8n< UЋ,8g8otjSV u]G~}t"t >t}tUE P0UP41e[^_UWVSRu] s,3ECCC8UBB)‰S<}>FuP@>FuP@FuP@>FuP@ xUBB9|1ɅFuP @ >FuP@ C>FuP @ {>F}{8uP@ E9C|;C<~{ 1CCC C@ȋ}CșSuSujjjS C C4C0jjSV,t Uu hL.S hM. XF(F$C$t V(C$B(F(^(C(e[^_UU S]ECCPjjhR<]t h`M.;CKuP @ ЃCQjjuR3\thM.YCPjhh s\thM.3C Ph{tPss`t h N.H {C$C(C,tJ.J.ЉC0Cy Qpu1ff9މry Qu fo ff[^UVu SM]u%19s=y Qpu19މry Qu o [^UW} SM]u19s7y Qxu9߉ry Qu m [_UE S]t PhN.谳 ZYCPCPhN.蘳 ]UE t PhN.y XZE@PhN.e UEjj(PRUEjj(PRUES] ȠPjuR 1jjPu!]UWVSu ]Sj ThR11 jjSPjThRЋjSx ljYYtFc~1ҍe[^_UVSQu V]SYZ1҅ubVS8jdThRh'j@jHS1҅x;jj'SP EPjjSETh'j@jHST҃e[^UWVS} W]Sj 1ThRЃ hjPjXS@u!u{(uhWS1aC(%1҃PuQhjSPjUjSPhjSP$j ThRЋjS uj@L Q4PLXZFt @1jVj ThRЋjVEE8F)tF)EPjjVjVj ThRЋjVE8F)tF)EPjjVt}uE؃tue1}IVEPVE߃ 1}&E~ EEߊMt|uVj ThRЋjVjVjV$jVËjVEf ‰fEEPjj VEUu }ufOEE؁<}aE^ 1E߉tPCuJVWVb t#fSЃfCFt@1tfS EVXEG<}vEߍe[^_USj@jJu u& SnJ1]UWVS=$4]u Q4ShDWЍPwl ;u Q4ЋCxhtSPh_SP^C.u jt hThRY=LQ4u"jhN.jjjj`h@U LQ4Ѓ@s,E߉_dEG,C@0ufO.G.t`}u C.uK$hThRЍFu Q4V1F.jYtSVǃ} XZtV9tRvFPhO. tu hN. Xtu hN. Xhn 1 X19e[^_USj]Sj ThRЋj j(SPh'ThRЋjj(SP(h'ThRЋ]UWVSPP]u EjS3j ThRЋjSEjSjS$j ThRЋjSNjjSu tu} }xy+jdThRE}Xt}yye[^_UWVSQQ}uEk F+jVF(XÈE8F)ZtF)EPjjVu/V N.u-/RhN. whN. whO. F$ t^jGPvsDSPCTf$߃f$jWVW0 hO.VE ^_EEe[^_CUWVS ]C8@C4B0 t:M fft+fBt'fK`CCCCC CCu7fKWQ4PS調u  8tfcfKtCDžU Bg<v A> \uQPAP u QT2AT2$ tc u 1Ɓ u 1Ɓ u 1Ɓ uQWAWt)Sw Xu QW AWAW u Ɓ uQ81A8 ]uQ`A` uQb1Ab uQc1Ac u  u4u e[^UWVSux tjhjPP 68<6Ѓ8< u*Ѓz tjjPRR 6@6\t(z t7j j@+PRR HPWh Q. @t SV~Y_SVÈXZ68<,e[^_UWV}S(SWXNZye[^_UM$E u tBuBU M!US]jjhjjjSv]]hJUWVSHEԋ}PW(Y [u ’ƂE %qwW1w%yw H5 !' QwA aI =w-= w= =v => w=C = uQ1BQ u »؋tt(z t9j j@+PRR EPW5(Su h`Q.荈 FVtFB,  B, VWfXZFSPXCt* t "t hQ." )EԋEkEEȉEE̋F,EЋ@t VW{YX+im,UЉB CMĀwPЃ?SCCUЊBCCCVB$9B(ujuuȍEPWE܋Mf0tKF$@FCUЋC BCF0Cy t)jj +imP(QQ z tjF(pjF(0RR y tjpjPQQ NF4VWeX ZuQ@BQ@F@ @|uVhЋFhPD @B&4Љi@KL1PFhPC 1 u22uEPhQ. ɋudBdEɋuQBQu>B>؋u=B=uVSPh@R.| ۋueBeEۋu>B>ȋu=B=% PW`Y ɉ[u ؋u<BB>ltσpωȃhƅgAtƅgB(gjgSlWhUR<pjj jVDž` ujjjV tyc uU@`UBp ¸`X #4te.PU@Phe.Is jj`lSWV_(jj jVL t-jSjWh]SXjhe.jSV/,jjjV t!kEU@@@ `jjjVt!jjjURV uVQjjjVt)jjjjjj]SV% uVGQ_X}tOU@ tXUBp h$jS]@?PgPWV^he.q Y[1Q49ptGvꃽpt EPVXZ ۋubBbȋucBc PQ4thW.fq u ’ƂV^5WhW.(q u ’Ƃe[^_UU S]kB jPQRS]UWVS]DEEEE ubBbȋDE@ucBc ʉ1;us9sA9s F;ur;D}~ h X. p S^jhe.l E}uBEu1B ɋ$uBEt ɋu EEBɋu1B u ’Ƃ ]u `B`E%t< u B  u ’Ƃ 4u ‡ hThRY u ‡t}tUu EEB u EEB ]u`B`e[^_UMS uP @  ۋu ۋuP p@ p ۋu ۋu ƀ u [UWVSUR}BuE SM Ut9th`X.i jjh8 1 titJǹȉ׹@fǂ21󪍾Ky M E׍e[^_UWVS E Mu}EMu苇$]tF  uP@tuP @ u1 D@}uM MQ#yusQt+uҋ9sʋME]M } [^_u [^1_UWVS}%uMu&u u R4Ѓz t>$t:t0ZE 9w R49uE t& z u‹E 8tz t$t:uE 1҃&[^_UES$M Utp R4Ѓz t)tt BBp9tz u1[U}SM ]u1#E$t}u‹9v…ɉt}uAA 9vЉ[UM9U tE$tt}uRR 9vЉUWVSVu}0UEuE$tBBBB 8Bu'Z:Z uB:B uJ:J uOuuutU fBf 0U fBf!009E[[^_UWVS} }uEEu E1U UEU kB UtECSECtUS C US CSK;Eu 9u ;ME}$ t(᠃}E Et@U fB}f#2f2ဃ}t,UBt} f GUf2}Gp  }E EU fRfUEf2EuBBf}t }}uBB}tEE uJU$t uB USCUSjhj} w GPuMuEt.EVe.u #4P}w E p RhX.f } w RhX.f jSuu uE}t uP_e[^_UWVS MȃEEU }EkB U]t^t^ F9t~E$u }t uB^jhjM q APW tٸPE p h Y.e jVuu WE}tW?Xe[^_UVSu] SuVVsEPhss CPVse[^UWVSH}E 8SEPWEԋkE0EEJJE܃ f2tJMBMABEf0uC@t ࿉Cby t jj@+PQQ EЋ[ M}{ ɋu ‡EuqEɋ5u ‡ ɋu ‡t$tɋu  u EEE0 u E M̈ u »\z tj j@+PRR  CEu ¸ȊE u ¸ Cu ½ Cu ¾E̋E9E u E MĈ}uB ɋu ‘ uɋ4u ‡e[^_UWVSP] ɋuP @ x E;E%t+ɋuP<@<tɋuP!@6$ tuP@uP@ !ƅuP=@=ȋ$uP>@>uAt 1APRtȃpPVu 1e[^_UQ4ЉR4ЋMs9t R4rUE SM]UK ECKSEBCuACKfC[UE pp @PEhe.B` UVSEZ!@ tEQ$At APB?PBtpPVu /e[^UM%u uB uBUWVS]}ǃǃ|G u:B:<P?ց΀@@tց| dQF|@ t1#dQ@dAF|Gt5Ƅd @|Gp ۣ$`Y.^ Xl@ |t Ƅd Ƅd@B|Gp 肣X@ te. #4Phe.^ Y^ uw࿈nGt u SXZ[hY.] U BP@PhY.]  u:B:wPAPAPhZ.CVhu0CE u ºe[^_UWVS E u »tt)Ez tj j@+PRR E EEu §E}u ¦ ˋE}u ¥ ًE}^0v,u ¤ ȃ)ƉE}Eu ¢E}u ¡؋EE ˋ8HE,}Eu   ލ9)EE}u …}Eu… E EHuȁˆȃE u …E u؁‹ E u؁Š E u؁‰ E u ˆE uŽ E u E u ŒE$uf u B E u B E uBe[^_UWVSuu vhjFPv }W/jjjVWe0jjjjjjVW }tjjjv FPWP}t%}Sv FPuh^.B e[^_UWS}!u) u 4Ƈ44ۈ5u.jjhH7 ƒ ҉ t׉1e[_UWVS} %=% t{`Q4ЅtqA9BuSA9BuKzuމً,%,, ƒ,, ‰, Hu`Q4Ht SWuO^Z~ۍHt"LLLH8L"LJHdQ4ЉLdQ4Љ8dQ4e[^_U`Q4ЉҋMt9ʉt Hu1UU EUS]t jPo YXE ]UVS]t rWSXPPPP8PP0PRR((S@NSY1Xt jPҤ XZF~勃t jP踤 Y^0t jP褤 XZjS蚤 e[^USj]SX Zu1 uB1B u †1Ƃ Hu1Y~܋]UWVSP] 5u ‡ ɋu ‡t$tɋu E uu uBȋu ȃȃB uBEu ȃȃB ɋuB5u ‡ hThRNXt& u ‡tυuh^.= ^X 5u ‡  uB ttwt.t $$Ph _.= $tsuBȋu ȃȃB u EEB u ȃȃB uB1} tSYe[^_UVS1ɋ] u  u  u 9uKu 1ƀ u u AO[^UWVSM/ t@1E= u 19}, Xu Ƅ9|ԃ u ¸1Ƃ.@ t u ¿FFu ¿Ƃ u »Ƃ u ¹Ƃ ^u ºƂE9É.@ tuB1BBuBBB u F F u ¿Ƃ[^_UWVSuǃ@jjh7蒜 ƒ ҉ -1׹ VEE_uPhXf.49 hpf.P PPPPPh?G3(Fhf.8P0P,P P(Ph2(xJ1FV'DYuh`_.Y8 XZV1 e[^_UWVS}Fw$ }.Ћ@t@@@@sCPs3h3jS諜 @ u80P (hF3 Ph?3tj0 XZe[^_UWVSED<rk8jjj" Nhf.ЋU@PFPFPFPVh/1(y jV螛 @F@FNMEDE)E}~EEU9UC$s(MK,EC0ECCC PMPjhj hRRucDMDBCEEDEE89EGe[^_UWVSQU 4Q4he.Ћ]u SVA6 1эQM$t5,APSPRPh_.)P2P5 a #4tf.tf. tf.Шf.uf.ЋERPEPPWQhf.)P2P5 1эQM.@ 2ut hEPhf.)SQJ5 EPhf.)SQ/5 e[^_UWVSPP] u<1B< uW1BW$ u  BB,  SuB ɋu[B[u8 ȃ 8 ȃB$t" u  BB uB uBB u  BB, $ tRuBRuB uZBZu8  8 B$t" u  BB uB uBB1EEE%PS3Y._t!E% PSGX?Z~FEEv18Fv틃x tjhjPP 1<Fv%t6 u1B u1B uDJD u ȃEBE u ȃFBF u ȃGJG uHJH u ȃIBI u ȃJBJ u ȃKJK u0B0 u1 B1 u2 B2 u31B3 u4B4 u5 B5 u61B6 u71B7%t! u †1Ƃ&t@ ƃ\uO1BO \uPBP$@ƃ7ƃ6 u Ƃ 7u  7u  u 1UƂRuL1BL 7uMBM 6uNBN u@B@ uABA u:B:-JtZ uTBTS Yu 9@@B9S!ZuB$t1 jdThRN_ uB uuS&1e[^_UWVS0uE,tƆSƆR,$hf.PPP8PPh&( &t\8X 81EXDE }v拆X 88<EuVY jARPV2 t $t1jBSPV uh_.S+  uP<1@< uPW1@WE$,Uw @%,Et2 uP[@[@t,t , ۋuPZ@Z@t,t @,E,t5h `.W* ,EX$ZtyEpۋuP3@3ۋuP2@2 EEt4ۋuP1@1ۋuP0@0 ȉE$ uEEERv$t Sk1߉U,t$tC(R4ЈCC M܋$Eԅɋu MT UD MEfEu+pE#E ¹uE#}u MTpUDpEu }tEt1PWV製C }uCCwY%tPCJtBp@uEąEtЃ!EEąED@PWV8 Ct C{uCy $tCC %°(ЈCCCCCEfǀ2Uf4EM9MEffdžVe[^_UWVS] 54u ‡ʉ54} t54u ‡[^_UVS],N ɋu ‘ uɋ4u ‡hThRXS* X5u ‡ ɋu ‡t$tɋu  u࿈ u ‘u(S Xu ‘Nt<=u &u( u B Pu. u ‘Ph`.7% ^X,e[^US]S. XtM u ‘ u$ 4u ‡S1]USj]S{jS)Sە1]UWVSu.M ۋu uȁ? ȃ? ۋu ȋu * ۋuT D [^_UWVSu.M ۋu uȁ? ȃ? uƄ u " ۋu T D [^_UWVSu.M ۋu uȁ? ȃ? uEE u ##ۋu T EML [^_UWVSQEu E1}t}E$St уpAtSB(Ј‹C?1:Ut}u/19tGu&19Et}uC19Et }uZ[^_UWVS}E $Pt փpH?AtPB(ЈjjjhQPVW+ e[^_UVSuV1ۅZtH7H<\t&z tj j@+PRR u SVR $@ t 7u7uLBLe[^UWVu S}]u" u 9@>@B96RPy t jj@+PQQ <7@z tjj7PRR 7@By t jj@+PQQ e[^_UVSu$@ t8ۋu ۋu ۋuPMHM7[(^UWVSE}E7U$@ t@ɋu E Uɋu E$E눂ɋu MERMUU}$UEEu.u$E냿 7u 9@@B9U8UEꋗ<tt&z tj j@+PRR u$<ERPhf. hg.uuuEPu VWmtu E U uuPAXAe[^UVS] u Ɓ.@tR uAB AB uYB AB[^UWVS] ɋu u E E ɋu ¿u ¸1ƂS}X u5u@B@ u?࿈Au E E u ¿ u e[^_UWVS(EuE.u$ UUu jjuhuuu VE } EEEtE }BEuƒUE@E}u EE.tE@ U@UE܃}U9UEEЉE̋};}E% PVY[\t&z tj j@+PRR t3uuuuu SVtE% PVXZG;}uEEEE9ERjjjuuEPu V EE u E U舐 u \t&z tj j@+PRR uuuuEPu SVtV[E苆E9E< tZ uuuEPu SVzt2C@u x,uU P,Cu hg.Y YSVHXEZu u E U숐.u$H$uVYXE؍e[^_UVSu u  B߈B ɋuɋu؃؃  ThRu ‘jу XuVH Xu  B Be[^UWVS\uE EdžjPjjjEEPL 5u ‡ ɋu ‡t$tɋu V话V讂Y [$uBEAt tEBɋuTBTE8Eɋu ؃؃B ɋuB%ɋuB}tVZV賟 Xu22 uZEdɋuB%ɋuB}tVMXV3 Xu22Ej jhjujVE$jjjjEPV<EEtKEjujuu]SjjjSV,jjjjjjSVKE 9}vE9}v}t V}XB ɋu ‘ uɋ4u ‡Ee[^_UVSu At`uYQtFX$DuEt Rhg. у+N0N,yxQ%ÅyFX(e[^UWVS0 |.ȃe)čT$)čt$)ĉMčL$M1MĉUE}ЋMEE1ۃXtE E@EUHEЈE狂wPEЈEUE v.EEM uP`@`E uPb1@bM uPc1@c1EPWEPu-UȋE;}wdMr|.9w$<uFEЃ<u=MȋUfLC(Up|.9w"<uEȋMf Ẽ}vEPWuEȃ GoHUۉDt1jjSl M @u hg.J NjuԉE u%P`!uȋMha.Z @`1e؍e[^_UWVSE p|.Ћu}sOC%9uBuZu C %0fCfp|.s C%9tE 1;7e[^_UWVSE `h.ЉEEƒ}EU$8}.Љ}EfGfƁ19E v.Es1EPSEPuU9v9v)E܉C9r+u܋% Ot UOM$ u,}u&?thg. % E$t$11ҋ]tBA~uyMs}t3M% fAf% ŠA ‰U:% fGf% Gƒ  ME uu PanPa h b. e[^_UWVS1ۃ}uƅtE U9rhn 1 E_uuhh.hP< 1;} syLU!D9u*!9t"ۍu hhh.hhh.G;} r4PL h4PLD à ;} suthhh0ЍPsL Wh(. 1[}^tU e[^_UUWVSPju$ju jhu uVE}V$ tPu,u(h`b.juu EE$0u VV,tPu,u(hb.wuWju ju VEVtPu,u(hb.Djju EU2E0VV tPu,u(h c.UP E1X uhh. Y}_t}t"/}u)E0VVXZu U2VV0 E$0u VV( ؍e[^_UVSuV]SSVSSu uSS0uuSS(e[^UVS] u Mu  u ȍT D u ȍT D u ȍTL[^ÐUWVSj@]מfR^fC6$tfC8[PCL$S4fC:CD8S4t s0fSfjSZ,@Yt jjAS $t,y jjBS ,u2jhhN#ЍC0PS $tOjhhN#Ѝ0$tjhhN#ЍPSl jhhN#ЍC0PSR ˝Xe[^_US]y t j pjQQ ]]oUWVSWE @EUy tj pjPQQ E P t@B] CCt[U$@tp](E Pҋ@tBAE PË@cQuv[^EhP蟿 Ex$YtJ@ tMz tP] C pjPRR UM q PPXZ] C tyE t2SBu"&4BљPChP舾 ^_[ u΋]{,t U B@, M Ap E]CX$h ~.v Y[UB,$h.ЋMAXt7t""t(uFU 1BMA,U]C,IE@,=UB,1MA,%]CC,E@, UB,MA,uT] CtK4C,UHދ+}im 4MA,j@˚Zu u0j_XS̚]K$d@e[^_UEx<~@<E l UWVSPPUB Px U8Pu SE RUj@?Ɖ<$liÅXuV?XE@,V$UЋ3Sh$hPJ FMEP M8BuɀNUB @FB tFKNjjS SuW+e[^_UWVS0}GEЋU @,@XMЋA }p E 9ʋ_,sBC9rW0PU1B z D@tPG pjPR Ky tjW(pjPQ G,B G,@B@@ @MO4j@荘E̋E@Yt(}tw PXZWVg^_qB$tpkMĉEȀBt pMȊBABU2tHM4tH@U0t O@HM6tH z t+jpjR  G t G B  GE@u%UС&4BљPEЃhP腹 Y[@uc.uZ$@tp G(BGB8GBO9(tE@}GGR| 5u ‡ ɋu ‡t$tɋu .@u& u @ @ u S@@BS ɋu ‘ u*ɋ4u ‡ WVeXZUBuTB @u6WV5]WSV讙juuSVMЋA @Ƅ(u7[1BEpV>ZUYBt u h|}. XWXtuXe[^_UVS] Kut7hThRЃ Xu uKuuh}. Vf1e[^UWVSEM A< AXA(A,BvC]C@,j@(YuucXZS)E H$9M < qvȍz ]KE H$tRU] SRjQs Ur PP tC,KSN9MA p PQjjue[^_UU SB u' BE tChP/ [ Xu]UWVS}G@ p j@E4$G[uh`~. $AtpEEAtIMUmB*EE@?EGp <@$h}.# Vt O4u?B?ɉEt*19s$W,D%P4Sh~.C ;_4rGt4G@, ]jSV PSh@[. cz t+j pjR  ۋu E܅ۋu »ȋu<B<D9\t7y t+j j@+RQ 9t^Cp :GYt}.n 1Ph}.z OC_K@_9Z} &4Љ׉1PChG t[j jBPB?P$t BAAP$BtpPVV1f WVX Zu:B: u E EBCp 9$~. K&4PChP> z t+j pjR G t h. }t: u B yh}. V+e jjj@Pu]SuV ~1WV[XGp 8Yw@Ph@. WVzHOjjj@PuSuV(.@uQ u @ @ u ¸jjjhB?PS$BtpPV Gp 8$}. WV u E E܈&4PGhP@ XZ ɋu ‘ uɋ4u ‡u蘍Xe[^_UM S]Eۋt|fAf 6 fAf!6[U1UU1UUWVS4j@] ESEPuaC@ PMEԋkEEf#f 4֋Et f!6Uftf 61jEЍEPjuG9EvEjjuЍEPumtEEGEGEG}EuEEf4t f6uejEPEPujuЉÍEPSju(}uEE}t G<vGGjjuuuSEPu u讋e[^_ÐUWVS@u EċEEEEE0E1, DE܍EPVfE fEfEfEfEfE ÅXZtWPj - PuEPntu ÅXu}t E뻍EPv _ u ƀ ɋu u1Ƀ u TpLpU Zf}tt tɀ {u T L ;}U B$RB"t @t@% ,,M y y ,E @ t ,$t-@uU B"ufEM fAt1[ÐUEUEUE UE UE UEUEUEUEUEUEUEUEUEUEUE UEUEUEUE UEUEUEU1UWVSuVXt.jjVZ uPN@N1ۄ-jjV, uPR@RÁPVe[^_UShGh.j]jSuP?@?1҃w PPSЋ]US]SjjSSJuQ@1A@uP7@7u Q= A=A=u 1ƁuP<@<uP91@9uP:@:uP;@;uP?H?u;uPK@K2uPK@K2A;jjS$ uQAu Ɓ]]KUWVSu] VtSSVuPZ@Zɋu tɋu ƀu ƀu 1ƀ‰E ue[^_UWVS}WjjWEWEjXWxVWEEu3VWJ$h. uWhThRЃ 1ۃuuuWouWuCvjjWOVWhWShW=Y[uhW,[Zu 1ƃuhWäZYhWY[VhWhhWh,W-% =uVh,WVh.WyDh.WPWVhWSVh.WG(VW uW[XZuRBRuWYjjW!ȃu@t7x3hThR^ۋu ­uDt#ۋuȁ­ ȃ爂W Weh,WE%=VWhWVWE-EuVW誽$h.p 9E0EEPWEFY}?[vuW XuZ%=vhh,Whh.Wh0W.% =t[VWhWVWEdEuVW$h@. uWn[uX%=uhh0W"h(W%=t[VWNhWIVWEEuVWW$h. uWZuY%=uhh(WuWEPWR@e[^_US]SNU R9Yu:ɋu yɋuP[@[0u1]UWVSQQEɋ] u[B[huTXZUu 򈓤huXy u ¦1ƂEu ¦Ƃhu[YRPjpu%PjxuqUuJEuBUu VhuE uhPxÐZY@hu]@^_jhuKM u [B[ [Eɋu Eɋu ¦tɋMu ­1ƂEu ¦1ƂUu  BBhujhuľhuA Whu苿E$ɋuBuEɋuBy xɋMuB% VhuE u 1.ƃ3u+Uu j`u薿Y[RPhuWhu荾VhuM(u[ B[ Eu \ B\ B\UuBEɋu ¦&Eɋu ¦tCɋMu ­1ƂEu ¦ƂUɋuBɋMuBhunXEZtWSP߹HMUpJWSu¹PUEUMUM1UM ډUMpM u Whu荼 y'Eu ¦1Ƃuujpu調Vjxu>UuJEۋuB t@MۋuBEɋuBtGUuhR9ä^_8huY[ɋMuBEu ƂUuhRÐ_ZHhuH[^MuZBZe[^_UWVS]t hӀ.V jS^_4fFf;uy>WSZYu'PWS{$h Q.A S$Ft PS7PS^_f@f%ffwfie[^_UWVSuuP@1݀S4ЅtS4tVβ$h. CvVnh.1 UWVSuɋuB؋uB t-V-YV˳ZtuBVX $.hh.jjVVhPVk t[u S:@@C:u S;@@C;uS91C9ɋuRBR@h ɋu @U B@M VS$h.:V諽PV t PVV$$he. _XSh. VjjAV膂VWPVX uV蕐Sh@. h . 1ҋ@LRPjpVhjxV'uz1BzuBu p BA uABAÁSV&$h. `t:w t3w'@"t w Àt; t  jjAVYVǯ$h-. 1VPV uh.h jjAVjjA@P@P@P]S1pPuuEPV',jjjSV+jjjjjSV(0u 1ƃu 1ƃu 1ƃu 1ƃu 1ƃu 1ƃu ƃ`܋Hu @ @uS7C7u S:@@C:uS;1C;uS91C9u@B@G(AG(WVDqG @,jjV蹭uUBUu U1,BUVkPVn u@B@uS7C7Ɔ dž dždžuhVZÒYhVڻV(VEEPVz,[_uABAÁt$tSh. V襋V{/V@PVC }u,uPEPV- dždžV3khh.jjV般u : B:࿈B:uIBIPjAV1$hQ. u lɋuS;C;uS:C:lhVïZYPWSh.x uS;C;ȋuS:C:% PVl[NjXuS9C9hVDZYPWV蓶$ShR. uIBIhVmY_PhV__ZPhVQZYPSh`. ɋuABA؋uFBFSPh.\ u<B<Phd.3 [_u PhD. V Ɔ dž dždžuS7C7u @B@Vs]SV(SV@uS<C<hɋuABAȋuS:C:Q%hPjAV:$hS. uS<C<dɋuABAȋuS:C:Q%dPjAV輧$h@T. VmVPV PVhkC @,pEPV'uuEPVa$hU.' V足 PV趷…XYt/B( t)jjj@P@PjA@PVm uhVlYÒ_hVNXZV'PV* PV,@Ph.f BHwm$.JxjjQWjA@PV(u?zStPV&(jU.u_.PjWtPVA$hl.莿 VgPVj PVlh. ɋu:B:@t.ɋuKBK@uɋuLBLyu 1ƃjjj@P@PjA@PV:k 4CPV6$h.VXSV$h. Vۦe[^_UWVS8}W赥jjWEɋuSBSƒUЅɋuKBKÃlɋuLBLU̅ɋuQBQEȅɋuTBTEąɋuMBM`t7jjW藤 uKBKjjW!m WiPWl tuP9@9tvuJBJd.u1RW覣$hV.l uKBKjjAWtW W]HtWU$h@. jE t%W8$hЁ. jjAWtvEtWWlq}tfuW$h.蹿 u TEEĈBTu U1BU}u:1B:W^W)XZuLBLuKBKh W.SW芲uSW$h.ξ W豁1P]SW#F @,VWejhe.jjSW[=,u B`tWGWf[^}t;uW{$h.A uSEBEЈBSEtW0uW# Et#u QiBQ`Eu E%u:1B:WEYɋuMBM!ƅɋuUBUtw@tiuum1PPWEȠWǬPWȰuuSWE$h. 1ۃ X( EEzÃEujuP<@jj jWE[%ujjjWH%uEPWh.1 VW̷ #4te.P@Phe.  u @EF)@tPU@EjjuujAuWdPh.诲 jj jW$tjhe.jjEPWH1LjjjWb$tmuiEPuuEPW\@t)jjj]SW,jjjjjSW0@@@ VWYVW5YjjjW#t*u&jjjEPWVWXVWX$jjjW#t.u*jjjjjEPW(VWX$VWXLtjjjW[#.tjjjW;#}t }̠u\tSVW!XF @,XZt'jjh@PjA@PWb VWǨY[E}1ۅt8@ tXVWYjjS@PjAuWbÃ$W譓$he.s XZhW蟘Y^PSuZph@.I W,s}t EPW^_e[^_UWVS(EP]SyS蚟PS蝣ƋẼuP9@9ȋuABAUЃ}uP<@<yEPSWh@Z.腯 1xuEPShZ.i kF @@,tVShZ.hSZYuVSh[.% VSγhf. Sqǟtǀu(jjAScPjAS$h@[.ٮ u : B:࿈B:u@B@uP7@7u1EPSƃ ǃ ǃǃVSN(_Xu^ph[. Y[e[^_UVSESP] s 3CPuVjPuSV e[^UWVS,]SEEEEEEEEEE踑E$jShS藕19ȋs9sB9sF9r;}~0QuS=$S4$h. Sohe.蠩 E}jjSM` ɋuKBKEɋuSBSE؅ɋuPBPEԅɋuQBQEЅɋuTBTE̅ɋuUBUEȅɋuK1BKuS1BSuP1BPuQ1BQuT1BTuU1BUjjS ɋuWBWE܅ɋu E܃W E܃BWu EuLBLuBS_ uB hThR_SA^tS腎}2jjS u KEEBKu SEE؈BSu PEEԈBPu QEEЈBQu TEËBTu UEEȈBUjjSE u u WEE܈BWuBEPS轍e[^_USh h.jϋ]jSXuPP?@P?uPQ@QuPT@TuPU@Ut6uPT1@TuPU1@UuPS@SuPL@L탻uPK|@K|uP@]UWVS}CPCPCPCPWh.ק h.ͧ 1Ph.F踧 XZv@Ps$s ssh .蔧 }e[^_UWVSEPP@$y@tO191|77L7y. #4PD7%PRQSh`. CE;XPrE19s?TҸ.x #4P%P4RSh`.զ CM;YPre[^_UWVSUM t9tR迉$h.; jjh( 1 t`tAǹJȉ׹ֻ1󪍾Ky JM E׍e[^_UWVS EEU EUEUM}uPJ@Jt!UuPM@Mu  }uU UBȀ#zu s Bu [^_9sЉEuM} E [^_UM E9Ust 9v9`v9v"uuu 9w u 9 w UU1SM] t"wEt‹9v…ۉt}uCC 9vЉ[UM9U tEtt}uRR9vЉUWVSSu} UEuEtBBBB 8Bu'Z:ZuB:B uJ:J uOuuutU fBf U fBf!  9EY[^_UWVSEu]EEtu11ۍEPE p 0@Pu+EtHXEGEtW _ MO OEGWM79u9u E9$EW_MۈOSVE p uą$h.芢 1ۃE thƂ.u XEt۸΂.u҂.Ph2P YC^Et۸ւ.uڂ.Ph2. XCZE@t۸ނ.u.Ph2 YC^Et۸.u.Ph2 XCZth2hn 1ҡ X/E.u #4PU r u݄$h .裡 Et]} u uYXWu u] } u upXMt$Ee;Ett EjWuu u&E}t}t u^e[^_UWVS uEEP} Ew 7GPuڈtECtECCt;Et EECt+}u uGXSWuM }u u`XjSuWuHE}t}t uXe[^_UؠUWVS]SMjjSE蓃ɋu`B`EɋE @ u`B`EH@E苃TEEP‰ƃG1uut ex.e(efy uteueBeEufBfueBeu fEEBfuaJaucBcu bEEBbExuE@uudBdu `EEB`EPS观e[^_UWVS,u1oSEPVEPuuEPVUЋE܃ f uC(@t ࿉C(`jSVÄ[ G uVIYEuVEVZV迁jjVEɋuABAt4ɋuKBKPuɋu : B:࿈B:V谌ۉXtR@PVhV蜏@ u [ uWV賌EPV$}uV蝁Xe[^_UWVS ]E ES跀EjjSɋuPK@Kx EYEuP9@9tɋuPH@H!0}uɋuPi@iɋuPg@guP:@:ȋuP;@;ujAPQVugEE ]e[^_UE pp jAu~$he.T US4ЉT4ЋMs9t T4rUE SM]UK ECKSEBCuACKfC[UEJzyPjABPBPQu UWVSu}dždž V藹Ytt+uS7C7u%u3Vh}$h`.. Ƅ@ !G(uS7C7U;UwE;Eu ;}EEEEE~~Ftvv PSl$h\.vv PSl$h\.~ ǃǃ uuuuVSvǃEjjuVS)jjuuuVS0E}t'ǃǃ ƃEt}u ǃ e[^_UWVS }WE7xPW:|EEPE p 0@PWp ƋuSJCJjjjWIt1jjjW6t~ w f F `F FFRjjjWtmE pp @PW#k$h]. jjju WF(8F XLJLJ u WLJ[^jjjWt1@>uP?H?uP91@9uPM1@Mhh WLhh"WLhh`WL$hhbWL1ۃ hVWCL vhh(WLhh*WLhh,WzL$hh.WgLhh0WWLfLJjh2WAL$jh4W1L Sh@WvMShDWjM$tuPKHKE11ۉ PWCYX?Z~É}v܃uPX@XuPY @Y uPZ @Z uP[1@[uP\@\uP] @] uP^1@^uP_1@_jjWE uBfLJjWRjWRjW"SjWS jWTp(h$WKjhVWaJ jhTWQJxtpWjW($WSjjWEe[^_UWVS(}ƇjAjW茺 EuWfD$h .,a EPuPjAWI@ @ ¸M̉f Ef "f BBB?@tBBBBBjjAjuP]Sk֋Ef!$jjjSWr,jjjjjSWẼ}51e[^_UWVS4E @&EȋU B$ujAPV[ uVEM9MEPuPjAVGÍ@ EC C M̉f!Ef!"f!E̋M fAfEtEf "f f fefE‹ŰM fQUBM̋U J?M<>Aw<wAE@ UBBDM̋E VIlj؃  ‰$VIXZSVLWVIe[^_UWVShh.jujV] =VFIlj؃  ‰$VIYXuSV)BWVtIe[^_UWVSQE PMAXu}Etu<9EtFu.9EtGu E@9Et }uEEZ[^_UE P@jjjhPjARuUWVSQ]} S<EjjS=<S1t H%CPS!LXZWVS'PSHEE ]e[^_<UVSM uɋ]up(h$S0B@(B,jQS"?ff@BfKf@(B, Eu ]e[^>USh2h.jj]S;SH%9r))]UWVS]S;jjS:Sy1t@ FuSv)Ɖ4$hTS?PS;e[^_UVSM A @u]uP,uX,M u[^NUWVS8}WEE;jjWEI:ɋu ­uHɋu ­爂u ­uWU.GƁ}$EEYuPSh`.U fp(h$W? ;uwPWeIÅXZuwPVhf.U hg.uuuEPu SWtKEă}$tBr}$tJ}$tBC)u hg.XU Xu SW9"wPhQ?/8U YXSuW] F;uAPWEX}$Zu h.T XjjW{8 uPM@MEEEth`W<PWGHEW1Dh WE<% =EEuE}~h.U9r"PVWo7$h.5T Whd.(VWGYXuVW?7$h .T h).P VWChWFjhjEPu SWE^,u UЉU}$u@PhD.S XZEЉE@PEPEPu$u uuuuu WEă,}guuuuu uWEă}$r}$t2}$UB)u hQ.S Xu uW hn.R U@uPWv;eu PMEÜPMhTW:Y[HPhTW4; @PhQ?/oR XZ}tsE%=udjhjuu SWtGh.1R h`W_:Ee u PMEÜPMEE;EtVPuW@U%=tUԃ}$u h2Q [%=u?uWAEPW 6Eče[^_UWVS hWh.jjEuE5EEU(E,%=OU9r'PSRD4$h. Q uhd.SuDƅXZu Su 4$h.P hlg.Su@E,huCuhuEPu Vu ,u}E}$tnr}$t(}$tSaF)u h.VP Yu Vu5 u0SuWuEU,E%=uU(Wh. P XZ}}~ hЄ.L %=}$t}$u&hTu7[^+EPhTu[8 Ee[^_UWVSQEE]} uhh.jjS3E%=uL%=uVh S7 WS=?VhS7}e%=uuh S7 WS>uhS7uS>VhSq7uEEE "]e[^_J7e[^_UWVShh.jj}Wu2E%=tuWY>VhW6E%=uSWf6Z;E Yu uSW6 u W e[^_UUWVS$uEE$2jjuEh1jjuhuURu uU10} EEt}B} uGE}uEE@"}?~EE U@UE}tu;}spUЋu;usSE PuEPu@t,uuuuu Put uuCXZF;urGE;}ru]oUXtfv uuuEPu Su9tjjjSVQ,jjjjjSVܥE9}vE9}vVi Yu" Vhɶj`PLEe[^_UWVSuj@@VhYXuVh@.H j@S-S,jjS3,uL BL ɋuLBL t%Shɶj`PZKSP-Voɋu W BW BWuPK@Ku ;22B;S,VKXZ}e[^_:UWVSuj@V;YXuVh.G XZj@Ɗ‹@;|v@ ;s1҃@9t RSXZ@+DŽShhxPJVy}e[^_gUVS] xut e[^SVXZ] ue[^>UWVS(u >uK+Zu u_+1XVuUf@fPh4R/u uX+YF(V tF(B, Vu%>EB, GV BXG "=jVur-^DV CBX CVuxJKXZAS A A ƒwhބ.8Cw5$ܛ.h.!h.h/.hA. hM.hd.VE _{u F @,CEN( 9jjABPBPBPEPEPuuEPu-Ẽ,^@Vu,FPjj Vu9ZYPSVuD*GẼ 8w@<wGGGG GGV B$9B(ujuuЍEPugUЋEf tOF(%{@F(GVu'*N(Vus8UtF( t/hVG u2'$h.C _XVu;Y[e[^_UWVSu A$}QtF X$yuzt+VWTH@Ph.C VWF @,Jt Rhg.!@ RVW* yxQ%ÅyF X(e[^_UWVS, .ЍCe)čT$)čL$)ăt$M؃1ωىuԉUEEuPuAt @uA@Ev@U˿t9s9r1҉twˉ)QЈEЉЈ]EUMu+șM̈EE0ME@.E1u ƀjhu*1ۃ EPSEPu} wmub.9w*EȋU؃<uIMԃ<u@uf|@E+U`.9w%Mȋu؃<uEf< EЃ} vURSu^G C9SuȋMt5ujjVU u hu.= Nju܋MEu ƀee[^_UWVSE X.Ћu}sOC%9uBuYu C %0fCfX.s C%9tE 1;7e[^_UWVSSS] 119E@.Es0EPVEPuRU9v9ډv)ljF9rЍe)[^_UVSQE @.ЉEE]u$.fFf%PS^%U XUZNt UN11ҋutBA~uMu􋃜un h b.; e[^UWVSV}EE@9Uu EpYu 9~MA~Lu ؋u  9u IEBE[[^_US`S4ЅtSXu]UWVSPP}tE 9rhn 1= Xuuhh.= }Euh0L2= 1;u shELU!D9u!E!9tU}4h.th.F;u r)Ph^ 1_= UD E ;u s }u}thO/h0L2*= ÅXte[^_UWVS}W!ZEuWE!XW"!jjWEh W'  PhW$[^PW$h@.< }t h.< YW1Zt h.r< XEuBBj2URPjh؅.jj0ukBkj2MQPjkh.jjuIBIj2]SPjIhą.jjuPW@Wj2URPj hʅ.jjuBj2MQPjh.jj\u B j2]SPj hՅ.jj'uP6@6j2URPh6h.jju?B?j2MQPj?h.jjuABAj2]SPjAh.jjuBBBj2URPjBh.jjPuFBFj2MQPjFh.jjuP<@uSBSj2URPjSh.jj uNBNj2MQPjNh .jjuWBWj2]SPjWh.jjuPBPj2URPjPh.jjjuQBQj2MQPjQh.jj5uRBRj2]SPjRh.jjuTBTj2URPjTh.jjuUBUj2MQPjUh.jjuVBVj2]SPjVh.jjahn 1a5 jZW[^Pj\WZYPj^Ws[^PhTWbZYPPh.5 jjjhjjjWE8W$h.ЉE4 EY^EE=hWP'^ZP@Phˆ.4 E@PW$j+ hWZYPhW[^PhWZYPhW[^PhWZYPhW[^Phև.* 0h.* EY1;Xsuۋ\u ȅۋE܋Xu  ȋUfV\PPhQ?/Y* ]X;XZrXIMxn\u]܁X M܊H]܃\Ku DX]fDXɉMyh.) W.EPW1}uWXe[^_UWVSQ]S jjSE S1VSlVh.c) hSYZPhSzYZPhS@YZPhS2YZPhSYZPhSYZPh.F) ,~hn 1( WSEPSW e[^_USMA(Y$t@u/At ABAI(][[UWVSuj@EV #4u.RV| $h.B( V%V/u!VQ $h@.( V jjV u<B SV +K(@@@@PVC)t'u —@*@1Hu ’jjjhujAuV SVuV_SV*h}.P% hS($-t#StCBCc(uV [EEe[^__UWVSu Vu])F(t}.n 1Ph}.$ F P1N(t!C(t tQC @9¿s73Et1C(t t C @G9s‹[ uޅt RV'[^Vu(h.3$ 1e[^_UWVSQQh%h.jjuV]} E-E؃9ÉEu u aƀaVEZtV$h .# Y[h}tEOu u hV_ fXZC;]2Ee[^_UWVSSSh+%h.jujV} ]u ƀu AƀAVYE9EEsjPhV  u u QƀQVfEZuC;]ru 1ƀu AƀAV[uEe[^_UVSu jThRXu tKu1u<e[^U1S]B-|t%8K-u1ɺ.B;|t8K;t1[U1S1ҋ]SB|tf9K>t1[UUUVSh%h.jj]u Sv h@.d u¹SZu ¸E ES$Xu¹SJ$Xu¹S$Xu ¹1ƂS#1e[^UVSh%h.jj]u Sv h.% u¹SZYuNu ¸Eu ¹1ƂS&#1e[^UVSh%h.jjuV jThRXu xKu1u<e[^UWVSEu1jEPjEPjhu SS$ t!PuuR$h`b. jEPu uEPSS,t!Puu$hb. EFVjju ju SStPuu$hb. Ijju u6SS u @ F1APuu$h c.V 6SSXZu uSS0 uEPSS( e[^_UWVSEE 01V19} |$@9|VSSWE pSS0vF PSS( VSSe[^_UEdUEU MUE E UU ыEpEUWVS} ]9u E9t?uuWS uWS Ee[^_USQQ]uEPEPPSKuuS]UUS]t uSXS ]USPPEPEPE P]SuuS]UEuP@US]uBSZt]US]t.t%@tSVYSS ɋuBBuɋuBjjS]UE U@PE}Et BɍBUM A)ATt BB A @$BB Ɖ$W2M QH)‰$A<0SS e[^_UEz M tuhqLA<0RR UE U+UU @$Mt"U MUU @$tU} BUuEUkUUVu VS]u  Šȉu %[ ^UU WVS}MZu2ˆ 0uӉȍ2  0[^_UWVE SUE Hu ЍE UE xu э؉U 󋌂E pu %ȉU كu %[^ _UWVE SUE MXu Ѝ2E 0UE puӉȍ: :UE Xuȍ:ȁ:UuӉȍ2  0[^_UWVS E U} Ou U E UE xu э؉U 󋌂E pu %ȉU كE xu % ȉƉÉUM IEMu‰1 ׉M%}8Љщ1 ЉE ϋE܉}UM IMuU܍1]u E܊Љ1ҋ]u ΋EUM IMuU؍:1ى ׉ME؊8Љщ1 ЉE ϋEԉ}UuUԍ1]u EԊЉ1ҋ]u ΃ [^_UWVS(E UE ]uHu Ѝ:E 8UEE xuM؁UUEE @Eu%M؁}9EUEE xuEMMUUEE @Eu%Mʉ}9EUE @EuE܍ 8 M9E؋}EԋE xuE؋MMUԈUu %([^_UVSh*h.jϋujVۋu ȋu e[ ^UVSh*h.jϋujV] u u e[^UEuPff@UUE uffBUEuP@UUE uBUVShA*h.jujVjVSjV|e[^UShJ*h.j]jSu jSJ]UShQ*h.j]jSuP@]UShX*h.j]jSxu PE U P]UVSh_*h.jujV6ۋuP@ȋuP@e[ ^UVShf*h.jujV] uPXu PXe[^UU VS]u  Štu[^UWVS] S}WCSWe [^_UWVS] S}WSWe [^_UVSSS] SuVSVEE‹]M1e Ӊ [^UU 1SMwt j SQA ؋]UWVS]E䋋Mx(}U 2MEH(:(x,J4}:EB4O[^_UVSu ]VS{fHщ%=u Rh.; f@fSf~Pt VSDVSXZVSjVSFE ]e[^UE @DUE @LUUx tu hjPP UUVS]1z tjjPRR fDf;ue[^UVS]u1fxS|Yu'uP@1tquP@ t,SZt(uP@t S XS9XyS9t SX"t VS:YXt VSGXZe[^Uhu utUEuP@@@UVShh.jj]uCރuU   Rue[6^ÐUVShSuVSh5/ j@ÃffF6tfF8vPFLDT4fF:FDXT4jVڪXZt jjAV jhhN#ЍF0PVS蚣e[^UUWVSU EEUJ MЋR t@BMAEhP'Ex$YtJ@ tMz tPMA,pjPRR UM싂q,PPXZE@( UMA @uP,tu@, Euet!C @uUB pR ^_[ uuu MA @u@,Pu$h. UB,$x.ЋMAXtt."t(u$RUB,kM1A(UB,UMA,IE@,=UB,1MA,%E@@,UB, MA,EP,MA(Mt;}Љك4uu}ىƃ4UB,Y[ MqDV^B B Ë}B Ã4EE 9]v]Ft(NVA A A t2  }M4UB,j@菠uurS蓠MIMe[^_!FUEx<~@<EqUWVS UB x @EMuB,JREj@ÍEPuujAWMQ Bu@t B EPWƅXZu!S负E@,nS蝟UV VhhPCE ECMA @CA tCN(KCjjVCVuWAe[^_UWVS4}G E@,@XŰB }p tgWVpX]W@Y1PM q1RWVE KuۋE@ z D@tPG,pjPR j@|EċUBXt&}tw,PY[WV>EPBPBPjAVEȋJE"tJ@E$tH MAtO(xt`E t O(@HG t G BGE@u%U̡&4BљPẼhPڿXZG(G(tF@V@PV uPH@HVWV[XE@uq@ @EMHXuHWVjjASuP]S;f WSVsfjuuSVD]EƄH u詜1AUrV=ZYM̋At u h|}.  [W.Ytuie[^_UVS] Kut1hThRЃXuP@uKuuV$h}. V1e[^UWVS U UMEEME@X@(@,MA<Bv>UB @,j@芛uumS莛MIQ(AȋEpx$t|UUBƒtЀЀPjEp$p Ur,EQ tUB,JR@7MA,P UE MEEE Ee[^_e[^_USPEP] s 3CPu:}EfSt f $ f!$]U1UU1UVS]1t u P#XZhu4诛S觀e[^UWVS<] C @ pEj@EC @ XEPVWjAu|jjAjVWEEP1cE܋MUf#f "0UtEf!$Eft Ef $1jE̍EPjuYUB9EvEjju̍EPu\tEEMAEAEUB}EuEUЋEf"t f$uejEPEPuKXju̍EPujuX(}uEE}tMA <vAAjjuuučEPuYuwe[^_UWVSEEEUEE EU&41҉E؉U䙋EU܋}e}܉ÉыEEjh4VS>UEUBuuuR5 EUE Ue[^_5UWVSEEE E1ҡ&4ЉEU왋EU}e}ÉыEEjh4VSX>UEUB @u6@|uRhЃhP蟹 EE UB hEe[^_陹e[^_UEuP@UWVS]u j@NjZuF( t =$4u F hP谹Y}e[^_UE @ @ E@UEh@.UUM SA( Uu* A(tC hP)[ Yu]UWVS0u] uS1ChT4t h.YuS1C1ɅuSKA~uS1C1AuSC9tthT4 t Qh .&XZ1p1}!S}u l hT4 tEPh .Y_hT4 tuSCPh,.XZe[^_UhT4S]t h>.Xƃ>ǃ`ǃdǃhǃlpSf`fCV[pClT4CdT4fCZjhhN#ЍCPPS ]UVSu^@ۋNDuQ1AuQ1AuQ2A2uQAuQ1Au1uQ1AuQ1AuQ A uQ1AuQ A uQ1AuQAۊ`u QAuQA[^UVSEp@XDuhThRЅXu1j2ThRЍe[^UWVSPPuF@EFDVEVV >`1dždždždž1CC BC0v֍L81eƆ>t C$@,C$hP+SV/ t*C$@,C$hPSV uƆ=L@@@@JyƆ>}u UE@e[^_UWVS] uj@蔑C(NjCZSt P {K uQeX}e[^_UUWVSSj@u} *EYu8u,jjhJ.jPu tԅt!SҋC tB S CK(uҐe[^_UWVSSSu^ hT4{ t hQ./YhT4tCPvFPh`. FPWEÅXZuF,s$FC,Sh!)ЍFhP聲 F tK(C C!vSvFC F CF$C Cj@ݏECC C>XuWXu跏X1Et4s,VWi tSs,VWRtSq^e[^_UShT4]t hp.X{<~C<]]`UWVSPuF@EhT4]~Dt h~.Xt6}uWG tVXE @t1hThRKXuʸe[^_UWVS}E w@@$@ XOD`u Q  ؈AuQAuQ`A`uQAuXXƇ>[^_UWVSPu`"@ЍBt+RFPh@.h.hT4@`1 ŠM Bۍzt-C$P ffEf9Bu ff9Bt [uu<PPFPh.h.hT4@h.SҋC tB S CɸƆ>kf 2`{(y1AF@VDu<u BA5C(@t/AF@VDu<u BA C,C04C 81eAF@VDu<u BA/AF@VDu<u BA e[^_UWVSQ}G@EwDuV F C$P Bk8`JhT4uCtQBPh.L SҋC tB S CSWjtQBPh.  [whT4t h̲.Z}uV F }uV F }ue[^_UWVS ] C$EP UBku0LhT4Et hӲ.lY1UBCC C E4K(CC E@C(tJUf!B;u] ue[^_SVC_ZSt P K >uue[^_e[^_UWVSPPu ^$C E@k}8LhT4Et h.eX{,uDF(@t C,4t C,'~FuC(FCXu }e[^_rC(KhT4t5C(t Ph.YXC,u C4Ph.PhI2XZF(tUJUf!B;uLJƇ>WY VW#XZsVW?E ]e[^_.UM SA(]QtҋA uҋA tB Q A[UWVSP]C@EhT4sDt h . X=u\)؍?T1\}uV F  t (t6?AC@SDu<u BA?~L}uVFA?C@SDu<u BA\A\}uVFGuT<t<uT% tx~(TuU9uZ}uVF}uV(F(}uVF}uV F }uVFuzhT4tTPWh.; >uhCPh.z$G @kLT $.Ћ0BG(ƃ>ACC@SDu<u BAhT4tCPh).fY_CuAC@SDu<u BA AAƃ>2,B0BB,B04B 8CPh@.hA. CPh.XZhT4@AC@SDu<u BATxCPh.Qh.G PSfY_RCPh.&XZhT4@t h.AC@SDu<u BA}uV(F(}uVF}uV F }uVFuhT4tTPWh.{ e[^_UWVSWW]C@EhT4{Dt hQ.I^}uWG}uW(G(=uQEP9u4hT4t h^.YBA}uWG )ڍƃBƃCA!ˆ!BD҈ABwu$.ЋuhCPh.ih@$@ @Ep?ƃE `ƃEWƃE NƃEE?ƃE5CPh . XhT4@Zth.W @ƃEFP}uW G  t tA}tG @uAu}uW @G @v}PuuAPWAAPAGDu숃C}uWGu}KAT}uW G e[^_UWVSEP@UhT4xDEEt1uW G }uWGQPho. }uW G }uWG}uWG}uW.W+G.}#}u WEWUE(t }~?Em耋E }Wu @fo@u ff] hT4]t Shz.^X]E~0}Wu u fou ff؃E ~W}uWGȋE }WEu u n u U}U G}}uM}uWG}uWG t}uW1GhT4tAh.Y4}u WEWUE ut߃}uW G tE tg}uWG}uW G ~=)M}uW G }uW"G"hT4t Qh|.0XZ}uW/G/}uW G }uW1GEe[^_UWVSEP@UhT4XDu Et1uS C }uSCQPho. }uSC}uSC}uSC}uS.C.}G}u SESUE0tt>Em耍}S}u @fm@ffu}uSCU9‰UvE}hT4}t Whk.XZE)EE~5}Su fmMffEUƉU؃}~N}uSC}؍<7}S}u Ml M}uuSCE u[}}uK}uSC}uSC t}uS1ChT4t h.X}uS/C/}uS C }uS1CEe[^_UWVS }G@EWDUu1MAhT4t h.1X}u U E UR UhT4tEPh.^XE tGPh.Y[>GPh.X}Zu U MA =O@WDAu-?uɊ<u BA$uɊ<u BA>H}u U UZ hT4tPhԳ. Y^y0GPh`.X}ZuU1_MASè hT4t h.X>ubhT4t h.Xu hLJJBt H Z }u UUB@Ƈ>@hT4t h.X>tGPh.uhGPh.#C$H AƇAk{(8Ly ƇA C(@tƇA0K(If BC,C04C 8C$@u"&4C,љPC$hP ^XƇ>}hT4t h.[>t GPh.h*3 1u h}u U1E@}uUM}u U E@ hThRЋC$@,Y>GPh.T>Ph5.BhT4@}u UB2UB2}u U1MA}uUM}u U `E@ `}u U UB }u U1MA}u U/E@/Ƈ?Ƈ=LE*}u U UB >t#tru h93?u6GPh?.h[. hT4@6VW.XZ`@$@,+u hk,B0BBJt H Z LJhvd}u U MA E}u UUB<}u UMA<=@+=p =t=t(><WƇ=L><W4Ƈ=)>hT4t,u hPƋ@ HPPhr. 84W4)8Ƈ=>hT4t0h.^X0,W,)0Ƈ=M>hT4t0h.yY[0,Wx,)0Ƈ=@ >u~u hM}u UB(E@(}u UUBA}u UB E@ hT4tAPh.XZƇ=GPh.[^hT4@t h.VW>F$hPVW Ƈ>WY}u UUBe[^_UVSu ]F,N(@;u>>AC@SDu<u BA PVSyFZYVt P N >u]e[^e[^UWVS]C$@ p Phu1xj@q C(@t h.\[hn 1OC$@,SV }e[^_qUVS]C$p fC$@ ^u61;s }&t h2YPhl)/FX;s Z|En 1E.Ѝe[^US]s(s$Sh.CPssh@.] ]_UVSlT4Ћ0hд.uXtS[Xuhݴ.RXtPzXh.6XtS^[Xue[^UWVS Ep@XDuSCuSCuSCEuWQuPh`.uSCEuSCEuS C uS C uS C uuWQPh.GuSCuSCQPh. uSCuSCuSCWQPh.uSCuSCQPh@.e[^_UVS]=Ph.TP>Ph .gDPCPBPAPh.=1,TPLVh.bP\h.F ~e[^ÐUWVSVuEuF0u P@1=@R  @RF0uP@u*@RЍB @Rj ThR[뽋x tjjPP }u*F0 @RuP@!ǃ 7UzuIj2ThRЃYF0uP@x tjjPP UB;itz tjht)PRR U<B@B,,F0uP@!Nj,uCSV XZ8PFPh`. E@ F0uP@!ǃ=@R -e[^1_UWVS(EhEf@f9v‹MitBǁEjPjuVjhSRR$ tPEPh.EjPSuVRR,tPEPh.dMPjjjSSRRtPEPh .1ujjSPP tPPh`.EuA ‰A CdžV uPhW. XU9tPSPhr.Muh3jhu4WkuEPVE1ۃx t C| t~DE1ۀx tDD+EC| t~E1Ҁx tDDBEC| t~D+1ۃ=U4t*EԉE̋ű<U4Ѓt <U4u܍EPE4U4ЃPh.} tEu Ph. UЊB!M@PPh.1ۃE)@PhW3uXF!C9Z~hn 1zjhjjutEPh.h NThRЋE@4<@8B8_1ۃHE)@U_ffGMЊA"@G$A!f@fGЃ4GT4ЉGW ffG jhhN#WR識uЊF!C`9~e[^_US]CPh».j hjjSh@KLThRЃ Eֻ.Ћ]bUWVSu] NV0uBtj2ThROYuuFPh.} u1ۃV0uZV0u ؃BV0u ؃BV0u ؃Z}uQ} u0V0u1BV0u1BV0u EEBV0u EEB1e[^_UWVSWE k] EۊE}Et6MuG0uP@!9u1jdThRK^uʃe[^_UWVSu ,1Ҩ}uFk0t8G0uP@tWX,1Ҩuj2ThRKXuȃe[^_UWVS]hEC0uP@hq ThRпXC0uP@@uhThROXuuwC0KuP@PQh .ɋC0uP@~ t)C tPU싂8pjPVV E8VV^_{,U싂<t;ttC,C,E<EPhY.TU싂@tXtt&uP{4C,6C,-E@EPhl.; C,C(U슂@CXuuKS#E t]e[^_e[^_U}UM u u0ut HA0t HAUS]tABAu ǃ[UWVSEPx UO M䋱j@uEEU^ƋE䋐9UYuPzEXEnMy  MAtV.^uF,҉Et;tV ^E@,juuu EEUruwYXu6}tV]MA,@uuuFV]1nV]upF0vC PvDCWC ЈCWK шKW ЈCC U䋂KffC$F  ˆF  ˆGOu9 ˆUB0t@0uKcM+B PffC(u~$@UB8Pjr$r VuMQ tFEPh.XZu j@h.Wh.^_uF,Su4Ex t#1ED@PvjVuUR Fu'F ffC F$ffC19S,},D ffD$AffB;N|ԋu+B , ffC ffCC C#E䋐z t%jhtM+PR u䋆x tjjP }t,,jh4Sut+EPhļ.E@,SuB1}t:Su$ZYtS-Su tSXSufe[^_UWVS]p@ p PXF0uP@F0uP@WPh .Oj@YNj,t1hؼ./XF0uP@hq ThRX[hn 1p@,,ǃ0,jh4SVbtFPhļ.诽[^}e[^_YUWVSuE jV_XuFPh.Z,,DCǃ0C ЊSSCC SʠffC$Ѓ࿈cC(ff{ C 1C,C C,z tjht+PRR x tjjPP x tjj,PP jh4SVt FPh.SViZYtFPh.ø<u @t@<FPh`.藸x tjj,PP ] ue[^_RU}UM u u0ut HA0t HAUS]tABAu ǃ[UWVS uV8EjPj}Wjhh?RR$ tPFPh`.V8FDjPh?uWRR,t PFPh.[Fe[^_UWVSU4Ѕ}] jEPjuVjhjHSS$ tPWh.jhU4jHuVSS,tPWh .oEPjjjHjjHSStPWh`.虶jH5U4SS0Vu` t#SVuDtSw[e[^_US]S!ZtP[]UWVS]ۋ}u t WFXt1hThRKYue[^_UWVS]@ p Phu1nj@K t-h=.OV@@YZuQSVXZ9hn 1"SV<@,ǃSV}e[^_YKUWVS]@ p j@&KVY[}e[^_KUWVSSSEE} p8U싚ChPm{$YtC~ t.C tPU싂pjVV EVVXZUuEPh`.h.ūG Ht tW~ uC,C(C,C8u`C fxuVC$+GvKs C @Pu,@ 0 u#uu{4C,C,uuK^_]e[^_hU}UM u Xu0Xu\t XHXXA0\t \H\\A\US]XtABAXu ǃ\[UWVS uV8EjPj}Wjhh8RR$ tPFPh`.V8FHjPh8uWRR,t PFPh.[F؃ tFPh.蔧XZtFPh.Y[džadžPdЍe[1^UWS]ǃǃǃǃXSk_{Hj?sHS4 uCPh .Ҧ\?tj?PCPh`.跦SY4`SA=Zti$tW Ht{=t^=tG =tT{= t =@t kCPh.KCPh(.@CPh@.5CPh.*CPh].CPh.CPh . CPhs.蜢CPh.إY_ffDǃDpZǃHQZЉǃU4fǃfǃjhhN#ЍPSYqe[_UEx<~@<E6UWVS]C @ j@EEE@EEX19_C u-@U`t ug@|uþY:@M`uJC҉Etu9jSufuÃ{tWuWƅXZu4}tu?C,jSuu?gu?CWVSt~j@?uVuEuE?}t}t C,CCu1>Su t#VSujtVXe[^_UWVSPPEp V UJ8] M1󫋃C4UB< C wMQRCPEp_UB ~ PC0PBP; FCFCCPEPh.uC,GPEPh&.sC,)GPGPPEPh.蕛C,uu>KXZ]e[^_USE Ѓ]tJtMt]€t-ACE EB.)CPh@.)XZ]]CE E.Ћ]PCPh. ]U}UM u Xu0Xu\t XHXXA0\t \H\\A\US]XtABAXu ǃ\[UWVS EU] UE.tEE t #E NuE@w}t= N}uuj2ThRNXuuWuh`.c}t"}uSC}uuM}ttut#}utj2ThRN_uu}uh.BY^UUr}UJu SMMCuFuM}tout#}uuj2ThRNZuu"}uuh.˜ M A}E uSCM}u}tG}tA N}uSCuj2ThRNXuuWuh .L$}u  1}u@@e[^_UVS]ǃDiwǃHJwЉE f@fDǃV4fǃǃǃǃXj@2Sf gP`PCPh.iStue[^2V2jhhN#ЍPSce[^UWVSP}_0ۋO4uQq1yPu  t#jjEPjWQSEEW tWXe[^_UWVS] uj@1XǃdPPtTPTuQIX}e[^_1UWVSPMip1} u;ME} lF8RV@Rjhj!hPPtPFPh`.ɕ 1F<+VHP \ DPX|P1LJdtPFPh`.~ ?LJPT8PEEp9E6Ee[^_UWVSj@u}0Zt PҋTtT*"E u1jjh.jP.E봋TPdW*0e[^_UM UDPt9\t XuUVS] uSh,{Ћ`hPRǃPTP ue[^nUVS]CH~DS8z tj C~ t)C tPU싂lpjPVV ElVVXZUduEPh`.̑h.x{,UBt u C,sPEPh.LUBtSЃtt#u({4C,1C,(PEPh.= C,C(uurKS1EX t]e[^_e[^_UWVS }] u1ujdThRЅXu<0tNu1Ʌ|uSC1ehThRЍEPjURjjSWEE 1Ʌ0EЃEt"At 1ɃMPh.huThRЍEPjURjjSWE EЃ t t5Jt%@t€t1  Ph.aEЃt1 tt? t,t1@t%* 5 . ' Ph@.91"}tUJE׃Br e[^_UPjjEPUjEERr4r01UWVSE@0pUR4ulg+.й(Щu)jjEPjulpEE6EPjURjulpE 1 1ۃ1D+tFA~C~MyLtAEPjURjQlpE#11D+tFA~C~U ~ uƋMyLt"URQEPjulpME LUЃ3.u0.ЃQ4u:.PEPh@.M1ۃ,D+kD+C~EPLt1ۊD+kD+C~Mg2~81ɅEP QURjulpEE1ۊD+y3€u t"D+k PPESPh.芌C~ExLtF1ۊD+̄y6€u t%D+k PPCPEPh.;C~MQ8|jPjtWjhh 0RR$ tPEPh`.EP8jHPh 0|WRR,tPEPh.mUB8`@,dǃhSV }e[^_|UWVS}W8GHz tj GG~j$hjjj VuPh.BfBfBfB fƆjThj(jj VejPRBfBB BBBBBB  BjP R蛄j$P0P胄B@4BA5BB6BC7BD8BH<BL@BPDBQEBRFBSGjhjjj Vt0HBIBJBKƆjjjjjVuPh.fdžLjjjj jVht%jjjj jVQtffLfdžNjjjj j V#t%jjjj j V tffNdž,M19ωMjjWjj Vƃt,uEPEPEPQ[$։E؉UԉEU1u1҉EuԉEE舃E숃EEE쉃jjWj j VtffG;}} ",ufF>xљfF>f} #4t2PEPPh.{Pft30.PPft30.P^Sh@.c{0NPLPSh.E{jhhN#ЍF4PV`V4G jjk`P$ Éu#h!.wPFPh.zk`1191ۋt D1E ?ZY[^_U}UM u $u0$u(t $H$$A0(t (H((A(US]$1t&tABA$u ǃ([UWVS]S B Er"EC,wkMtfztzC,KSĹ:jSu C,u%uG'PEPh,.\xC,Ej@E܋E;$YjSPe C,S = UruCuuUdZDC5w'$.Sw_=%C,C, Mfǁ2K95{u;QUAP U@ EeAEt@E8AEQB EB EB EQA ‰UkM9Us EE9v1RuEuPh.vC,KS5su% Y^EGUW _CGG& O(C85OMECPjs$s QMR tPEPhF.ǃBEƃ>ƃ>UB<tu<5tqGBG FNOtCǃJ1;q}ڋD RD$VF;q|IMDŽVA JEEf4Nf0tH209~)CPhc.sWSUB, dV41,WSPWS\E@,@( dV4иe[^_USMA$] UuEw.[ls9vЉEA E ][hyUWVSUB Rp X% $t.1}Ej EpEEEE1}:kt1Ekt1jh.ЈEEPEEE 葻Ph.jEPAsjh/L2ЍEPm(uj:VQ1d Bƅqƅd#ƅgkt1fkƅmƅnƅoƅpQ1Q 1rstAdj,WuPFPh.qE@,Dž\Dž`kJ\]^_ƅ`ƅaƅbƅcj\Pu Ph@.pUB,1]C,e[^_UE@,ɸUU1U} u1Et 1UWVS = UuEEt = Uu 5j@ EXVTE[u"= Uu u Yfdž1EPVUEfEXEf]䉞M艎X= UZtE5UУUЊEЅJuQSFPh.ok,\0d= U{u GhP-XfC&fEC(EtPG<tG<5tCz t(G tPCpjPR sPPYXSVX}Zt}u EWEPURV2E܃= Uu uI X}t}tOWׯX jWV }tVXe[^_UtUWVSQu} ]E UVZt;5UuG';Uu E jThRKXu U jThRYVdZuEe[^_UWVSQE ]EEfE61jSIDžXZuCPh.m1"EG&G(G(S`XG':Ef>ǃ6EtK umf}u*EBEFEf@JhRRpUsC CCC9SDžDžDž/WUuz u'jdThR[uDž2.Uu@@Dž/WUuzu6jdThRYuDž.Dž .DžU@t QҋAtB UQAu DžK.hAqA AAFfRfFf@@jjQ PfrfufMuDžZ. tDžm.t Dž.n@t Dž.Zt Dž.F@uQEɋu B Eɋuz@ty U@t QҋAtB UQAt`AqA AAFfRfFf@@jjQ  t.h`.Ph.hK.cuPWh.cDžDž }|"U@tSҋCtB USCۉbCsC CCFfRfFffBBj@ijjS t"VgEPh.baVELJLJB= Z~LJ?LJLJ LJ@u DžE@T@P|V4f@:@HV4иUfB>fB<jhhN#Ѓ4PR-uh̝1e[^_UVS]sVh2ЍPShD5t Vh .a:u  u@@e[^UWVSj@]^j@YtKQҋAtBQAQS^ZtPCPh.a uuBf@QҋAqtBQAAAAA uBuBfxk&tuWǃjjh.j SUUWVSE U]EUC 3C$jPj>K,MQjhsR$ uCC jPsuR,tOuP( CCCC ss s$e C${(}CE@S ujsRWP tu j>h.Ph.^Uf =R|#=S~ -bwU U 1҅t?}G Mf1|};G}}D D$BA;O|狆x tjUrjRP z tjpjPR uSYXtyuPX{$Zt1ss P0C,PR(CCCC1}t]e[^_e[^_UWVSPuF} Eu0FFF0FShvuBfyj OThRЃXuGNF uBFFF01UBPCPh.a\e[^_UWVSE0@g5tkxdOuP@@uP @ %i 0SҋCtBSCCSVNZYu1;]t9uP@@zj OThRЃXFe[^_UWVSu ~F~t @PEPh.=[J^(tKG<<5Ez t}G tPsjSER S=St. =RtQ=bt =ctAUx t"jUx tjsjSPP USPPXZF$t9vPv }`Uvv PP0EF,PRR($j@ËXFFF0FtG(OW^S`1e[^_UEx<~@<EUSMA$] UuE`.[Y9vЉEA E ][_UWVSEP B<r [wktfztUB,E@,P5g$.1}j EEpEEEE1}:[kt1E[kt1jh4.ЈEEPEEE 胡[Ph.jEP/Yjh.ЍEP[(]j:1d B[ƅqƅd#ƅgkt1[k4fƅmƅnƅoƅprstduj,SPFPh.WE@,[Dž\Dž`kJ\]^_ƅ`ƅaƅbƅcj\Pu: ?j@KLDžPUJ<5Kzu0APY @ ÊAtOJQYB B yB A ǀK*uAt DžP[k9s9vRWSFPh.VUB,R|(DžTbt/t( DžTc DžTc*t DžT@t!QҋAtBQAɉu E@,P襖LUQB A B$AAA[[PTfPPXfxUBÃuSPQ t5LuE@[t@,8UB,R!L@1YE@,e[^_UWVSuDžuZ@u B %i 0Y@ۋQtSQAAAAuZ@Kt#utV_uh .CSYj@Z@t|QҋAtBQAɉt[AAY AA@fR@f@fCCjjQ Tf{iWXe[^_ÐUWVSudždžV8jPjSjhhRR$ t PFPh.-V8jPhSRR,tPFPh.QF.2CMuPh\.Eǀ ǀ$ǀ(ǀ,Ejhq.<P͋UP Tu ǂTMX΋Eu 9suTDMu P @ EɋuP$@$ɋMuP @ thNThRЃ_uEۋuP @ thx.A-E}X۹u 9s}DTM/uu Ph.0EXuT D uhNThRЃ[uNjEXuT D uEh@.U0T~ ǂMǁ~9|UME䋁UjRjSjhuPP$ t Ph.MȋjPuuSRR,t Ph.E1MMPjjujuRRt Ph.?UjSPP(&MjjuPP tPh.?UjSXEǀEMǁǁ 1}EECBTC CEKTAAEE߈AfE߃$fAQ(A00A,MC PjjWWRRu4MCEF)E@M;}=RVh.>> u*UjRPP(MmUMjQj]SjhhPP$ t Ph .Ej PhuSRR,t Ph`.oM U SRZYt'h.u=MʋjRPP({)x!h.C)Ph.>=MvMC,C5C PCPC P;u #42PPh.<ut>EPh.<EjPRR(UPPnu]hRЁÔS6k&4PSCMfA:ffA6fA8ADW4ЉIPALV4ЉjhhN#Ѓ0PQ1e[^_US]SÔX]]VUUWVSEXTEUr EBt$h .PMqCPh@.; EPu jMqRVP Et.u h.uh.W;Y[ugFUBME;N~ }1M1҉AQGA AEE;F|؋x tjvjVP UBMfAfA}$1 󫋓z tjpjPR Eu&\u 4 B4 ȉB4uF0FF u@B@}?UBE`t@EE֙EEiPUJEZuEkEdHU&4ЉE@UEuHMAjuh.jQ#u~tE+&4ЅEoz}Yj ThRЋ\Xu0B0t<uDBDt$GXWn;}EXt M}=UztfB& RCEXe}u*\u 4! B4!ȉB4E܍e[^_UWVSPP]s{ECth .PSFPh`.a8j@ECXCtBSCXt SEY{tVz t(G tPC pjPR s PCCXZSXtG(OWx^uEe[^_UEWVS$wHXt ^ tPWG PG Pw EpXAPh.=7{41C4C6C@$C,eC,\tXЃtt$C,C4j PGP< &C,PVAPh.6C,GC(E`Xe[^_UWVSui@fU PƍPTxl1B BB BfBB&BBB fjjV=e[^_UWVS U EMffR4EpUEPTE@ @@ @f@}1һЃlEP @ˆP!jjuuMq qh(.m51e[^_U1UWVSSSuF @ ~ X`~+~41F4F6F@ F,V8vj@nEF,SEUËF$BF BrTFCC FZYtC tC`N~ ȉיfC1{j CPv:FPjutF,VuuuFe[^_UWVSQQuF ~ X x~+~41F4F6F@ F,Vuj@OEF,SEUËF$BF BrƒT @C CFCC F_ZtC tC`N~ ȉיfC1{j CPvj9FPjuLtF,VLtuuFe[^_UWVS]1\uP0@0u1ij@1X6xPXu@PP_uPDPDuVe[^_UMSX`uT<D<9u h4..`k&4PP]US]jjCPjSQj@OP`UÐUS]L@t$Q$ҋA(tB(LQ(A$A,[UE@,@ @@$LP(L$LUUE u B UEuP @ UUE u,B,UEuP,@,UWVSPPu ju]jSjS}WWtPuh.0jEPjujhSWW$ t$NP #4t2Puh._0jEPSuuWW,t!NP #4t2Puh!.#0CjjSuE 0WW u1}E3Puh ./ SuWW0 juWW( E 0WW1e[^_UWVS}7] uSuSVuSS0juSS( 7SSe[^_UWVSQu1;}}bƁƁU U;= vƁƁ?Ɓ@Ɓ C;|Z[^_UWVS h9.jhEPURuE܃}hz1jhhPdP`hC.jhxPtP‰p5PTX\HL`?~9džPdžXdžH U)Ct~G8PjjhjhRR+7_G,ChGEG CxGG$LG(L8G$LhmÀ`<9EVh|ЍPVj@UUfVE$XCCM؉KjjP $UaP9PPV-VXCCM؉KjjPo uzdž(jPE܃Ps2ƆjPE܃PW2ƆUByBzBxEJ.Ѓ VXCCM؉KjjP tDVXCCNjE؉CjjW tu hR.+ džUBЃDPЃdždž?~dž(~ dž~t љffF>uh9.jhEPURuC <y<o@~dZ_VMPPPhg.jP*PPPhg.jP*0ffF:fFGt7E䟆Gtj ThRM}YtGuG#uS_EZusE@,@$TUB(TЃ$T} u`t\FEFEPiU-$FhPR[^#} utMA,FhjP/1Ue[^_UWVS ]C3{EUj@脷EXC,tIUBu C,jSPY^C,jGhPUBPFPh.G <tL<5tHz t(G tPC8pjPR s8PXZS$ҋC(tB(TS(C$SG,OWK\[^UBPh.EEe[^_|UWVSPPU kY f}@t2PPPPh`/jS誐fE3fGfEfFfEjEPSX f}@tFPGPh/jSafE1fGfEfFfEjEPSX f}@jSjZ<Yt< t< u jS^_j<u䋃fjVSfESfE@fEfUfEfEfE X f}@JfEffERfEfEffEfEfEfEhjVSfEfE@fEfUfEW f}@fEffEfEfEffEfEjVSKW f}@EffffEJfEjB<wfEB<wfMfuft+jEPSV f}@uPh*.jSne[^_UWVSu }iXfE0VE f jEPWfUhV f}@u FPh/jWEEEED 5f\frtE U fE8fEf]ufEMTfD fEfERPEPuu h /jWB jEPWU f}@t;jE UR EWfE8fEfEfEWU f}@ucMf\1;l}NE U fE9fEfFfEUD fEjEPWT f}@u C;l|EE E}EF tSM  ؊ ˆ ? ˆ E }~e[^_UWVSEXuEUbbMr u[(1ZEEju kwf"U\^M ` =Ef MfЀfMrt fEf UfMfFfAfFf-f=@v"hAPh`/jufFUfBffFuBPh/juʊfFMfAffFuAPh/ju蜊fFUBF BF f^Ej t/vafNEtЃ twt  tfN@0 fN@fN@ /v fN@ u fFDt@f fFDU\^M ` =~'jEPQfE8fE fEfER FEj/vgTjxPQRETjzPQRETj|PQR$ETj~PQR UXPH|xH$P t| xp5t 'fN@xV|xF|xF|xF|1҉hlF|F|F|FpVtpFtpFtpFt^tFtF tF pSxhh /j uӇhE.j u过ff fF$fF&@MffF(fF*fF,fF.ffF0fF2FDfF4fF6PF@PFPh`/jQGE$VunfE`fEU$fEf$$jfEEPufEfEfEfEAO f}@uGMfǁfffǁσe[^_UVSUXfEcfE$fEf$fEj EPRu fEfEN f}@u)hV$R f}ƒ Ј1e[^UEX ` JyUVSE uXfEdfE$fEf$fEj EPVfEfEM f}@uu$V~m1e[^UWVS E 11}fEjfEtfEj EPuM f}@u1UΉE܉u1ɋE ȉU ډ1 fM  1u ȉ1 ȋM ډ1u ȉ ځ1 fM͉ME ڋuԋ} ׍e[^_UWVSE} XƅcDžd|P u&OGcZ9Yt0Pn$Se$h.juWcGtP xUTt|+TX)؅҉\lXpyHlʚ;pliʚ;p uPRiʚ;֋XÍ \iʚ;PTPdh/j u ?Bo@B1ҁd)Éw =(kEu6+ u-BMwǁXh =ThRЋEYu5+ u,j@ؐMZ‹@HuRːX(k_(kS؉1ËEu6+ u-BMwǁ\^SThRЋ]Yu{+ urj@ Z‹@HuPR^Gw(kv'd =(kw(kw剅d؉1du 9dGxjEPufE aI f}@tQEGUj< t t:c@cA+x(iEEPjuOo p|brBPuh.jus|fEqfAjfEEPufEfE'<xfCf%$f=pu8ktx|D0(9|xBȈB1ɍe[^_UWVSEXE@t$E~t<3EE]CP߈C(111;EEEkM(A9jRu]щFN ]ŠC  juu!щFN]ŠC z uFF EPuu] UBt3bE;Et'G;EE4h/juqEM‰11 M ډ1 M ډ1 M1 M1 M1 M1 ډV FEM11 M ډ1 M ډ1 M1 M1 M1 M1 ډFVUF0 ЈFUE E ‰VEFE@;EE1;UE}9MA9ukL+@kUAD) k]d+E@;EE|1;MEk}<Ӌ8 G9E}9}ETkEE|HU]Bjt,u(uFPvh/juNcF,IMEXCthuY^t UB,gS€u }}~A'E~w]C,Ѓt}}uF,CE@,1CLIetKtFtAfCf%f= u=juW_ZhCuC hC(u^hfCf%f=qkET(B@u UB, u&uh/j@uaMA,e,RU]tS,YuVEPURuJth.jukaMA, ]0Dj<t < t< EuEEEuM1}u]SEVEEEfEAGfɉME@EUË x tjj@SP METPxPQR]EfMuÃ! EPURMQVyIEE9E1}]EjtEu~ ~EEEjtUBuBMA8u7fE5uF ]@XtkE DtE@tfEMQ BtEȀEE]jtBEufFMX@t fBfEBE]EsPs:Kȉ֙ ffEu tfEEPuuD th.bEEMETPEP]SuQRgEtQfEftuf;hwЋDMh.ju]^E@,fUB,r$BPMQ BPBPB Ph/j@u ^]fɉME@EUË x tjj@SP METPxPQRE]ff@fge[^_UWVSE uUw$.Ph.jVN]fEfEjt2Xf@ ffEwfEt t uf]fE 1ۊٸ ƒ ЈjEPV% f}@Sh@/jV\ jfEEPVfEfE$ f}@SWh/jVI\ Ѓ ˆA3Z {t&fh1ffEt9tAE9|1fuh/jV[ 1S fEjt6X@tfEfEfEfCfEfC C f CfEj fEfMV&jҸtPVjҸtPVpjtdV{_jtSVNjtBfEbjEPV# f}@u%jttRVjRV"1e[^_UWVS(E Uff}DžDžfE@Mf tUTVRPMfYYXC~΋]fftS Z u t dž PXU(Rh/ju[YRuu [^c Mjtf@u]t$uThph@`VPTjj Vv}tkPPh@/jWX|TPWSZYP~PWS Thph@`WPTjj WP Ej/vQ~TRuPfMf[f9^t2fPPh8.jQ#X]ffuj<t<0k1ۋ}|TPWRf|TPWRf;t C~f9tUUThph@`RPPPh/juiW M|TPQR^f_]ff9fj/v4jdThR|TRSPfTjSPƃ}Tj WPY[f9Uj/w vvƅvv19}ˋfDWfDVB9| fDVB~1ۄt]xPuCXv9Z|fvUf9fPRut(MffqRu=AfAffA ffA ffAffAffAfA 1ҋDB~1ҋD2 B~銕PWPh`.juR}stM.ЅtPhY.jWR1ƅ1/PSh].hSGL@tF~She.juUR@ƅ|1Džt7ho.juRUTRM~RQP<th.j uQ th.juQ th.juQ tPh/jujQ]fhƋ9wuZ1PPh@/juQuTP~PVR$Kftf9v1}ы\ۉux󫊅<tPh/tPh/juuPUTRM~RQP ftf9wuыDt@C,}‹C @tM ЈtC,ujtt ft CXSWu {,u {XuC,EjC(t@{Xu: t5{,uC, ~ PC4P P1 C u@HXtk L }ЋC @tM? Ј}@u t C(C(tM{XuGt>{,uC, ~ PC4P PSf s$h.j@uN]t CX(C,{,uh/juMC, C$C( Ph@/juM{,uC,{$tuTztPSVR }frfu tw{,u{Xtk tC6< 0W {Xu?.s,PCXPs(s$C @PC @PC @ Ph.juL,UfftfHfA1󫃽@tf9tUuTP~PVRzTPVRf;} ffUf1fǂ;},tMP?_C;|ԍe[^_UWVS uEj<] t< t< uTh VPY_EESh.j@VK?r$.ЊM ƒ ЈEPjVRF&jjVCFVjjV3FE+h.h.jVJzTPVRXZuh/j uh#.jVJM ƒ Јh:.jhT.jwh/kh/aTh VPY_tH tahc.jV JX`X`XHNh@/jVIXHX`!h`/jVIX`XHX` Ph/jVIM ƒ ЈgE[ENOECE7E+1hz.jVIXTh VPfC X`XBBσVjjVCX@11fhtA@,Bh9|߅WQh/jAσX`XBBVjj0σX`X`VjjVBσX`X`VjjÊσXB BVbjXB BVFjjtXBt0 BVσX`XBBjjV Bh.jVFTh VPVÍP w_$.h.h.j=h/4h.jV}FjjVAVjjVAh /jVNF Ph` /jV;FjjVUAσX`XBB Sh.jVEEEE EtTuԋ]VEPfD]XZGE~1;}}+D}PV D}Ph.hVGtE;}|;E}EfE܍e[^_UE HVSu]w)$.h.jSE6Vj S@ uPh1.jSD1ҍe[^UWVSu fF Ѓ+} $`.F MQ u*BPBPB Ph /j WsDY PBPBPB Ph /jWHD MQ BPBPB Ph /hhN.hDSط F tShW.hS辷F tShb.hS褷F tShm.hS芷F tShy.hSpF tSh.hSVF tSh.hS<F @tSh.hS"Sh.hSFtSh.hSFtSh.hSڶFtSh.hSFtSh.hS覶FtSh.hS茶F tSh.hSrF@tSh.hSX~ySh .hS>Sh2jWZBSEP BPBPB Ph /jW1B,MQ BPBPB Ph` /jWBM‹A @t ЈEx,=@,1MQ BPBPB Ph.jWAM‹A @tqMQ BPBPB Ph /jW)Ajt-F t'UB @kX P @t tH My,eA,YFUB(MQ BPBPB Ph /MQ BPBPB Ph /EP BPBPB Ph@ /MQ BPBPB Ph /EP BPBPB Ph /bMQ BPBPB Ph /=EP BPBPB Ph@ /MQ BPBPB Ph /EP BPBPB Ph /MQ BPBPB Ph8.EP BPBPB Ph /MQ BPBPB Ph@ /j_EP BPBPB PhQ.8MQ BPBPB Ph /jtIF tUB$9Fv8s.o.PvMq$A PR@Ph.jW|> UFz,B(B,MQ BPBPB Ph.}EP B PBPBPh .XMQ BPBPB Ph.3h /jW= CUBXPR BPBPB Ph/jW=E@X(MQ BPBPB Ph.EP BPBPB Ph@/jWK=Uz,B,MQ B PBPBPh/jW=jtiMA @Xt@k fdߋMA @k L ЋA @t? ЈEx,@,MQ B PBPBPh/jWQ<jMA @Xt@k fdMA @k L ЋA @t? ЈEEP B PBPBPh/jW;M<(Q u BPh@/ BPhz.jW{;X@wj4PWfDž4b σXB BWjjW<6Ex,@,~UB @Ph.jW:My,uZA,QUB @Ph.jW:My,u-A,$Ph`/jW:Ex,u@,e[^_UWVSM fɋ]fh1f9w ыtuPh/jS1:|ftf9wыD~$F(FXtTzt PVSR fftfHfue[^_g-e[^_US]f| ~t ff=@tfǃThph@`SPTjj SPftt 5t.ffE fff@ffUffEfHfjEPS1]UWVS uj.u .ЋE 8ЃtDyDy?EЃt y y?M1E EtM YTPuVR }uE fXfDŽ^CEv}ufM숎ThPh@`VP }t hThRXe[^_UWVS(Ejt .и .и^] 39r f@Vh.UЃt|q|q?Ѓt q q?Mu#}uE f@Vh.ju71E tEM TYPuuR E fXUfDŽZCEvfMЈThPh@`RPu(]1ۨtUDEtUfZM fYCvڃ} Vh.j}WЩ] fЃ@tq6@ҹ.@@t0}@t]@t2@t5a@t6 @tDO.E@.E5&.E*4.EL.Ec.E z.E u1Ph.j]SكtQWh/ju5e[^_USUjt4XEjPRfEi* f}@uUC ЈC]UWVS}1t!؉t VWXZF!uߍe[^_UWVSu} !Њ? jXiȉÉEE uWuh/jV3AtfE(#E fE8fC0fCfEt@fEEufESfC fEfCfSf fCfERPEPuWh@/jVA3 EU܉ jfEEPVj }u0 Ѓ ˆ7fUEfCS Ј E܉EEPjV- E܃ }UE ut- Њ? ˆ E܃ }~e[^_UWVS}jXOE i$C~CfCfCCCCCk,0SC,0S$C f ttff#t@uW@^tt@t tut6,0h.jWR1X,0AQXCSQAut9,0h.jW1X,0A Q$]XC S$Q$A FE i0CpCjCv CfCfCCC C C 1ED L  Myt@uWYt@uRjEPWfE%s f}@t,M fDMf ˆfDMf ˆCPC PC PC PCPPjh.h.jW/,CPCPPPPPh.h`.jWY/sE(fFfFffFjB<w LB<w ? t6ruvuvpH<:vCu  Ј ЈFNNPFPPuu h.h.jW.E$ }8e[^_UWVSuVHYth.Gr tIVZuth/jV. fhf9fdžftf9v1 ׋\tZftf;hw׋D{$t Tzt PSVR C$C(C(C,S#!XGfhf9ve[^_UWVSujt <w1DžDž1ۍ]PSVC~ ~fISu PtDrh.jV,PPPh)/jV,$w9}]PSVC 9|11;}#+C;|th.jVB,8sPh/jV#,jB<w&SjVK j uhSjV6  uPjV D tuSjVSjVt PVPV [^1e[^_UWVSW}TjjW] PjThRЋTjjWPjThRЊj t<@uqt <w f]?fˀf]EfEufE]TSjWPjThRЋTfMEPjWRjThRЃ TSjWPjThRЃNyEfMf!TjjWPjThRЋTjWPtEfjThRЋTjjWPjThRЃNyTjjWPjThRЍe[^_UWVSPPu V EXF Њ ˆUuuVC ЈCFC FC FC F S ˆSMjvЃЃ Ѓt ЃCV  ЈV  ЈV  ЈV  ЈF CF fV  fSFfV fSVC ЈCCPC PC PC PCPPjh.h.ju(,CPCPPPPPh.h`.ju[(CE(1EMWA ЈAGAGQ ˆQGAMjw+<wE@MQ ~(ЃA~ЃȀUBMfGtffT3ЀfD3Gt fT3GtfL3G tfL3 G@tfL3@GtfL3D3fD3PD3PD3Pujh.h.ju%'D3 ЈD3D3D3fD3fD3E$ E }e[^_UWVSPPu EiMXQ ЈEuu&} t EF ЈF} t EEF } t EEF } t EEF } t EEF ЈF} t EE Ј} t EE ЈMQ ЈQ Ј} t E} ft EE fV} t EE } ft EE! FfVPF PF PF PFPPu h.h.ju$,FPFPPPPPh.h`.ju$1E(E^} uG+MC ЈC} UuG)MD } MuG+UŠD ЈD} UuG*MDfC} uG(UtfKfK} uG(MtfK} uG(UtfK} uG(M tfK } uG(U@tfK@} uG(MtfKCfCPCPCPuu h.h.ju"C ЈCCCfCfE$E }8e[^_UWVSPPu EiMXQ ЈEuu&} t EF ЈF} t EEF } t EEF } t EEF } t EEF ЈF} t EE Ј} t EE ЈMQ ЈQ Ј} t E} ft EE fV} t EE } ft EE! FfVPF PF PF PFPPu h.h.ju ,FPFPPPPPh.h`.juo 1E(E^} uG+MC ЈC} UuG)MD } MuG+UŠD ЈD} UuG*MDfC} uG(UtfKfK} uG(MtfK} uG(UtfK} uG(M tfK } uG(U@tfK@} uG(MtfKCfCPCPCPuu h.h.juC ЈCCCfCfE$E }8e[^_UWVS EXEM AI‰11 N ډ1 N ډ1 N1 N1 N1  1ۉN ߉ Ή t+VWh.ju1҉у u ׋Ep x$Uj< tfC>fA@fC@fABfCBfADfCDfAFfCFfAHfCHfAJfCJfALfCLfANfCNfAPfCPfARfCRfATfCT[ÐUWVSV]zTPS} uRfffEffEfEUfE@f%fEfUfEYf9[ttfEftfEf1ɍe[^_UU MBABABAUU MBABABAUM S]ACACACACACACACfAf fCfA f fC A C A C ACAC[UU fMffBfAfBfAfBfAfBfAfB fA fB fA fBfAfBfAfBfABABAUWVSQQ]{0ǃPzǃ8ǃ4G_ GW4h9~fG jǃozt fGXfGFfGNf,j<t< t< uQBfG Z BW4fB fBFfBfBf.jj@E8"Z‹@HuR."XuVjSj <t< t< uVjSE Bwǃ!^h =ThRYXhEThR$@!Z‹@HuR}!XhS'FZYuFH~vu싓Bwǃ'!XEfGjhhN#WSQj<t< t< ujhhN#Ѓ`WS^Qe[^_UEx<~@<E7UWVSV}G X jt#=$4+ǃm{PUp iXGs,Mu~=$4u+ߋG @ttߨtkE fLL  Š? ЈMf s,}[[^_UWVSQUB p VЃhhPA]C @ ;lrC,j@^Z‹@HuRTXTjjVPVU~jt[TtjhjVP BwdžXE@,eTtjhjVP +UBt;B,Bwdž;X`uV] X+tl4t 8] E4U8BwdžXhp/jV'1]Ct>+E+ SVUǃ+ Ј+cuǃfXeHHgth5EH1t/Ⱥә@&4PEhP^?EHY[f9ffPh/jV)+? ˆ+h/jV 4t 8U ]4E18S]S BPBPh/j V S]hЃhSa> 5&4Sm>E1HXZBwdžXe[^_UWVS u V}E4fZtet#>)hu~,uF,^uEETPEPEPWtEPEPEPWFuhThRKXu}uFu$VjW tW[~,uF,e[^_UVS]SSu~C p tChP=cXC tC h/jp cS"+<Yu'?+h/jV u e[^|e[^UWVS\uF @ j@E MZ‹@HuB4RXt']fh1ft]94tB9|1؅~FtSh/j u tCSh/j u ]BuǃZ FETEPEPEPutEPEPEPuFt%Sh@/juj fVt{Vjuɬ ~$tUTxt SVRP Sh/ju ftMf;hwӋDF,fVXBSh/ju Fәf&4PFhP:ENPEPEPu(tEBM}NEEfEF @t1u]SuE! EfɉME@EUË x tjj@SP METPxPQRE]fEfrth/j P MBwǁXe[^_US]j@Z‹@HuRYTjjSP BwǃE]z]UWVSuF x j@H‹@[HuR>YV迣fZe(gthF PR@Ph/j Wa~WhЍ^hS8Fљ&4PS8Nh2/jW +? ƒ 4+t 8048\V BPBPhD/hP/jWV^hhSd7$5&4Sp7N[^~,uF,VYBwLJEe[^_e[^_UWVS]j@Z‹@HuRX++4ulth1Bǃ4wǃ6X6P4XuGuWh]/jSy3BwǃEe[^_e[^_UWVSu+4u@t<1dž4؋P4YuGuWh]/jVe[^_UWVSE $/ЋEjfrUiXk DEEDtUtQD tJAu * Pt7| (t+ !t! t4Й1E%(= /t /= /=(t0L2Ѕt)Rk D PVSWh/ju RSWh/ju1}tU:Wh/juygM+? ˆ+h/jQ}+? Ш+uWhv<P3+ Ej<P3h/juEjtnfrtcU k}XP(rr rrB@t//PB4W4rBPQh@/jul0Zh/jEXUEE./tK8/t?B/H.L/Ѓ$=V/t `/= i/=t0L2ЋMqRh/ju}rUBM9AQHEtEЃEtEM;MkU|(Av=}UwBR9֋_E؉Uu!9uUw BR 9֋_E؉Uu9t A;M|}O;MM;M}.kEp8X(Av]V t A;M|;Muh/ju UM}AW ЈAM}AQ W GMAQGAOWGZ}Th WPÊjZ<Yt < t1< uUTh RP^_PPh/ju e[^1_UU ҋMtfrft$APhe.rEPu>shn 1rUVS]jut} tE 1PjS u~XFu FH[jjS uGjjSϡ u3ru1&jjS计 ufFf%1f=Je[^UVS]u SVuFCFCF C fF fC fF fC fFfCfF fC1ҊDDB ~1ҋD D D$D$B~e[^ÐUVSu1ۃ<@uP0@0xW49}أW41jdCThRЁߓX~e[^UVSu1ۃ<@uP0@0tW49}أW41jdCThRЁߓZ~e[^US]<@u%=t=@ujSYZtCPh`/_m]UWVSu} 1ۃ<@u%9uW49}أW41jdCThRЁߓY~e[^_US]{0t h'/S:YX<ɋ@u%= th/_ɋ@uth/Bɋ@u@@S&Zth /hSZ1҅Yth@/Sc:Ћ]UWVSu~0t h'/V=:ZY<ɋ@u ɋ@u P@<@u P @ <@u P@<@u P@<@u P @ <@u P@h'ThRЃ<X@u P@tVXttPXtZ1<@uPXSh'/V8 thGThRЃX~VDžXy Wh/je[^_UVSuVÅXt'V(hV t h'/V`8^Xe[^UU S]t k(`9t h'/jz uQh'/S8$B$BB dBd]UU ҋMtk(`9t h(/iB$BB dBdUMdt7k(`9th/ zt h/^iBdB UWVSu} BW$~0~y_wPh1(/V7s ss3hI(/V 7(sssshI(/V6s,s(s$s hI(/V60sPPPPh/S'F9|PPh)/S'1t,PPh)/S'F9|1e[^_UVuS\SjjjVth /w~0~Sh)/V SjVj th`/KSjjj VXth/*~0~Sh/V@ SjV th/V&~0Ptlhd`PaPbPcPh@/Vp&1ۃ,t,PPh/VE&C9|hn 1h[~0YPPPPPPPPh/V%1ۃ(Ph.3CZXZvhn 1ZPh /V%1ۃPh.3CZYXvhn 1Z8P:P;P4P6P7P0P1P,)P(Ph@ /V%81e[^UWVSW]CPPjjjS6{0~"CSPCRPCQPCPPh /S$C\PjjjS{0~"C_PC^PC]PC\Ph /Sp$ChPjjjS{0~"C_PC^PC]PC\Ph!/S*$E߉ލPujjSU<{0~1PPPPuh@!/S#tPujjS{0~1wPvPuPtPuh!/Sm#E };CPPjS th!/S9#Y^{0~sXsTh!/S#C\PjSM th "/S"XZ{0~sds`h@"/S"ChPjS th"/S"^_N{0~Hspslh"/S"EUDvPDuPDtPRh"/S{"E}~EމߍPuS t uh #/B{0~uh`#/S#"tPuSN tuh#/S! #{0~xuh#/S!E }\1ҍe[^_UWVS uNL ˋF`9fdžfdžtvSPh $/Vu!F\E}FdWjVE]#WjV U9th`$/V#!EF\V`EFd1tEԋ|EEE~0~jjWh$/V EPWV u_EPWV uJEԉtU؉xE܉|E~0~PRWh$/Vm GU1ҍe[^_UWVSuVP׉1B BE BV_X~0Z~u h)/V SVY1XhThRGVmXZuh*/V{ tSVd1e[^_UWVSuVP1׹B BE VY~0_~} !1u*/Ph*/VQ SVe[^1_UE<@u P4@4UE<@u P4 @4 UWVStu11džd`PVYXG(~4t~Ճ~0~)<@uP^ Ph4*/Vx<@u%t=@uVZ@E<@u%=tVx_th'ThR[|EPVZYt hF*/C~0~EPEPEPh %/VEfFE˃FBEFDEPV[_t h^*/~0~"EPEPEPEPh`%/VbE<t<E<F4EfFLu VZYt hw*/|~0~ h*/V [_h VZYt h*/N~0~ h*/V[_P19s+SVTFB%)čD$Ẽ~Dt t1zWvDV) tPh+/V9x~h,/VqoN>}1ع}Ẻƒ @@@ BB BBBFDB }EE~0~ph`&/V B19}CH9uMD GD$%U  ЉEAB9|vDuh&/V~uuVNusEPjV u>~0}~Wh,/V@ uFD9Et u Ɔh0,/V V])dž ؋eЍe[^_UWVS}EwDhE,/WthS,/P Duha,/W u <@uPX<@u P@<@u P@<@u P @ <@u P@<@u P@U샿<@ru P @ jdThRЃuX<@uPXSh&/WG <@uPXUB,EӋR0UU샿<R@K4UuPHUr4ho,/Wuuh'/W}t.UR<@U [uPH}u҃}]SUC EsSRh@'/WNUR<@UuPp}t.UR<@U [uPH}u҃}qh,/WYU<[@J?XCZt&u h4n0%?Yh0L2?hq8/?XCZt hn 1>[Mu }Le[^_ÐUWVSd]{0} ~ h=/S Y^{4Of GfOft! ffGfEpPUԋHM؋P U܋@EfGt M؁euKCT%1Ƀ}t ~}t    M؍uVEPS] th=/VGPS th@/Sh1GUԍpPU؉PU܉P U{0P~&WxRh@@/SuEPW[y fOtPh=/Sk PUPU@ EEPQS t h>/<{0~uuGPh`#/SUu}u {0~Eh>/ƃ v}u{0~*h.>/SQXZEtEPGPh@/S21ƃ1Ƀw$,I/бP ( 1PPP%P1 PP>>/uJ>/PGPh@/Se[^_UWVSW=UЅE9G$fpffEEuG4tvC%tju jSutEfDŽptFu jSustEfDŽpt"u jSuOt EfDŽptEfEf;Eh9e[^_UVuShF8džJdž^Љs CW4ЉCfCC$~4tfCfCfCfFLfC~4StљfC vHhW>/V$jhhN#SV:~4u jVhXZe[^UWVS$uLm~4t(jjS ‰`uFPhA/9 %1׉󪋖DEjPjEPjhhRR$ tPFPh@A/9DLjPhuEPRR,tPFPhA/]9]HDPjjhjhRRtPFPhA/9 DjjhLHPP tPFPhB/8 H@ PDEjPjEPjh~4tPDR$ tPFPh@B/|8@DXjP~4tPuEPDR,tPFPhB/-8TDPjjF4uRjuRDQtPFPhB/7 kDjj~4tPXTDR tPFPhC/7 T@ X\Uԃ~4tU;EEkE(`UfXUԉPUԍSPUԃ P DPjjhj1hRRtPuЍFPhX3h@C/61E;]z1kE(`Pt DRPPY[MЃ}yًDTPPXZDTPPY[DhXPP0 DUuRPP( DHPPXZDHPPY[DhLPP0 DUuRPP( j`豚džLdžXdž`e[^_UWVSuV 1X1tPG~0~+y+PLPJXShf>/V) SVV u1e[^_UEPhe.(5EPu y5hn 15UWVS]ۋ}u t WHFXt1hThRKXue[^_UWVSSS}GX s hz>/VuSyj@E_$Vt9_$thC/V?w$PhC/V(Vk<E@u}@u4J4}@u0 G eB0SQPhC/Vw $h>/V ~0~ wHY11`9tB(~4t~RVXEZEe[^_UWVSE ]EExƁEU⋋P)ʋL‰U{0~cBPh>/SUr rr2hI(/S$MqqqqhI(/SEp,p(p$p hI(/S0Ury(}tuuSZ Vh D/Sw _{4t~Vh`D/`k(M9tVhD/S0Dz t!j hMA+\PTRR EPB<u{0h>/SXZ{<st#{0eVBPhD/SLUR҉UuyMq$Ph E/SEp $h>/Skh>/S`$Ur}Xth>/S@uJuh>/S( EhPMy$q XtKDz t-A tPMApjqDR U苃DrPPY_My uE@,@X@(?}uUB,BXB(MA UBXAL$@I/ЋUMB$+AB(A UBXt#tBt"(t)6MA(E@,vUB,jMAA,[VmuUBXPh>/SME@,.UB,"MA,E@, UB,MA tE}p 4tUzXuB,}t Myx uSXZ}tEPS^_}tEHEe[^_hpe[^_UWVS(E p j@uEYE_uU B,JR#pSvSkME YA1CUB8CC MCFFC u FZt CCSu uE pH{U BCB$C(MAC, z$/B‹uDtЀЀPjE p$p UruDQ #t t] u E @,U B,Ph?/u j@2uu6M IQnS)9MuA>VR9‹u F$EC(EF tEUB>HK0EtvAuFUD AFt$1E@>Eԃ9EUuʀ ։1EEUB>HO9Er)C_4u؋UB>΃9vHEBFUB> }FEfȋU)BFF0EE9E}dAUBUD AUBUD$%EH9EUu ʀ~uA EEOmE9E|0C(u EF tEU1B;xK0}VAuFD AFD$%ẺFpN9Uu ŰẺUGB;x|MDz t=u 1F D@PMApjqRR C0C4K0ыu~0~Ss_j@Xuu hЃhVE @u@1&4PVY^uuSu Fu1(E pPuz t ue[^_UWVSE Hуu}t- tltPVXZX~0~Sh(?/V ~4tPk(`@ >Px1~4tk(`@ x$e[^_Í?E ue[^_EE C?/Љue[^_/UWVSPEEu FH $tJ/vh`E/uhW?/u1f>tPuEPho?/)[Xә t Ptht?/(G 9|hn 1(YFRPhE/_FPh}?/eh./FPh?/L~ue408.PF!Ph?/FVwHtPPF!PhE/uVƃ=t =tE=uh?/PhF/=uh@F/uXZPhF/PPhF/fPPF!PhG/PPF!Ph@G/u>SPPPF!PhG/u-vF!PhG/uvh?/u ~tau5_u hH/#P1׹BFB FB Bu޵EY] Ee[^_'e[^_UUSz4M ]u,A<t#t<tQ JuK[UEP Pr UEx<~@<E)UWVSuDjPuWjhu RR$ tPh@H/VDjPu WRR,tPhH/V DPjju uu RRtPhH/VK IDjju PP Ã1tlShI/V DPPY_DPPXZDu PP0 DPRR(dž؍e[^_US]DPPDPPDsDPP0DSPP(]ÐUE t PhJ/z$XZUS]SSLffǃǃX4ǃX4fǃ$h,PS]UWVS] uj@LXǃ`LLtPLPuQ Y}e[^_UWVSSj@u} оEYt1LҋPtPPLjjhh) uFPhJ/#XZ1Z ωځ% ЉX TPT\Pǃ`'u&jjhJ/jP`ue[^_UM UDPt9Xt TuUWVSPPU EEU`\uPh`. "hJ/{,UBt"=u C,vPEPh.OUBtVЃtt&u,{4C,1C,(PEPh.y! C,C(uuZK^_]e[^_bbUEx<~@<EUWVSEx W U@PREƅXZuUB,]E\UBdRЃhh7Py E,t DBFPFPEp& ȃ߈FFW ЈFW ЈFUBF % ؉F F FFB$V$UEEx ω% ËUEtD%E)9v‰%U)эt ρ;]tEUPEɉEt } ~F$ % ‰VUB$FEF_FFFFF j@vVuURDS{1EtoduuURH tQVXduuURHt2V9X)Ej!Ph K/ E@,Vue[^_UWVS]\@ p Pchu1_j@趹 `t h.@Y0hn 13\@,`ǃdSVVD }e[^_sUWVSE@u }tH9u9t @u1ۉ[^_UWVS]E UEUSh*Ѝs0VU ujjj蕀 ujjj x t uEL3Ѝe[^_= ~ECE E P/Ѝe[^_ 4`X4hK/AיuƃiɐЈE ȉU}E舃eE爃C @ƃjSf fCN[hUSd}{\fCRjhhN#ЍCHPS:k&4fdž@AX4thjFhK/  ƆFjF,AX4thjBhK/ ƆBjBjVP e[^_UVS] j@C Sh`Ru e[^UWV1=L_St E uj@֫Vh`RЉSث1t!1Vh(ЍFPN e[^_UWVSEx W U1@X4_t hL/X@X4tGPMqAPh`.E@EGUE|wM| }uVSuE }jjhrE }{}1U|UЉBrj@蟪EMAUB_t EQB EMAȃUB |w UMT ueYuuIDžXZMOAGEtO G@GD-EpG/PUrMAG@A GFDuC(Mu Me[^_C(K@X4t5C(t PhhL/XZC,u C4Ph.PhI2`YXVuXE;Zu!ǀtƀPX{,u<u6u0}UMD WtG B G jWl_XsVu E ]e[^_HUWVSu FP B1MۍJ|wD u SQW 9pu @@~ItVJ|t DHF t$҉F FtB UVe[^_U@X4S]t hsL/XAX4thjhK/ ƃjjSP tu jThRY]UWVSV} }t} t(ELJ‰U hL/jW!Y [u_19}jWUCX9Z| tTjjWPjWUjWWC 19}jWUCY9X|苇؉@X4t} P3tL/PhL/ @X4t51;s Ph_.CnX;Zrh3ZXe[^_UWV@X4S}ut VhL/+Y[@X4t*19}U Ph_.CX9Z|h3X19}6M  PjWR  ujjWP C9|ʍe[^_UWVS} t+ !ҍBb1 BJE UƉE8w ‹D u1RPS7 Pt xtU} t ƇUDE}OƇM쉏s CtxSU[ˉM܈]ꋏM܉și;E}At}2wuƃuu KE1tPj WR E닗PjWR ËPjWR] { yc@X4thLjhL/ AX4thLjhK/ ƇjjWP @fjE@ @ta@X4thNj hL/{ AX4thNjhK/^ ƇjjWP @f UB<BD1RGPhQ/  @X4thWjhL/ AX4thWjhK/ ƇjjWP @fuuPEPGPhQ/@X4th[j hL/d AX4th[jhK/G ƇjjWP @f e[^_UWVS(@X4tEh R/_XUuЃPh`R/Mt6<t,PRPhR/]ǃ@X4t}PhL/i[^Et[AX4thjhK/A UƂjjRPM PhL/ ]vn@X4thjhL/ AX4thjhK/ }ƇjjWPA fVEuHJu<t<vhxdu % tR~9u A9t=AX4thjhK/ ]ƃjjSP AX4tP}PhM/ EǀU, # MMA]@ @ "@X4$Z/t hM/AY}y.UBp sCPh$M/LJ MA 1u ]}WDuGP(EƀF tUPh9M/XZM@ ==]C@ @PEPhR/] AX4t hQM/GXAX4thjhK/, EƀUjjRP jThRЀgMA@ PXD uЙRPW ]{ItSJ|t DH}GJGIx@UB@ @PEPh S/MGGG tPj QR ]1PjSR 1PjSBUB@ @PEPh`S/gG`heM/_PGBPPhkM/t huM/^GMƁ]K t hM/r[}UB<BDt hM/EYMA<]ADtBPhM/XZEBt#GAX4tBPBPhM/ UxWPWM@Ggt t |]Cp ?hM/wE[^GuzGG@X4thRhhL/? AX4thRjhK/" UƂjjRPM @f,G!ҸU̙}̻aEؙ}̉EkEd)EM]މؙi;E}CiؙGUBp >uuhM/dMG;} GvGg@X4thohhL/ AX4thojhK/ ]ƃjjSP @fOEw Gt{OM_]拸ۉˉȉ}ؙi}9}AˋMt}2wuƋMuu KE1ۋ}tPj WR }E狗PjWR ËPjWR HBPEPhM/U xG@G GtOM_ÉEЈ]䋒ȉȉUԻi};E}AˋMt}2wuƋMuu KE1ۋEt񋐨Pj uR EEPjuR MËPjQR Gg]Cp ;hS/'AX4t h N/Y}Gp ;hS/iXZ@X4thjhL/M AX4thjhK/0 EƀUjjRPM @fm]< u ffuPEPh T/SBPPPu$}@y!ffjjPWPEPhT/s EPh.]^_@X4thjhL/A AX4thjhK/$ EƀUjjRPM @fd@X4thj hL/ AX4thjhK/ ]ƃjjSP @f }ft;AX4thjhK/d EƀUjjRP AX4thjhK/) MƁjjQP] ǃe[^_UWVS@X4utPhT/ @tVAX4thjhK/ ƆjjVP fdždžur@X4thPhL/5 AX4thjhK/ ƆjjVPf @f AX4thjhK/ ƆjjVP jThR[ tFPh.jNFPhEN/Uu @$@ttjVZYt>AX4thjhK/ ƆjjVP jThRX<t<dM؋A@,Qh@y1PPFPhU/jV t>AX4thjhK/X ƆjjVP jThRXjVVP _VP@[uFPh^N/jVxVP Ytzu-thjPRPFPhU/<u;}tU؋BDPPPPFPh V/< FPh.XZ@X4u^th1jhL/ AX4th1jhK/ ƆjjVP @f\th3jhL/ AX4th3jhK/~ ƆjjVP @f fdž@X4tPPRhV/jV[_t5AX4th;jhK/ ƆjjVP AX4thBjDhK/ ƆDjDjVP D$8[/ЋM؋A@,AX C0WzuAzu;Zۋ |w D JtB A B jRLXWYRut?}tU؋Bp 0-[hxN/M؋A@ @0YuLFPh?.XE@ Zth*3[h[.}E؃PƥuV|U؋B@,džHC$P[/ЍFPhV/7hN/X,jVÃSFPhW/؃KjVY_PhN/XKZaE؊UfdžfdžfdžƆuo@X4t hN/=XE؃P腤uVeM؃ t H E؉U؉BJ džƆtFPhN/jVY_~~;t2PPPSFPh@W/r9@X4tPhN/HXZV0Xt>AX4th jhK/ ƆjjVP tuB< PPFPhW/Ѓ}u hN/M؋AX C0Ѓ$t[/AX4th/ jhK/K Ɔj3GuU؀zIuFPhN/ tFPh O/y ya@X4th> j@hL/ AX4th> jhK/ ƆjjVP @f@GGGM؀yI@X4tethF hhL/V AX4thF jhK/9 ƆjjVP @fthH hhL/ AX4thH jhK/ ƆjjVP @fe@X4thK hhL/ AX4thK jhK/m ƆjjVP @fdž}t jVY_VPPPjV_ZPCPCPFPhW/ AX4thk jhK/ ƆjjVP @X4thl j hL/y AX4thl jhK/\ ƆjjVP @f AX4thp jhK/ ƆjjVP @t7t-PPEPRCPCPFPh@X/ džU؋B<BDƆPPRFPhX/lAX4th jhK/O ƆjjVP jThR[Lu"PPRFPhY/jV(ZYwPFPh@Y/ DM؈AH@X4@\tPAHPhO/x u,U؋B 1uMبQDuAP(ƆPFPh'O/3 džAX4th jhK/  ƆjjVP PFPhAO/VOu}u hXO/i jtE t=@X4@t hjO/R_V\dž@X4@t h}O/)[ u x5AX4th jhK/ ƆjjVP  AX4th jhK/ ƆjjVPVtV u"PPRFPhY/i9PVV0 "PPRFPhY/dž@X4@tEp@@/PhO/ jVZYt5AX4th jhK/ ƆjjVP MQ/A@EEPjPPVREPjVR E񋖨PjVR @u  u.E򋖨PjVR  ujjVP AX4th hhK/ ƆhjVP AX4th hhK/ ƆhjVP VPXEEp@RV AX4th jhK/K ƆjjVP dž@X4@thO/_XAX4th! jhK/ ƆjjVP 9vЉEE싖PjPPVRdž@X4@t hO/|[u5AX4th* jhK/X ƆjjVP 9vЉEE싖PjPPVRdžU؁b E싖PjVRE틖PjVR@u  u.EPjVR  ujjVP AX4th7 hhK/q ƆhjVP AX4t#1}hA ŐPhK/* UҰtҍՐRjVP VPn@X4@t hO/YAX4thG jhK/ ƆjjVP džCFPh.XZ jV uV^_ƆV[ύ]SXhRи2E=@BEY~ -@BEE苆VPZTEPXhRXE9EvC9E~ie[^_UWVSu ]FN @;<ua@X4th j hL/ AX4th jhK/s ƃjjSP @f @B &4Ѝ^~֙iȉ֙lj} ]e[^_Дu]e[^_e[^_UWVS uFEx G_ EWSP ZO/u #4RPPjSZYPPFHPvDv VCPhZ/@@j@qEF @Yth."jS詼 ^hn 1 E@,VS ;u8E@t/u&W$hO/O XZEEe[^_qUWVSWW|U-Xj@Ep^uEVtVE9B}GzuAzu;Zۋ |w D JtB A B jR:YV[Ru@Oyupk&4XZEEt+t }w mFPhY._Xhj*3+Et>}u8tG E@,EFPh`m/ƳYE[Et!tG@ FPhm/BEtOVZ}Et Eu ,B,ۋu ,)ȉER,)ʉUۋNuRuRuuQhm/t G TE}t VlE~Etu 0ER0UԀ}x>uuԍFPh@n/tG t!tPuԍFPhn/QE}w@}w}}}}}Ԃw}Ԁtn}ԁtsx}ԃ}^u,B,)Phj/荱Y}[UB,tFPhn/@Z4Ћۋu4ǃ} B4ƒU̅ۋu5B5Eȋ}̅ۋu6B6ɉEĉMuu̍FPh o/EȋUDEuuu̍FPh`o/輰Uċ} ׅuRuu̍FPho/蒰ۋAu ,B,jQ FPho/OXZuBLWy ZRRUu4}tEp >XFPhe.[_hp/ԯY}u9UBtGEjGPUjW?&}u%UBB uV}u }gGG CwW@ZWe}t Ep VFPhe._Xu uh@p/Shp/ݮ!}tUr YFPhe.趮XZG@Phj/袮GG@PG@<vPFPhp/q WBHBHjW [_uu,EWB<u$GP Ew VjW<uGP7Ytԃthq/\<u]GPZtu?w VzY[uu,1E-h@q/-G@PjWXZuu,E4Z4Ѓu5B5Ѓ~RFPhq/ '*)PGhPGDhPjWtV _7hj/説V Y[ }u&wFPhq/膬G Vk 8Z41 G \uh k/MX}ZyE@,70t70PuuuuuuFPhr/$6G@ UBXu,Eu ,pEpB,EEUWd}XtU:uuuV Vv }Xt,uu ,p EpB,e[^_UWVS ]CEP BsBDEEhP_iUXBXtKt1tO= (t^=1{ }G,E@,{ uhk/蓪UB,XlC cDZ4Ћ}CC P5jS<C< <E@, UB,{ tP}GtEy t%uRCpjPQ sPY_C SB,E}1C@XB,UB @}GGGG Gc$jjj E4PsR t!PFPhr/9E @,z tjCpjPR CPjS8 t 8X<88Cu7z tjCpjPR sPXZU샢}OC 4C44G(}e[^_Te[^_UWVSP]C@ PKUpCxTtp VuAPhr/7C(ztCPB@PQ jS_1e[^_UWVSEPh4k/臧uEEEEU fz8MEEUMU|tf1=t5ECE]Cp <VSh@s/FMU@t~~E}uMU8t/`@@ QR+XZEMA89EE8tT3MCtF U<SACAYCp `Shs/ uM@tT3MCtF UDSACAYCp Shs/觥 u]S$ЃC$1K3A,C@XCp s ShHk/QC C Cp,s ht/* ҋCtBESSXke[^_UWVSUB HX M@j@E-@E싳0_d}ҋFOhtB4VVhaQFbE䋄 Ejjj}e[^_UWVSWWE ]EUjSY^1Ep4VS,YZtG~uFhk/蠔E PUr4S+UB8@DPUB4@PS X1UDt0t'ǀ1DB~WuS G~ESXZE ]e[^_-UVS] C % xuPC8pVmC% xPC8@PVOE ue[^UWVSPPEE]E UTU샺w8F FP9C8+Xk0GTTt$9[hPShP@PSE PPPS$jPHPSpPUF P GT$@TtA< h/й$u 99sh/Ёnj% 1T h/F#v⋓TPU싂@PS1 TDpUDF~UDUBE ]e[^_e[^_UWVSuE ۋ}jtDZ1Y|um@~h s4V jVC8S8LBC8LC8LE jLE DŽXe[^_U5,Z4hk/C50Z4hk/35t hv/芍XHw/h2yjPw/Lw/u Dw/vMyEdv/ kHw/Ѓ}v/u #4PRhv/4w/ue[^_UWVS}GLE\U싟`1}uSffCtj FThRЁ'Z~WXtN\`u Pff@}u S1ffC}u SffCu}u S?ffC?\`u Pff@1}7 Nu~<w1K}u1DFA~狇\E`u V(ffF(E}uVffFtj ThRXE}'~Ջ\Uҋ`u VXffFXE}uVffFtj ThRXE܁}'~Ճ\`u Pff@1}Nfuft ft ~}u@Sf f@f fCf}u SffC}uffσ}uff}u S1ffC}u S1ffC@t(Wv\X`u Pff@}u SxffCx}u SpffCp}u ShffChWi$p WC }u S ffC }u SHffCHWgUfBP@fBPXUe[^_UVS]\sL`u QffA\`fFPu&Y tfЉtfA[^UE$p RNUWVS E\E}E`u VffF}u V@ffF@hThRЃ}Xu V@ffF@E\E}E`u SXffCX1}uSffCtj GThRЁ'X~؋E\E}E`u S(ffC(1}uSffCtj GThRЁ'X~hThRЃ}Yu V@ffF@e[^_UWVSE\`u SffCuS ffC 7u S ffs u SffChThRЋU@X\`u Pff@Efu)uSffCu Sf ff fCuffuSffC揃`uȉff u SffsU\`u Pff@QWgU`u Pff@} E $x/ЋUuS ffeff)fS Nu S'fC,u S  u S f fC hThRXUturE\`u Pff@uffuSffCe  u uȉff u SfofsiU\`u Pff@uSffCȁ?ue E S f e E fChThRXE\`u Pff@e[^1_UWVSQM\E@} `t#PeLGHG"$@GfЃ\`u Pff@hThRЃ}ZuVffF\ȋ`u Pff@ȃpw/ЉG\`u Pff@G}uV ffF t$OGPA$Phx/ӂ \`u Pff@e[^_UWVS$EE\U싈`MuFP%@@ECu hw/sڃ2=U~8MApCu ǁCuSD}Hu U fUfB 9}FM܍1}uuUf ff UfBMfIP}uUf Ef@UCu ǂCME}fu'UUعEԋMԍ9f Uf љEЋUЍ:f MfAUB8t SP舕XZh,EMfXu1}u UfUf4}u Uf Mfuۉ]C v$M}su o C t$u}7su n h`Cf8 8D=N~ ʈ8=a~8dž(UfEOfETRVPZYuf}t8Vw,(P '1fEfEEԋTPVRt fdž` Ef`hh8jSjjhS jjhS8tjjhS8tjjhSμ9tjjhS購`trjjhS蘼jjhS艼 8tjjhSn8tjjhSS9tjjhS8`txjjhSjjhS 8tjjhS8tjjhSһ9tjjhS跻`txjjhS薻jjhS臻 8tjjhSl8tjjhSQ9tjjhS6`jjhSjjhS 8tjjhS8tjjhS̺9tjjhS豺jjhS蟺hPuuhn 1Xf8Vhjhu4$LTVPVs61e[^_UU9u: HutPdP2E ftd2U fUU9u: HutPhP4E fth4U fUWVSPP]C0E8t@Pux HutPdP21ftd2f HutPhP4fth4f1 HutPdP21ftd2f ɋHutP`P0ft`0ffEɋHuutPhP4pfth4fptBS XHutPhP4fth4ftDVSY _HutPhP4fth4ft ɋHutPDP"ftD"fHutPhP4fth4f;0u VSXZ}yBS XHutPhP4fth4futDVS_ XHutPhP4fth4f t; HutPhP4 fth4f HutPdP2 ftd2f EtP-Ye[^_UVSE u Huۍquf ۍquf[^UWVS`UTj RuPEYM0fD[uf4#jjÅXZjSYC_sUTjDsjuRPqCbʁtJuRP tt u*E<(1E<:EPh|/` EDH,EQPh@|/`}ύG=ETAPECPuuuR{ {UTMjDQjuRPEujfE jfEOÅXZUjS_CX;CPz{)E)Usf}MfF}ЍG>;E~EPWPh|/1jDsEPeMGTPCjKThRЃX81y#tVu GPh}/,Y<e[^_UVSu@u8Kt*TjjjjVthKThRЃXuօyFPh){/X=8jVhVfEfEfEE苖TPVRe[^UWVSu@($,u  $,u ؍ Ȁ؃Ȁ hThRЃ(X$,u   hThRXe[^_UWVSE@u tBuF= t =t +fE(Ufzv FfE#fEuMTjjVRj!Qj8jFPu:E ۋHfutWpW8f ҍGpuG8fE9EUۋfNHutWpW8f ҍGpuG8f9¹XMffVEf^vTU HutWpW8L fmLtWpW8fff~u'EfFuFU;(u fFM@UB=t#= tl=*t=ts=Du|fVHw8$/и2+$ M&Ef1FUfBMffFfA1ɍe[^_UWVSH} fGf=u"fufEfEUf(8U@=t-= = =GH fEfEwM$T/и9GfE(fEtIEf\uuMtHtEfFuʐfU+fE#fGffE#fEfE}UDEEw1}&}fEEf-ufEEPVpY]MTSQP6E1҃}$j8jGPuE HutSpS8fftSpS8ffU wHutSpS8fGftSpS8fGfffvPU HutSpS8ȍL foLtSpS8ffETjjGPh!u1҃e[^_UEWV6S}t8t%PGPh:{/Q HuɍXuE fɍXuE f HuɍpuEfɍpuEf Huɍpuf ɍpufftjKThRЃXu۸<x1e[^_UWVSj8uu ]S}uuE HutPpP8fmtPpP8ff1ҍe[^_UWVS}]j6uu S\W HutPlP6ufotPlP6uff HutPlP64ftl6f4u H 7utPlP6xVftl6fxVj6Qu S{uz ɋHutPlP6ftl6ff=4ɋHutPlP6ftl6ff=xV1ҍe[^_UWVSPuTjj} Wj VtWFPh}/N M HutP`P0ft`0fujKThRЃXuۺ< HutPDP"ftD"fU HutPhP4fth4fj6jM1Vugљ19ÉE}P HKutPlP61ftl6fˉљ9ÉE|1ҍe[^_UWVSĀE0E}1Dž|fEfE1UBPt"EfHP}1U҉ttmJxk||‹ttujD+PtRx| tt Pxk|@fEMETPQRe[^_UWVSM Au1= V0o=8==#==t= =3=i= =AN=C=-=%c=*x=C===tj=Y=n=j8PDPYSQjPSPPPA APFPVJafAfJ[fAfLKfAfN;fAfRPfAfTAPAP APAP:APAP[P/%ifAfVfAfXfAfZfAf\fAf^fAfb~ArA|fAZjDPQO?fAЅtJtdž-dž!PFPh ~/UI e[^_UWVSL_h] hv pUl8YuPl  ulS0Wu蔇d i0 2i wH1i di wi b i i 1E i w9i 3& i  i86 i wHi  5i wi :i i , i wi  6i(i8} ufNPUxlTuVPuWS G l`EPB=- u9VX+ VX# UfBP@@uHl=u9fFfDžfDžfDžTPVQ%@@uNl=t?fFtXfDžfDžfDžTPlRXZ#lTRP@t lXuFPl<Iu WuQ Wu耏d^d4_uFP@l[lSPuuhSEpL df}=81=t9=71+= =t:=jTPlPCKfDž+G= t#>fǃF=fǃF2fǃF'8tfǃRfǃF Bw<$/fǃP*fǃPfǃPfǃP fǃP t,F9uP9u R9t TSP^ptUB`1e[^_UVSEu uFFfPugFfDžDfDžTRSPZYuCtHt0t t$NNNN @FFF|~u F7fDžCfDžTRSPZYuftNe[^UWVS]8u U BHz1U |t@t <VPE t/ frG~fDž#fDžtTPSRY^VS_ZfDžfDžU fBHftTVSPY^usVS_Zu^fDž U fBftTVSPZYu+PS<^_ut TSP[1ҍe[^_UWVUS8} uha|G@Gj5L_薢Z1Y|t+u0F9D|DPtFPV- u C~1ҍe[^_UE MfPfVf@fZt TQPX1UUVM AZA1UU VS]u9u 12z8u88fB1f,TjjVh8Suq1ukf,ffպ|*,fЋTjVj>j1Su%t,PVCPh{/%1e[^UVS]Tjjj>j0Su ud HutPP ft ff=vfFff)fV19F1e[^UMW VUu  z1^_UU SB1ۃMf$І/ff.mff0aff2Uff4Iff6fBf8fBf:fBaff<fBf>>ff@fB9ffBfBfDffFfBfHfB[UVSM A11҃]1$ /fǃ.#fǃ.fq fǃ0fǃ2fǃ4fqfQf:fǃ6f8fqf>fǃ<fǃ0fǃ2fǃ4fǃ6fǃ8fǃ:fǃ<fǃ>fǃ@fǃBfǃD@fǃ@5fqfDfǃBfqfQfHfF!AҋTjR8RPSe[^ÐUUUU1UU1ÐUWVSPPuF4ED džƆ<H u P21ff@2D H u P4ff@4Vd jjV|tE$Ph`/L fdžN fdžL PV [_uJ fdž fdž PV` ZYu%p fdžr fdžp jPV; [_t E$P/ fdž fdž $PV EZEYx$tWhx/!jS. P'SGf$h/ jWFP&E0f@Pǀǀǀu@` E썾 jh/Ѝ Poiv Ej h #4Ѝv WKi1Ift fdžP džE썾(bdž džHhhRЍ jSs(jjhSsjjhSs jjhSsjjhSs F u!jjhSsjjhSs G u!jjhSsjjhSxs jjhSfsjjhSWs hSsuDudVhЍ, PVhjhu4茻,VuV-1e[^_UWVS\E}4D H uP ff@ j4EEPjuup jEPj4uuR f}EE=xjj蓱ƅXZtgjVYF[tQ~^ES F FUVjREP&$jCPEP$uSjDuu,t V!Gh+G8Gdt VPy2XZEPVuuVW_e[^_UVuSN4fANfaPD H uP$ff@$E tApAl$^9tR^PA$Ph/=$fDŽF@љ$e[^UWVShu] ǍfdžPfdžPV ^4<CQu!*fdž*fdž,hPVY[W 5&4Ѝ, P\e[^_UWVS]{4uDGPD u?H u P4ff@4D H u P21ff@21H u P21ff@2D H u P0ffH0H u P4pff@4pt!D H u P4ff@4yMD ɋH uPff@f=u ƃ<ƃ<ɋH u P4ff@4t(ScD XH u P4ff@4t*VSlYD XH u P4ff@4t*VS:XD ZH u P4ff@4t!D H u P4ff@4D H u P2ff@2tW^e[^_UWVS]D u H ufffy1CPh/'ZD YH u 4@ffB4@D H u EfEfBD H u 1ffBD H u 1ffBj ThRЃD XH uff2j ThRпXD ɋH u0ffB0uLɋH ThRЍuff9uj уD XH uff2j ThRЃXuD ɋH uffBH ufffyɋH u 4@ffB4@D H u 4ffB4<~1e[^_US]uMjjSjjSjjS$jjS / XZE@U؋MfQ}t"t }fOPU؋Eȉ MfANe[^_UWVS]{4ufjjSN D H u P21ff@2jjS#1 sPj SF ~捃, PfgPe[^_UVSuuCPhw/% SSYFpe[^U=UWVSEEU EMUMfEEfB ff=uEU@t }AMDt E)EU 9]};LU؋u}؉tEE 9]|9]} E$[4J$[4ЋU @ H'=([4u ([4([4ЍB([4Љ$[4Ћ$[4Ѓv$EUE @/Ee[^_}t$MAk M@ ffTjUk$[4 LPEP k$[4 fUMfRe[^_UVSE 1B P fP BwA$/ǁ.ǁ"ǁ ǁ ǁP 9u;tQ^e[1^UVSE0hPV] fDžhfDžjPZYt @CCuNCfP uCE؃tt0 tt$KKKK  @CCfP t r tCe[^UVSuVjFTPFP^0 v0dždž<dž fdž"dždžS=+S2KXv džXX=tbw= t-=@t<=trw =tS=tsdž\dž`~dž\dž`hdž\dž`Rdž\ dž`<dž\@dž`&dž\dž` Xh`/SPI$hr3`\FPh/jVhjhu4(Hu h/\` |iʉdžtdžx e[^UVS]hB SXZue[^A UWVS@utfEfEf fEf fEf fEڍEPF0P&Txdžddžpdžldžhf]1\ fE|f]1` j fEt}WV1;\}eEE]Tf]j]EπfEfEExPEPVGEE;\|1;`}eEE]Tf]j]EfEfEE|PEPVGEE;`|e[^_UjEjPUVSjjuVjdThRЋtV[LPjVVtTPjVSjV(jdThRjjVjVZYuKujVZYt6hBjVf@fF0fF~P-FPh /[X tVYe[^UWVSjuVXZ1߉%PjVj@jVfy+@tttFPh/P uFPh/;V93uFPh͉/tV_tV ^e[^_UVS]3FPhw/j!Cp ue[^UWVS E@P%@@l|jPURSE}y"EfHPlph`/W UFu ǂFEUB8t VPYXViPST؋UfBNf jufEEPSEfEjHjSG`(9u1p@9ЉpUfJPle[^_UWVSVVEh} Ù uWS0RuEU =2i w!1i  i t*i tN5i 6i(EfHPUxu8SuuF UBPA@uSEf`PS[_u uuE uuFZ4Yuu:fu/C-|x-uBKFC%=C$4t0W8 G0CG,CXC'PAPh/I e[^_UWVSPPEh} b uWSLRuEU#2i w%1i  i t=i 5i w i tN6i(EfHPUxuSuu S_EPB=yE9PXrPXj|xu ffB|UfzPxuJ@@uu%@@uTtKxuff f ff fB|xu ffBS @tSB^UBPDu uum  uuZ4YuYE@P@tuSZSX14t 8u WWPuuƃuK` e[^_UWVSE@p|xu Pff@|x{u P ffp WhČ/sYf Xt Wh/_XZSSSufu j-E-j%E%j$E$ E'j'V[_FPh/褻E# uu؍P!ZYyQ|xu ffB|xu fhq/h/->f uuVhLEjhu4WVhXe[^_UVS]C4P)ySXsLZtjj8P% j8PVV5hu4qW]Xe[1^US]SY]]-UVSu' jThRY~4F8uP@tKuuFPh/XZe[^UMWVIS}txu u4W8u ffZjThRЃ4XW8u ؃f ؃fBjThRЃ4XW8u ffZjThR[ue[^_UVS]{4uC8u Pff@jjS8PS{4C8u P1ff@jThRЃ{4ZC8u Pff@jjSu SjVS${4C8u P1ff@jThRЃ{4XC8u Pff@jThR1X{4C8uPff@uj2FThRЁX~փ{4C8u P1ff@jThRЃ{4XC8u Pff@jjSjS{4C8u P1ff@jThRЍe[^UWVSu19}}U ZP;PuC6 9|e[^_UjuUWVS]u hR ۉXt jV[^tV Y}e[^_R UWVSEƒx4 @8 uP1@j ThRЋMA0G@t;u0u Wuy WuZ4Yu7E@P@t uFX1!EVPuu,Ãu{& e[^_UWVSuhE& VYHXDu BHDu Bf@uHHDu  BBHDu   B BFQHtDu B Du $B$BFPHtDu @B@Du  B࿉BSS$YZtCPh/褉XZSUHXDdu 0@ @ B0HDdu@ , @ B,HDu 8<B8<HDu 4B4HDu   B BHDu $B$fFP@fFP}e[^_$ UWVSQ}XtfOPfOPpPETu]tSFu LJFEPVS uG8t VPǜXZETtE;Pt+HPDu P @ fGNe[^_UWVSEf@Nf`PHDu % B%BHDu81B8HDu,1B,HDu01B01Pt2`x tjwjW`P `W`P_XTtP# DŽTYF?~L11Pt2`x tjwjW`P `W`PXZTtP DŽT_F~L1e[^_UVSuCFpPhČ/$VRS?Vtue[^Ve[^UWVSP}E0UGP@Hu)DuP4@4< WUDu P81@8EUɋDuP4p4t)_du;_dXu uXu[u"tGht ubY tu,W]XZUHɋDuP4p4<RUɋDu P8<@8<tWXEe[^_UWVS uF0E싾\L<9`x tj jRdPP L%TUEDŽTtUz8R4u 8GfGfB8u]SffX>ftjftɋG4u P>ffX>ftJtWXtW|X tWYfyWWXZy8G4u P<ff@<EtPXe[^_UWVSjjuY_E xvjSXCZtcsU rjRTU B;C C{<)1C<C <F@t;W2u uu貴 uuߵ^4Zu3E@P@tW[1VPuugÃu e[^_UVS]3FPhČ/lCpVFVue[^UWVuS^LfCNP6*fcP~8_F4uP71@7~8F4u P<1ff@<11tgV{8C4uff"EPSEEUM E]USPP]1\UMuN} umw($h/иbdf jh{8ЋC4u f+f %E EEEPSEUfM]UUS]PoG è5&4S#]ÐUWVS]` u C8tS4u PBPS4u P BPBPjdThRЃ{8YS4u P BPBPhThRЃ{8ZS4u P BPBPjdThRXie[^_UWVS]1{8S4uPBPu S!X{8ZS4uPBP{8S4u P BPBPjdThRЋK8XS4uPBPt ɋS4u P BPBPjdThRXu{8S4uP1BPEf8e[^_UWVSQu19}fE}3EPEPuE XSfEtf9f|͍e[^_UWV} S}MlG8uG4uPl@l؉mG4u P`H`hThR1X8G4uP`X`xjdFThRЁX~ցuGPh/Ec1Íe[^_UVS]{8MES4u% `% J`hThR1X{8S4u`B`yjdFThRЁX~؁uCE E/Ѝe[^be[^UWVSuh] \XuSu V} um}cۺbtdKtGt#|tXt4dEf>j7h0~8F4uPX@Xf1FPh/aWb 1"~8F4u ffW? Íe[^_UWVSSSE uE]}h E쀾\YuWSuVP`}uZw*$/иb.d'f jhFPh/>aXZ~8ЋF4u ff<EEe[^_ UUWVSELEEEEUJ8B4ɋUfrPuPDXDtWUɋB4uPDXDUz8B4u P@My8A4u P @ UɋB4uP1@My8A4uP 1@ E䋀EPU}ܸu܉tEfHPE}tDju讦^_  E  EUE҉UtJM뎃}tEx8@4uPDXDUz8B4u PEUPMy8A4u P EUP e[^_UVS]{8C4uP7@71j ThRЃ{8YC4uP7@7t F~؁uCPhn/^XZ{8C4u ƀe[^UWVS0EL=[4EEEhEeElElEoEEwEoErElEdt hŔ/l^XjjE_}X7oUfJPMǁR4uhThRu}̋jWEPdjPEP dfG E@ <@<U(z8B4u P>ff@>jP MЉË9^}=}GuỦPMЋ}EuE7EYuS X=[4EZt h/#]XhThR1_Uz8B4uP>ff@>%@=@tj CThRЁ^~ˁuEPh/MAh(hW =[4t hW/WYjjjjWV5 @u'FPhk/Vjjj"Wj"Wr j WeXZV|Sb|SWVtFPh /VSל=[4t h~/|VXe[^_UWVSVVuEuCjjEY}[7 juVXE@ZuPd7F$FFF jVMU AffX>ft{ftEɋG4u P>ffX>f{tTtWXƈ@tW-YfyWuXZ tP/W^XhEtP[Ee[^_UWVS E ?UMA@t;u0u WuO Wu~Z4Yu7E@P@t uX1!EVPuuÃuQ e[^_UWVSujP ǍCPhČ/GFpSSjV}e[^_ UVuS^LfCNPfcP~8XF4uP71@7~8F4u P<1ff@<tPhdždžX1ۃt(F<PP-DŽ C?~1ۃt(F<PPDŽ C?~ȍe[^ÐU S]HDHuɉ[UVS]SHXDu HBHSH^Du H@ BH@BHSuHYDu H BHBHSLHZDu H BHBHS#XHtDu HBHDu H BHBHSHXDu H BHBHSHXDvu H BHBHSwXPHDu H BHBHS@HXDuHBHu&ɋDu H BHBHSX0ɋDvu H BHBHS YdSFZv ǃddHDu HBHSH^Du H@ BH@BHS[HYDu H BHBHS2HZDu H BHBHS X]e[^UVS]HDu HBHSH^Du H@ BH@BHSHYDu H BHBHSyHZDu H BHBHSP1XHDu H BHBHS%HXDvu H BHBHSX~HDu H BHBHSHXDu H BHBHSHXDuH1BHe[^UWVSuHtDu HBHDu H BHBHVHXDu H BHBHVHXD[u H BHBHVXSdKE HtDu HBHDu H BHBHV]HXDu H BHBHV4HXD[u H BHBHV_Re[^_UVSuHE Du˜Ef;1jThRЃHXDuHRHyC~Ѝe[^UWVS]HM uDu HP BHPBH< HDu`P `JPHDOu Hf%BHffHDu`P `JPHDuHBH fHDu H BH䯉BH[^_UWVS]S1HXDu HBHS[HXDu H@ BH@BHS2HXDu H BHBHS HXDu H BHBHSu S[ HDu H BHBHSHXDuHBHt SHYDu H BHBHSYZuSTEf8e[^_UWVSP}19ufE}^`< uEPEPV< MU u RPVpRPVXE }XKfEtf9f|e[^_UM} HtDu H BH Du H BH HDu H  BH BHHDu H% BH%BHUMSHDu H@BH@HۋDuHBHۋDu H  BH BHHDu H% BH%BHHDuHBHt1[UVSuHDu PH @H jV~ZKYye[^UWVMISۋ}u t!PWLXZue[^_UWVSWWhu } EFFfFWXjPWjFPW jFPWqjFPWdWiEtWOK^y}uW=Ytf ^ujWjWuL 1}e[^_UWVSu] h CCVjPVjCPV jCPVjCPVjCPV$jCPV}jVjVW e[^1_UWVS }`<M ]wEM` uE2atlEtKE6t!, EE EE HDu ف`  ف`1jThRЃHYDu  x%=811CE 먀w8$/оE>70)"SGPh/t8EHDu%=EEEM]u70)"SGPh/6HDuE~E|EʈM]fEuHDu ˆ"hq/h/GWw>Wl^Vhtjhu4EPVh}5T e[^_UVS](s4tjjP t jP4}XZ PV^V>Phu4T e[1^UWVS}1ۋ1 @ u DŽCǂǂ  ~ǁ ǁ ǁ [^1_UWVSQQ}E1 EjVWJ 77t3 ?@ tUD FE ?~ƋEǀ 1ҍe[^_UWVSPuU EʅUjj&Y_uFPh@/WjP耪XCZu FPh@/1CC  jS PPtFPhy/zS贚7E ƌM Ό @@ @$CjSA_x@Xt {K 1󪋖 z tjM ΌpjΌRR E ƐU ֌@ MAA x tjj R PP 1e[^_UWVSEEU h‰UUl1UE䋄hSEp< ;u t'EuuVuF@փ 렋E%?E;uK;ttKU+]苺l9suVuuEpSMEUe[^_UWVSP} Eދ x tj j V PP <0yC@E}?~1}@t #e[^_UWVSuF4E싾 x tj j S PP ]Yځ?EU䋖 z tjpjPRR x@t:%=t,thtXWVEځ?UXZfDŽyM%HtAE@h@t@tuWV tG@ue[^_X UEPjRjEPUBP耣uWVG@ ۉu E@hjS谜UBdXB8Yt SP1'YXSuTXZq e[^_UWVSPP]C4E ; U싃 x tj j R PP ҍBI%H=@t1` u fySJXDŽ` <aw u{ u stfy-E@pt@ttE@tu]e[^_ xEPt@l~t( x tjvjVPP  VPP^XtPADŽY x tj j u PP G ; v; t Ef`P t1UfBNe[^_UWVSQQuhǫ EF4ExZHt`O0DuP`X`utƆbWo XG0utƆbWQ XbKDuP(X(u/ u&`tWC G,XuƆbW- [bu+G,t%G0tƆbMtQIYytbu&4к љP5&4Ѝ PXEZEe[^_鄪 UVS]`uS`X`<t< uqHDu 0 B0߉B01HDu(B(uj FThRЁX~ҁuCPh/S |@=|HvDu 0 BB0 @Du 0? B0?B0HD|u 0 B0 ȉB0`<t< u"HDu 0 B0 B0e[^UWVSPP}G4EE@PHu)Du(B(WUDu 81B8 EɋDu(r(@t)EXdW XE;XduWYW|ZutWXtQW XtAHDu 0 B0 B0HDu B tWXƀt)EXdWcXE;XduWR[WYu tWWXZHɋDu(r(t ɋDu 8B8EtPXEe[^_UWVS uE ju WPP7EEEU;Wxt M9t }-U )ЃEUL$ C}u!ǂK ǂUD CMAEUE];_OE U ΐʋΌ Ό@x t]ytxt0 @~'5 WPP7tdt x tjwjWPP Uǀ z t$jeuMP RR E]1ҍe[^_UWVSE 0jj}輜YXt~v+jSXCZuS蒍GPh./D 7$svjVcFC CV`E 1e[^_UVSQQuEbu IFQ? EÐ҉UxtG:ut;UBu džBEPSYZEPuSv xu1҉Ut$Bu džBF8t uPXZfxxCEÐE; tu e[^ USECPhw/j ]]UVSuۋu QffAuQ 1A u P1ff@u Q1ffAu1fffF~[^US],u'$tSЅZtCPh/ ǃ,1]US],t(tSǃ,Y]ÐUWVS\]C0ES4CVjjjWS (8ujjj"W'>j"W> j W>Y^t1<P<jj$PP= ǃjPEPEj$PsVEf@PǀǀǀǀǀPu. Shjhu4迅 Vh /XZPWCPh`/SPWCPh/!PCPh/ C8pPP_X1xt C8RPPY^G?v1xt C8RPPXZGvC8lPPY^C8lPPXZC8hNtPP0 C8UuRPP( e[^_UEjjuʸ DE^E_tPUfcP"fKPEEEEMy0A4MuPPHPUz0B4MuPTHTUz0B4MuPXHXUz0B4MuP\H\e[^_UWVSu} 1ۃ~0F4uP0@0tjCThRЃ1X~12uFPh/e[^_UWVSj}W] uZ1҅YuS0G4u  P0  X0jWZZ1҅Yu0G4uP4@4%e[^_UWVSju] }uZYuDEx0@4uP4p4Uz0B4u  P0  X0e[^_UWVS]{0C4DuPpHptC4uPpHpt={0C4DuP8H8tC4uP8H8][^_UVSEPu ֯ @FDFe[^UWVSPUE@BPp;t*{0C4uP8H8C4uP8H8u ;_u?{0C4uP8H8C4uP8H8Mq0A,ShEX$t;CHt [0uu h/;CT t5CPjs8s$P4 u?CPRjs8s$P8e[^1_ÐUWVS ]HELU܋ E؃uSYuCPh/Pƒƃ u K4 ƃ@ƃ°I(Јǃ;ǃ:ǃh7ǃ:1҉XB~t | E E@Uԉ} uE}u""}uVFWjPhuuVu MWjEPjuuVu1҃ tD(䈄B~jPu F }uVFu ǃdS/ZtCPhܟ/k1e[^_UWVS0EHUЋLŰ ҉EEu ƒUrh'ThRЃ}Xu UȃEȈPhThRЃ}Xu!!hThRЃ}Xu3'!}uSs}u" S3"1}uSCy }tCjdFThRЃc_~҃}uS C }uSHCH}uS C }uS@C@jj h h\4uuSuj jj }Wh uuSu~\4й  8}uSICI}uS@C@}uSCjj h@h\4uuSu jj }Wh@uuSu\4й  8u"EE}uSCEče[^_UWVS EHEULUEEU E Ed@}MEu"UE"}u U@UB@}u U E UEP }uUE  EUB }u UUJ}uUȃ  EH }uUEUu;} ?E H t}punE E u} EEEU z BE}tǃ@'?ǃDT?heh{ejVS.jjjjVSǠ ,,ujjj"Vj"Vy j VlY[e[^UEjjP$ UEP 1UVS]Pu I 4F8Fe[^US]SzX]]骢 UE7 UEHLuP@%UWVS]Hu LuJLu  ȈB[^_UUuh/L/uu PRUUuh/L/uuu PRUUu%:HLuBÐUVS]C8$ǃ<@ǃ@@ǃD Aheh{ejVjjjjVS覞 (,ujjj"Vj"VX j VKXZe[^UEjjP UEPݠ 1UVS]Pu ( 4F8Fe[^UE陠 UE& UE uP@UUE uBUuu h/uLUuuu h/uXUÐUVSREu] EutIu1jThRЅXuEEe[^UWVSS} uE}ut4jThRЃ}Yu}t t}t }tMue[^_UWVSV]C;Esj VW# 1҅t!sjVuW^1҃tCe[^_UWVSE0xXj`SV 1҅t:utIu1jThRЋUXBue[^_UWVSPUEU} 0xXuhSV^ 1҅t:utIu1jThRЅXuEEe[^_U=@Rt&=\UuE9 UuE 9,Uu1UU B Mt ;At1 QRuPUWVSPPUZ0h9ChMEЍEPu R]ut)|u"jjh 1҅Dt PXe[^_UWVS EEEP0U=@R:rZuRh1IЃ$Pfy jjSVWMuju*ZYtEhSW uh/utIuh/?XjThRЅXuZZjjSVW@uUhSW] t`utIuGjThRЅXuZZjjSVWm@tE@juMY[tMUEPPZuEҠ/Ѝe[^_ve[^_U} uE@4\4h/NXZ1UVS]CCC CC CپASQAS,NCy[^UEpu pp0UWVSuE |vPvv6gt!ttPu V; uڍe[^_U} VSu]t 1҅TSЃ@tu;t5@SSZ1҅t+SS1҅YtC@tu u1ҍe[^US]E ۋM\4t \4BPq15 u] E/Ћ]¸]UVSuEU Tu'~ t!jpS v Y^]e[^S e[^UWVS }EGEG]EC1;CD Pu W u h/$Kwu uuuuNu߁uC&uSBC~u C nC;CyC$9C(}ZCtd Nt$wu uuu:uNu܃u C <C(L@;C$C(|e[^_UWVS0]u~b1}Ĺ SEPu3 1} E̍EPu u]ԉu }u}tVuEP Ee[^_US]Kt3ҋAtBCQCACKKu[UVS]h-/xjpQ XCZtPXCtPXjThRЃ;XSu;Suuىue[^Q UWVSPE E}t>^tkSuW} { t hE/XҋCtBFSCtS1iG$PtFCF^^Yu,CD PuWR uEa/Ѝe[^_ge[^_UWVSE M|_CKu9ȉ}Mt 1ɀu&SBChz/ C X/@9ȉC|t{$t!wC(S$19}pL@9ЉC(|]ҋCtBGSCtS"h E$PrGCG_Xt u u_e[^_UWVSPE U}tE}~ tjpO ^ ۉXtҋCtBFSWO X 71 uC PuECUS$ 1}Cjp O >Xt }tVY~VSV^u u uiXZ>t}EtlC Ed}tJj5&4h/jScEt#ҋCtBFSuYS UE5&4Ѓ$PpXZ}t,} tuu CP FCF^W@N Ee[^_UVu SEX ~ Vh/XVSSLED4EDVuE1~t t\u%Wh/*jThRЃ >Vu맊룃;uQjThRЃ>YVKutSWV kE|4]StuڋCwE9C }uVTFT}uVTFTEf8%u @>;Et h`/e[^_UWVSPEȀPu VufE }uV] F] jThRЃ}XuV]F]jThRЃ}XuV]^]jThRЉfEOXy}uV]1F]jThREe[^_UWVSS}u } uV]F] jThRЃ}YuV]F]jThRZE x}uV]^]jThRЃ}Xu V]^]jThRMXy}uV]F]jThRЍe[^_UEf @U P@@US]tҋAtBQ[UVS] uj@ C)Zt!҈C)CtBSC)t!҈C)CtBSK)fCC-Ct XCMe[^ UWVSuj@ YuvtlFEufSV`YZu@c)StPSK)Cu}e[^_ e[^_UWVS UB HP@ EvjPEPh/Bv&jPEPh/E@,‹Uu]C,vE@EtuUB,QEt E]CE@,@X@(j@ uEÅXZuUB,u~ EH$EP8EPjQEp sEp8R tZPEPh@/~UB,U t X EUC[EP8z t&1ED@PCpjPEp8R 1ҋC;P}D D4CD$D8CB;P|UB$CC@C*s0E4UBC'rJ{uP SuhBЃhV;j@  EK)UCRXEEHu& &4ЉȺәPV<;u 1YAUB~/Bu)uhThRЋUBH^_B~Bt׋ExuS[u e[^_UWV}S1GB9t%@u@@P3W F ~ʍe[^_UWVSSuF@`UЉEU fBf% ]fBBB BMz D BJ tȃȃȀB uB t FD tfJuBtMD ]4ЈBuBufJ EU uY[^_US]tYa)ҋAtBAI)t HAu[UWVSPP}G4_0Ej@ E}Xu 1ƃ}u 1ƃWXhThRNXy}u ƃ}u ƃ}u ƃ}uf fǃWWLJGEWEE e[^_ UWVS}4tNF X P觿 F @PF @PFPCPh/5zO)WS] e[^_se[^_UWVS }G4_0U Er0F@}GBu }F u }Fu }F u F yt5fQu,fQ@@PF W E @(}uf fǃGFF GGU 4@u B<t<ugGE E`f@@F tU EfBrGG@tl thE x,u1t Av ЉU J,v fN@GFROFDG AGFEE P,ETGOFEd}u ffyU fBE @(FFtP}GGu Fv.jThRЃ}XGFwHu In IGF}uf fǃ}u E U1e[^_UWVSQQ}j@ EZuP_4ۋO0u ffEy}u 0tWU tWy t WXNt8t4ZuC(VSW`]4ЊEC(VSfEW]4Ѓ u5 1 u) e[^_UE @=t=uEUWVSV]C4{0Euf fLJfFt-fFF ࿈CGCHCICJ~CKCF{tvfFCFFu F ࿈CGCFKFDGADGADGACFVTGACF~t DGDGACFCFt3}sGun {Gu E f@CF}uf fLJ}u Ƈ[[^_UWVSEx4X0uf fǃE p@'un E f@ uf fǃu ƃ[^_UWVSPPEp0@4E} Ef_0ftO)}u Ct}u u 1Ƀ}uf fdžuG}u u}u tG@)AW+4G9t-W+)ˉOL4G*8ˆEsA9rB)Ã:Ur}u Ɔ_X[^_UEUVSPEu H0X4f~EftN)u u,u tF@)AV+4V9t-ӊV+)ÉFL4F*8ˆEsA9rB)Ã:UrX[^UEUWVSPUfUEM X0x4A*8A+Q0yfAu 1 ǃE H+pu ƉU J+B*u)ȍ)M Au ufEf fUff}tM ABtu ǃu ǃf}uu 1f fǃu ffE f@f}t…uf fǃu X[^_UVSEX4ۋu H0u F-fFEuf fǁu Ɓ[^UESX4ۋH0u ffteu @uuf fǁu fffx{u lƁcu fffxu Ɓu @uuf fǁE f@uf fǁu Ɓ[UWVS EP4p0҉U} u f H"$0/fGfG}G1UZGBFAtDO0fAfAt fG}ufdžumO0faAA }uffdž}u dž}u E@FEЋE\GUBPF]CGt fGCHCFt,9O0u8G,t?utfuyfGxEfGyj P ZYW]CI<fGfa{HuWCJtt'8u3y}GJ?yx E@J0IfGfI yurfAfAUBFBG}uffdž]{FfGfa{Hu{JtCKu AA $A 1һ]4Њ}8GJvBCv QQ}Au }A u A%PQu E}uf fdž}u Ɔ؍e[^_UESX4ۋH0uf fǁu ǁuf fǁu Ɓ[UUWVSWEM Euy 1ۍt ABABABA B fAfBC~̃}tM u^[^_[[^_UWVSPPuF4~0EEu9jKThRЅX}uffLJEXdžC(}uf fLJjdThRC=_tf tF@tAk=t=u]fCUtKE9C0;u K)SVY[u,4@u SVzC-E@SVXZue[^_e[^_UWVSVVEP4x0Ut vP#Y[}u fff%f<Eww‹U1uPEPEPh/iEF t ^3^tf{tUfC^jR-XZfCC(}u E UU}BBu }Fu }F u }uf fLJjThRЃ}Xu Ƈ؍e[^_UWVS U EEUB04Ef`uU UUe[^_ChP!&UB-CXY*<t|4titT0"(===UBUB)t C,t!u8{4CXC,zC,qE@)uaUEU Ee[^_WUfJ@EUE Ue[^_6C,'CXCXC,CXC,C,S CzrtAC8u9{,C u ``ujuUDŽXZEPuuK_X]e[^_ UWVSP] u4j@. EK,XtS0!C,tJGhP#$Xt:V8z t%G tPCpjPv8R F8sPP_XC)t!҈C)CtBSC)t!҈C)CtBS1{4@{󫍻8CC*C+C)fCCC-C(ǃ4C0;tCEEe[^_ US]tH)PSVXZu]UWVS]{4s0j@ KE[uf fdžu fftMe[^_m UWVSP]C4{0EhThRNXu}u Ƈ}uf fLJCEtCEe[^_ÃCES|SǃCE^_]e[^_UWVS] Xu{C41K)CC-C8 C C*C+󫋋4CA @ɈCC C't&Au Aי&4PAhP _XSVZYt] ue[^_Te[^_UEU x4PG@F@0uf fǀUWVSSSuj@ EEY1F<@ C F<@ 4CF<@ 8XCV8Pjjhj hRRtFPh/aXZ6}~CE\}bEEe[^_ UEx<~@<ElUWVSWW]u S4ҋK0`UCD u tKD GKtKDfs@ǃǃǃǃGJCBOMCCCES\E^ECB9EtF1jjj‹E ҉t1EB B BF~EE}~fCBfCjCD CPCPCTЉfCnCxH]4ЉufCl]e[^_UWVSPu ]}u hjSV:u 1ƃSVYEXPEPSV^GEyjjSVu 1ƃSVXZu e[^_UWVSQQEEEPju V}WE}y u VWXZu VWYeM[yu ƆVWXZu 1ƆVWY[u ƆVWXZu ƆVWrY[u ƆVWSXZu tu 1Ɔe[^_UWVSS} ]uu EEPSW3 FEyu e[^_UWVSPEPj] SuV1Eu ƃSVeYXu ƃu tSV*XMZyu 1ƃe[^_US]ۋM u Ɓu y[UWVSPPEEE}] EEEt u SWwYXu SWQXZeMyEE@t u SWYXu SWXZeMyu ƃ] }e[^_UWVSPPE EE]EPuS}s 11 @ff?vf4CCCCCCCCC 1@wv1@ vfC~11@ff>v4f)fEEEE ]e[^_e[^_UVSuFDN0^4tqau u Ɓu Ɓu 1Ɓu 1Ɓuf fǁۊFBu u 1Ɓu ffu ffu fff u ffu u Ɓu Ɓ[^UWVS ]E s0s4`UPS8EjPj}WjhhRR$,tPCPh@/S8jPhuWRR,t PCPh/XCU VS _Xth@/ЍCv kf"k ff=0v` UWVS E U8RWuUup ƔG fEUfDV1҅jjjk1jx GPUL u1҅jjjj_PuP u1҅jjjj_PP u1҅teh/h(/41P1?t jThR^EUx{p ukB/Ѝ2 kB/Љ 0,ve[^_UWVSWU”EU1҃U 1һ/Њ<y9t ƋE4 /ЋDB7vˋU ByNjjhFjUZPEL W1҅Sjjh"kU f1f=\wf={wf=wf=jjhjUZPEL W1҅jjhjUZPEL W1҅jjh.jUrPEL W1҅jjjjUrPEP W1҅tTh/h(/21?1ҋExrX uk/Ѝ k/Љ 7vȺe[^_UWV1} S}wqwl1?t jThRXExHsu"k/Ѝ kM H/k/k] X/Љ ?ve[^_UMVSf<] <~1f4B@~fBf ff ff 1fDŽCT @?v[^ÐUEZǀ, tǀ0 ǀ4 ǀ8 ǀ< uǀ@ ǀD ǀH ǀL nǀP ;ǀT :ǀX ǀ\ ǀ` ǀd 3ǀh pǀl ǀp wǀt ǀx ǀ| -ǀ Jǀ mǀ ǀ ǀ #ǀ iǀ ǀ ǀ ǀ ǀ ǀ ǀ ǀ ǀ ǀ ǀ aǀ ǀ ǀ ǀ ǀ ǀ ǀ ǀ 6ǀ Vǀ ǀ ǀ ǀ ǀ ǀ ǀ &ǀ Tǀ ǀ 6ǀ ǀ !ǀ /ǀ 9ǀ ǀ$ ǀ( Sǀ, ǀ0 gǀ4 rǀ8 |ǀ< ǀ@ ǀD ǀH ǀL ǀP |ǀT ǀX &ǀ\ ǀ` ǀd 8ǀh ǀl ǀp ǀt UVS] SjjS1HKɋSu @ @ЃfSu fSuИ ǂИ1{SHu€ ǂ~Ճ{SuujP`@ffǃǃǃǃjVh43jjVS9$VSSڍe[^UWVS] ۋ}uGu @@jThRЃjSVh@WIuGuP1@e[^_U}VSu ]u)jSoZYuhD/h/hThRYjjjS\uhD/h/{Su11jS^Zu hD/h /mhThRjS u hD/h`/GhThRjjjSu hD/h/jSZYuhD/h/R+1ҍe[^UU Et wJu < 1UjuUWVESuUjBPPV 1҅E F V1[1ۃ}uf/fyf=vZ/Ѕt$Hu!~f/ЋNu Ѝ 4,~Nu/Ѝ //Ћ/Љ G vhThRЃ~YNu ǁhThRuVP 1҅~Nu ǁhThRuVuV71҅@t.jVojVTujjjVH 1&tWV[Zt$G&9|~Nu#$%%Wh[/h /0)1$%$e[^_UWVSVVuF 1trttTR QjEPHP.jEPLP.~FMu ~FMu ˍ ˉ~FuP(x(e[^_UWVS ]{Su h`h`hKɋSu $E $UɋSuE$%E%$hThRЃ{XSu  j ThRu S {ƋSu ǂhThRЃ{_Su%%1҅.KɋSu XXɋSu \E \UɋSu hE hUɋSuX  X{SuE%\ ?E% ?\{SuE%h E% hjThRЃ{^Su  j ThRЃ{YSuԘ! ǂԘ!{Su%%hThRu S {ƋSu XX{Su \E E\{Su hE E쉂h1҅tYu S_Z1҅tH{Su hhh{Su $E E艂$e[^_UMyQu ```jjjh`QluE Phm/h`/$1҉UWVSu~} Vu ```jjjh`VuPh/h/YhThRЃ~XVu ddt5)ƒvKPh/h/#1e[^_UWVS]1{SuJ uB % B %B sSu dd} uIu (%)Su dd{Su B B [^_UWVu St rw 1 9k0U1( 󫉲,}tuSu Huڍe[^_UVSu] &19ËM}>k0,u1+A<ADA@fA f4[^UMU &9sk0DŽ,1UWVSU ii0 0\fDž4Dž8Dž<fDž@DžDDžHfDžL DžP}DžTϏ}fDžX@`fDždDDžhDžlfDžpDEHɋPu DDtɋMQ]4u DD8xfDž|E oE# o1UzxRu"k MȍH@ƒ}uAA k Mȃ}HpuAAv[^_UWVSP}M &19k08(Ex1,PUB PW uv 9s 9rUJy@HWu! ؃   ؃ e[^_US]U &19s?k0,t rw 1 {ЋCu[UVS]u &19ƋMsCk0,t rw 1 1{ЋCu [^UWVSu} &19^ۋFuPHk0,twHt Gt$@?ۋFu P, @, "ۋFu P, @,1~FuPH[^_UWVS]} &19sgsCuPHk0,t r$wCuP,1 @,1{CuPH[^_UWVSQM }$}] u(Qu EE%A;EEE%A;EEG v t%< ؉E0t E0t E0t @t  @ rE0 t e8E8 BEEZ[^_UWVu U1~S%^9ЉCu}tf}tK[^_U1UU SZCu${JfB"%B'%B(C%fB C% B&B%<B*B$fB"utB$tJ$tJ$1[U1UEx@uP @ UUzE Ru B UEx@u P@UVSu~Fu P @ j KThRЅX~~FuP@u1e[^UExPu hh࿉hUExPu h@h@hUVSu~M ]Fu PP~Fu TT[^UVS] 1?UwwBv7rCuT 2T ЉT3ruPپ ًP ЉP[^UVS] 1?UwwBv7rCuT!2T!ЉT3ruPپ!ًP!ЉP[^UEx@u LLUE Ut zRu LLUES] 19‰SuE t S[UM SYCu $fAf%fA A%Q&A(A)A*C%fA"A$Ct %~ A'A'Cu4tI$CtI$CtI$C%A%CtI$1[UUU1UEju HPUVSPPujHP] SjEPSjEPSEE$~VEu ~EVu e[^USPE P]*EEPjuHu 1]UVSMYۋu Qu @@vt  @ @ۋQu @@[^UWVS EjfEEPu ]ujEPE P{SEu {SEM썻Nu%? %? jWu 7 f}uS e{Su*$ft% ($ft% $jjSs e[^_UE WV1҃SMwVyYu$@! $拃@ֺ! Љ@[^_UE V1҃SMwCyYu@։! ⋃@!Љ@[^UM Uw zBu @@/UWVSQ} }]wRwGu @@EM !E ]Gu @E U@Z[^_UWVSVU uЍ  À̀E~ӋVu @@! MVu@}u }u @N~Vu  B B [[^_UEx@u llUWVSMYۋAu pp1ۉNjAu ll1҉ [ ^_UExPu$ $ $UuUPEPj=u! 1҅u 1f}Z‰UWVSMu yA~u yA^u 8FyA~ u FyA^u 8F yAu F[^_U1UU tV1=sSuw8~u^v,RY^v,RVXZe[^UMyAu q,%PUWVS]s,hu _Z19{Su=s,VwY{^Su % ȉ:s,V>X{ZSu % ȉe[^_UMyAu q,%PUWVS]s,hu _Z19{Su@s,VZY{Su % ȉ=s,VY^{XSu % ȉe[^_UMyAu %q,PU1} UUWVu f?S}w=1҃ƋOZu1ǀ~[^1_UU 1f?Mw1y‹Qu  fy1UWVS u 1f?]]} tD tjEPCPjEPCPEjEPCP}jEPCPnjEPC P_$jEPCPMjEPCP>E[jEPCP&jEPCPjEPC P$jEPCPjEPCPE1U1ҋEMxyƋLԍZu88vuPue[^_UWVSQQu 1f?}]u4jEPSKjEPCP<MƋWMu MƋWu e[^_UWVSPE}fEOɋuGu } t}w } t} t=} t NuKɋGMu@#@"NuɋGu@ ǀ@ɋGu @1 ǀ@Gu @@t5hThRЃXNGu @1 ǀ@ɉ ~1%E G$Gu e[^_UE@$UU1UExPu%o%oUExPu  UWVSQQ]{ M uuEEͰEʍ]CGt_u S0C0_u S0 C0C0_ukE  % kU %  EEDu}u E }uE_ukEE` kEE `_ukEEd kEE duЃ_fFu D8 D8 ЉDUMЃ_fQu%h%huUЃ_fDruSh/h0 e[^_UE@UWVS]{u Su$1B${t'@t @t/{Su¬ p p{Su  {sSu $B$[^_UUSftfǂfǂfǂCfÃut0ffǂl fǂ ftfǂ|Ƃ& [UMyQu$1B$} Au?QuT ǂTyQu  @:@;Qu T1 ǂTyQu  俉yQu $B$UEx@uP@ UVS]{E Su ` `{Su ``` NKɋSu ` `t+u3ɋSu ``‹Ef1jThRNXu<e[^UVS]{M Su ```{Su ```{Su`HDH`'jThRЃ{XSu ` `t1Ҩt Nuк<e[^UWVSDU]< vRh/h0;11T 3‰ Pu SGU1҃ {J{fV fT Mu( % lj(  % ‰9U~{f {f f f fMu/4׃?? lj? NjE? lj&?? ‰? ‹E? ‰4{f {f f f fMu/8׃?? lj? NjEЃ? lj&?? ‰? ‹EЃ? ‰8{f {f f f fMu/4׃?? lj? NjE? lj&?? ‰? ‹E? ‰4{f {f f f fMu/8׃?? lj? NjE? lj&?? ‰? ‹E? ‰8 Cu {u <|LJ<|{u<< LJ<<e[^_ÐUS]Hu. tSЅZtCPh/ H1]US]Ht tSYH]UWVSDE jTPE P]u ĉEPE ( $ PS]a,0 uuh 0V $Eyx t"h ph`0V#EPffPPj3ZYPh0V#PffPPj2Y_Ph0Ȃf,ft2PffPPj2_ZPh0节U 4 0 5]45]45]4R3ES ]4ЋCju ]44ju 4ju 4ju 4$u EYtPh0V" {u E hP?u E hPu?M ǁEЉǁDЉHǁ0\Љ4ǁ(,Љ,ǁЉǁ}ЉjjSD U  @Euh0V!XZ1}Ĺ EPMjMSD UM L @eBU~fFP"džxdždždždždž dž dž St M 4  4 PSE VVdž ЋU  dž Љ dž 'dž cЉ dž*Љ džLjPh4 h@hVjXjE V P M 1Ҿ@ǁ @ЁDŽ M f f ǁ@ǁ Ё U fHf ǂ Rhjhu4M ,@uȃPh /~^_u hU DY[uЃPh 0~_Xu"$5]4e~$h0~uu 4u M H13uh`0V u ^tS0 [E 4 Ee[^_UWVSuu V)P[H~0XtXjP WWV0 P0 W[W蝤Sj D@hu4e[^1_UWVS]u jP ۉYt|SVjV9XZ}e[^_ US]C0PpX tu S[X]UWVSu^0CP} t,S YtWVXZCP@t]e[^_e[^_UE0UUWVSQu4 ~00 t1GST Z1҅5GPAAUX tRSjS` RSЋ| #UY@U_tjS` j,(! t%jS` j40t,PS tdž@tjS@ _XEtjHDY[E@tjXZEtj_XEtj[^e[^_US]C0@Pt h0P XZ]E ]>US]C0@Pt h40PYX]E ]UE0 u ujjP Uu uZYw'$01,@%PPh0hP0nwUEEUWVS}0 WEGƅ_0XhjP SEb8HTfD fPuU fRSfE!fEEPjEP uU4 ,uuh0SW' XtWƅXth0WI%Ythh0S?XZLJ| q u LJ| q| uU` fKP@ǃ BlPS;X t PW,_X tjjjjSЃ u e[^_UWVSQ]30 jPO EfCP@ZfCPfCN4 u jW` ZYV"4 XuV$>dž@t-Bu ǃBRXV jjS4 ujjjW, V6XEEe[^_ UWVSWW}_0 0 fRSfEjVfE` W"W7#EP1} PEP V4 ,uuh0h 0S<W$ Pl| V` W #th0h`0S S ^uW [e[^_UWVSE00 N0UM@P%@@4 jP^ |XtҋGtBWQG [uEfHPU苚T t CT ǂX M胹 t)EtCUu@ǂ4jP G8 $ Y CMA8Alt SP訊XZEPSuxZ uZdCE\ CESCU%PuuM dMAQXSWuVtPjP G8 $ E@pEY/PupRXZdžxUfBNe[^_US]Sw4ZuCPAAuS+X1]UVSuFP@S0fFN4 uxxt/Hxuhw/V(jSjFpEfFN u( u S*)Y[ShRS ue[^e[^UWVSPPE0} jPEt 2i E^0Xw1i s~ i ti t2i UfJPUxu RS-_XUBPt#@tV4 uu}[u Su薻 SużEZ}4YuyE@P@tiVTh<UrPy EIuWu6 4Eu2UBPAAu t REX jV^_EuT Ee[^_UWVS$E0 X0E uEPV XZs1}ԹREP Px  E  E 8EjjEPEPV$ HuEЃ}c1ҍe[^_UWVSUB: BZ lj lj 111zB  B lj 1Љ111?u  [^_UWVSWWEX0EtR@E}utE @fKP%u uUY҉U^tJMfcPe[^_UESX00 P Ћ t tCQt ]UVSPPu0 VPS S8 EPVEEuuS e[^UWVuS}v Vh0lu WÅXZt vWSYC^u S1Ze[^_UWVSE0EU0 U}{t&, sPPs CC u uz`YE^uE KU, jusPPEtuUC@tPh0h0k}{s E E uU4 tCC@ F}T uX h0kU  P&t P'Ɉкu"jjRjjjPjF( %=]uсA wQB( SS CjvEPdDž  U, jVMqPPE,jjeY_uU$VK^fFf%VfCFCFCFCF C CVSC$CjSCuM(VS9 #svjVVCC U, jSMqPP$މt E4&UB@t?Ph0tM4VoUBxuM0 E, z tjMApjPRR EpU PH ET uX h0nYDžƒ tt>V%=u Dž:Pu Dž)=u"Dž%=u Dž1LM TXЃM\ u*Rh0ELV?w t5M A4 t,ÊT'L&DžE\ÊD&DžDžBtDžMP( 9~DžMTu6 t%PjW fADžƅۉ\)D&t T't!SjWWku!SjWAM uD t VPnXZM Ɓ tƁ t E U DXM Ɓ  Ɓ fFf%VfFFFF VSDžtE US mPWt MP Pj Pjà jVe[^UWVSWM Q]ꋃl f\PTftPbf|Pptfff fffjuPju]uWPju u@Pju u)jju| uhjudà ju8EY@ ^D uhBhe% EɋMD uhBhhThRЍe[^_UWVE Su]  ÿ @ D uP`X`hThRЃ@ XD uP`@`tOy1yFPh 0.<e[^_UWV}S] } @ D u ǂ@ D u ǂ t@ D u @ D uȁ  @ D u z@ D u @ D u 1 ǂ[^_UWVS]0CP@t ju"^_U$? tCQt@MEEEtbPU}uuOjusƒ DEZEYtPUM}ufcP!EfKPEEU@ E싒D u œE@ D u  E EU@ D u0B0h NThRЍe[^_UWVSE r#@ ND ~FMu+R#  ŠE ‰Љ$R#  ŠE ‰]@ FD ~uȉ% ! ʉUfFf[^_UWVS E ]UEuU19щEU@ D u荖  5]4ThRЋU胻@ X DD uɍ  Љ5]4ThR;}^j@ D u tuuCPh`01*1;us6]Ph_.F)әXYu hn 1)XG;}rʺәtEn 1Ѝe[^_)e[^_UWVSLE0EU@ ǂD u 1 ǀE  }1UU1ۋUE ~DtDD D I }EMyE@ UۋD u @ UۋD u Uǂtu Eǀj8EPhue[^_UWVSPPMUEM P} u]Mt@t>(=u!MM]Eu} Ue[^_huSPVWRE e[^_UES1] t-;uuh\ 0PZY1Ʌt ȋ]UWVS$Euuuuu uEE U EPEPuUB)ER- ;UUЉUEr uE;Es EEUu ##EPuZYb}y M1ɋu1 ƋEЉ׋MMЉ1ɋu؉1 ƋE׋M11 )W}VZ0x #4PE܃Ph 0J&}uuj^_uVuNY[t#E#Pek$E܃Ph0% E Vu _Zt8EЉ1ۋM 1R PE1ۋM 1R PE܃Ph0%U zVuY[t G Pj$E܃Ph 0h% E EB)E@B-u4juuUzWu;VuP_ZE#Pcj$E܃Ph 0$ Vu[^tXU #P&j$E܃Ph< 0$E#Pj$h(.$G Pi$hR 0$uE P uIjue[^_UWVS0}1"]󪋓 B6EJ6}ōr7B6љPEPhSe[^_UWV}1 U󪋲 FWENW}XEj Ph"Re^_UWVSE0EUi  P6@WD/EE@ ɋD u UɋD u EUɋD u %EɋMD u U@ D u E U䉐} *M1h y E tU t tE ]4ME fS2U1f fs2 Eslui } EM u[@ _D u U@ D u E U쉐M@ D u E U艐M@ D u E U䉐e[^_UWVS} ]1@ D u @ D u U@ D u 9tF~[^_UVSu^0 t u7 t.EPEPVLEMEM苓 J)E B- P)U@-EUE H2 1BU]1)k @ D u% % e[^UVS]0jP| XuSPXue[^r UWVSE } 8Uu1P)LJd jWuju `WZQ} M $t 0hd 0h 03&4]4кљPP+^XE WWW7U totj@ D f u'f@2fE1҉fu ȉ f@2fE1҉fu W[} t PY} uU tujjWXZuu u }u } uW3X؍e[^_UWVSPPjE UjY[XS Bt#tPhx 0BfB BfBfCffC {1kCCfF8fCfCCfCtfC C0FPStEfCQPh@0| XZPh`0a S蛍 i tfKRNjjcYXt~vjSĜXCZtsvjV%FC CV"ރ1ۋH hVH Pt u9BH x tjrjRH P k } 1;x}t;t D BD$u BGC;z|u h 0gH H@G<~CH y t))jPR H Q 1ҋH y tjPR H Q 0Ay BA+B@u G8ɉt%tu EfHP9HC=~:H z t )jPQ H R 1ۋH x tjRS H P  C=~4H y t )jPR H Q 1ۋH x tjQS H P @ D P}}fOPH H PVՈ IWPh0xV貈&MAp}GpE@p@ǂ8 MfANe[^_UWVSP}] jPk Es0XtAt;jV ^_t'jSY[FPt tjSXZVXEEe[^_! UWVSSSE0EF(} ^0u @jPٞ 2i EYw!1i  i tIi t]i EPB=v EE9PXPXUfJPUxu RSfXZE@Ph t tnVFqtvju[_hu SuJ Su LEZ}4YuGUBP@t7VX.uWu1 4Eui tuEXEi t uXu躝 Ee[^_US]S諛4ZuCPAAuSAX1]UMi U uBBÉU MbUWVSu  } Su@B@%t ;Su@B@jS1PVCjSE ]e[^_US]E S9t{t(rtKmtrfuajSYXE tIrt@E ]]NE t sjS6XZE ]]Y]UVS] uSV]^e[^UMSۋQuPBP3} tۋQuPBP[UMSۋQuYBY} t@࿅ۋQuYBY[UE  QuTBT} t% 9QuTBTUVSu>FuP7@71ۃ>FuP7@71҄t$j CThRЁX~u h0<e[^UVSM9u AuP@@@u M[^fUVSuۋFuPPHP?@ۋFuPPHP1ۃ>FuPPHP1t+hCThRЃ1X~iSu h0<e[^UWV}SwV S0YZu=VSX XZ uRBRɋ u RBR1e[^_U1W}V19Ss/] Sjjhj@huURuF(9r׍e[^_U1W}V19Ss/] SjjhjhuURuF9r׍e[^_UWVSu19}sU DtPWWYXC9re[^_UWV}19Ss ] t PuEPXZF(9re[^_UWVS@}T EЉỦ]ȍ $ UEĉ]E 遧Tf@<% 1fw1h0  Ƈ LJ FәEEЋKEtL.F~fC/UȈ]Ћ@@tẼUЋ@2u]̃ UЋ@2t]̃ UЋ@2 ] @ Uă wi$(0иp0u0n0E0`0E0R0E0D0E#06@0E*0(v/Ev/]3h10j ]S~؃Ph@0^}XtuhK0Y[ t EBUЋ@tru!]EU ]e[^1_UWVS1} 0E8@uPPXPE tUfBEMfAE0Eˀ8@uPPXPjjUBP]M Ɖuuh 0 EfP1MfEҋARjEfVfEEPEEPEPEPfEfEfEfEfE u'uhT0Ej0^U/M9Au ?PP?XPuusZYu1e[^_UVS]3M SuZBZtwItt ^4 SuZBZ[^UEVSu tqr t-fDhSfCX Z~fF:hj蝎fF8Y[fDhS耎fCXZ~HfDhS[fCY X~# fDhS6fCX Z~e[^UE8M @uPQ@Qtr uUWVSu>] Vu VuRň CKKSCT0Љuuh0S3=$h 01e[^_Uuu ߌH@ vRhZ0hn0GʋEPtUS]E@E@E@E11ҋDADD ~[UVSM1ۍA;YIAA s%1A@Q C(;YA r[1^UVS]s`S 9X~e[^UWVS}] uW9v0O y t)ډuRPwQQ G))1ۋW z tuVPwRR e[^_UWVSu] }9v-N y t)uRFPvQQ ))1ۋF x tuW^SvPP e[^_UWV} Su;t/V tjCpjPV҃sVV3y 9~e[^_UWVSjj}u 谈YX7tZjSXCZu Sy7=C0C C>t vWWZYjSvWWt SOy1e[^_UWVS1] SuhƅXZtVWuh0 G?~ҋE8e[^_UWVSQ}GUH9Uu ӋF@ C@ tW z tjFpjPRR W z tjEjPwRR e[^_UWVS}1;ws] uVSWFV;wrGe[^_UVS]3M Su7B7}t !ȅSu7B7[^UWVS0E,DžPj jM<э, P p@ɉyA}j jjD8XAH2% t)PEPh0UwM` %v PEPh0`El0fyU d%0=0tEPh0[^:M z tjApjqRR , E Vfhuffp>UɋBu P>ffp>ltuYftsމ؃t PWXZ%t PW{YX% t PWXZtWXf0t%0PW^X@tW[E} He[^_UWVSE {0 STjjW xH Fu P<1ff@<> Fu ƀjj Q , VC0P B Oy獃, P `_} XtS{^Ef`Pf@Ne[^_UUrR0tr 30t.C2UWVSu>]FuPTHT} tr} t"u0?t$? tFuPTHT[^_UWVSu>]FuPTHT} tr} t"u0?t$? t@FuPTHT[^_UWVS]3} MSuTBT%trt,u8 ?!t- ?t"}t  2SuTBT[^_UUWVSPPEE]E }uE jSVWuSE`E ]e[^_oUWVSu ]9\u1O PjVSVd$Nj PjVSa(u\ ǃ\e[^_UWVS u ƒUE^0 plSz=YE_uh|0h 06E;u1Vjj  Wf plSwz@ vRh|0hn0juu싓 BlPPrlSTP@ PdW+ tFPh0XZUjj WVR؍e[^_US] t> x jSSZYtPCPh0z ttSX ]US] u.ptSЅZtCPh/-  1]UES  Q u@B@ % u % %9Qu@B@[US] fǃh Au Pff@>ltQY]UVS]u  jPq XZ uXBXw$0Ѓ ɋ  uXBXE Me[^ UWVSE EEEM T]0 twt#u#\E U fCPfCPt MCQtEfKPi҉UtSJM}uuju(ʸ DEUY҉U^uE#E@tCQtEEEU:ERuBE8Pu EEB U:MRuDBDe[^_UWVSPE8W0WUÅۍ Xju)M BljWWJÅXrWjV  FuPX1@X tFu P,f@,Fu P,ff@,jVjV>FOu ǀQ V~ >F( uPxHx>FuPyL@yLWSW(Wjj VUfJP@Mǁ >Fu P.1ff@.>FuP21@2W=jWFE ‹ujjRjjuGPh/f؍e[^_UVSj]S3XZCuPQHQCuPQHQ3CuPRHR?ɀCuPRHRjS e[^UE VuS$0Ѝ P]CPCP# [&4кљ}PCPM&4Љй }QCP'*# PSe[^UWVSSEXtЃ1t1с}t^E00t t PEʳttE 0MPu! ؋M QuY[^_UWVSujPx SNJC1҃CuCucC9Ct PS Wx &4к љ}PPƚe[^_UWVS}jP5x sƍ PSV-x &4Љй}QP`e[^_UVSu V]h8"ЍCP#Vh"ЃSe[^UWVS }Eu jPE0w 2i EYw!1i  i tFi tWi EPB=v E9WXWXfOPUxu RS!XZUGP t tkRltrjW^_fu Su# Su$EY}4[uEGP@t8u~Z-uVW 4EuE t WEXEuv Ee[^_UEES,  zM ]txu1[UVS] {u tuuuu@u f11 tAuCAKEQAȍe[^UWVS}7 _Pu+Suuu jPVgU1҅ Suuu j PV\ uh@0[Xu Ytuh`0EU 9BvUf u uEPV[1e[^_UWVS0E0UBP%@@gDž t DžPPPPu@t֋ xGPEPPpR yp Džt+wHYDž~^Z Bt~6 tt"  9B~  u%~u %@=@PPG P_S P PrV蹽$@5fCfFCG {t @GjrP t ^XÁCS @lffC @lf@fC fBf%VfBB BB RVDž vmVDž@@1ۋw;Z}u|$Pۉt JD BD$B F1ҋ6C;X|G GO@ W@  B+ABpjqwW@ jjwB Bu BB @8x 9t#@UfBN ɋ u  Cɋ u   PUV 0P@e[^_UWVSSS]3fCN E@ H@ u|, tyuC$Ph0Cp   Uu ƀjjukVjjuYfS fCNE }U]e[^_cme[^_UVS]0jPVl XuS*Xue[^Ll UWVSPE]} fE 1҃;C :ru T.L.~jSfuYf_v;Cu PpffHpf Cu PpffHp;Cu Prff@r;Cu Pvff@vjSEX;ZCuP_1@_EE ]e[^_UWVSu u SY} Xu PǃujMu jSUXZSY7} E $0h0h 0Ot 1#jSXZ&4^4кљPP wt$0jS V躿uCPh0Y_(@uB P2R#PS S3XZ} t PˌX} u tu C0PXuu V|e[^_UWVS}ۋu WuJۋWuB9sI1ۉ 1[ ^_UVSuu PYYRPu ^0S(4uP ۋ u ۋ ^0u jjS e[^UWVSSSEuE}]EWuSuu VPtÀu- u$ uEE E}Ee[^_e[^_UEPUEu PUS]SSf4ZuCPAAuSlX1]UM U uBBÉU M hUWVSP}] jPg Es0XtAt;jV`xY^t'jSXZFPtxtjS[_VYEEe[^_g UEj0P UWVS]u} Sh3jhu4lhu Wh /XZSh63LiFZYu} E 0Ѝe[^_e[^_US]t Phu4jhYXCt E]Li]US]U CS[CC jk(jR?. C t1҉Ћ]UVS], js/CX NZye[^UWVS], E@E@E@E1tVIYZu G ~CC<"C\DC|e[^_UWUM} z EBEB1U_jUS]Pp jj@@ PP@ Phj@@P P|P@ (Phj@@P PKP@ Phj@P S]UM A S]w$0Ѓ=^4t8JJЍAwu$@0R P9 R Pǃ`'YZHjR Pǃ`uR P ǃ`Ѓ ǃ`C1 @ЉX]UWVSM9] Au PD@D9Au PD@D1AuPD@D%=uAuPDXD[^_UWVS0uF0EЃ dž  uP@@@%=0t@w= 0t2= u0Ѓ h0j]SڃR^Sh*0 LjPjDWjhh RR$,t PSh0dž  @jPh LWRR,t PSh@0FPdž  Pjjh jh RRt PSh0 8Pdž <N` P 9~዆ jjh @PPP tPFPh0dž VZ|dž V@dž _, ,1ss G ~dž , j@P tPFPh0dž V[ dž  uPD@D@t NQTPM  S@xdž VYt uh@05 dž P V duuh0XZdž S( Y$ _uu̍$ PSG u̍P$ _u̍PShEF^0dž C$FC(FC,F C0fCP"v0ǃd#ǃ"(ǃ-ЋEǀ ǀ ǀ ƀƀƀ ƀƀVPSS2VMЋ||ǁ/ЉB ǁD2ЉB ǁ 2ЉBǁ 2h3h2SxYVh.ЍP9Eэ(эfdž@džfdž@dž jXjSPVu̍Pdž PFPh0 Ve[^_UWVSu  $$d0j^0SVFPPPSVS2 ddždYTfdžXtjP1'džTXZj@, P Q ~`< D  ` 9~VX PPP_X PPPY[ h @PP0  DLPRR( dž e[^1_UEPUuUREu PPUEu PPUEu PP UU ERPPUuuEu 0PU}MUE t@ u EE MUWVSS] }uE{ tπEC$ EsjV s,jV sjVs sjV] sjVG s jV1 uouu3VuZs(jV  uHWjV u8ujV u&sjV usjV u1e[^_UU RjEjLP}UUU VSӉЃ SRXZSjujLVEu8hPjjV/u"hjjVu jjjVe[^UU S]KL@tru AB{Tt PjjQ]UhjEjLPU1U} zT@t PjjBLPwUSj]SYZuhThRjS]UExTDtēRjjLP$UVSjuvVhAjj^LSu0jThRhEjjSujThRjvV1e[^Uh jEjLPUUW1׹jR"}UWVS]} 1SZu5F~WS^_u"SYu{Tu]e[^_1e[^_UWVSE]} uPSZYuUv>jSZYuBWSZYu5S*Yu*S$ZuWSMY_uu ]e[^_e[^_UWjjjX1 1EBTBB=BAB?B ?Bp@@@@ d@@@@@ G@$@(@,8EBLE BBP׉}UU M` Lcw RjjQUUW1׹jR }UWVSSE uE}jjj^LSjjjSwupWVxZYuc1v\jjjSPuIuVI^_u:hjjS+u$EEE ]e[^_e[^_U1UU MLv t1PjjQUWjjjX1 1EBTBBCCBwDB xCB~D@@@ d@@@@@ G@$@(@,EBLE BBP׉}U1UUW1׹jR }U1U1U1UWjjjT1 t<1EBLE BEmEBEB EBfEЉBP׉}U1UUW1׹jRt}U1U1U1UWjjjT~1 t<1EBLE B&FFB-FB 4FBEЉBP׉}UWVSEEEEE EE$E}E] uEWSZYucVusuuMVS\ZYu@uWVS%u.EEEEEECE EuEe[^_e[^_US];E Su |  B|j ThRЃ;XSu|B|%]UWVSP]E  ÉƋ}ˀE1?GuP|X|?GuP|p|jThRЃ?XGuP|@|%;Eu1 jThRMXyh0h.薷e[^_UWVSPu>@Fu ǀ@}uMIEE9Ese} t>Fu jThRЃ>XFu }tEE9Er>Fu e[^_UVSu>E Vu ^4Kx(>Vux1jThRKZyh0h0Me[^U1UM ʉ^4Ѓ^4 Љʃ^4S] Љ^4  ^4  [UEH w8$0и70/B0(Q0!U0_0h0 x0C2UU WBV SuM0Hwa$0Љ 1 _ Ju QVY[ 1*1 0HRh0h0 SRPu1e[^_UU ЃM  UVS] uEUtvuRP\RPZY ЍSw$$80  0E ue[^Sh(0h0Je[^ÐUWVSPP}WhXЍ$ PqWhXЍ< PqG  Ed w0EuX SW5S+$h 0W7` P:7$X uh`&0蘳$j0uW tuh&0v)j PW tuh&0Nj PW tuh'0&j SW[ tuh@'0j $ PW* Tdž dž dž dž O` `0Љd0Љh0Љ l0Љ$hSGfRfDŽT@Y@X~ٻdhSGfRfDŽT@XZ~ֻhSGfRfDŽT@YX~֡p0Љt0Љx0Љ|0Љ0Љ"0Љ&0Љ*0Љ.hSGfRfDŽTCXZ~ۉ>fFPdž„džwdž%udžvЋGF$GF(GF,G F0VVSCdž Xdž MXЉ džXh@hdXVFjXj VP7LJ @f LJ(@f f(f 1LJ LJ Juh'0~Y^SWXZ PW^X PWzY[d PWkXZe[^_UVS]$ Pzn< Ps0knVVdDVd PS PS $ PS PS$ PSe[1^UWVSQQUE P@@$@ @,@(M u jjk0VjVPPtEPh'0R} EjP} jWjhVRR$ tEPh'0E E jPVuWRR,tEPh (0U jjVM q1PP tEPh`(0E x1U @ B jjkuVM EA }uEPh(0^ `1}1;]}:1EM  APjjhjhRRu G;}|1 EPh%0XZu u ؍e[^_UWVSE0u E1;~EEUVU]^{tAE z tjpjPRR U 3PPs1C CtPu菊C[XEGE0E;~vE z tjpjPRR FF$F F,F(e[^_UWVS }G0u E~tN z tjpjPRR  6PPkF0 PvRR0 FjPRR( ~E1;F}{E]^{t4 z tjpjPRR  3PPsX0 Ct PuHYXt  RPPXZEEE;F|E FEe[^_e[^_UWVSUE P@ @@$M u jjk0VjVPPtEPh'04} EjP} jWjhVRR$ tEPh'0E E jPVuWRR,tEPh (0U jjVM q1PP tEPh`(0E x1U @ B jjku V M EA }uEPh(01};]EE1E4 U}8  WjjhjhPPjjL=GZYjP=GY@[E jjhGp7RR utU@ BEM0E 9MF} z tjM pjPRR 1TEPh(0_ -EPh)0EPh@)0 EPh%0+XZu uz؍e[^_UVS1ɋ] ;K}%11ҋCCD0A0 ;K|ߋE z tjpjPRR C CC$e[^UWVSPPu ~}tN z tjpjPRR  6PPkF0 PvRR0 FjPRR( ~E1;F}iE]^{t4 z tjpjPRR  3PPs&, t  RPP[XEE E;F|E FEe[^_ e[^_UWjjh 1 t?1׉}UWV} u?^_US]S@4ZuCPAAuS9,X1]UE0 u ESxUE EӣUS]ShXЍC0P虅&4к љP< Sd]UWVSPu$ E Pd} XE $!0Ѝ< PdY uP81@8jjS'  plS &4кљP$ Pcg plSu XZQ plS_ Yf _u( u YǀZ @l@ t# u P!ǀP" u_ ǀ_ t #PSQ&S8% tuB V_ZuCPh0 Y[E7g PS EuPjjS% t%&4к љP< PbS" }uuu V Ee[^_UWVSPE uE uT1BTjThRЃ X u TBTjThRЃ X u TBTjThRЃ _ u TBTjThRЃ [ u T BT jThRЃ Y u TBTjThRЃ Z u T BT jThRЃ X u TBTjThRЃ X u TBTjThRЃ X u TBTjThRЃ X uTBT t˃ uETEBTjThRЃ X {uETEBTjThRЅXm u TBTjThR[fE u TBTjThRЋ Y uTBTf E {u TBTjThRЅZy uT1BTjThRЃ X u TBTjThRЃ X uT1BTjThRЃ X ]u TBTjThRXe[^_UWVS] p uX)ʉй0X0)ȉ19Ɖk 0t  փx tjj0Rd PP uh%=`uFffF z tjj0k 0Pd RR  @0љ9 a u P`@`e[^_UWVSPu~0 k0t щMk x x tjj0Rd PP U SwH$$!0Ѓ{tC PPW Gl;{tC PPsWbGpM1FPh)0ӞGp  z tjpjPRR  3PPs"CsW{CE  z tjj0k 0Pd RR  @0љ džT fgP}e[^_UWVSP]C0E k0k   x tjj0R PP w$h!07CPh)0蝝  z tjpjPRR  6PPv!FvuzF' z tjj0k 0P RR  @љ ǃT Ef`PEe[^_KUWVSE0U 0 H P()ʉй0EPh(0肜XZEPh)0jr A&EPh*0<sn C T@(0)ȉ1;2]H 4 k0щk 8 ؉M x tjj0R$ PP ztAh]ttChCE z tjpj1RR ] 2PPq^B%F FM[ _ ωˋ Ǥ ɋ uP@X@Uɋ uPD@Dى11 ډGW G ffG f@fG] GB GfFf%VfFF FF VQDž =3(SE 蜮v~tjB PSVN?A PPSߖ,Svjj,Cjs*-CZ@YU jjhSr3PP @ AE z tjj0kH 0P$ RR ]H @ љH ;e[^_UWVSu@ k0k 4  8 x tjj0R$ PP uqGtGC%=vG  z tjj0k@ 0P$ RR @ @ љ@ O u P(@(e[^_UUJ0 tu"k  t pRVYXUUVSu u P @  ɋ uPXɋ uPXtV]YtVZtViXtVzX tVXyV!X@tV3X u P @ e[^UU Bjw4$!0ЋEf t!  0UM SU~#t҉tC(Й҉tCtEtC`[UEjwX$X#01RKD= 6/ (!   UWVSPE0UE E] u}t ~ tE  CfCdC ~tff? *Й҉tu)кיtK AfKV_C tU tC e[^_UWVSPU k0 щMUkMBl @ ju 6PP<tPEPh@*0uu vM NEFp jWqhDuuM z tjpjPRR E z tjj0k 0P RR 1e[^_UWVS}G0Dž k0ʉ kЉMAl@ ju 2PPtPGPh@*0Uu   CK ffC f@fC CM fAf%VfAAA QVDž +(U V 9E AUQXCuDDž j fC% Pu Džp jM qWL z tjpj1RR  z tjj0k 0P RR  @љ  u P`@`1e[^_UWVSjj]u }$XZuC Ph*061:A@fxVPfVfPV P fVfPA Aȍe[^_UWVSE0Dž} W t3f ft ]R\;jjjw]WESP行U\ t$jWQ1ǃ 7zGB w9UBl@ ZY ÍFP jƃ SjD0 PuUË k0t щMx kȉU jW1PPtPEPh@*0S!jP3* UB$<* XYEAAp jshuM z tjpj1RR E z tjj0k 0Pd RR E U @0љE DžU kx щMt k0ȉU jW1PPjj ^XuWPfGf%VfCGCGCGCG C CWS&C$CjS!CuWS swjW`WfCC U jS1PP$߉tEVPh@*0W%@CU Ӂ CK ffC f@fC M CfGf%VfGG GG WVDž U%U(V 躠yEA u#GA MBJAB A@uAY[ Pj fAp jwuM z tjpj1RR E z tjj0k 0Pd RR E U @0љE  U uX ǀX1e[^_UWVSQQuljE0T ttE샸 CT u LJX C\ CEC tS ϞXZuSu(  Cu džCE샸 .~,CufNPF8t SP,YXEPSVm  tP XZuSuQ tEt PWof[_FpEǀT fFNe[^_US]fCNT ~-HT uBPhw/ӈS Cp]fCN]]%UWVSPPEu jPE0# 1i EXtHwi i tϖWUfJPUxu RS讔^XUBPt@t uk u$ [@ju^Z1i u Su SuAZ4YugcuhiuuK 4uK u% u 1^X.uVuBKǃ 4uUBPAAuR [1u" e[^_UWVSPE]} E1 u fyjFThRЃcX~΃duCE E%0Ѝe[^_E  u e[^_UE VSù u J1ۃ u fyjCThRЃcX~΍FPh%0L1e[^UWVSQE]E} 1 u yjFThRЃcZ~σduCE E%0Ѝe[^_ޅE%   u ‹UL e[^_UWVSPPu] F0SPEYX {y>[ 9vЈEE` r$%0hjV40jVE@PjhjV40jVE D&hjVw4<0jVhE@PjVU$hjV-40jVE DPjV $tPjVhjV4|0jVE$ DPjVtPjV)hjV40jV~E DPjVi1$P4<0jV@PjV'hjV$4|0jVE DPjV1PjV$f1ҹ09t B$vM$wH0jV0jVE@PjV$0jVt E t\ tSjFV[ZuPjFVhThRV) u e[^_US]` tL PjS P PjS]UVS] s0 uP81@8 H2 uP0H0 uP41@4 uȁ u 00 u M uP8H8[^UMS Y0 u<p ǀ<p  uq u@8 ǀ@8 uD ǀD u H oǀH p u@ 8 ǀ@ 8 uD  ǀD  uH ǀH [UWVSQQ]f f tffEffEfEltfE< u,J,€ uu,J, u}uHBH  uLJLXZ[^_UM E UF u UVS] C C Cu  uPHCK  uPH[^UVS] C C Cu  uP H CK  uPH[^US] M uP @ AAA uP@AA[UVSM fuu u[^UWVSj}Wu ÃXZt u` B<vuPjW u \\ڃ Ё u \\e[^_UVSj]Su ƒYXt u` <wPjSe[^UEw8$H%0и%0/&0( &0!&0&0"&0 )&0C2UVSujVf ` f  f f f Ѓ X1ZCPV(f^j ^k CYX~1ۍC#PVf^\ ^] CXZ~׍e[^UWVS}1jW[ZujFThRЃcY~1ۃduGPh0&0+{#0P0PWC v1e[^_UWVSPES0U tS _ju%Y 00^ uhBh00 p ulBl utBt upBp uxBx 0 u „ ǂ0  0 u ˆ1 0Ћ Š0Ѝpu ʋDDvˋM8HTufD fPSX Z uœS ǂSjSjSS7S jjS$ u B u BSy_tju+U ы Pl plSu Y^tNtnUBQu u ɋ u  ɋ u ¼ɋ u B u B MfAP@fAPu ujjVjjuЃ 1e[^_UWVSQQ]3jjF0PdžT fcPfCN  u P`@` u ǀ u P@ uP1@  U$ d Uu P @ QVSVWVuV uVkX} Zt tV Xe[^_ÐUS]dhu ffjdScXdZhu1ff]UWVSREdhtu 1ffBu}uShhu{MtxBdphu 1ffB]dhtxu@H  @H Ju\ÅXCCCC uƅXWF^ CFU RDžX"FwG GM QZÅXG{C CE PƅXC~F FU | Eu(uYۉXtu MSBCCC FrB B|MEpC送~E}RU ǂ ǂ jj P0MA0^4A4\Ɓ Qh] Shjhu4$d hu ffBEdhu ffju e[^_UU 1ɅҸ-tJuE t P/CXUVS] 1tu PAYXuM  hu4 t%BH u jeRXZэe[^UWVSPuvojjPE u h*0jn1ߋM19s.u G9Xr19st Pu+ YXG9rjSHXZu juuwe[^_UxUWS] tBH u! jjehƒ t&1Zhe[_UM U BHu BH Uju UWVSPu }j@ EdXhuff& t P.X=jV YdXhuffBf hu B Ɉ hu 1ffBdhu ؃f؃fj2V} =XZf=Ɔ t jVY_dhtxu@H  @H Jdhf uffBdh u B dhu ؃f؃fhV6|XdZhu ؃f؃fdhu ffdhu ffBjVj2V{= t, S, hyS, S(,EEe[^_ UWVSu@8 S{,VhyS+ S+F`UMQ@ t jRY+ǂЋAƂPprNUVS]j@M jSu e[^I UWVS} w]Gx8jStXdZhuPff@?t S]Xu-Nyȋ t9xt @t9xuEe[^_e[^_UMdhuPff@?t MUVSudhu ff1jVC#tXcZdhuffuփc~FPh*0fY[e[^UWVSP} j@] EdXhufftɋhuff1dhuffB9t#jSG^sY X~u 3u u} 1+0PCPh +0e e[^_UWVSPPE uPURjhPk1uYMEQQB CU NC yϋE CU 1ߍe[^_UMU B UWVSPPE uRURjhPTk1҅u\1MEQQB CU OC yϋE UC Cڍe[^_UMU B UWVE u9S}tXPWX9Zue[^_UWVS,uFEPUFPUP@ ËMuh+0dE|əMEt EuGu.U$E Hjuu 93V4UuUEF4EEEEOx uEEtM u tXtUQMEMQE9UAuEuEuڋE$B}VUt%‹E؃ ‹E ‹E ƒi#‹E؃ ‹E ‹E €QU@EȋBUB A uЃu1UE 1e[^_UE@4UUS]S[Zu@E]]UWVSEC0}h t +CUJ PCDEESLKHPEPE@A ~1@`4Gx@~dۋhuJρ}ۋhu 4ER4Uۋhu HERHUۋhu LERLUP%=uۋhu BdۋhuBۋhu B1t3jVLXdZ_huJcu̓dhu Bt8FPh.0?Yd[hu EMJjdVLXZdhu EMJjdVK[d_hu B1j ThRYdɋhuBt"G ~эFPh-0a>X Z1ɋhptu@H  @H Jdhu @@B dhu (@@B(dhu @B@dhu   BdۋhuJ MɿۋhuJM싞d?ۋhu8%5ER8Ueuk-1 Eۋhu 4E]Z4 k 1dhu@B@dhu EH EBHdhu PBPjVI_dXhu HEMJHdhu LEMJLmEPVXIdžY1[jVBIXdZ_huHBH% tF0``4F4TdžPdžLVhjhu47HjdjPG1N|VGY>X~VtXZVfY_VXXZpPVB؍e[^_Uu juueAUqBUMWtBHu jjej|ƒ t 1Ћ}UMU BHu BH UEdhuP1@UWVS ]u j@ EYd=LhEuQY?}u=LhuQAPhuQ4A4%?TdhuQYj2VF\=dhptu@X Q @X Ydhu Q @@A dhu Q(@@A(Pt"dhu Q%%ALudhuQY@dhuQYhV?EˀXdZhuQYdUҋhTuQ8Y8k-1 Ã}huQ4Y4dhTu Ӄ@k 1 k 1A@dhuQHYHhu ؍QH؀AHdhu QPAPjVDYd_huQHYHj2VDdžTdžPdžL=XZUUe[^_ UEt$u=$4u =u E1UWVSQ}x1ɅEt,tEtDdhuP @ (dhuP H tEǃ1|dhuP H #u1KTXt;\XPL2Zt!XGPh-05LJX teuWW$ tGPh-05Y[t.GPh.05XdZhuP1@@t@$WjWdsSWh0S 5&4S[XTt6dh_uPp!VSh-04 e[^_UU} dt!@ɉhuP@@%࿅ɉhu P@@@UVS]j@ $SjS{ue[^ UWVSS] 1ۋuEtASVsZYt xX&SVZYtUXP$E Sh/00u,,t xPu:((t x$P$uEe[^_UWVS$ETj@ U(,ǂ,Mǂ(P _X{$CEGGPPCK(^t+C LC*tOEu2C*tGj@] W*Vf SuXZv9{$7uXPuY9{$XtV4@BUdhu P@1} Gj@ Wd*V ]U,z4J$MGB87F@+G4F@@@%EGEEWLB EЋtG }ԀuGuAB@19ƉE}0Lr 1ۃtˁG0MfHFA];u؉M|B8uRuXZURu^}ԀXu uE܉GGLj@ W-)V UUTe[^_UUWVSPu>GW4U(tx_8PXu F_A$0Ft4FGEW4U耸t'j@S ËMFPNP9VSM F8Tu =L_u h@/0j$j@ ËEFFPPS U @jG04j@ ujS j@ MËAVLEE9r$Yu:M;JuMzu RuXZ9w$tՃ}t GUBM!V^]e[^_^ UU WV1Su]tOэL t2F1ɀ;t ~DNDNA<tD [^_US]SZu@E]]UWVSHU@EEEt ]%KMCsS C{ ʉUtUBtdHtҸ ;MvMMM@a4Ћ@ a4}Ma4Ҹ  ;MvM}a4ME)E ;M}vM}'a4M)];M}vMM0a4M}E%Et tE0Ph .0uug }UE}MA}E@E~ {M ` ]U B3M;$FP$/0ЋEdhu Mdhu Edhu Mdhu Edhu mnMdhu HIEdhu #$Mdhu FEdhuju#XZɸ Ed]ċh@a4uPHPH߹ MEưu EEUɋEdhuPLPL1ɉ~T5˃F ;MEvMMu}} 1}MEE;} Udhuu TPTPUVVV;EvE}E(E; PtHNttdUdhu Mdhu Edhu 1hu ,YM_uJdhut5F~-Edhu  EMA1UBj@边 uFSŹ e[^_UUUS]SyYu@E]]UU@t $UVSu9p$u@$Fj@! V^X]e[^ UE@ǀ$US]SZu@E]]UVSu@t "VmZu=t VSY[e[^UjuUVS]C0Sys8Ve[^UE@4`UUS]SYu@E]]UWVSEC8@E䀿t 9CUJ Ps4uS@K< EEs8PVuRQWSwU"U UfJ*URUB$EpLj@c ;uEZtUP$@;EuE@MAEC8!dhu P@u~t>=u5PSVhS@&4кF1PS@uٶ =Xt uW[^e[^_UjuUVS]C0Ss8Ve[^US]SJYu@E]]UWVS }E‹J4@M쀸t W UMY8PƅXtrF$0Gt4G<@W@P FSsCETS fC({$fC*_Lj@蟵 VMQUr8!P蛵 e[^_UU9P$u@$jRUWVSSSUBZ@z<0]Z4j@6 ESC @9Yt jV&XZE|t9Zt Rt9ZuCBC B u 19X}EȺ әAx9|Ep8VCUr4VLe[^_UWVSEU R4Uuh.0 9v9wq <119}ÉEsHЉU19Es}׃ExBE9rU9Us}Ή}A];Mrj@ U|}QWQ W WyQ P۳ 1_9XsЃMBx9r} _XdZhpuT D %1҅t0E}cvGPh00 PW e[^_UVSMtb,uY=tEdhpuTD?t(hpuTD M[^[1^UWVu1҅S>dۋhpuT D ?1҅#ۋhpuT D TX tPXt VXtFPh.0yY[t@VjVSVh0S 5&4SXZTtB#dhp^uT D WSh-0  e[^_UU} dtɋhpuT D UjuUWVS] EۉECMA}(E@E} UM} EU}ME;MUd4@URphUu  Ճ}fU$10ЋMphu ,,Uphu Uphu Uphu ??Uphu Uphu UUUphu * *UƂ'} # }ľb4UEƋdphu T\uUhuQAEuMdhuQAEEȋU1~D ;MEvMMu}M} I}MEE&}EU;} MdphuUT@ UX@ttytttEE1utt tMtEEø;EvE}E5}$EU;E‹Md4@hURpUu  Ճ}U$10ЋMphu Uphu ˀbˀb% =ujUphu؍  ؀ huM_,XEƒdhpu  juEUY,[Mdphu  tEPhX00ujuu cUƂWMphu  #&Uphu  MUJ1UBj@胐 u S芐 e[^_UWVSP}E 4@dEhpu  Ճ}phu  X[^_UUUUS]SZu@E]]UU@,t UVSu9p$u@$Fj@s VY^]e[^r UE@ǀUUWVSWWEuSURhhP1u`1MEQQB CLUF`)CDv̋ECDU1CDߍe[^_UMU BDUWVS EupURhhPD1j@M EXMEQQB C8UC4E`})vV Xj@ ƋEC4U1 C4C<Vލ ߍe[^_UVSu] j@詍 S4ZEe[^颍 UWVS EEUBE }gdf1 ƍFЁ% h6 QE ptb1ZuMGG14u'uuEE} ]e[^_Ne[^_UWVSu1e󫋾C(C0 C,C4C8uC8dC(S, S<ЉCRAM C diskCCfCCfictCitioC usC$fCHfCJCXǃƃfǃWEVǃWEVS詳fjh6ЋFf1҉% ЃЁ%  Q/< e[^_UVSE pjV54Ћ]9 tǃ1ҍe[^ÐUWVSWujjiPE1BjjkSȅUBȅUЃңUtu3h`20ȅUЅ^t jPCY[UЅtjjPCXZ^1׋M5b4=UЉjh20jjjh hUU >jhU$hhUe[^_UWVSEXiȅUЍdǃ}G Gwh20jP1vh20jjkP@k1DžhDžlDžtDžx ;Dž`Uxp`1F PhWxU 4tjjv !@Fv PWuUB0EPp_($ẺFu}G0j|Phhdpp`@ <t<u|@(9hs)h!jvIAj]XG9rE ]e[^_9UWVS(EEEuEuEEUUыR19r˃EM׋:9Esu)}ЉUEzt 9  zuȋJ+ZrUu] UƃtQMMkMEMU B0t*B<љ9E~E@t UBtM܉MUkEuЉEMu UB)+E ;E}E} uMUM} Mu EEjhU[_t U1Ủ1} ]艃MMԋU B0@A0MB,AX.ЉA,UBADMU1BTMB\EBZYuS1b4Eb4ЅtUЅtztPlUЅҸtRQuuSk,RXRЋ]U=b4M UtUЅtxu =UtUM UЋ@Eáb4UtUЅtztPlUЅt%Pk,&XRtu R(XRЉËUU1҉trRUUЉS]t!tSpP X ZuUj pP [X]UUЉS]t&u b4Ѓ=b4u SpPYXtb4Ћ]UáUUtxtuu upPUWVSL_ЉUЅt PZu }jjh!$ǃ ]uh30hWEPEEE}UA0PuJC40 w=Pv jj0X# ƻ t 0jEjEEP uUEEEEECuE 00E jV$^XuYt jW$XZ؍e[^_ÐUWVS }Ծ60йU B490Ћ]CT4:0sth:0[M PCgPCfPCePCdPCaƒT*RD(PC`ƒT*RD(PC_ƒT*RD(PC^ƒT*RD(PC]ƒT*RD(PC\ƒT*RD(Psth:0蓾U B\w490h70tXZM d1:04U 90Pzu70 #4Psth@;0#M yu9d1:04U 90Ph`;0 hn 1Խe[^_UU EMP4UP8PPk P PkPkPkPP k(P$k,P(k0k4P,H0UE MUAEAkDAkHkLAQ US]t BuCBRAAYڋ]UVS]1{4M C8Su   {4C8Su ̀ ̀ FK4ɋC8Su u?~݅ɋC8Su tAɋC8Su   {4C8Sue[^hh0hh70h670褸UVS]{4u C8S u1jSY{4XSC8uFFF{4C8S u jSX{4ZC8SuFFe[^UVSj]Su iX{4ZCS8uFFFe[^UWVShuV} !YX&ك~4V8Fu)=t jVHYZt19e[^_US]{4C8S u jSX{4ZC8Su]UWVSQQuE~ xhFEEu mMEtkE @:0ЋD:0Ѓ9sˋNfff% fF@ډFNfςff% fςF@F~1UFUM!Nt tiVBE@pBB MApBB ApBB ApB B$/FP@BBBBBj=P Ru F EMx4Q8Y$FNu   ȉEMx4Q8Y(FNu   ȉe[^_UWVS]SlB;FB ;Fu h;0h7Vzth;0h:h70h670ݴzuCptCpRS_XFN@A~FNF t]e[^_{4S8{$Fu   ȉ{4S8N[(Fu   ȉe[^_UWVSQ}GlE@;Fts^ ^{uJCS904C4 90wth70d{us h70NXZhn 1BXVBFVMA9uFF F F4N_8W0u   ȉe[^_UWVSE P xU;}M]ۉ]]uh70hh70h670*uN A%`tw @t!P =t =B={B=jBj jEUkIY^t#jPIXCZuS9qC 1ɅNU ;usrjjIYXt$jSIXCZu SJ9XC 1ɅuMu9X>#E]]UU F;urM1E>#U]F#E  v܋uFn }uEF E U)‰MA uuu] CuE!u! Ѓt6t1A PA PA PA PA PAPEpth<0訴 1UM] C U^u vQAuuʀQ QAfAf%ffAU B u@ % ‰QU B @#EB M#M#}MK;}] C{;C1U B #EMFl1׹1~T@Pu uV;~Tuju uFVN th Eb4Ѓ= UYr U;b4u1b4ЅupUtU0XxM H `UEdU݀UM݄UŀUńU1ҡb4UĈU+b4y؃v!=Uujh܆UUW=XZu e[^_UVSQQh܆UЋu=hUhlU XZBEB EZQ jEP1UU^ ^vF t=~v7H  PK2hUNUY[tjhUTXZh [b4;b4t#B= Ur b4 Ub4Ѕ5džQ e[^UWVSp} Wj^XvEP苅h~ hh UЉÍEP蝅UЉ9v)‰U USM EPEP$E0EE0EE0EE0EE0EE0EEV0EEu0EEP)衃Wju$ hU[,}1}e[^_US] Su1U UЋ]UWVSQQE Exu1vjjh] {KE pvEf1U ƒu$=0E=UwKEE#jjh=0h  Uh UЃXU\U,EU9vEUUuWXZ[NȉәNtD)F "F % ÉNu#4>Q9sC9rE}t}u%u uWE }u E xjWnEe[^_UM S˃AUt-f1 Hu=UuhUu藰XZA ˉ؋]UVS] StButP]^PjPH#ӋA4Q8u;DžC4C8B,R0tP`\[A@tQ32i t8.B [Zuit fx#jJ C@tS0f 1ҍe[^_UWVSUE EU]sN }tEEPjUvusVtuYUtE#FUBHEU1e[^_ÐUhUjj95&4 UЃU1UWVS} 5L_Љ E#UЋUЋt-;xu"U;PuXVhS t 뾋u1ҍe[^_UWVSPL_ЉE]{ s0#UЋUЍ ҉t9pu 9xu&utZKujjC@P]1e[^_UEHttJ@UWVSEX=|4xt{@t Sh>0踚ZYFWjS fu WjS肗 e[^1_UVSEX=|4t{@t Sh >0XYXVLSfXF ZtPXF ^j:ǃe[1^UVSPEE@] Mt fǃ@ fǃfǃu6st&PtEPjNډЙRPSMIHu|A u fA @uf@Auf AufAufA@ufA ‰AQ ‰1ɅufmǃǃEtP.VXe[^UWVSSE} Eu9Ot)]StEPjIډЙRPWEXHuzw|VC=PZYu VC P^XPC PZYuG|PCPY^u1ۅu6PEP9G|XZEtPUXe[^_UWVSElPxUpuPUpu@EE @1G ֙k]ܙio)E؋EHd֙ki) ֙E9kMk ‰KAS A A> ‰C @S  ff[^_Uh?>0fjE 0uUWVSEEUBЉEM A$U9UA,q E}uM A(9}/CFEEӻ.ЋU1 we$>0пle)#M A@E}1)ލy1:=UEU+EExEhW>01eU B(xXM A(9QWVu$kUBDM 9ȉE E p U B$fMJ,Exu-b$U B,BM Q$)A f1e[^_UWVSQUEB u ӻ.w5$ ?0л92UЋU%EBXzh?0;dF(XZF$fff;V(vfV$))F 1f!Sv Wj^ 1}u fe[^_UVS] S$C()Phӻ.Ћus 豬F! t/Ht6VCN dRjs$s QF!PC$fC$fe[^UWVuSNAV A A]  ‹CH{cπ>Cu [^_UU B$fBxUWVSuF} ^t^ tPS!YXǁǁFtA|PSXZA|FPS{t^tPSYXǁǁFtA|PSXZA|FtPSe[^ge[^_UE j0uUWVMSQBq BZQ BI B B } ؋u f1 ȉg[^_UMAU #B@Bt U MUVS]KAS A Au ‰VK AS  A A ‰V FKAS A A ‰V[^UUWVSQ]{t1{CE t1 uf} u sr>018uB} u-s|>0й ts>0й 18uE `Z[^_UWVSUEB ¨Z!uZ"EPM AdES!P}u6MEPA A AM ‹A;PtU B\`MωEE @F9re~u-]{t8uC8Ft({uU zEte u VS EXZFv ƍF9sM ytqAtjQyU;W}\‰E P HG9@|9w:EPjwO euw GuU r EpHzEtP{JX]{tMK u u uS^_{uEe[^_U0E EЋEh c4ЉEEPuEԃUS4E EUME]UfEEMExfC T!EPdRC!P}c4wEPSxYec4ZPEPS]U0E UEUfEh d4ЉEEPufEEE;UWVS0E ǀ`]">0йt.E ǀ`]1>0Љ8u-E hd4ЉE܍EPuE tKe[^_ÐUUS]B}t;U u.t? d4ЅtB PшX]UWVS]uE ؉}9ÉE9EPuWVrMƃ;EukC<;;]Et$ AЃ< kU CT;]Uu19t"EPuWVk E9\uދU):Mt.A<wɍA U9tEa<vt)uU)jC;]019tZ]SuWVE.t 1҃;t719tSuWVz};u1 S)ʃ e[^_UWVS ]} }uEEt =FE9t:EPu WS Ã}u};u }.uMEEF9EuƋEUfe[^_ÐUVSthAE^}E ƍ=VU!Ujj9hh]获EǹZEEpMЃP}AWP A A ‹EP Ej",PÜS8ZA A AM ‰PA A A} ‰TLJdEȉG 1 ‰WUB0B0R?M }܉yhA @AlI@ADExHUP B|HMAl[U}JP MQjrPr <NuEpH}艇\ZYMUAlyAl }GlB0B0u?EXUBlƒMtX }LJXE胸X}j",]PÜSgXḾ}A A A ‰E艐PA A A ‹M艑T}ԉdUB0 B0}t u>X1aEtP>X}t u=^1}ujDPu}tj9uGM ǁY[e[^_UWVSh]EAEUEBDXEE@}MyTA<A01s8A@QU ufE^_5E@HEƸOA0FU=HtEE}c~M =Bj(PCPEj8PCP؍ǀǀ9~C<ǃƃ ǃƃ fǃǃ ǃWEVǃWEVS#f[E}G0 G0W;Ee[^_U1UWV1ES}tPjWz uEC @|@ujjs s lxj9S LJg@e[^_UWVS}S,VV1҃XRu PWe[^_U-UWVS}] FCCFC GH9CCCCt?jZCTPPTjZPPyTjpPPPdT$C8e[^1_U1USPUEJPE pR]Q uUfuRvF1]Ujjuu uUWVSEEpu VUZ1҅Y EP5Uuj sqtMjj:hoEǹ1jjhaA0ЋE@jPEUEBr M JRÅXtu=vXm4}uN] ;^|uuSh@0Eu #p~!;x~uuWh@0LEPjUrJ Sr 6t uhuu8ShjA0dLE@HE0M;A~>u/uXEtP8_UPV0RhA0LFEuMqF A @@}tWNm EU Pt@xEtP*8^EPjjju8tutE@HEMuAV A A ‰֋EPdphME P A A A ‰ЋMQlApUBAtQxE@8M䃹Xtet*uVtEPjIډЙRPuWEuuuuuuEtP6[uuu EtP6YU |4ЃEP8$@0ЋUЋEP4UЋEP4uMup tYEEǀ VЋEP4usu vu]^XZEpppluG U䋂PËuVh9ډFdu 9uEH<UE1ҍe[^_UEU f ABAtB1Uu U PR~ ɸ tQ0EEQ41UESX@xDuKx uExu?x(u9x0u3xu-H APuBt%S8Jw$A0и 1[U1U1UEPp p%Pr~UWVS@}GE_FCFC%CCC CF|S,C(S4C0C8S<CHFlVpS CVpFl Ex8jjhªEEEEEEEEEEGEEEEGEG EEP u+EԉCC juXZCDC@F@C$FlVpSPCLUB8e[^1_UWVSDEP@xx yP3JJ QI @Љʊ tЉR@!ЉIȉ+J9vplxp+|w19 |9sB@;Њ9Džrwi9setAB0ЋJƉËHp9΋Plrw9rPjPtP.ǃ %Pj6.ǃ +p@;vVPHRKNj1 ;Bt,X HBlRp9Ӊu9uB0B0d0Yuyt\e[^_UUzzfuB jPj0rUE@EUU1UWVSM Af]u}fAD 09Br@t'Dǃ<50@D0APQ u481e[^_UWVS ]EE~=uEJECECuEH~k9u9u}tXt+$ PSƃ{tSSufCff}(,t $PPPSVG 1e[^_UWVSVhB00_Xt hSz[^EЅtPYujjuDzEe[^_UWVSU1EwtPjuZ uhVjjujjVi$ujjVXujV%ۉu\F|@V Y`Ythw`貔XZ@thw@蝔[^hW萔Eǀ`@1e[^_UVSEu Vs4Pk u H<C,1e[^U-UUE QPQPQ P @@@@1U1UWVSL_ЋUEE}Rju VEEE8jhUùEE FEEPjvN URvEt2uhB0j.ShU EP[ExHhW}ZYthB0.jhW CDu'hD0-ShUP u> WsDEpH3uuEPuE[Eth C0-ShUEEC} {{utE t+[]0uuCPuC$D&PStW=ÅXuw(}tzEPuȋMq f}y}u GG UB@}uXUЋE%=tMA H uju EU:}uWE1Xf}y}t}uE@tMq E0u WHe[^_UEpjpW1UVSEptHSwXC tP>BC Y{DthsD}XZShUI dž^Xe[1^UWVSEUEUuUE~PEPuuVu&FD°MU M t;EvEU M 9v‹E ujG!RO ]SwtPhE0#GURPuuSCHM1e[^_UWVSUEEBEzDGH] ut"uhE0QhF0f@tl tE1)ËE;8U싀1҉EE9֋E|J9sDE1)ËE;wr8U싀1҉EE9֋E|9s}O tQM}MAB<}xPhF0{chF0jRDbjB  Pjjjj%PBPEp 1i$u1US] ǃǃϋE@@0% C9Cr CP XCkS@CyЋ+ +BBB BBBC9Cr CPYCkS@CyЋ B+ BB BBB1]ÐUSSS UЉL_U@L_`3·h G0h5/jLlg|I4fR?%UZ(UYt@ (UU U,UUDUpUЋ UЋXUt @EEiC]USPPEP]VEEiC]USSSEP]XhRЋEU+hU+lUЉSYy H@BC]US]h(dUЋ hUЉKZ]E!Uhw4hgI0jjjj0hUAhw4hnI0jjjh$hU"PU8UESM PAx<u Hx <ty1"9|A~<u H~<t[UEU ;Pst@(t1UWVS ExE EuW[Å^ ttG(C,PEREPju t,K,C(t C,PYu+uB uRXZuuuSuƃG(PRe[^_UWVSE UxE@Euu^ƅZ UB19Ӌwr9s;='4r 9}uEU1F,E(PEQU;z[|TEPWu t/N,F(t F,PYu;u> uQXZ@;}t hvI0 uWuVuÃE(PQ؍e[^_UWVS8E EȋURUE@1uuZY =F,M A $I0ЋE UxB19Ӌr9;='4Mă(QMPEPWudt3u*u3 N,F(Xt F,PʚXuP_?uuuuVuÃN,F(t F,P茚^Eă(PzPUUċBMM UABt MȀ UȀ$FƒH҃ ‹MfF$3fFM fQf fVŰF}uWh~fVPF@E̋FuWh}fVPffEFuWh~fVPf~ uF$@~c~ 9~әc~9jj'kP=F GXFF'jj'P<Fjj'S<F~P6E0Wv]s_PvEpp$Sv]s[ ~,tD1;~tfx u WVjYXG;~~F0F,F8F41;~(tB =u WV#XZ@B G;~~؍e[^_UWVSEXfC&HffC&s;x t@,uPYXNyE@{~ j'38=XZCH~j's=j's=CtPZXC tPL_{0t js0<Y^{8t js8<XZShUOe[^_UWVS ]1ۋu *tIF,tCf{ uUB,GtjuVPx wE@$EEG~EukP Vw- ;EE}TffuVu t+fF@F jw VG OE؃ E܋U܃;U|EW)kG҉WX}t U؋E1ۉ%EPuww wuËUEEH,@(t E,P螂Y؍e[^_UWVS}GEEEU fr1fy#։уqҋt4Ѕ҉Uu WE8t[U 2uEY}^ .MA,A E M;Q,seA0t[;{u fCU f9BtEuAMQ4t7] 1ȋ]!ЋS8t;Ku ;{uf;stuuE @u EU Bjh@U8ÅXZE RMK4{EɉC8tI,A(t ȃ,P"XU EBC,B C0BB ֍{uSSMQ Et)uuSu U BC,B C0BC$hhƋC8jSP tC(C(uS_VwhYtC8SPMqQS`E @tC(uh'hK(P4hXZU Bt2C(t,hhS(ƉЃC(JXuS/XVgX}t uu_XEe[^_UWVSxE@$EE UEEEҍu:|}JȺי|EuEV苇Zt EX}Q~ &4iQV_EEPUUEE?BEU^@EEEEE}u}t{EPxM;M[uE9EUEUEUE+U)ȅ҉EUy HE@BE}Q~&4iҀQU EPEZ} h},fEEx_ug}E#xHjuhI0hPzEuf}^}u E}#EUEBE׍EREG}fESҋC tB UBC SE9uute} 9}[NC(tC(EHCuC8jSP ZYuc(UJ}sEECt8c(}OudC8SPEpPShdE9 tC Cc(UJC}GC GCGM}uFudh}u WohEEE}>d}Eu }UҋEtB UBUEud_}tkEPEu PE })} EU Ee[^_UUUUWVSPEp$jP] EcX؃At~tEF PuTNY[WwcEe[^_UWSE] P$1BC8SޅuEEEU;B,|UB4t^@EtTEuEp8t+U;S;uC8SPSh@US >ޅuEEUB4@9Eruh`U$E@$e[^1_US]Ct CSzXCtCC PYt jCPXZ]UVSEۋu t)C8VSP ZYtC(C(uSX[u׍e[^UWVSu ۋ}tC8SPwWSue[^_UMAP0E E UWVSUB88uAM y4uȃ4Pjjj@aU B8MA1ЋU #B4R8U MB,Q9wgƁ9vjjP^(U ËB,PSr0QM y,)1_UEtH(fH@uÐUWVS E @E@$@(DPJZ?URM U쉑B8H uUB0uEMAT@@ tU `uMA0j@u`EU @Iu kuMA0juDIujuIuEPUB0jjjjM qquj>8U B+EB 1;5$j4лj4ЋtEu uЉYXuM 4@8utuӋE (t ۉF ;5$j4}uuLU $vM wUBP$19׋@ wr 9v 1tNE P&XuMA0ju=Ep4hU輳Ur4hU誳u,؍e[^_UWVSPUBJ, u DžxDž|DžXjj?5UЉT#UЃ TRuDžEEDžDžEEj4E^_h5HhRYEDž[tD]Ѓ;t,:t BF:uj?3$FX;Zuj?u$_eXE xEtjR)W t.PVRu{DžE xtzjR)WH tAPVRt?놃=t4tW;t4kJ!ЍUB +;Eĉv VhjuEPu~ EE EE LJE EEVuDžω)SVEP$djh߿S Lu1u;ubF 9vPEP0UƄf> tP#[E@@EuF,@F,tF,vH6pYUBQ;Pu;Pu Q;P u;Pt uN, E`, uT9ZUJ,ZX8^tuFBtUBBDžDžuvY[fDžu fDžPPu PPvÅXZSuUB0V{=t @Dffpf@ @}4ЋP$`(H,@(t ,PfnX E`,uV@BV@BF.hVÉPxdždždždž^1_1ҋuFǀǀAFǀǀvSUYh5HhRhUcuju#6$}tEh PjXZU؃z,tPuR,^_uPuEP(uu6E@-t jP%IY[j?3XZUtxHt ;EtRPH_U؃z@tPuR@[^uE؁f,P詻ĘYtuԃuEXZEt jP_XE܅t jPY^uju4hUh5HhR$j?RE`,XZUrufo uvoV9hjW辥E t jP^_E܅t jPY[hU;uju3h5HhR<$j?ujuE`,1e[^_UWVSU EBEr ]jSEP 1҅ME4@ DIEɋE }MxBjSEPx u|EPhuW蘾ucEEEHEyjSUR6 1҅uaE NXx>jSEP uEPhuW5t1%EENyjSUR׼ 1҅uڍe[^_UWVSPPE X4+X0x<jSfU BuU$@؉Ft EXT1K,t9S4t$PVt {(u {(pC1G<UC4Vt!<jREEP ~F tjHP@Ҷ ^CXtFPƅXt9CXVSDC(Y_tC,tPV?XZVcUC`B`$9v‹EP`fǃ<U@BHP3S-<u?C,u7ut-C,UC4V1<E0Ft;C,t1%C,UC4V1tbEjREP踵 J[L5u 4Ft E1!jjh~#3h u\_e[^_UMS] 9YHt@;UuA(QLtAPBPAPCTALt STALBPCTKTAPYH[US]@hUSS tC B C SLtCPBPCPjCpNCPJPXYuC0*shU荠 tPGXSh@Un u4Ћ]ÐUjujjjjjjuUjujjjjj ju|UE St\ttt6$@t@ tɀjujjjjQju É؋]UWVSUB &4Ћp u4ЍA9|u9|"hu4h\Ri^_tNhJ0螩[AjBV u4ZYt5UÉBPt9Ӌ@prw9vjV u4и#jh 54Q ujV u4и jh@U@1ƋE F(1~X+Fj(PEPGVhЍFpPi Vh]ЍPiMF, A, tVPXUB,% F,jhUFjPMqƱF@UBt@@E t u6Et uuFMXAt P/FX FU$@ xt B,tN,EtN,MA@F@t Q@F@BDEp@E@FDUVHE@tN,MATFLt QTFLBPEpTETFPFTUB`F`Et VR0_X uG0F$YxDt uVPDXZM@Hu A,uQ}_,E uPEu"PEuuPVuEV t@UЋPUXEtDUЋTU8EtHUЋXULUЋ\UЃ= Ut:&$Uк1BP$U{Yu͡$UЉF4UЅFt VUЉP 5UЋN4F UЉ#UЋ UЋF8tʡ U#UЋF8B<# UС UЉ4UЋ U#F4FF1V}S+DVhTЋFPXfVhcЋFPDfE(=tF4 @PEPXZEVЃtVЀ}yVЃ}(tU(2t"F,tjjh$J0j usXF,u}$tF4M$A1e[^_US]S5Yu:SOZu*UЅt9Z4t $9Xu Ru1҉Ћ]ÐUSPEPju ujjhjh UЋ])$u/EH,EPuEjPAtE1]US]tSL_p4Ph@J0S5L_ZYUWVSS`UЅu] EtSDjjj u hpJ0sEu4ЉrZu4Ѝe[^_USu4Ѕ`Ut5u4Ћu4u u4u4sSjS) u4Ѓ uˋ]ÐUWS]U1 %pp@Ct CCE CEC EC[_UVS]11C@t h(AZf{t {tC@tPAXe[^UWVS ]EEC@u th@EXC ǁpp@Eu E@4EC tC%Cx C CC%@ =@ u hJ0F$M0ЋC@tCC;EtCpE@tRC @C Cpttu@X1uh?EX΋C HC EcEMPECptAC @C SC PCPCPSTEC HC }2 uCpu}C@C C@CC@tCC;Eu fCfu hJ0fSҋCЉCfCfCCt CHC{C@tCC;EtC h K0.CHCtC6CH,CC@CtQC @C Cttuw>X1uhM>^EϋC HC ESEMJECtfCPCPhL0QC @t CPhJ0 CPhJ0+XZ hJ0YC@uC ~C PhJ0XZ]ÐUWVS}v h M00wCw w vAlw  W Jw" w  -@ w  k8 UhE7 UEXU Bv 獇 EEEtUP R5LV5 u4ЉUuEu h`M0Vu 71f+U UЍ f0~ MfH6EU)U9v)MyuAEUu6؍e[^_UWVS }+UЋU  k8E UeEhA6E} Z~C PW5 u4* % Uu UUB8ExUUe[^_5U=$u4u,:Wкљ=@~@=$u4UQQ4ЋBLhRjE$u4j PEPEPR u4ЋEUЋEUС$u4jP54XUUWVS@} MttJt!-(u4ЅucU (u41Ph=M0)PUW1Fу\ ~ƅtƃUhUuuunBj8EPA=i=5 U8U@pUU==U~yUr=PU~fU_=-= =U~EU>=@0U~2hU+==U~U=U~HUR?j8EPuuuEE$B-e[^_UE= v%=wV=w% w A=w=0p=%]=w-= w=% <=@%)=w=f1=%ÐUS]tj5L_S u]UVSuL_tjSVm ue[^US] ʃ)t QSXZ]UUt PRYXUEUWVSPE]U tHu8$E%E9п u hM0̒t  EjjhM0WSRFue[^_UTIUWVS(E%] E1=L_EEtCj@0EC0^t&C0 C0jjhM0jSEC0uڋC0C0u0ECDC4{,CpYE1ɋU;JxEu؋E0~IE  C0MQ A CTFC<CHSUC$9t-9z u(C1<v}Bt@BHBuRY[Lue[^_UESXۉt/{1u"t#jSRjSJ[@u[@uы]ÐUEP4E1UE@HP4E1UE$PE1UE S]t2;C4t-PgXt+$$R 9P t$PE1]UE S]t2;C4t-PZt:$$R 9P t$@ @t P4E1҉Ћ]UE@PE1UE@PE1UE@.U1UE@P E1UE@PE1UWVSu EHҋ}u@ ,X 9ڸr!PvP, u1e[^_US]$S49Pt RYtjs4SES41]UWVSE p}tE;W4t@RYt PUZu{$$R 9P uGC-@t Z$@ 9Xt*C4u&9t"VU…Xt$@ 9B tEu ]e[^_Ie[^_UWVS EXU EEErztjPCPАE tjVP踐E tjWCP袐E Eu EuEe[^_UWVSSE 0xU@ZEt;su"t;xu}E;Ct%;st ;pt;stju/ZYt%;{t ;xt;{tjuZY}t$U;St;Pt;StjuZYuWt;stjs:jV2st;xt P"x^}t E;CtCUJ,1e[^_UWVS EXU EEErztjPC P E tjVPE tjWCPE Eu EuEe[^_UWVSSE 0xU@ZEt;s u"t;xu}E;Ct%;s t ;pt;stjuZYt!;{ t;xt;{tjuUZYu\}t$U;S t;Pt;Stju+ZYu2ts t 3x^}tECUJ,1e[^_UVSE uVM@Et;J uZu;X9tMEuEPVe[^UVSE uVM@Et;JuZu;X9tMEuEPVe[^UWVS}E _09pu 9su9ste;st;st;ptjWZYuJ;ptjWZYu ;stjsSjVKss3CpO,1e[^_UWVS}E _09pt+;st;stjW~ZYu3pO,1e[^_UWVS}E _09pu 9s u9stK;s t;st;ptjW"ZYu0;ptjW ZYus s3pO,1e[^_UWVS}E _09pt+;s t;stjWZYu32pO,1e[^_UWVS}wjW[ZuGE w86PPE pufX O,1e[^_UE P T9ЋMs9u 9r1UUBxuE uf>1UExUWjhUs1Ћ}UUHu RhUbvYXUWVSP];u%ESEǍe[^_UWVuh^_UU z MvB BEE $@ EωUSj]SZYu(jj $@ PE 0Nj?u]UE@-t1@fx&ÐUVSu E)t8 tt_V҉t R[|Vu$ RZtgHt[9}ËI@uE~u @@F UЅt*AF9Bu 9}ËIu)u ES1e[^UWVSSu E1tG ttwF]t P$YvSu EFu U$ PZtuXtjvSutE[@G uN~uUB@FUЅt0CF9BuvSu-EG [uuEe[^_UWVSEPHɋ} ]trtG@9t 9ƺuW~}9}ju/^Z u hW?HS1ҍe[^_UVSj]Su v芇 u S6ue[^UWV} S}}u Ep_V 9ӋFwr9w_ 9ӋOwr9vjuu[Z8EP~+u"HUrUBU 4Y} t%w} t7} t)} t)0u4Ћ4u4$8u4ЋUM]9Eu$$R 9P tvA-t6w($8N0ЋA^P9tPO9tI@9t@9tt PP譩^_MIEeS,E4@u4EukE䅃t EKE䅃 t E7Et~ƃt$x t EtS,E }uK{1Ah~ EC1Yt tw{,C,t }}E!Ef<CH@,u jPaXZSC,} tst4 C,sH!}Xu E!}tG{ltQC1R}t E!?{lt9{,y3S *;L_u#0N_2vƃ2S4XEEe[^_^ e[^_UWVSEҋp,!t1ʺ!ǍYЋM#ttuf<hF._t hO0ijEpHu*2 SUB-Y8f<f(؍KM !uF$ @u4t HEx4tc@-$xu MAH@,f<u jP.XZhuV2S mt+c ZuF-Mh.O0lX=E ؍e[^_UE@1`,@HE]UWVS}5L_Ћ^$OEeEЉE! M9$t1EE܉E(M싃,E܋0M}uWV[^h‹YtM䉃 E䋄 M腋t%E! t@u4t RhF@<9$Xu(ǃ$ǃ(ǃ,ǃ0uuuuWuP e[^_UVSu ]Vs4h?O0jgVs4h8O0siE ]e[^UVS]u K, f>@u4tC$$SZu΀u ]e[^UWVS0UBB B-tjR[Y[UB-t=u4t   UÉBPD9Ӌ@@rw9r eUB@BUB@ BEPhVO0jSihhEUP]EEEU) tu4ERPbZx8u<u 86t 2Vй4juDžPDžTu4R E f>UhH,<PRnU,PRjPDž轰DžEP$$(Dž V uZ<u Dž ujj j1RPj],ujj j1ҋRP )P:VuRu.ujj jjjPVjÃ,ujYuj] u؍e[^_Uj uNUWVSU]u 1 ߅3SuECFw$N0ЋEC EC[^_UE L_ЉH4fH P1UMQ49u A9HtR9JuB@BUE Ut %9BuB 1z ÐUWV1Ƀ} S}7^u FO};] v] GtHt3S|L_Шtj*Xu S6u$k&Su6kuS6uSu6j u&)^)_1_W ])] } ~ `e[^_UVSRu ~Mu_F~S{u HFCFtHt "jM3EPoj uKNFV 1ҍe[^UES h^O0r`9s9ruu P 1t9s @9rESȋ]USjjj]kƒ 1tw ?t }u0tjQW_ utjWS7`ƒ Ѝe[^_UUS1ۅҋM t 9w (}utjREP/_à ؋]UWVS}ME }u]U v,xu-EU]u }[^_[^_UMWV1҅Su ]}t >w ?t }u0tjQW^ utjWS-_ƒ Ѝe[^_USPPUMEU1҅ɋ] Et ;w (}utjQEP^ƒ Ћ]Ujuuuuu u Ujuuuuu uUWVuS11҃}] t} 9stu }t };}sl}tFt*U 9s!\0D02uV]]M ‹\0} QuVA]ƒ u}tuVu]‹E0 Ѝe[^_UWVS1U}1ҋ] t 9 s "}u҉ tQRu\ƃ e[^_UMWV1҅S} u]t 9s t]SXhRj6SOuVtjRh&4}O e[^USju] rYZuqtjEPRP uXStjEPRO u>;t EEEiEEPZu{tEU&4Љ&41]UWVSPPju^_jEPu 6sO ui@Bu;5v4С&4~k Étyh[P=(UЉ$UЉ5(UZu YN[t%@B֙jQEEPU,N u1e[^_UWVSu >]v hXuwEP[E䋃E苃E싓UYuthM9u;U|}EEHUE+U)ȅ҉EUy3HE썂@B$CEBEBEB EWJjvEP8Me[^_UWVS(} ?uwk_tjEPSM 'Wt EuEPVU 1EP]Zu SYt ?SvEP=[X}Zu}t:EPVPSUUEE܃ ?BE܉U~ @E܍EEԉE؉E܉EBShVMԉU؉SU܉SUS P 1e[^_US]jS XZu"uǃǃ?B~@EPYM9Xu E9~UEUE+U)ȅ҉EUy HE썂@BEEPtUHYPP8]UMwAx=?B~ut &49}Q1UU:u &49B}BUMSA ] 9}Qu))@BA BAA )1ۃyA ut89uyt$QQ AA )؅A y@BIA A 1[UWVSEuP} EPXE)؉ENU)ʃ҉Uy HE䍂@BE9Eu G9E} }uuEUVEEe[^_UWVSEuP} WE)؉ENU)ʃ҉Uy HE䍂@BEut}~UEV}x E19‹@e[^_U@U@UDU@U1Ҹ@UЉDUB~UU EPUP @UWVSu] hv4aFى `UЃ~VN[t`U))9}0FBFVDUЉFDU@UЉ5DUЉ0Ev4Ѝe[^_xaUS]hv4aCXtSPScc]Ev4;aUShv4``U@`U%@UЋ@U9й@U[tMDUЉ`UЋ@UЉP`UЋD@U`UЋTDUЍ@UЉ@UЉT=`U]aUЍ@UЋ@U9й@UtMDUЉaUЋ@UЉPaUЋD@UaUЋTDUЍ@UЉ@UЉT`UЉ@UЋ@U9й@UtMDUЉbUЋ@UЉPbUЋD@UbUЋTDUЍ@UЉ@UЉT=bU`Uug@UЋ@U9й@UtMDUЉcUЋ@UЉPcUЋD@UcUЋTDUЍ@UЉ@UЉT1ہ=@U@Uhv45_؋]UVShv4^=@U@U^ @UЋQPQQ+`UЅT== @U0ƍ@U$= %@U @UЋ@A+`U== @U0ƍ@U$= %@U @UЉ+`U== @U.ƍ@U"= @U @UЋ@A+`UЁ"%@U-č@U! %@U @UЉH,AY Aqhv4x]Shv4#] =@U@UJhv4N]e[^ÐUjuZYu E 0˽ÐUhXZEC{tEE Ee[^_e[^_UWVS EEԋE E1ҋE} EEtM A @x t=UЅUEt[{tLfC ft9fv0sffx%k$U 9B u SEPdYXffyۃ${uu=(v4t3E܅t!}tX ËCphS0X5XZ hS0J5XE܍e[^_UWVSQ} EtU B @x tE=UЅti{tZfC ftGfv>sffx3k$U 9B u}t SRuYZPu UXZffy̓${uue[^_UWVS EEf=L4E} EEEEEL4x3k$W@.4ЋCpsZYu SEP[Xf>y͋E܍e[^_UWVSu }]VWu t]uE }e[^_`tGPV^_4,v43[e[^1_UVSu V]Sj t jVPj ShS031e[^UWVSQQ}U tG @x t֋Z RWXZCE MV4f{ ufS9FuBfCfC FUЉFUЉ0FVUYVu Rh-S02 GPRh7S02 }t juUXZUЅtG{t8E9Cu'fK;Fuf{ ufC f{ uAfC${uȋRuuVWMQVe[^_UWVSSSE @EU 2>/w h@S0jj6/ u hS01MAu s C(f~ fVu.F 9ȉC}&ExtS<tB9ȉC|‰CsEphRS0jCPR2v h T0=.EC$UCr9t<699~MyjjPP EuWS0u^S0Ph`T0[)E <1tRuU2 7jM1ĕEuMS<tCPhT0y-C,e[^_UWVSuN {yt VUYu{ t u VS [Z-tE PFPhT0-=D.4@.4tA9yu3fy uA;FufA fy ufYF@9uCfA$yuVҋFtBUЋVFVVE YuFPhdS0/XZV1ɋW9X} <uA9|9uj7wG^_1ҍe[^_UVSuF 1z^(u-u؃F(jVRZYt^(e[^UVSuF 1z^(u-t؃F(jVRZYt^(e[^UVS]{$u uhU0jjj u h@U0~+Xp UЉBUЍe[^YUWVSUЅۋ}t>C9x$3u.CtFUЋSsS jS8! ue[^_áUU@UáUHUСUUu hUXUUWV1S}u t9z$Zu VR;ZYuۉue[^_UUWV1S}u t39z$Zu%tt R&R`Z-uۉu͍e[^_UU SEx;P} u1C(u1ۅtSY؋]UE@,US]C,HC,uC xtSPXjS[X]UES]Cju CPuUЉCUЉ UЋ]ÐUVSUB$] u C$ms@;p@‹@$s5tVJ$B@9A@sJ$;q@rCuAT9CT|9y$u/y$u%t!J$A@;B@r9ruAT9CT|y$uߋB$C$Z$[^UU19s f3 9rUWVSuFDf1 ‰ЃUM]aEthmU0Q)XZF0?2unU0RuPuu hsU0׃~<^T ShX3YX9}x ]ShU0XZVUЉCUЉYUUUe[_USj]djWҋCtBUЋCUHUUy hU0%]UUB4@B4Hu BhE>UVS]C4Hu C4@us,hU0(XZEP=E+ChEU+Sl҉UYy HE荂@BEUEStCp?BCpSt~ @CpCtEUChSl~,}tsPSTC8S<sXS\C@SDCHSLE3pVje[^U5L_jEjP蓂U5L_jEjPxUVS]j@_ƍC`C8C<CPCTC@CDCXC\CHCLP u hV0"1Z}BBЉUjuĊUM A,Ut <B <uM EUEVS1X0H uFt1It B$A$[^ÐUjjh0hUTRXRTRU=8v4WS]u8v41E C EC8v4ЍB8v4ЉSECCXRЉCXRЉC[XR_UM9 \RuA\RЋQҋAtBXRЋQAÐU=`RMuhR`RhRЅAt QhRЉP hRAhRU=dRu&jhmW0jjjjhUdRUVShRЅۋutV3bZYt [u1ҍe[^UWVSSu1]E|}tO1,$EG(v,G vFA vtA PA Q BwE Puj zǃ 1tDGEE GEG EGG}tGE tOW}e[^_UVSu^t"ڋۉtBCBRVXZuދVtFBFFu vV螇^Xe[^UWVS Eu}EEM ]Gu@uWt u;BtKUD C GtGXG_CunF @9uUD F Et7E;Bu-}t" B ɉF tBABRWY^ J}t] }e[^_KUD C tXse[^_UWVSQ} ED8]E;{r;C v uSƅXZ tmC1҅tVM9HwN9x rAE t-KjjEhvW0иuPSu&VS#‹uVRuWSR1e[^_UWVS u$uE[}^ EEEEE@ EE +EUD!ЋM};_suWn|Ep@9^s u6u}t*MA 9r +EUE!Ћ} E؉EVM9ʉUw}99} tsU M JE$@xUԍCuU+BE!E$@uMAPE;PsP 9vZMU 9rQ;EwL}DM;A 9F)+EE$aY}t;Es }E܉]}F +UMU!ʋM9u6Et9;u} teU M JE$@Cu}+G!E$@uUBPM;QsQ 9vZE|U 9rF;}wAMD};G w29r.)]E)EE@E$ut{}t;Es UE܉]UE$u}t M]MME$ t5}OjjE$hvW0иuPuu0Xuu#uuuSuTE(1e[^_UWVSQu EXE1@uuPDžXZ MQB 9ErrB9wu9u#;]u tBABRugY[rMAu;9u;]rZ9v.J 9tG9s#CGFO B tx:W=zSVhW0)h|W0FB CBt WuXZUBt BRa_1e[^_UWVS]C} tj{ uNu\1KjjhvW0иuPC P1҅uW{ t[ tCBC9h蹷Ƹu1PhU V请tCڍe[^_UWVSuF] CtGt!CF tF XF ^ CGh2ShUЉ.W6CF tF XF ^ CFt?F fEe[^_hնShU } e[^_Ͷe[^_ÐUM WSUvfUЁ:a0Yu9Z uBx9} Bx9|1a0Z B~| tj XUUe[_UVS UЁ9a0uHqQEY FD9BAvQx9|AA;Au@9؉A|A[^U=Ut U1UUU1UWVShUƋC19CYuJEtV}#jjhW0hS U<tVIzC9CtV9%UE xZt[CS)yC )ЋU r9vƅtUtU/UЋB@UЋB@UUЉ1e[^ÐUVSu>] uCCTSVXZB9Cs}BCC@~BCC@1e[^UWVS];u t7VS:_XB9Fr$w"Bzu;VSxY[1e[^_UWVS0uċMEE^}+Stn;BsBCBztVF1F-~-StA;BrvBCBzt'G9GU B;Csv뇋@G@FE؉BEԉB0[^_UWVS0uċ]EE} }& QtGBABzt4V3F&~ҋ QtBABzt W;G몋@G@FE؉BEԉB0[^_UWVSu ~}MuGD+G[]UWVShu }JVjjjWSL=UuVjjjWoe[^1_UWV=US}] ut b4tub4Ѕtƃt(t$VWsYZyt;5b4u b4t#t tt=Ut PMZt=b4u tWUVSh$w4vE Pjjju54w44w4 =Uuuh$w4Љ54w4ye[^UVSh$w4u jjju54w44w4=Uuh$w4Љ54w4e[^USP] UDۉEuUEPREPj(uWۉtEЋ]USP] UDۉEuUuREPj(uۉtEЋ]UWVSXE EEEEt}tEEUUEMЊ<%tWtSUBEE Ut$}tM9Mu E u UBUuu P MЊ<%tuEЀ8 @EEEEEEUUEЋẼ X$4Y0ЋEEEEE1<u VShX0< u VShX0<VShR)/jEP8E}}tEGEE t$}tU9Uu E uMAMuu P ?u UE:BUO!!؉ },u<EE t$}tU9Uu E uYMAMuu P E8 ~LEE t&}tU9Uu E u!E@Euu W EU: EM9 ~ EE8 U:BU}EE t,}tM9MuE uE>@Eauu j>& L}E MEEE؉EME+UEЃ*UuEE8}GqEeẼ01 wk M̍|ЋEẼ0EЃ v}GMȋMU وuEY01Y0IM/E+Eȃ E!}EԊỦEȈUEE];]}]}tC EtEĄuQ})߉O~EEE t%}tM9Mu E u!]E @Euu j O}t2EE Et}tU9UtrMAMuu P}EtEE t%}tE9Eu E u!U0BUuu j0y EE t'}tM9Mu E u$UËBUuu u8 E%uQ})߉O~EEE t%}tM9Mu E u!BE0@Euu j0 O}+}O~EEE t%}tU9Uu E u!M0AMuu j0 OM}tOUBEE Ut$}tM9Mu E uUBUuu P9 M}uEQ})߉OAEE t"}tM9MuE u ujSUWfUk tVe[^_ÐUWVSR1ۃ=@.4tULw4о@.4ЋFf+4]t+49~@f+4u$C>uʋELw4Љ=Hw4УDw4k$@.4u@.4Ѓ$C8tHw4 Hw4X[^_UPw4VS11ۃtD;Tw4u'hZ0)0hZ0ЈPw4YXPw4ЀqtQue[^áXw4U;`w4ЋU\w4} U@\w4UWVSuhW3j(h@UЃ1b@Uы\w4ЍL ; `w4s>@UЉIQUPh@U}@UЈѡ\w4ЍL \w4Ѓ e[^_á\w4U;`w4Љ}ƀU @\w4УXw4UUBw RhX3.@w4Ѓ tuRhZ0RhX3RhR?/XZUSEk$@.4ЋCph2XC Zw/$x]0CPhX3Y[]EZ0EZ0EZ0Ћ]fUWVS Dw4]9~;Hw4 Sh[0&Hw49~.,L49")4[0hG[0eY_f+4w t2+44+4h'.:C6 f+4uwhL[0e[^_UWVSQME19- uEA90uAuǃ}uhc0]Su ujahc08Ek$@.4}Ĺ ESu ufEjifEhd0ЋEfE}Gja_u}EPsEPiuaDw4ЋE9؉]E k$d.4Ѝ@.4 K$9]~k}$@.4Ѝu 5,419}&f-4ft;E| Bf-4C9|1ۋ L49}(ufL4ft9| BfL4C9|ۋE@=@.4Dw4Et[1D.4Ѓ1{I;M u4u su' uJ.4ЅtuH.4;E~E$@.4uE=@.4Et[1D.4Ѓ1{I;M u4u suL' uJ.4ЅtuH.4;E~E$@.4uE=@.4tm1ۋD.4Ѓ1~I;M uFu vu& u1J.4Ѓtu EfH.4`.4;E} Ef`.4Ѓ$@.4uEP[e[^_UWVS]E1< t< u C< t< t]< t"< t< ttCE< t < t< tuEw4Ѐ8t>w4Ѓ1I;MuuRu& uuw4Ѐ8uŠ< t< t< uC< t< t< t}uE8 h\0Uw4L*i$8^0Ѐ;u h\0XEPSY[ ETw4=;u h\0(EPEPEPSpEPEPuS/;t0EPSv_ZEt tu @w4h\0;}WS3Y^u uEPEPWS7jc;tT}WSG^Zujd\WSZYu uT<EPEPWSjd;u h\0}WSY^ujeuSWSu^Zu uEPEPWSyjeJ;u h\0}WS+ZYuEPEPEPWS-jfEPEPuSPDF;-3jq!;u YS;EPS^_;E&4ЊB<v ttCB<v tu< t< u C< t< t;tEPSZYuE&4jt&5&4A5&46 5&45&4h]0 @hc[031=(v4(v4к!1u*/Rh!]0_X h;]0^1e[^_UhL]0Yh`]0tj(hUu ~hURZthf]0HÐUUUUNU-U1UE kURUE k,XRUU;fR};gR|!fRЃt% f1 щUMS;WR|.% f1 1gR9};fRt@9|[UWVS] 3V}w9…XY tBtB,uBPssRVWe[^_UWVS,E]E̍ẺEԅۋE}]E]EEEx=]ȋWEwPuWtE9Ett t#u1+]E O,G(t G,P[e[^_UWVS] 3V}wP…XY tBtB,uBPssRVWe[^_UWVShuEv%jjP8à E]EuSEu]ԉuEEE un19E}"CEE{xyGB9|ދEPpEPuu]t9]tt t#u1+]E }t ju9^XEH,@(t E,P[e[^_UWVS] 3V}w…XY tBtB,uBPssRVWe[^_UWVS,E]E̍ẺEԅۋE}]E]EEExO]ȋWEwPuWRt*E9Ett t#u1 u j ucXZ+]E O,G(t G,P脇[e[^_UWVS] 3V}wYX tBtB,uBPssRVWe[^_UWVShuEv%jjP6à E]EuSEu]ԉuEEEj 19E}"CEE{xyYB9|ދEPpEPuu]Rt'9]tt t#u1 u j uwbY^+]E }t juz7XZEH,@(t E,PXe[^_UWVSEU X2SS_X FM If ltf u!M S$ M S 1l%hhuF,hDždvjjh4à dtly1ht hSU r tEM A6l@tht1ߋhl tU Bl|fwl{f@.l}ft@l~fpVfFptfFuQh~f.pVfFpt@fFuQh}fVRpf~ u$V$BtxFtUffhU}X69XtHhe{lUЉXu{1uSS|[ C,@t࿉C,ue[^nee[^UWVSQQE1@;}u EEsiyfFMPuÅXZufF 3C,CuVRSP fFK, C(t C,P|Xf~tGEE9ErE8e[^_UWVSPEԉEU RUu vu}G'49v9U.E EvjjP,E uuU 2 1;]sufD@;Er}tqE֙iE̋E)iEЍEP*^t PEPUUЋEÉ?BẺUY~@E̍EEEEUЉEO,@uuuW(U:}t{EP!M;M^uE9EUЋẺUEUE+U)ȅ҉EUy HE@BE}Q~5&4iQu EPEYhbƋG,@Zt U9Ut VbX*࿉G,juh*q0hhUwVbg,#t'tt uu 6uqà E9Et ju+^_؍e[^_ÐUWVSE@E(PE/jhUP"jhUP UREPu Ef@Ef@ Ep$E@x4ЋEUEPEPuz u}Ef@Ef@ Ex$E@x4ЋEUB~Y[Ee[^_UM SE}f]P$t(wf@t3 s@t6=1~ft8st);B@tB@ B8B81[UWVSEX$E 1AsYXC<VVhU e[^UVS] C4H$CQY^AEtS:Zfx Cpuut9CH U}u/AtPuLY^tPu6XZu[>Ee[^_UW}VSƋu k,WXRVXtBu7F8x4 F8x4Љ~Npjhx4hFHPV[S0ZE @1e[^_UWVSQQ] %uz%,fftQv:`d0Ѓ?$e0jS-@ j;C} SDjp4/EffEKpPCPx t"SuXZEPVCP uށcpu.f)fY~OxQSjhXOZyBPVhf0 1 tCp u CpSj\5_XSV SPY^fe[^_UVS] Ku~"VjVj Vj؃Kލe[^UWVSVVu9ʸw5V,yE x,xE x,y1yF4U 9B4[^_UWVSjp] }(ƋCp((Yt V($ u Sj XZSWSV(1e[^_UVSufjuuuu =u 1f9He[^UUUUUUWSjj>h1߹@jhCP1jhC(P!$jhCHPUЃ CSh)aPUU!Je[_UWVS UЋ]ҋCKs({HtBUЋSQ'V!Wj>Se[^_Ujj kU(PUЃ ңUЉtiBlBAB(ABHA ffAffAffABpAB|ABxt@A A BhA$(u1UWVSSU} EU}ut H$f0СUЋUUЋU*UЋUЉEEUu} EUЋUЉUUEu} Ue[^_2u0kU(P5UVWu4j 5U-e[^_ÐUUUWVSjj>u uF1M }t,E Hљjj>XSUljF1 FF FE FFM Ne[^1_UWVSuVtN1j>vY[^t$FHљH1j>vXZFFe[^_UWVS jpuE$E_EtY^U~t +F8tMC;FFuFFEHuF Fu$Ee[^_UWVSPP}E jpuEL$EX~N>~IF V)9r^)9~SuRӎ]F)) ;FFuFF~>>uF Fu#E )EEe[^_UWVSjpE#EE0Y} @uQ )…҉UI)MMy)E tC EE;XtaN~Z;CE uPعUEMIMt+N~&;CE uEE;XtN~ ;CE tu#Ee[^_UWVS]u jp"Nj9ZuD~;~7C K)9rS)9~ ));CCuCC~;Ƀ;uC C}e[^_v"UWVSSSjpu M"E;FYt(u:~u+h g0ІjhV5t u)"yFF FF UN ^+Nt=EtȿѺEȿѺE F @;FF uFF u!1e[^_UWVSPP}M uȻҋM sȾÉȉU9É׉Eu!+}HŠMҋuE 03MJu 3؋U 2C9} M@;E|^_[^_UWVSQQE} E1ujp E;FZu-~uh8g0?jhVuwFF F~jF9}cF ^V)9v)9~SPu V tSF +FPR ]F );FF uFF ~F9|u! e[^_UWVSM] 9YuDRСDRЅtu1JH1҅DRt>C;YuY3E0yt$+A8t E0[^_UWVSWW}1҅DRt?OE W҉Ut'+OșщEUtu W[^[^_UWVS jp]EXt[C K9uCHC BC Es8t")șEE0t;uC Cue[^_UWVS ]jp;Xt6E 8u6@9Cu.}ԉ޹u ߹} uԹRY RQ_ u PY^S,Zue[^_ÐUWVS}G,t$@ p1t%WhV2Wju VWjV ؍e[^_UWVS] {G,t$@ p1t%WhVjuSV=WjV4 ؍e[^_UWVS] {G,t$@ p1t%WhVjuSVWjV؍e[^_UVSMQ,1u t $@ X۸tDat t7qt u$@ 9Ht 1Q,QjuuVSe[^USUB,]M t$@ @1uUM ][AUM E[UV@4СUЅSz4\4Рz4PR@4\4PRU@4t)FtЋ^;^sC tЃ4;^rvu׃=U UhHRЋUhƁUиhHR)ЉUУ U=h`Rhxh`R=jhHR= jh`R=e[^UUЉUt 9t @u1UVSuu 1ɅZt"PX9sfft9t 49r1ɍe[^UWVES11ۅtKPYt@Pp9s4fJ;E u ;Et }uf:u fuu׃49r̉e[^_UWVSEEE] EEEEuE1Ʌt{uCE FEe[^_[R_*tNvDuuuuCPFPR0'PH9ʋ~sB9uz0uʃ49r*e[^_UWVSUЅۋ} t)s;ss~t jWuV 4;sr[u׍e[^_UVSUЅt s;ssF(tЃ4;sr[u&4кљPu;e[^UVSUЅt s;ssF$tЃ4;sr[u&4кљPu;e[^Ujhg0jjjhh@U=ijhg0jjjhh U!i8jhh@UJljhh U9l%5'4h@Uq 5 '4h UtqUj<5y45'4h UqUWVShNUЅۉXt s;ssF,tЃ4;sr[uW28UЍe[^_U}UUWu ueY1_t z;Ћ}UWVShuFfu.FPjh[ZM 9vP 6^ 9] ~jF +E 9ljvRE FPu|)]] ] E t1>u&FPjZYtvP 6E@t U9P}Pe[^_UVS];u t;utDCuC CN ȍ9r3%QC CPv|F C Vue[^UWV}S] ډx7~&H 9w @ )ʋ )PH 1҅tGtj))_c1H ΅t9r)GH tA)W

^tjSS^ u^ tjSS^ u~Ft^u V[uM~yGV%=t5t0jF&4Phi0hF6PuFuЃ~tF jjjjVPufFt hh0_fFVuoe[^_UEP jjjj PRUVSj0](fCZu hh0k_fCt C @ uC ju jjSPÃ5Ve[^UWVSuFt-Jj0F[tF @ u VcYt8F ju jjVPÃW؍e[^_UVSj0]\ƋC ju jjSPVYe[^UWVSj0u)FZ9t%uF jjjjVPÃW e[^_UWVS4EEEP B u}tE}t Mq1 E@ljx]f;uEt EEEtE@u B tE}tUBt@@4}t MI M]ftL}xS؃|PXEE E܋Ef@8E'E#UfMfI j0E؋]f[f]XuMfA8fuu-A @ tu u}uE9c} vE+P|Ë+9~EEtE}t1ҋ]9׋ |9w9MvE(u"[E虉EӉEUu};]| ;M}}uMU;|]9}rfEEfЃMftȃfPYE|PE܋]fcujX}ZXuQEUEE)UX}u 114}u&jjEE@MAjj_EEY[|pvf}~]ju]XCZtH}Et%}u Uк)9։~ЉËEH~)]9;u~EU9~)U}t}u;U})ЃUBuSMqE܋UEpZ MEX1 }U|wEtEfH}~ }}t]fKj0EX|w Ef`ߋMQ uu Euu PuRu؉E}t]fcEȃ}EEEEu t}ZMfЃfaߨftȃfP^EtP[}t uYE܍e[^_UWVS4}W UEMIE} MEEt u }t U}Et M1uGtMEt}jj4jeuPj WU܉REuAMQC 9vuPsSE.u~t}u uSXtGtExtjjjjWURfGxt}xGLPXfGxj0EsE_`ۉ^tJ},uGLV9;G\rE@ ;WP{E@ fG8ft#EEfG8fW t tf{tCtuuG @ t E9Myu }ru}y E#[fWxЃfGxtGxfWxPn YGLPuEYXEZEuFt@@8CE؋UB EEt"} tjs jSM GL+C GLGT-GTCt+C0GT} tu G`hCfEx}f{u }t}fgUruGHt +E9vƋC +E9vƃ}uB}ujVSCLPSKtjS jC6P8F6PsFLPV  tjVЃ F|PVXZe[^US]fC8fCC6PC|PSCLPStjSЃ ]US]fCf 0fCC6PC|PSdCLPSZtjSЃ ]UWVSPP1} dщE1klU_9hUЋu<F0V2F4k19bjhU8YXJ13fffFfCfFfCfFfCF C fF6fC6FZ t׋U t Z uAQ ++Q9~19eE >t#B AABtB0A:u݋B AABtB0AAtpqqQe[^_UWVSPPu }]EBF EF Eu8}tu ۉfFf9Bu9wuGV_XCu}wvƒt t19[8u,ҋKS t C0C$ ) )‰9Ev:}u4fFf9Cu*v C CPvgFF C F Vƃ9t3wwF GGFtF0Gff6}t t Ef CE1i0Ѝe[^_?e[^_US]{t3S X{Zu]UWVSSSEXۋ} EtSU)C {E)8u}u hHi0 <]SUC 9wU))B-BCt+C0BhxECf ujU rEPo>ƃ tuEp1Uuu_ E`(EH,E@(t ,P-_S[UB(PuEH,Z@(Yt E,P_e[^_UWVSSSEPE} 7Ep 5UZ$C%=u J,E@(t ,PY%jwwEP uStƅXZC%=u+EH,E@(t ,P*Xu$j0CXt4f{8u-jjhh0hC6PuCtf{8tӅu s8fC8WXfcEH,E@(t ,P_EtP^[ue[^_UWVS u ExvvEP6vvEP6G(PEžEPEPuX>EE؋Ef@Ef@ E@ujEP}܋U u2u=uj}܋E pUR7à E9t jVeXZ؍e[^_UWVS8EPu uEEv UBEԋJ 9ˉMEEuEEEEs&Bx EEy PE9MrڋEPEx}tE1PjEPEPEp$Mt9}tt t#u1ۅ+}E8U2tbMȅu E,UBEċQ 9vUuVq5 EċUB}tjuEP5 u{EPtqxtE̅u1YƉUV 9׉Us EH }uuvE5Ë tEeUU)ׅu tu}E+xUzEH,E@(t ,P_EȅtP趲^E̅tP訲Ye[^_UVSESPu 6Ep u+vEp$ËEH,EZ@(Yt ,PXe[^UWVSEVP} 7Epz1 v} tSjjY[vjPeXFZu7?7t6wvw 4 uGF VwwEp$1tV萱_EH,E@(t ,P^e[^_UWVS EPEu 6Ep ~ tjEPv4 t lEEPvvEp$9uG~ t@Mt9Et2P 9vUuWp2 ujvEP2à EH,E@(t ,PXEtPد_e[^_UWVSEP} WuVJe uOEEEjE7EPt2 t-F(PuVIuVIF(P@e[^_UWVSPPEP} 7Ep61 jEPw2 u]EX$jjծƋC jVjjSPu5F 9EvEuwv1 ujwEP1à EH,E@(t ,PXtVAXe[^_UWVSRREPE 0Epi1 Ur$Fu J,E@(t ,PX9jEPE p1 u]jjܭNjF jWjjVPu;G 9EvEuE pw0 ujE pEP0à EH,E@(t ,PXWF؍e[^_UWVSESPE 0Epp Ep$jj֩9F ZYt#EH,E@(t ,PX-jj[X7tVF jWjjVPu? t-u0wE jpV/ ujE pFP/à EH,E@(t ,PYWR؍e[^_UWV}S}uviuj)ÁXZvjS聼^CXu SD76{ Wsu / t SE}uC1e[^_Uu uX>YX tfz t& EB,1ÐUWVSSU } wL_E-1 t}t Ex huuN$i0ЅE8WEV{SuV ~ESuWiEiuWEfF t @MA {4ЋQ{4ЉB{4ЉB{4ЉB 0WpV8tuHhi0F WTF,)V,F(WL)C|V(PShi0}tSu ZEYp}F t(E8wSuWJ Et^u E9NF F{4tPuuR{LWt4WS5_XtjS EEE7}VmYGt E F u hi0}CLtuuP tE uPXZSTF +H,)F P,SL+H()F P(CLPSa^_tjS Ehi0j5VGY[EPHf?uF t SLMQHE~uUЍBUЉVF0V4MA0Q4A(Q,A Q$FA1-E-Ft8@ UB PrFpHF t@t@ UB PrF @؋MA 9FtE@ jpF P0* UB hi0 }t u2Z}t u#XEe[^_UWS]t{PuBtt5${45 {45,{45({4 hi0A S u5jjj8耆ƒ Ҹ7t1׹B0SP71e[_US]Ct@|sYLCX{ tSY{tj6s:X{Zu3}@s Y=UXt3jS蠇 ]bjS茇XZ]UWVSUE zHt Yp=@VAPDS^Ƅ.DE`4PDžXDž\Dž848Dt>XRHdHZ9YuSKPJ$K0}VйUEB@$%jEB0RHEPXPDPH u5UDC|Zjhʚ;ju ɦUBujSO1ҍe[^_UWVSTU JAEEEEEDEZ  9u| t (EP7YUUz8t &uUB0hu Ep|=fUf9t)xUB @ t_FtjV"DžXZu=OFx_tjhʚ;jp蠥CUB@C B@C$KVu^_uH؍e[^_UVS]u ff9Kt)DVQ tu%BAJS#XJ SV[^ hi0*1e[^USUZ tlB t?uVC9uBCÅu hi0@9uBCBfaQC XE]}]UUf8uB tt E%UVSuE fC8VD{Yt,CSKvӢXZE ue[^Ve[^UWVSL_ЉEURUE jjPHE MA(P7U}^B t+ۉދEuNYu19]jEPW#MPju=EtMNxE4Ur:XNZy}uu[?_EE(MA(P^5UBU F9ދEl} tދEH UNu}u C UEH UB(PmjúEe[^_UWVSE @E]s~u~u;C t P EEK )ȍx fCfEƒt t,9[8u'ҋSt C0C$))‰9=~9EjS_CXu 7{ssEP 1S ;}\0}gjEPS"uu1EtGx t xu 3jVEP!E@ E@GUЃ ;}|14 ~)jEPV!EH EHO UЃ ׉؍e[^_UWVSS=UMPUЅUUfcϋuPUЅtjfC tfC UC tBu=;Ct8fKf{ u+S$t$B xz4u@ tjhYr` u=UujLUj&P}PUЃ ۉEt(C t;CuC uEC,C ҉u؋]Kxfx u@$tPYKy]Kxj61BXKZyj&W~Ue[^_UEtjhP UW}VSt\tOfxuBx vU$9U6}u FGLG0࿉G0GXj+V3cY[u uVW~XZe[^_UWVS] ۋ}u u'jjWuuË@0tECT#VS.ECTCXЋC0 E@C0e[^_UWVSuEF0tF4EVLUBFLzFHERUUB HB @tMEWsHut{8{< }tC0C0US4SC)~8}YUEB HB @uN89t7} hk0VHE)9} )QPu )EuPP ~;E܉s3;]Xrj+V]`WuM quvu&;}4thk0Ћphl0=hk0A9ue[^_UE}4Ѓ<u h l01; U}<u }4ЋA; U|US1ۃ= |4t;4 |4C< |4Zu1ۃ= |4t4 |4C|< |4Xu]U1Ƀ= |4t |4ЋA< |4u1Ƀ=`4Ut`4СUЉAUЃ<`4uUVShw4hk0jjjhhU ohV2|4Ѓ  |4|4 |4~։V 2(KYue[^ÐUhw4hXl0jjjj4h V=UVS]Su aۉXttNJt|4t9~1Bjh VX0e[^US]s0aHSh V]UWVSEEuEuEuE uEFU ML_G~ t8U2z E։0xMQ A EEt&E؉U܃EU9}9uE8u}tU1fB1}@PCpZY s{E؋U܉SC USMKufFfCC CC C$Ef}t'}t2}u,]e[^_0SQ uS6Sb SXe[^_UWVSuFEE$f~uE(MffEEިuV#@td@t_CPltUx|4uI=p|4Ѕ~:B@t2@;FuV Pltx|4uA9|E tf~ufFVTfFX^F(C$F,C$0F(C$jjhx|4uV٠Nɉt!V(ҋF,tB,A$V,F(Ft V VS_EEEEPEPjVSstEX$xl0Ѓ}~E0EFnf~uEfxuPBYfVEfP UfFf9Bu Vd0ZJV9ӋFu9VuXZf~uEfxu PXLEH tBA(Q,y(tP,EP$A(Q,qA(F$A,F$~$EH u}Ut2E@FFEEE@u9E@FEpFVMA QFuE'E_w}t E0EFF VMAQu[1e[^_UWVSWW}GEuC^u$l0ЋVEuY^W9ӋNGu9tKWVWEPXZiFUEXPX4GWF VUBEZG WFVEPEPjWS:e[^1_USu] xXtdfAfCfCAQSQA uuCC +AQCS @t A@4CCfC1]USPP]CEf{t EfxuEPEPEPjSRu1]UWVSE}u FVUE}N ^EtFU9BEtFU9BUB RUBEu@tE9E-|U9Uw#ut[UBR9ډE܉U|F9vBE_u QUBR9ډE܉U:T9L'Uz;}ru;uu9]u9M#;}<|;uw5UB RUBEu@tut9]|9Mr 9}<|9uw5ut!UB RUBEu@t;]|;Mr ;}F|;us3UB RE܋E9‰U|U9Us }u }ub;}|1;uv*ut uV9ڋF  |9wBu @u,h`l0GEUE@E}1e[^_UWVSQQMQAM y9qu#9uA QσMAQOEU XH B R9ӉEUu9uMq yA} GbjEp0YNju M ËA QCC C C$SC(} XGZWMA Q_ye[^_US]K t2Q(ҋA,tB,C$Q,A(AjQK XZu΋]ÐUWVS8}$GEUB,@B0MIMGujhUJGXZEx@uPhwU2PhwM1YuE@EHutwhUUB|Gt8GU Q9‰r&y/u N9r>/t9r))UEMAFUB MȋA B uUЉB G8/u;EP 9whUswhU\>MȋQB@zTtGGEPP^uGu#uwhU Y[G1%=uujUrn MQ BA myvjhUXZwẺuEEEEEEEGEEw EPEp2m tUzVhU6^XEM)MċEPE=?wv(RUč2PMqwhUw GUEMHpMGM8/QYlRwEP XWwhUUrSMqE@؍e[^_UWVS(]E$CEЋC ƒ UMuV$t }t JtE%EE@cx@uhW1fCE 8/ubMQUy/t)Ɖu)FS8t Eyu,Exu}EUzKEsC E҉t"/tEEAE̊t/uEtMỦSU)=CE?FM)AQ:/u)EPUx/tu+FE)FVKEcE8u}Ct@俉CK C@C{uCx.u8.u K cC tUU;z t;=UuMyyG@G<t.Cu(}GTxu XG@uhWcd 뫋u~FcSPWe EtTKE}u VBT@@t EEPB@C ~4;E|c+EԋU)BC +EBC B8uKMy8usw|tlCufujjVuu?ujWiEVPVR uVE}W }u~X8u w|tCtG8u!C@tUԋEP)PKtCt Ef{xMACqR Xw-}uGT@@u}tuF@T@@t EGUBtCtB@@}u Mq ^CuujWh 1WEC% =uujuvh Ep }[tW WI UYBE܍e[^_UWVS }GEGƒU%UGuhuVaG 8uhl0 G t hl0Wu VIb t-}u FT@@t GtdF@_E 0w!}uNFT@@uE}t UBT@@u3GtE@@}u u XGuujVcg 1>G%=uuju;g uD XVU ؍e[^_ÐUhw4hl0jjjhh V VRVVVVVVVVVVVVVUU ҋMt tЃ t uQPEP9Uu jEjP`9UE9UWVSS |4Ѕۋ}5L_tWCPZYt [$uu jjhAE1}}jjhl0ЋEjP:8 Vjju E@X UB@BBCC% B@jCPP}Ƈ/jjYPu -E81e[^_á RUSt9 |4Ѕt*C tЉ1tRCPhl0 [$uָ]UVЉVЋMt9Bhu A9Blu Vu1UWVSQQuF XWR%Fh^lf=xRu fxRWR%xR  Ё=VVЉE}]t EfxRWEZuEFhe[^_UU1ɀ:tB1:uUE@@ @L@P@@@D@<@8@4@0@,@(@H@$@@@@ @@@\UWVSSL_ЉE&45|R9V~ |Rj@F@u+Ã࿉F@V8VWG0jV@RtN@@^WV}XZVЉue[^1_UWVSPu EE@EEE}P} YuEXTPeCWv vvSPe[^_UWVSU EE@EEE}P}ZutEXTPsHCWVSPuUC@%CHjW-/[_t+hSV覹DžDž hE pVعe[^_UWVS@PE 0Ep|* @B$pTu#J,@@(t ,P~fXF~HuWVPË@H,@ @(t ,PBfXۉuWF@%FHju5.Y[t+hDSW许DžhDžd hE pWe[^_UWVSM A8Qл145VЋ VЉ@Dž<uhVjVt@49<8~HwFuWVP uoF@%ju,-Y[t+hDSW襷DžhDžd h@W׷ uI@<uV2XZVЉ@t"49uCEv3}VйU BEuUB0EPS-ƃujSU EH,E @(t ,PL_e[^_UWVSE @t DžXDž\@Dž8U 4E`4Px[uxjUB0RDSuhS4CT@@t8}VйU B%uEUB0EPS'ƃS%e[^_UWVStE @t EPU 2Ep7 EX$UjB0RS_uhSvCTt @@t8}VйU B%uEUB0EPSeƃujSEH,E @(t ,PJ_e[^_UWVSU DžXDž\@Dž844MP`ƭ[jUB0RDSeuhS|CT@@t M yuytCju"ZYu =|4t*uUB0EPS,uKE€9u}VйM AEAEuUUB0EPSƃSe[^_UWVSU DžXDž\Dž844MP`蕬ƅXjUB0RDS4uhSKCT@@t M yuytCju^_u =|4t*uUB0EPSuKE€9u}VйM AEAEuUUB0EPSƃSe[^_UWVStEPE 0Ur EX$MjA0QS.uhSECT@@t E xuxtCjuZYu =|4t*uUB0EPSuKE€9u}VйM AEAEuUUB0EPSƃujSEH,E @(t ,P>GXe[^_UWVStVU B]UuRXhRЋEUEMXU0jRP虚 }uE}uEDžHDžL@Dž(U $$PPө_uujC0S4WyShWGT@@tu(u|u SKu E tCD1Se[^_UUBT@@tB8w$8p0кB<tR€Zt1҉UEH<UW} VSu]tNDShVOSuWVV~e[^_UWVS(}$]uuu0hu  ẺEԋEE̋EUEЉEE EҋE0EE]܉uUEuu(WPu , u(WPu S},ËEtU, t uuu0ju e[^_UWVSQEX$MEyjuWS"WhS;M QMAQ {8qt!uE@PQSrEM+qM 11QWjSU Ee[^_UWVSSSUERp$U~8u @t@txx FTt @@tjuMqVWuhVnM QMAQ YuWQV,EtMAQ M QE+XM 1QujVEe[^_UEP$UUVSpEP@0EPuV] EECN8IU $\p0Ѐ΀@` ΠSEC ECECEЉCEUS‰Ћ]UhWr0u1U Uhor0srUS]S<1t'SKy؋UNJy u$9t'v0G8v0u9QtKyȋE[^_UWVSQE UEƒ?u@MA tk U B 9tM?U k LUBBAt /M A(؃ ABKyċUBAt/tOU B(؃BS;Mw8BuFKyʋUBAt/tЋM AABuKyʉZ[^_UMS1һ  AKy[UE U…S~J t.uH1=H Ⱥ ә[ÐU&4h\Vкjљj;PXV1UWVS}5L_ЋEE #\VЋXVЋ1҅t8E ;Cu,;{ u'E;Cu{,tVhś t몋e[^_UWVSSSMAEyQ U#\VЋXVЍ҉t/;xuu;p uu;pu x,tu؅tJY1 ZY[^_UEHttJ@UWVSL_ЉEUztu uurj uC\P[ShEP E@ SiEP SjEPfSkEPSlEPfSmEPSnEPfSoEPSpEPfSqEPSrEPfSsEPStEPCtUB ChUuCx1BChUuCx1BChUuCz1BChUuC{1BC0xtUuCv1BC0xtUuCw1B} t u ? u?1e[^UWVSuFhE܋F@<^0t#{ttv vhw0 T1RE Pv6QE 9FxsuPV} uFtEFtE'jEPjE C`KTHHPVGE C`KTHPVXE #CXZE}KTS\}tE)CDWjs`PsWE j)s`Pv<tu?vOEK`}xH+M1EXt u=uk>_E Fx}uN$jj1} uuPvxjVQU Et.jEPRSj"u:E KTH艆EUtCt Ѓt RS Y[Ee[^_UWVSQQE MEM]C@<s0t~tt Cht {x9}w hTw0NF`MTNTD8)t6;VPvJjjjRStjujsxS] ECxK$E ]e[^_$e[^_US]ChuSX]]7]UVSEX=|4t{@t Shw0@YXVvSLXF ZtP@zF Xj=Vֵǃe[1^UWVSPEp=|4xt~@t Vh x0YXE{\t1{,!FT@@ujjjjSEEC\jSXZWjV {\u WjVg| Ee[^_ÐUWVS1ҋ]E shs4Clȉ)9‹}vCЋC8t}tE}t E 1shE[^_UWVS EEEEp0VЃ}} ]u}u 1UBtEBhtqNT;Bxr}w+N\F@Me}t+N\FU;B`u uuiM_I}u]Ѓ{e}tfEt2jjeuuu_Eu+F1)FV EFCjjeuԋUrxR,]MЃ9YtEEtju[E^Ee[^_UUE@EUVS]1{ sPVvJ1{ P蘸e[^UWVSQuVFz8u E WSEXZ9u v7v7Xv7Ee[^_US]s ssd7-]UWVSdEX]ЋPUċPŰHM@EMI L_ЉMEEEMATEJTE;HTu ۉtV;KTtQuu]XZU;UuR7u6XEЅtP6_uu)u619tuhRE uMMŰGhtTExu@8.t9}tE@ uMA uG@tujRX 5@GEEċEEЅEt EUR$UMI(MEpp huOujủUMċRt9PttEu5}[}t~}t ub5YuWƅXZE@u hy0uEPu* UċEЋUEt E}tmMAht.QL[B&}uGY}uuyƅXZu4E^EPuU+ MA$ Au hy0}uujud uEPu)Ẽ u7}uQEpK4}[tuju# u,41WUUJ$M9t>}t h0FEp3}Ytujuȑ EP3j UR_\SEj SMQEUP$MEA(ujQW,tj SEPR FG,UMJ$WRƅXZu+}uYjGPjEHTEPut}uju tURX!UMO W?}XtujuĐ }}_tu h z02UJT+J\CBDURjMq`Pqt ujUEȋHHBtABtAEPtExtu;P;F<5Dž@| @xtu @< Džƅtt3hhԻ.ƅhƅhӻ.ЍPfK ff9AQPP ` t*>Cx񋵠)ΉߋHT tPX+!ʉP`+C9vЋËBx)ȅ9v؉ÍPPPVASPjqwx@)9މvPH9‰Ds+ss1s#s sKKe[^_UWVSQ] C=}E19 fƒE$,~0%@t1  = `t=t49AyyЉ%@ts tla`taPptUtPE% Vt" t0t@t !A9rA9s A9r EF9DEEZ[^_ÐUhRh0hR讜hRAUWVSSS41Ʌҋuu 4P4Ћ49}A<t;4@=4uA4t hL~0>49}<uf4fFL=4t=4t4944Ѕu 4 4Ћ49|9}4j4j P]E Alj1M󪡘4Ѓ tuSPj 54Bj4j P4ЉE@lj1M󪡜4Ѓ tuSPj 54]B4ЍFFFhk0V4С4Љ4ZYu 4Љ=UtVXjVke[^_UWVSE8tP ^U$U1эQMUMAUEEwEEHj@j \(SE?lj1^(UV(CuF0PuMK}GUCWLfSGTC4Љ4~ F.ЋW VG }҉ENtJUJMq }~8FU}tMMDue[^_UWVS}WL4Ћ4t/jP7wjjVSLJ8]e[^_&we[^_UVSjPvVЅۉXtS[XuVve[^UWVSPujPvE<1!=UЅXt,tVW,<XuEEe[^_vUS=4]u(VVVVVVЍC C Cjjj= Ct@jjj= C u h`~0M@VЅCSt VЉPVЉVCVЉ]]jUS=4]u(VVVVVVЍC C Cjjj= Ct@jjj< C u hv~0@CVЉCVЉCVЉ]]UUSB<;E u-Z4jjrr0r jKu ۸#u1]UWVSVuhtEffPdž8dž8dž8dž8Ѓ~8[tVY@VЅtVh&SS( #tG!~VVh4V<h VV.XZhWV!V_XFtBVЋVFN t]QҋAtBFAQxuQ<ҋA@tB@x VЋQ@A<VL4; t j Q=Y[N uFt0VXFZuVj VL44<VL4jvi ϖDi$ wi i i$Fi@IHi wLGi i wJii tb8i t~5i i$w~i tFi 6i(KiEfUfPMQ\EPXEPjDEpETPJdjSPHZEYUBPt&E@uhhuSh E@t&MAPuhgu9Sg UfBPUfRf%RfqM ЃfAPWVQIjSG[E^=E@UB\MqXjSvGZEYEtQWhi uUEM 9qXQ肺^jS%GYE[Eu -WVuUEEj@P]SIEPj@EpSEjSF_EZNEPj@]SEpE}ǜEj@SP jSQF[E^GPu,uW$!jS#FZEYGPu)[E^YjSEZEYM4QL۸oeUzXBt HMATt t #t1=uEjPBP jCDPEPE @Phd]UfbPShi RMfIPShi QVdEX t@txu Su^_[u MQ Ҹ-tXuWVj QREEf@Pf1EEt3EPXhRЋUBP[tjPHduSOd Ee[^_UWVS,E EVuJEt7UЋB u <v\v uEЋ@EuɋU 10U RỦE jEЍuԃ$VPJUЋB u0}j uV E E ><w1EGEGEG j ủEEP1E EI)Í[vUju̍EP EuPẼPWEȃ U̍DẼ}u vveEЋ@EvU )Eȍe[^_US]t-Bu ǃBR1KXɋ]UUUUWVSE 8t11ы] | /~߉р| 9 *Ext u 7N[^ujjj i) Ǻ jjj L) ujWEVЅtu SZYt [ uukjjj( ) ujW*jV* yju PCCCCC VЉC$VЉC VCUVCFC0sGBGB8GB1ҍe[^_UWVS}_ۋu tV3YZt [uu SҋCtBGSC3Nt39yt u&t"ҋAtBFQjQ)XZPJ҉Pu+P ҋ@$tB$VЋP$@ j3s)_XjSi)1e[^_UWVSMQE ҋ@utOAvuBUyt6}v-j6]S* jWSumvu1e[^_UWVSVЅۋ}tWSY^t [ uudGSu҉tRG6uFEҋt:}v1jF$P]S jWSum6u1e[^_UWVSEP] tt6x%ph0йutsh0u [^_[^_UWVS0VЅt>~0މt [ u"tCth~0pmY^u5HVЃt{1}VEPPEEV tx<th~0pSCUP8PDPPǃjjSC8P#]US]t&JtBABj7RiXZuڋ]UWVSu 1ۃ9}s1;1ȃ3 ~0ЉȃC3 ~09r[^_UWV} 1S9sJEЉك01؉3 001F3 09r[^_UVSUB] ut' ttSjSBP諾jVSizujSh4蒾jVh4LCC^BCBCBSzu1z u+zu%zujShÍ4DjVhɍ4743C3BCBCBCBCjVS /1e[^UWVS$h+SEЍEPEPEPtuSEtEuuRE [t0}us}ԹuCuR1jj7j@ uuR7mjPEP$jCPEPU S CCtE CBU Cu(R4e[^_UWVS$hQÍEPEPEPt SQE E UЋRUЃ}t(}uЉuߋuи}ԉu SQLUЋBHBt SvQ14MЋQtABMЋAj7QE SCQ4e[^_ÐUWVS0UEEBPAAu 2]C4u$ju!ÉEXZtK8 AC4t7C\t@4u(P"]Xjs0!C\_XAC4t!STt |U9s;]@UBЃT$`0ЍEPuu SuU1҅ZE @BUBQ5jj PAM  jhʚ;ju :EEPuu Su舼1҅fE҆jEPE PEA j]EPS, Et E fHfC fEU Z%P+t @t(d=tX~KtA8CiE fH[PE$Ph~0y/ }fEtSuuuHf}U Btt69R8u1B+B$U Bt)Ѓ$+E v E h@ jju 7ƃ FtFF@@@@@jPEPǸ Ftt/9v8u*F+F$Ft)$) v n F jj Vl7ƃ t FtF 7^TCjPEPK }CtjPE jPEP& f~^h[ME̋U9Y|V"6EYuEM7hFUupEX|ftUBQuRZuL1 tV5Xe[^_UWVSWWEUEU@P] QuF}Gx Gx4ЍC։u EfHCt UfJuFt }UB8xxxfxfXjR:fY=^t: =t=݆tTx &4jj/j0hK V{u~Px` &4jj.j0hyK4L &4jj.j0hSKW&} EUUe[^_4h'KƋC 9CZ|Cu3{_u-S3Y$}GCu;UP}{Cue[^_JUS]CTCUCVCXvǃIS(CUP8PDPS;]ÐUjhЍ4XZEЍ4UWVSjjhu à ۸ 1pVh0jC$PtCXȁfCPǃ3SǃQCTCVCUu"SV\Ep5V SYS4jj C8SP1e[^_US];VuSSjS1]UWVSSS} Gu]u h0螪V8t#FPtMAWffPR ۉwt6C4t-W1S41YA3FlGF|UBЃtt VE0WE"PF$Ph~05Wo1/hyHEC 9CZ|CWF1usH7TGCu;x{CuMj &4e+j0hHFdGFxuH1e[^_UE t@PȁUE S1=2i MUw=1i s$= i t <=i t-3fIPAt/B S&tBtt/ BAX[ÐUEP @ P@@U UPUPUSjj j] u h0xE BEB EBCBS]UEWVS} ~!1t7t7 t7uKue[^_UVSu6] SV uNPSh 0Ё06SVu%jjSV+6SVu hE0讧Fe[^UWVS}}EEg} ]U=5i t =6i(tiBE X7SWG -t;_u ;Gu1WwUG_uWEZwMOE x WҸtBU BBBBRuW_ YE^t EuM A txu9vjjP E_ 1҃ t9sCMBt9rPE p$u Eu tEjuNXZMU J Ue[^_UWVSEH ]1ɋ} tQ!!9uu΋ u[^_UWVS}O ɋu t<tA%9u ۋAtCGQj Q YXۉuče[^_U1҃=4Mt";4u 4ЋD B<4u1UU fzMxB B tRRfzyUWVSU fz}ux%J Z "3t " ;tRRfzy[^_UWVSM ]4 )CA҉UE~)9s2EЊEЅEu^ECA8EtE9r9sAEu79r}t!}y+}9sCEu9r1}EE[^_UU VS1ۅҋutp jRS 1҅t)X VuZYtt9Xt @t9Xue[^UWVSE X HE9ЋuvЅɉu ̵R 9vЉ‹}׋U9s2"1u BCA9r[^_UWVSE ]Ef{S 8xC MC t[[f{yCEt8u֋K }9s8uFA9rC t CtÉ1~J+u҃}uUu[t7C tC9EuSu [uɉ[;tlGt 9EWW`C U9‰UvEwSu t-G9Ft vt9FutuVuC uu;]u1ҍe[^_UWV} SuFٺfxpx P fFUV @ FF [^_UWVSQQE EX E0uP6MuX 9XZsAC8u9rUuC2A+MtIu]S C }:t[[C9wuQuNj@EV MF u~~{wW G M u_ uw_Ee[^_UWVSEEE V9ʉU~M}uEE9E~|}~EHPĵR@P̵R@P諩 ]+EPEĵRPEEP艩ĵRЍ4 9v~u N9v~t)ƋU9։u 49|54СVЃ,\9} <)1E䣤4ЊUĵRЈV05ĵRn^}_tx E5ĵR9t1ۅ} j Vj0PÉE܃ 1 V0us0V5ĵRЉu蔨SEP5VV}th`0j襟ju'zU<2u9Es>u F9s>t9t4€t EuU:4uG9tEE+u4uEfC}tK ؍e[^_UWVSM] :v!u<9sCA8оw9r1[^_UW=VЅS]t GVjjjjƒ uh0j薞141fCfC BC tZCBE B׉e[_UWVSE ]EEUfEfEt7r jPE 1}sEf@fEfEUR UuEPSu}ƉtJV1;U$}t6t)Ef;F|)Ru6YZuvuyYZu vu9u3uG UF G~E9xFwupEp]UuGFwF~tpEUB fBB }tUVUfBfFB F }{fGfEG9؉EuWUEfxyH}toUzt)Ef9B| :ujRU܉ÉXZt]܋E@Eu.Ut%U܉ËEf9} SU܋[uE}fUf;W~C fFfE}fEf;GE9uUU܋t\Ef9|GRCCtF xth0jݛB;}tWubZYuWuZYu SU܋[uE0VU܉e[^_UWVSES}WEC UEY]U[J;Et u+M>Ex 9ɉ%} t=uju 1҅@ U9BtMI1҅ɉM9AuuN҉E@ Bt;Euz ~3h0j賚9th0j螚XZB HB yuE@MQE@9[]KMA9;]u҉t&9Bt zuVЅ҉BVuh 0j"u_F Xu E@ t1URUMy9MuWu9ruzLExDU҉t-;}tRt!M9JutuFBFtPh0j菙Y^EE@  ߉P9BuZZCXCXUz;}uZMQ9JuZZSutpf{x҉t zRuSۉt3;u$JB HB yVЉBVЉʅҋ[tuͅtSRh́0h0j讘]9]t2}UBPBPS9ZuMJurE` `#e[^_UWVSEfx}x @fxyP9Bu@ uЋR9Bu@ t@@fxx @fxyۉƉt@ [u WPU ZYuۉuF t1e[^_UVS];u t'jjjxj 1҅tu Ee[^ e[^UWV}1SE,Pu 5ȵR]p\X@ @F U fV̵RЉS UB ^BzaBYB XXB(dЍe[^_UUЉWStP(; V~ VЋ@u VЅuh`0j軖kjjkPk ãȵRuh0D Vk19У̵RЉĵRs@9rjhV[_u h0趕e[_ÐUVSu^۸7tR5454V[S u9sF @ffCE fCVЅtVЉXV1CVЍe[^US]C@P#4XtCBCjS3]UUB@tÐUVUWVSE VЉEUEۉUEEUff9CfCft f;BSt 9ɉ֋}S t 9ɉ֋}uq}tejhʚ;jutKjP}uLWgTu VX)WuwQE^_tjP SU2}tFju]uLSTt+SuQEZYtjP uXe[^_U1UWVSWU ] s}ME-Tt y $0Ѐ{x E WSiE&V#~ VSL[^SnOYF tE8GF E9C SuPEXZF VxSv1SLLR1o-hE-MFu E=SwvF u E9!Swv 脛_ h0}t uXEe[^_UVSUЅۋut{ ts$PS XZ[ue[^UjhX0jjjjlhV言Fh@VUS]t x<t@4uu jCP#]UU Ҹt JuEt1UWVSLuF<@VjPE1/EEYtqWVWDžXZtdG u^} }tPG4tHuPY[t9EPjjjVj t}G8!EtB@5t]uFC4u11}C EC0ECECDEċSC f@LfB CBC$BEBuU rru u}7EEEUM]L uQVM  }jj P SҼ tjj PS贼 tjj PS薼 tjj PSx tjjπWS[M}1ك9}D*9tB9|9u A\*EeEә;E~EEU9EEE}}EMjD)PV jj P S袻 tjj PS脻 tjj PSf tjj PSH tjjπWS+EE9E@EPVzu P腻}t ]i@B^`e[^_UWVu S}19};EtA9|[^_UWVS}E EP%=t/wEtG=t4=t=t$E%EEE | t}hEM HEtoR%[&]C}u- tVSWE @uC~PuWE }UBuGu1u;u1*]%}u uC~ ;EtuWZYuYE4E9 t E49 t/ w$0Ё E4Me[^_UVS] uCC uC wQ$<0 PDXPV( C "KKKK Hw3S$`0Ё Se[^US] t(H ujjS tfCN]UWVS }EE1ҀtPd2E1ۀ0Et.M슄 0:D2u ȀD2ECE09|B9|EE}v [^_UWVSPPu M } v u h0E 0ET} fu t !9tE}~ }~iUR R@1EM} fTyu t) !9uEѺER}~ t1PVR VEER$E}~Ջ t-PVR Vou VT^_Pḧ́0]} u y  M f 1ҍe[^_US] @t1_fǃ ?f @ff w*f fw uAff v PS ]UEf fU uuBJ%P=Pt+u!%=t1@ƒUUE Mw9$؆0 + $t u 0ЋD 190tBv1UM1҉ȃ90u 0ЋDBv1UES$Phe.Ѝ]S_Su _]ÐUiUS]$ tjPǃ$ XZ]UWVS@EE$ Eu2jjh EuU EM$ U ŰJMBPj}ZEĉEYu}U M fAUf%VfBABABABA B BQRfEă$MĉA_}XAtA UĉBmMāyA vjQE[@^t‹@0B MċE ypMċQmEE}BtpM@ B( uHv%=uBM( EċH1@~AE࿈BU JAEffEԊAkuE֋ }׉ESPuk }M̋A +]uEEUȋJ +M9vlɉufBPjzMȉZYu}E E@ }vju U_BXtB0B EY;]~]SEMAPŰEBPuk}t SEMA SEUBPV]ƃ )]]]}}tjEuЃM9A rA 5EUȉB BPjMȉY[E@ EjUȋRUuEPujsMEȉH EU̻J +]+M9v˅~ MSD)PE̋@EuujŰ]}UEv;ut M u 9EE u #u1e[^_U1ɉȺt 5 JyRA~UU S]9ڋMs1B3 R9r[UWVSUE Mҋ]EU}Mu h0Vuf~yjVIffXZ E@E URUt , uN }MEw 0  tZUBMJMfAufffAtf9u 8 udž k E@t3Uztu*CPt P蚞$C$Ph 0,Y MAtuFExt@ttjMPS҃ CPt E P%$C$Ph@0X utjEPxt$BMAxuA|BuBp ul Pt p SXEuE  y$0Ѐ} tE }#CQ9E@,ƃ@ }uJ u苻 #u4йK}t < > tE B#C#fB'fC'ECE CU @lClujjh茲 NyE@Pt #4L1PCP艔$h 0uzU; ~gN~9ɉtU RE@PtCP'$h`0uO ǃU E@PE }}tj3ǃXZf}tEE P藓$EPh0h0uU; tE wU %PjuU XujjFPذ t.NjhSuU E e[^_UWVSXUMMUEUMEUE MPӉUP }@U44}}F } }0- }z }Pt-}t$ }} E)؃ @ ]]]UEE plREfEEE1_;]؈X2wz$$0Љx]sM ugCfKfMf ECkPCPECE;M t/CE']"{t Md CE Ml C\;]d}uE` MԀyv~ EMRMuEp M u8Ut t t rVEURP]܃ SR&EEuSu#EZYE'Ft*My6u!ψA671}N7U܋MBA#fBfA'EAUQMUB)AB-MffB2UfMfA4UERAlEfApUQrEAsjuuQuqU t}`}PVMEjuQE ( 1;]EEsGtt 2t ]]C\;]rЃ}tMԀybuU` F< vMd t,M :B6uȃz79tE| lMU; uE܃ PR!E^_DEUBMJjuuRujjPuuUE)؃JEfPffKfCu.PPuuuu؋E܃Puu$fu$PPuuuuu1U vM f Y} uEE0EEE)؃}t U u܉׉U#tM ffEf}fUt1;]EE)tt 2t ]]C\;]rЃ}EԀxF< vEd St(U:B6uȉ׃79tM| 'U싂v=E܃ PuEY[tj hPuME U샺tjkMǁXZEtU tt-juuuMuuV&E djuuuuIUzWuW?Ȼ M ƈѸ!EfǀjuPuUM EUBMJEfB2fMfJ4U @lMAl f@pfAp @rArEĉEM Ue[^_`$U u tMT iE)؃1U UffB4f3ft_MAPt4E܃PS$P}0L1t #4Ph0ufUE; tM fUf;]EEs*t2t]]C\;]r܃}uM` EԀxvUd ijuuuuNMyWFU%Pj)]؃}Eh U܋MfB t tU%PjMU; BPPȃP$h 0)]؃}Mh U܋MfB tt!vU%PjuM WMU; tIBPt"PȃPb$h`0uEUE Ue[^_"M e[^_UWVSQQ]E pF EPSQDžXZu(CPu^EC$E E0fNщ%=t2CPPUu衇YEC$E E0Ѝe[^_'Bf;t4CPRPu`$C$Ph 0AWx҉UtBGxu8G|/CPuZEC$E E`0Ѝe[^_AE@HUrutjPS҃ N CPtGP諆$C$Ph0=A E@p u Ul UPEp t Se[^_UESPP1] t-;uuh0 P>ZY1Ʌt ȋ]UWVSEUUEU EB)EB-EEUE؋E9‰UwrU9UsEu ##u]EPu=Z1҅YyEU+EU E؋U+EURPZ0x #4PE$Ph 0?1҅gu u^1҅_PuVuY[tWE #P]$$Sh0?uuuuSh 0y?E $PDŽ$Sh 0\? U ju R5E xWu9Vu8_Zt#E #Pz$E$Ph 0 ? 1Vu[^t[U #P;$E$Ph< 0>E #P$h(.>E P$hR 0>E ǀUP R 4e[^_ÐUWVSU ]BCfB!fCB#CfB'fCB6Cj CPЃ7P=Du vluHfC>Flf@fC@FWCBjCCPXP D VuU CRjCSP)PCfF2fC\fF4fC^fFpfC`FrCbFsCcFtCdffCfffChffCjClCpCtffCvCCx{8uCxU E; uKxe[^_UVS] uCFfCfF!CF#fCfF'CF6j F7PCPBCBFWjFXPCCPBfC\fF2fC^fF4fC`fFpCbFrCcFsCdFtfCfffChffCjfClCpCtCve[^UWVSE =iDž=i wC=iYw=i3=i =iU= i j =i|w=i =i8B =i| =i' =i &w7=!i tow=i>=i: =5i t\=i tr =i8w=i =6i(t1 =i|=i|- uPuuyPE Puuj5L_`^_c j!EPEpA A UĀ + }Ǥ ʋU׉ Ǥ u&1}!M Ewˉފ MāƤ U N6Mă7Mj!qEP{@Pj5L_vY[y] u u~Vt11DžMDt~#P+xPt@ ~]sNwktt@uE uUzt] uU~ u M Džkt]ɍ<x0u G OA CACA C Dž4뙋E UBM @BDžE|tQj5L_蛳_Z UD t PU> j~Sj5L_3Y[6MfA]f yt- u  U  M ]C Cj5L_莲_ZEƿC0U󦋂 ы u #] uF fFf 2E HU  #RE w` u‹MAf] t uFf fF}1U P#MQf@'j5L_L[^O]fSfuudž GffMRу]R u E u  9Pl] 9Blu w u U M @lPu]fChuEv, P;j5L_ZYE @MfQB1f=Dž]f Dž4u @Uf MfA]SB=uVXj5L_f^_iE Y@PuDž2DU u.t  M  tjjQ jk&4PhI0ЋEh PEPu Y[uPulj5L_蒮_Z] {]Su Y^uSui DžXZtSuFxPWVu >j5L_^_!EPu. Y[uDžE; uDžujhWuU~jhWuMWu9XZ]DžCu te{{v_SWuQj|UBPS8u-|MA?t|9As Dže[^_UW} SLJ LJ LJ =LJ bLJ LJ t4Љ f fu fLJ f=v fLJ   љjjS“ uhS0h00fLJ XZ 1e[_US] 9 |S\X 9 |1S Yt ]UVSuVÅXu h0,CljPfC$rX fdž de[^US] tPS ǃ XZSb Yt jP肔XZ]UEWVRR@󥋐 zluNBl^_US]   t   CPt$ tO/0Phȍ0S S]S Z@Yufǃ jSYXƃ ]]]UWVSu xlN9vRWVRWVt t Gt ;xluue[^_WVmWVd R xljjVe[^_UWVSE@Pu t h׍0PvXZU slVRkUPSWPS[P S_@CcUCffC!C#ffC'^ _u# t C#f fC'K#E ƈK6Ƥ ɍ{7CCC)C-Uf fC2fC4 tfC4E u fCpCrjjuUe[^_UWVSQE EpluUM RqlRuEU =t M 9AltMEU MfB4 uuMU fB4tu tMju u" yMM t&M A69u΋}7Ǥ 9tME tƋ} #tM Ee[^_UWVS }GPt$ tO/0Ph0W t  t?vlW[vlWP+u1Rt*t F~Áu;`Ã1RtKt F~эRP+1ۅ u% t t W>Y[WWZu8 Ѓu LJ PX  WQW0tB~&VW^XVWZYutC8Fvu&S W ǃ u'j W xWjjjjW t P[LJ e[^_UUS YXu u 1[UWjjhы t +1Ћ}US] tjPiǃXZ]US] SuYX]E ]3UWVS] Suu+ǃe[^_UE @UWVSUu ]FfBfF!BdžjPD Xt u ǃ  F 0  Ft  FB   F Ee[^_UVSuVÅXtu SV* x e[^UVSuVÅXt/u SV B#C#fB'fC' @l Clx e[^UWVSQU B] Etfu} uDEҋ@tB EP A ȉ E@Eu1Z[^_UVSjP] u SP e[^UWVSu } tt {jPN WV KuS t1uWWV_X1tF BWCWB[C[B_C_BcCct jSVЃ jPC$^؍e[^_UWVSEQP] SuV tCjP{ WVJ uj tWVÅXZu JUuRЋC#fBfC' BWCWB[C[B_C_BcCct jSVЃ jPC$Xe[^_UWVS E EEXjPȿU ۋ ^tis} uRE9ClEEPtC6uE9u#u{79҉uU9U~ E]E[uU MEe[^_UPEPuu ufE#UWVSP}u ; u h0F ?ș EѸU !ҋFtB VVtF B F  tHVxt'BFxuF|BR=XҋtjPW҃ u LJ VW e[^_UWVSu }jP^K^$Xu5u,jP VW E e[^_ֽe[^_USjP]詽 YtPSX Zu 葽 Yt PSbXZ]UWVSP] G jPA XtsE 9 ~`9~tT~~uK u3 jhVSjP VS VS^X uu Ee[^_鿼UWVSSE uE}jP莼 Yt SWUXZu Ee[^_rUWVSE UEUfuf f9s=ف?ș UEM MtCf9rf9r'juuVEE ue[^_u؋Uf f%? ӈٺ⋾ 1ҋt RuVЃ juuVEǀe[^_UWVSVM u t Ph0fft?Á?ؿ MLjѸU!fdždže[^_UWVSQQE E uEM Ѓ t t/tx}1Y%Pt8t3U #t4йEwAt3t c^DQM tuE#AU u'#A M E1}u}t_Z[^_ÐUWVSSE]ECPAAu }jjV蕶 @it h#Nj9Y|&V<$h0S*7}FupFC|FtCQuSZW赸1+E}Eu ]e[^_[tVWX2e[^_UWVu S}]u h0džCtt/9[8u*C+C$Ct)؃$)؃v kC jjS蟡à ۸ CtCsESBfBffBFfBfF!fBB ffBF#BfF'fBfCfyt f%fCJ@GPtQ t E%Pt;vlWZYPFP5ae}$E44h@0WJCX uT XX \ fGNW1e[^_UWVSjju 1ۃ @it E xHAt tut t fqqVuÅXZuGU jP6C$B_u'V`$h`0uGE ǃUE x wjPNZE YuU E pE}Pu/_XuU ǃju 5U B@@@@@UfPU BY^tt69R8u1B+B$U Bt)Ѓ$+E v E h@ jju 詞E } tU BtBE U JfAffAfU $0AC#AfC'fAEA fEfAEAE]AEAEfAEA fEfAE B#AfB')AEAEfAC#A fC'fAEAfEfAU tI@EE )} t u ͜_t Su[^U1e[^_UWVSSEEM}t EjEЙGt)кәGFA*w$$0й 4fw1ۃ} t ]øUPff_1Y[^_UWVS,EU EUEUMEUE U(MU؉E܋UBM}$EtEE+EԉE1EEȉU̙։uEEt UCUEȉEЅt~U̍< }}̃}t%uuuuQuVWShА0h0,M1AuA tuuuVUԍ:P?@tAKMQM܉Q1҉*E܉EEЋUMEԉUMu Ee[^_e[^_UEWVU  @~@Ǎr^_UWVu Ev2@@ǃ ^_UW}VMu GG^_UWVuS}v Vh0tu WÅXZtv WS[^_e[^_UWVSSS} ]u h0-jPΰU B$װ}@YEts4}}} }0}}Pv}_}3WM Pjj Euu EPPM  PRu vlu USWSP=M+A$A AUu F6u0,PjjO EuM ]uVBFB@M f@2fB fȸf)ȋu z"ttU Blxy fM P6R7PWuNj WPW Ǎ@uYU GBpfBqGrlumP1G@M qluPG1҉u GFrGNjE plGu!XGZU Gu GGGGM WPGWu+FF F_XjjΥYE^C1҃wM t1Ʌuu t uuҋFtTFF FuFF FEx1ff_fGt(fGU  u MfIu > E@PE SPV$h0u F6Pjj EUZZM ufȋ f)ttu Flxy tf Uf fC} {u P#Sf@'fG{ M A6Pȃ7PW] WSPiSPu+FF FE"jjj EuE MQQu ttu Flxy f fZuM ffB] WSzWSPu+FF FE@Pt E SPBU$h@0ujjj _EZuU dMQAA Afu .uuu u`u}tUE u uY^e[^_UWVS E WEU J6RWH1Mv3Eu Pjj 1҅Ef@@f@4ЉPf4fPP ffPM Q#PfQ'fPf@@@fQ2fP 1҃ X" f)ttu Flxy tfU B6CCJ67B6uPCM qlCuވuC {u CCCCuCSzU+BB BM J^;E_U~urh0, e[^_UWVS] }uujPW 1~:VkGPXtIj2CPpR$G$Ph0 "FC|usxps|^e[^_UE@Vfǀ  fǀ * ǀ ǀ ǀǀ9ǀ)US]T t-BT u ǃX B\ R舐Zɋl t-Bl u ǃp Bt RQXɋ]UWVSS] E E~ 19ߋu} <^wGF9|9u;hI3 ۋuY~Ph@2 FXOZuEI3Ѝe[^_ h0 ۋu_~Ph`.v FYO[ue[^_UWVSSEuEF} ]tO ttpF P|P$h0 FPfP$h0 F`F PKP$h0 FP5P$h0 F/FPP$h0 FPP$h0 F PO$h3 [FPO$h0i FPO$h0S F PO$h0= FPO$h0' ƒ tuhf. Y44hm1Rh0 XZF@t hÑ0 XxغљPhȑ0 Y[}xuh͑0 XZhn 1 [~?19}&u h0L2 Y3Ph`.Cr X9Z|En 1Ѝe[^_Y e[^_UWVS] EsluӨUEEE1X{WsWZJEEt@MAE9}0U|2\1؃9~ E\0T1AE9|ЋUD2ƒEUt'x#U xUD9tEEtQE1ɄEtE\U߃9taAE9|U9uE u U|2yEEEt5}t5JM9}D1D1A9|D1E\0럃}u UT2UE9E}t}t Ee[^_UWVE SuU $H0Ѓ$\0Ћ ttQjhSV=jP薢 ۉXt"ftjhSVuWxX ttGjhSV3jP3 ۉXtjhSVuWXdž T t-BT u džX B\ R諊Xɋl t-Bl u džp Bt Rt_ɋ$ tjPjdž$ Y[V= 4ЉCf4fC!4ЉC#f4fC'slVtPSWPS[P S_@CcfǃCXZ$p0Ѓ u| =toPVo[^ jj@FPt #PJ$h0Vȥ VY PVÅXZtV5-$0Ёj.t tjhSV )jh$0jjjSV$0CW9|Rh40hґ0 FPtsC#PI$ u00Ph0V跤C6P 7PLXȿPslV[_Ph0$dž VYe[^1_ÐUWVSE 11]u19Mv @~ETtM D !9u:΀M Hx'M D!9u} uMff9zrHy[^_UVS]CCk C k ҉C CCtѸ1=w@Bȉ֙CHSL[^UWV 4S4Ћu])1f[^_UWVSE}@E @W_9sP19v @vˋETX4Ћ ܐ4Љ)G Ѝ21UfDZ[^_UWVSSSuF] WECHCPC@PiZYts1ɺC9v A@~vMV9sGfDwfwf9v9f҉uf ؐ4‹Ԑ4ЉE)ЉыE1fDwe[^_ÐUWVS]ۋ} t'E48VuUZYt~E<0Ku1ҍe[^_UE @E E@E?UE @E E@E?UW1}hj jtEh 0ЉEEPV1҅tЋ}UPPhjjJEh`0ЉEEPE1҅tUM11f9 0u$0 B sv1UE19`0u `0ЋD BIvd0UVSu] 11f90u(0f=wȗ0"sf=Gwė0A 0vƸ[^UM11f9 0u(0 B sv1UVS]j0ơ&44PS\VЃ t"BHTɋt|U9wR Xۉuމue[^ÚUWVSS] C0E=4}sHuE|UЅ4u |U@|UhRh hR購5&4hR込S4t OxCuCxtS4C4trh(4s StC<@TS0BC#FV CtʋF #VCB #NF fK>#FV C fCf#VFfCf#VFSWHqUZǃB @8ZuChǃ1e[^_UWVS EEP@U@EL_ЃEUEEfp։%E؋EX C8M u e[^_=t Vu 1Efx>u1x8u+uC tuEy Yt S%=f{uft,E#tfCjs\%^Z1Tff=juOZY "U샺t>jPCPjhVut@@M9t 0uPCPjhVut@@@Eغ0CUfB8MAhtfP4f5L4fE< t&ju/O[^ VfEXfH4f5D4fUf;uE)tP1f)ЋMfK1UfHf9fwf;EsMf1MUQ RRPfZYuuPE8PjhVuu)t}O12EfK1xqUf@f9frf;EvMf1MUQ RRPrfZYuuPE8PjhVu uEfx>P1ҍe[^_UWVSQ]C@@ @U 18ruRS=Cit h0z t ~t /f~u 1t VЅtFuBH@uB @PtBXF{8u7EPC@@PCHPVu}uE1UiC>PC8uGPFPvsn0u={8u!f{>ujS1YZ1tGC8FC(fFfCXCit 谮 D$PkS҉XtC B C tCBCC;CSuPPC;CSuPQLkShV3]UWSE XU@ 1CfB>fCB8C[_UWS]C@@ @8U u[_B R1BfCl1E@hRy,uy0u y4uy8t4E8uxu xux t4uܸ,}t$E8uxu xux tU܃zuz u z$uz(tDM 9uyuyu y uܸ} fUEf9P#VF CtʋF #VCB #NF C>#FV ҉C tCBC~CifS>K(fC<}~}f3Kfffҍ!UMt #VFXS(fCf#VFS(fCfffffҍ!U}Mt #VFXfCf#VFfCf#VFS}}e[^_OdUW}VufU ff‰fS‹M#QA҉tQBiuEM 9J(u=f9zu1M9J8u)9t+ tBABtPZu[^_UWVS EUfEfUE P 3fEfff‹Ef‹M#QA҉UUMAitsθ} u_fUEf9PuIƸ,}u6E9Et>MtABMAtHEXU҉UtE [^_UWVSEX]@}uU VЉEt VЉU EVЉfff#UEt,Biuf9r>ufz<u 9B8uz(tuu_EE9tOfff#EUtTBiuf9r>ufz<uE9B8uz(tu+t';t# tBABtPZ[^_UWVS UfU VЋVЋEMUHM܋@}} Et EVЉ} }EVЋUfEf3Uff#U܋E؍҉UtaMAit@fEf9A>u6fy<u/θ,}uEԃxux u x$ux(tUԋ҉Uu }u}E1EfEfUff#E܋M؍EUBit@fMf9J>u6fz<u/ָ,}uEԃxux u x$ux(tUԋ҉Uu6}t0M; t)tABMԋAtHEԉXEԃ [^_Ð4Ut PU>4XUWVSEx} t VG8 uG} tACU9B r6;t/<t+< t'< t#< t<t<t<t<t<t  VuFuu G P fGfv4]1҅t9s S t9r9։vЉƍ@=vjjFÅXZaF=vjSVYCXu SXG1Z6VCS u )ЃC} (Sv h 0E  VЈ} uEB9B} uEBE} u}u}t EffBEBBPVjuJCuSC$9s h0KC QC CSuFCAABfC ffBG B GfBB Bjj VZ tPu ZVSYuF uF1e[^_Uuuuu uit EUWVS}GEf@] f)؃E  V$;EvE9G sPWLY^4GƉE)_ wuWu-YZt  VQ_ )_<(9 V(^$ 0Ѓ,$ģ0Ѓ>70 )K Gt jWXXZ}#vDV A9E|,v'F%=~)uX}CvA09E}  VhUD0PWJ^Xu  VEGEŠEUB4B` Vk4t4ЅEPh4S҃  V=x4u Gu'=|4=x4uGt  V} F F}=t4m} UBtuUB ē4ЋG>Ph4…XY'BhFEx uB @Put BXUB Gt jWWY[ VW VGt jWVXZ=4}#vV9E|w  VUB ԓ4ЋFē4ЋF4ЍEPhГ4jjh4h4E,Et=4t54hZGP9 EtP+^h4jD?Y[W}3WAe[^_UWVS,EpEEv Zu~ ueF VFt VЅt ;SHtC @Pt;SXt [RС|U f=4f 4@Rt1f4Ѝe[^_Uf= 4/uw |U;@R~~4R:RRPf 4f36Rf 4ÐUE PE PE PEPh0jh`R|`RUW jh0jjjjh` VfEKfEfEfEfEfEfEgfEfEfEfEjhj51(u h0-`4iNĈ` VG~ T4Ћ=X49s7A8u(fAftf=tЉ-`4iNĈ` VЃ49rɡ4Ѓ=`4,V Vt Vx Vt Vt5d4.l4X1@V 1f}t+fL}сG @Vf|}u1f}t+fL}сG Vf|}ujh0h Vjh0h0 Vjh0h` V}USh0O VЅۉXt#C Vu  VC  VROYt SZ벋]UWVSQQ=t V]  VЃ{ wjS/>ÅXZ {Ѓ<@t  VЃEw  VE;C vPS=_Xu  V{GfftG ffuC@Pu  VTC u&t VuSY^t V'C  VfGf;E}  VS9}  V~9S uC C )PSQv 1YtFBFVh` VX 4Zt0UBfPNff@ffAf9}u+M A UtA PEM A ȃ UBMUtPEMHEEU r t0VfBf1;EOfBfEu6uЋMy)CEM=~u  V C ESP<5>Vh` V 4Ѓt(_ ?Vh` VƝSu 45u؋UEffBM AB ABtABM AjQUMA )A[A^t1ɉt C uUBM#u V.uh` V 41ɍe[^_UWVSu^ t5;s .YtCBCSh` V˜ 4XZuˋtFBFjVe[^_UVSj0E$yE=, VZu , VPvE,VЅXt BHBu R VBXۉuh*E$, V/ED VЅXtB8 RR[HB8D VVDe[^UhD=, VZuJP, VD=,VXt5,V V=,VYuhDZ, VPDYU ,VЉVStQk4Й94~81Q VEY ,VЅtk4Й94~Ku͍e[^UWVS0E@EE EPUĉÊEL3&Et%}LCE<U91Dt =X4{M؋Ah$4У(4YuvOG;EvEp S@XZUjh(4ЍP設 uh$4…Xu"h$4\ 5(4…X8(4ЋM؉AjPBHPPCU؋B% =E} {OG;EjEh(4ЃPh$4u5(4…XjPBHP輬CM+u؃} j EPS蘬U zE<oʍQ9v&EB Ȅ҈E<j}WDP;E t tNEU9Mĉ (4ЋEph$4^XtzjWBHPѫE BEU9jh(4W訫h$4{t4E E+E؍pw.EEjDPEPjE U)UӃ}}t=P4t ju=1> +]؍sE+]؍sjjVuu% Vиe[^_UD VЉVSuH Vt';5L Vt8B8 R[XHB8D VCshD VH V[D V1tB@e[^UESX+wShRPcC 4ЋE RЋ]UWVSEjEEPEEfEX1ZC4%=C0E܀xu|VЅ҉UtoMI ɉMtUu؋}܋G8Au8ADW|:uC8 S>XHC81}؋}uE@EuC8 SXHC81e[^_U= 4VSu1jjy&Y1[tu 4ЍF 4NRЉjRRRЋFPhRV RrRsRЉe[^UWVSu~F )؃PWRR臨)^ Ft)^e[^_UWVSEU EUpEEE@u vZu VЋEE~w jjjj fD VЅۿH Vt)L V9FtUC8 SzXHC8D VGH VFGhD V D VЅXujjjjuRfFDf9~jRju&tPW,YXNUB9CjPj0M ‹+;E[}}uE7 VRK0X}t%]tE@ECS]XuEЍe[^_UWVSSSE PU@ ]sljEfFf8=tFCu S)C$9sfjj'…XYCBCBCBC B Ck CfczEB UBjrVS{ {jsVs WFPEP͙EWfF fffFe[^_UWVSVEPUu <~CUt9u F UZ9~ySVuHރ )]+E Xt CFue[^_UWVS EEEEE X1E}8UEtJEP".J<EH$80Ѝ} Ee[^_ G0E$0ЉCmCtCht|wChtkfChtZUWPu E[t> u8G0tt &tch2Ch߃ Ch ChEE-E*!W_EH$0jjNjE8Y^t@ G PwpVnG jj{NjE8G XEZwr$40smest_sh shshHuuE XjjNjE8G ChZYu G0"GG E-E*Ee[^_UWVSPUtPXE} U J u RXE XT9AU B {QWSU B ~ztt<EtvvWUvj9f=t=u9}vOE h mUWjp_S薕FPSGP臕+u}E x ,w U1 u e[^_UWVS,E E8]u)jj5jX%U @@f@ E $H0Ѕ{ Cu gt VЅt9BHt RYdGtE8uSF(E9tCC@PWu E:19E-SV´SVXZ hr0(}t u_Ee[^_ÐUWVSRE EVЉ@id}`VУVu V`VЋEUfSf{CSttd׉ d׋EUtt,uZ}S4t׋uEfC84%}S t uUfS ׋EEfCpX[^_ÐUWVS UB|@@} EjhVrDžXZuqMA@8tGU 9Bu$w S^GtBMAWtUM 9AtuRuV EE0FM @Q)Ѕ u6u}t{MAXX)Ӆ~hE;|-VЋu V$VWhVt!SuY M)E XY[Ef)щCfKRv 2 XZu4VЋU8VDž\h]9C rhdHEPjhu_tMA9B JdDždEduF+h\EEDž`t\E@E‹@%=gMqrѣ_ZO]C u'@t VuhjumߋuF VE@`‹@uz u z`yuyu y u`{ u{u {`~uj(ju>t VrdB EvE9E~  VE+E}EhEM9A rhYdREPuhu\t#Mu9B s hȧ0yJdDždEdu VEd EUt~Nz uHdy u9A u3]ECffECEffE싵dv udBffBBffBfBffBfBffB\t8\uWdAP`PP`PhdV讳"dCPuvPv hdVE}|VЃ\tB\urjju> PdBP`PhdVA3jju PdAP]shdVE}u VuvDTf~hodMEfBY@uHl|C1}Ĺ}󫃽\t\t78EEuF EȋdffEEEFEfBWEE`AE̋A EЋAEԋAE؋dffEEEAEAEA EA$EfFfECtbTf@h\frt$\u?j(h@V`jhhVjhVujhVdCEEtdEPEP, EEuSuhdEPEP&|@|RUJDɉT|sPQH[^`t1=@QRu(`Puv`ZYt Qdff9BuF\t'\u4`` UB 9Bu VfC4f9C2EPuuuShdEPEP,$EvT4fyh,~$&4кә`VPȃ8P5_X}t/EPhuduuTzMt-Et&‹T+P4)=UvETf@hffZE7tTL9UdCT;l9l9nt+X4ЉTE艆LMdTɋP) )څ9  f~ntVЃ}tUt 4)PV,T0t#dF+4~4)PS[^dXT+ؙ`VdVhVЃTt+TA|t@itxHtjjA|pHn ||SP5TVtX@YtdA+h~ VtT9`s`dBTuT9_u؃Px3^0TF4u$&4кәNlȉQP2Y[|t|PV.XZ|x|R9YT:J|SPCX+SL+CT9~9*xVЋTEVVVЅt%F|t@itxHtjjF|pHl |@ t uhX'hEPu*|uLP/|LP|.|^_tjR TAtu=4tEtTCt#uTFt5PVЃPL1Y[T@t<PhUt|QPAX+QL+AT9~Ѕy1ɋT)9}ȋTZtVEEt VdHȋT++Mt-dVЋT++Et"j=TX@TXZEt#dFT9yTPd0dATEPS f{j~ Cp T@NtE+|V'fFh&4кљ`VP8P8/Ft` `uKHJIh TSt_uTVtP E$jjThL Tbt$N T0^t4)PQY[TCp  TfFhd@TU9v;)ljPuTEe@VX=DVHVZdFHTFp }tZEuTTLtD9Ey?4+T=H?~ ǁL!EV V$VpVdC)DžEte@CfCfvHfCeO;}u.Eu(eTNt}= V$VV(V=,V0Vtdx)}fP9~f)dfQdefC|Ft+Tfxh~}tP2=LV_T dEzNjT++@V9Nj DVЋHV|E DVЉHVt2Tf{h u%dF+~S<^TT ‹d9A JtPVӉ DVЉHVЉPuY)}e[}ti]苵T;LxXdHX)ЅAEEt@)…TLTǁL4ЋTTEt`TXd9B Fhw9$0Ћ|fA8= |fC86TfFhVV%E EuT@t TBht+ "|VJ"TfAh&4кә`VPȃ8P^*TFt` `uKHJIhTZQtuTStPE$jjThlTft$ndXBHdKT)؅}t.d9B+@9\V 9tTfAnlT;)TVCu fCnTfBn@fBn;4T 9vЋT1NpwT$ЃP6)Tǁ0dFAp VQVVw&TBpRnT$ +^_ TCp S&_TfFnwTBn;4|$9 v TfAndV+~ XV)ډӉЙ`VdVhVЃ}tUt4)PT2T0t)dAT+4~4)PVJ XZTd9AuЃP'XDžx4TF4u(&4кNl֙ȋTQP&_XT T;$@pv1TH9v‹T t+TB|t@itxHtjjB|pH` |A|9ÍQ|vT)q|R(SR(T)1|Y^tЃ|PR@"XZTQt@tdF+h~ QtT9`s`dBT9yTChtw t |F t/V&4кљXVPTPP % TfCh TfFh V;?&4кљkxPPP$|Dt@T;5T_I&4кәkxPTPP$[^ETdA9x89u Y9x)dFT9l;vs}u+dCT9ul;vlVЋlTdCC;@v@DžxE dfFfTfzh ЉЋ|AL; {4vfFedSЋT+~C|+PLB|BHufJ@||TDYEdf9CwI|Fu=tuCPV$TЋT+~}u ETf{h h ZStuTVtPTXd9AM:Dfzh9hTct$Ct_u=4tEtTFt#uTBt5PVЃP![^ETd[ EVVVЅɉ]t%A|t@itxHtjjA|pH[ |F t uY#tu|uLP6|LP|aX|ZtyjP etu,EPudThEKTbt$MTXIt ueXETfChff |KtXTFht) t t& teTf@hvTfBhhTfAh QF:&4кәkxPTPP|$&4к֙kxPTPP^_|@tETttu/ujh@VRujhVTrPj1xuTAt?T:[.VDžTc54h4h0V* EuWTKtS54h4h(V tWEuQEtjdvjuEp#EtEjjEdBPuMqT)bTtQTC|@@@t?ttu/ujh@VSujhVTrPjume[^_UWVSQ] ۋu fE~}tit }U{H;}?th tE@ UfzhjEPCPefE ffEfF E@ UfzhJt@S9vЋUK uzFjPCPe FffFjFPCPdFffFE @ t%UfzhJtFL4ЉT)}t }e[^1_UEVE SKuxF 9w6)Åtyhߧ0[NE@ي@DED^ SQAQMAtuHFC,F C0FC4FC8.FC8έuU싂ǂS#MUyXr CHuMA jj_XUF PvRVMA tt(CiuVS2~VSTZYt V_TVUB@DHt[DKtE슐Ѓ<^t?KU슂JH`IKtMtKtSzCxZuj7Su UBPPM싑BfCh4Љ,&4Й4PC8P VЋUPSMftSf_Eft Cp U싂@@&4Й{lWCPj MA@ZY~‰+~XVVU싂tPXMQ tB8 R޻_HB8u]hݪЃS jS EjEpju U rj?}t u^M싁tPN[EP tB8 RXYHB8u]hݪЃSB jSU VVe[^_UVSPj0ƍEPu utE@+v VfStP kCD VЋSǃt kCD fVЍCP VЉ4$)VVXtP#XS tB8 R0XHB8ShݪЃS jS2 e[^UVSPj0ƍEPu ut8E@ff;uft fwfVgfStP kCD VЋSǃt kCD fVЍCP VЉ4$VV^tPYS tB8 RZHB8ShݪЃSjSe[^UWVSUB@D\ӋCXRP+SL+CT9ЋM ~=X~ DžXt[\t=ؕ4Et1u(uuuu$QdPfDž_1҅k DžMyu 1`Pu u ÉTtSVVttP_ECLuSY[VVjh V(9ÅXZutVS_1T.{UPCTPROM PCpPQOfǃUBk M(fA fE@SUt@1RPfXC@ECL% =uf``uMEUzPv<ƒB Ј< wȸM;APrƃ\uSY^u\SXVVZUtPXS tB8 RXHB8ShݪЃSjS VVe[^_UWVSuEEFUttF EE'V E(U} zu Xl<t E؃} fEt u _jjZE Yt=EEU=v#ju U _BXuRbE Y} u 7E =UxxU܉PP @1FUt t8E @EFXUBFtB B fFVfGfFrfB_E @EF\UBF`BFdB FhB$FxBF|B BBBfFV(fGfFrfB(1ffGS@ffGG  ЈG G fF@GfGfGfGG<_t _ffGt3 FFP4ffCFLffCFUtt.`fEUf+EffBfGuu 蚱fGXZ4fEUf+EffBfGE)EuPju 荂fGFUtt?EfUffP\4ЋUB#U`Ef)EEfUffP1҅tP|FUtt+]1=`4Rj Puu 9U1҅tPffGUffx@tw@Dtp;xh;y`URRPQUY[M=VtDMRRSffx@xD;x;ywuPU^_l=Vtc@4ЃAt 3t@uM1}EEffEUB Su EEP uuu hdV[e[^1_UW }1UEEEBEBEB hZjjjh0jEEPhdVt0}UWVSPPE uE^DV]Eۉ_tl{pt3@4uuV[V] tFCp9uBLtEjSY}^u}~]e[^_e[^_UWVS]sD} SH]Yt)t%@4t WS)[XZE ue[^_e[^_UUS11fùy1؃`V1fA fv[Uhh`V|U TVf=ZVXZt1fZVfXVUf=XV/uSw |U;TV~fXVR@fXVEf ZV^% É؋]ÐU=`Vu `V@8=TVu TVЖ=\Vu \V@8=PVu&4кљPVUVS]j0ƋCt Zu CtSXue[^Uj0aTVPXV4]UVS]S%NYye[^UWVS8j0u EVt _tP{@~|tzh9xjFp9y_flVtfEfpfEފrE܃ ЈE܋G(4ЍEP_mhZj(h4hdVWfFj@f fFj~-fFj VfFfu<RVYVf8f:f<9sFj 49fVl}f^l f€~fFl&4кәNlQFP*X=`4ZF|Ef~hf~j~{‹@@x|tpRY_t @4t@LuY1ۃtuN}ĹUEEB(EȍEPkYt @LuCLjuGWXZSaXf~j~$v|Vf8ff:fdž8_ 9dž0v^p1wˉ $fFnVV[ue[^_UVS]j0aCv Yu}CuwVf8f:<9sf{j u/4+,;\Vs T49rVj5j0ԽE_Zu4}fEt6Pν[t} t}uV肦YoSDUfJhfMރ}E$l0ЅE8WEZy fufGxG@DECit uS " uSLEf{>u'Cit jS!jSKE[}^UfBh}MQB<zBuxuxu x [8R8u>xu8xu/@ 3%=#jrFFZYf{>ujS/!EY^uS$X<ucB%=jrE^Zf{>ujSJEZYuS>NEY}^suUBxZu S]OfOMytyU艂PwPu=WMVfAh&4кљ4PE8PU艂REE-uE&GWu5E[^PHEGcu,VG|PuEj5u&EFHu膺1BHuG@tGuMDt Eu E#F MVEED+W|+9~=}V転E7YyVG|P=G|UBrR$MEAr DCit uSl&%uS[NCit uS& uSyNXZ h`0}tGtjujuEPju@Ee[^_UWVSQj0} EU B1Zu)u }^uUtP[6}XDtLU B @t /uWuRu>uWuu u'ƃ}tw}Ett$Jt?y v9A8CttCt-ty vA~Cp9fSp *tIQ5Y@jjU@ XZtt CtQQCp*uѷe[^_UWVS}tPu5d45`4W udhdVWD^ZuSwV[u!fGÃfGVcKf _7$f@hFit ǀt ǀt1e[^_UVS]C|f{hp@ S?~yf~ujS}^X%VFLPS tP0Ye[^US]Chw&$0fChSXfChfChtUuE 0E0UWVSĀE VEEUzt t}DžxEExEEM9A r EAEEEPjuutMA9B s hȧ0WJMEE}u VUfzu VTMfAf}t'UB+E9tU9FvA)QuEY^;x uUB+E=~ËMA+E9t V}t}uEf@xf~t{xzuz u zxyuyu y uf~u V`SujuRUffBt{V8f~t`My A xDtVVQ&Suju&UffBt)Vu4$MA VVEt tX1һ}MEEffEMA E}ЉUEEfBfEMAEu1}UEEffEMxqPEPKZ}UEEfBfEMxqPEPZxt xxt4}UB%=tMqr9_ZVЃEVDžtZxCht  UfBf9C>xt.{,u{0u {4u{8t)xs, C8t M;A@xt.{u{ u {$u{(t9xs C(tM;A Uff9C<tjhʚ;ju+xEtCh? tPxEPS蒭uVvuVEtPLW8uV{E^tPmYV/Wt1tXZtjQ EC@t@t[V6txEtCh? tuxEPS蹬uu蛛uuEtPLS[Stmt_XEjRMxfAft(PxPPxPhVHPEpPUr hVGVЃxt6jjuZ PMAPxPhV`J0jju$ PUBPMqhVIu~VЋUBt Vxt$f~MfAjjju|d }uԹf~UfJjjjjuNxEtCh? tuxEPSʪ}t!Ch7ttjEjPE Euu聙uuEPC@LPDuV4C@LPs@OS@Y^t.jC@P uIEZtP;Xe[^_UWVSjju 1X1Zt'_C VP uw 3CECe[^_US]S@E fB8S@BLPRC@YZtjP S@B|E U]mUWVS`] EE^{T;K}AEw EJ1}u EA}tERR}t%UUERUE@ EURU>EEE}ԹjjEPEPR}tgExt^1}ԹEEEPE܋BEBEB EUrEp\9jjEEPUrR!}ԹjjEPEPQ }EU9BEPjuREE}Ք1UEEBEB EBEċBEȉЃPEp8jjE̍EP]SVQ(ut}u2EPSEPEPhVC1tVukrY[uuuEPEPEPuuujh0jEPhV e[^_UM WVSUuyu9uzyttwoB@4wJ1ItDtPt<Rv @PvhVyBt!x@tSP^_WSQhV;e[^1_UWVSE@EEEEU M=EEUM(ɋB(tHRhU؋MI8M8j0 uuEe8 tuY9UBtt69R8u1B+B$MAt)ȃ$+Ev Eh@ jju.E }7UBtBMq1 F UffV MA8F A(FfA>fFfAFv1E\>M UкљUҊD:D>\:MA1҉FuvGXZ[^_UWVS EE9E}sk@ʊD9EG0UWUD:D9]\:D9D:] U2M ]B9ډUr [^_ÐUWVES}Ur ;~0u Myt,F<F(N`dљ)Åju Pua}E;F$|E}uUB1 Eh WuPu ~U JM1;ju Wu|h0ЋEpV%Ph0e[^_UWVS} u EEt E MUyz t,G<G(O`dљ)ÅEEu&Pjw0Urh@0Ah0} t"EPjuVMqE+Eju VuE{bEuuuuPuE) tsMUJ} tIOdE9PTt hΩ0uPUB0B0E}xHM1EM [_}$E$0U;W$|EtOHG<]G(љ9Ph0j:LJSuu 9t hA0SMq8;u|u u1e[^_UWVS$]{ E P|utlEPjG#E U GW OdRC p虿u%EXHC=U Et U u{ uu@1 |UЅCtWЉUԉֹ}U E䍄uC\EE܋EԹUԊM}E K0ȾEЉE)ȍHșuЁ}U E썄uC\PQhx uWE@EE{U tC\Puh? uPs0u h@0h`0UUU){U t C\Ѝ4t&F~Ph0}h0)s0љEԁ{U t C\EԉE؉ѸMK U PLƇe}@uCPugE E e[^_UWVSjWYXt ƆjLXZG@|@jjujjw`uj1DPw(wjP@jV8jW0Eǀ`@e[^_UWVSuFA t4E PjV ud1ۃ|t SVu) C~u jV u4uhwzujUB0w< ujw"e[^_UWVSUp\T} t h0(F4GF0GF(G ^8_FshV u)sss VtsjVl!Vze[1^UWVSEE{u t$tPh0h0觖EEEEEPheuEuE tE܋@Ct#uuEP3; tE܃}utF@CtuhsuVustEujsj uB'XtVSZYtE܋E܍e[^_UWVSEEPu UVuMZ1҅Y,}W50Vuj躼tEjh`VEǹGjjh0ЋETjPJMUJ A@@EEBy}z E܉Brǂ4RVÅXtugXq&EPjUr0׉1ӋЉG!G<ExM1qxÉȋI`;HdRUrBtuuMmM1qx֋E}pHǘ }Gu较EP54V5,Vu>Itu)UuM䃹u6%}䉇@w LJE@T@@uEHU胺,M E}1ҍe[^_UWVS] uKPvB,9s [^_&%[^F_UEU f ABB1UWVSEXEs4JșE䋻P9E}EEC8;E{0~ }+}{4jjWEKdPEp8WpHuқ} } t V谁XVR_tE{8}E9E|}jjshKT+Kd1Ҹ  tP}wÃƃơ|UЉC shvHSN LNHu ǁP,$8ZE}DO}]PT40} t Vр^Vs[tEEe[^_US=R]u=Rhw4h0jjjhh`V,K]]"1]UVS} Eu]MUtUtHtBtt6E4E4ED4E@4ЉUM] u[^:-[^ÐUWVSHEPU䋊M@E܋Y ]؋}؋X 49ӋH0rw9v E܃xu1yEU1ۃzLMM܋A)ƋQ ׅ&]؋KP tЉE@} E+KPËU9ډEUwr9r M؋I0M*]؋E8U؋@!ËM؋IL!ˉ]Ћ]؋8]ċE#X]ȋU؋R0U)ډŰ@9sE̋E̙9 |9sűuM؋IPM t1]9ډM]r9=4t+EPjuuԋu$Pu谎dEH};G$u_ FM9Uwr 9ErEEċ]u#@#FLEEPjjEPEPuuuy{à EPjuuu{Ãu`Eԋ}G$EP@)UЋM9M} }t@]Љ]uűpHuu(, uu}E}܃ZEtPm}XEH؍e[^_UWVSLEE@ EċURUMIM싙]BE1}A8tdwHt otyhEtM䋁]CS EtJUz r9׋u9t+Euh0h0 h0h$0][ ]UBR ҉EUx]MA1EU490w?r9w9UEz8Xu4t0P1ɋCUMx9prw9vjSo]1E]1ۃ}MԉEM]Q AKP tЉE܋U苃8R!ЉEЋC0+MЉM]K;MsM;E~MeE䋐EPuȋMqu]s suRjEӋUJEZ 9r)w9v#U䉊SQuE uxMMA@1҃} EUX&E܋]@KPM䙋9׋wr 9r]K0E8!ȋM@IL!ȉ+M;M}MuuEЋUBHP( tE}xH1MEt uxIEEЋM;A0u3=4t E$Puuyu'y_u}tUJMy UE;PvQMAtxt EfMU;Jv*}ht!1}PEPY^tDEtgUMqeuuuRUE+BM1)AQ EA)MU;JvEt]䋃jjjSPÃ؍e[^_UWVS Ep~8uF|@t @CtVXEEEx uEj@'X^lC0%C0[u^lCEC0C0x h-0}t {PEx t7{pt1C0u'4U1t jjS҃ t C0 C0PSrC0 C0W'_}X Ex t SwYS4vZj@&NjFlEX]0}t EEx uBjhB0jVtW&uuKj@x&~lXt}~MWr&Ex PjjRe[^_UESXpSvZYuh`V }ǃ1]US]SX]]UMQ tA@ @Q1tqjjRqqUWVSPEEEURTU}u }MtEM1qPHEEEuUĉUu}WuVuQ>҉UMUJ(Mu  }F E;UMA,M9FB U;EMA,M9tMAMBE EEPEuSuvZY9}t u uXUBjjMqPSuvE‹@0u;EH(B0 zTB0RL_Ћ@@,u|ZYUM]BQHEtP mYMEPjRPQS+E}uEuEEE]XH]f{t=4tHuSu( t5h0ЋuVU)E }}fO?t$]CTxDGuF)R~];U|E}ɉ}=}u:UЃ}u EE؋U9U|E]ɋًu)Mԋ}t7UBTxD~OuN};OuEw9ɉEEUBU‹M]CE;tUu;E}u"E}LJEEtPkZ}t }f}UzMquhu}u;}  ]uGxP}u.U؋Eu @x0M)M؋u؋]sxE؋}UԉWxE9E}EEљ] C|KuN}uujuN }G@t}tWE0uv UMA}uXUЋuFT]xD }GMAuD1ۋ9Ӊr`w9vZh0Ћ}WyMAT xD ]CuF}DLJOuhf}Xy}uU%}f}Mquhu]u Cx +EuFx}9GuE@@UMATPEP]qTR ^t3uVt);t!M싁9tQu"E}}uju{EH }}f}UruhuM9Au ]CTPEPusTR qE}EH}SujSUJ 6E ujuMI ]CTPEPusTRt!uhS u7}g+}t6f}y/uju tuE`EUoM9Au ]C@uT}GTPEPEwTR uK}tf}xujuUJ EM]C@tSu6ur 1ҍe[^_UUSBXTuu rPh 0'yCHu h0u]UWVSExTD] M~ssSu6)9%DCC9r~h0';t19} |t@9||u1h0{x[e[^_UVSuF]U BCB@PCPrX~F@T xD~  CCCe[^UWVSEP U@E]CTxD UB]CEWxҋt hǷ0EPjuhRPWQGORPutEf@UBTPPJ#EuPHRu?}uƋjjjWPЙ9ڋrw9v EPEPRPWQvu>t!]CTxDFFX1F)ډU؉E;Gx}bUUf^fJEރ:u E12]CTxDBBXSV)RE2| E;Gx|>uE;Eshܷ0E؋UfB"E9E} h0rE؋UfBf^uVu{ u XOulG|te9ӉwNr9sH} tuju ujG|RPW} tuhu e[^_UWVSQQ}EPEP+CxRPSu QuV{xUu ffBtNfNGT@@@t{xt u;`1uZ_ZKe[^_UWVS }GEEPEPRPW] QuPEUUBTxD~ UEPKfKUBT@@@t u_ u[Oe[^_UWVS0U119֍}ԉEȉU|9jEPujjVSj WEpj1,uY}uSfW1ffUtktBUB@TxD~WW1E.u?JuE;Ht .uU 9t1#E1;uj ;]_e[^_UWVS$U BEЋuB;F}u1ۃUЃz8uGjjWjjjjjEPRj?,ugUЋBTxD~EEuf}..t=E;Ftt0RmUЋBTHEPurTQsEu h`0Cr_EЅtP&^e[^_ÐU1U1U1U1U1U1U1U-UU1ÐU1UPUEJPjRQ u E U1Uu UDPR8 ɸ tQ0EEQ41U=RuRj1UVSREUHu RvP]Q u)U􋊌ft F9tRF1e[^ÐUS]s ssC@ |4P#uC=htjPLXZ1]UWVSu~^v SvW |4R7#uRF=htjPY^JGHt3+@83S1e[^_UMSAtA t A tJ1ۉ[USQQE@x@EP̓CZCuFCt E􉃠StECHSLtM|UЉ@tBCt E􉃨StECHSLt |UЉS1]UWVS}wGҋy*P8w"$0Ћ@T@@tASZu6ytw V P萤e[^_UWVSSSExpE싟P臂CYCKuFCt E쉃StECHSLtM|UЉ@tBCt E쉃StECHSLt |UЉSNCFFCFF FFHV FF(F,F0F4F8F<FDF@G8u F$u F$ GT@PF$ FLVPG8CHSLVXFTe[^1_UWVSEPpUP U@EE>u*~u$~u~u~$u~Hu ~Lu~@t L~DUBT@@U9BtRZExut =UMFD"u@FD;FDu7f1VD ЉOFDt1t ~ u~t/UBT@@Guuvv ucV BFu@txUE܋EP81wJuUBT@@ujv vWV ;UFwr;EsE~(u ~0UBT@@U9Bt3RÅXt&F\uuhu;u|~(tO~0tOV0jRV(RWPuO1ۃ~t)UBT@@t4uuvu+Ã}htEuPܣ^_؍e[^_UWVSEu9F} t VYuq~t5Ex8t OuUV 3^Zu u6ff%f fKE@<t uPwfY1e[^_UWVSE} ]Eu E u UB;u9E u; tRS_ZuuYq E싖UEE 9uE9]uMVZ0uuuVuuVV  U V|DžXuuuViuuV^ tuuuV?[V&Yt h0dE 9Eu9]tNU 9UtExt f9]tUzt f1LV E쉆 UV[Zu&]SuuVSuVV e[^_UUE@EU1UWVSUr~8ZtutDjB pQShtjP軠XZhtjP裠YX9uS+V$؏e[^_UWVSEPPx Gz8uWSBT9BTtWR19t*jP tWY^#ff=vWtWh@FfNjjjVPu,SWVIjWS tNfNwhUWXhZtjP_XhtjP۞Y^9tjP= e[^_UWVS<EPHË@K[MI YDžDžDž@T;CTu ;BTtrX;ZuP /XtP_D?ut _9y8u G莌背軌B$ BsQP ijQ fvjRu tjR%=@pp hRu*trr hPÃtj? OyuA8.t#9tC u@ uGt j OvGDžhtjP)[^Džt GfOjjjWPtjA rqq hyjF9t t 菉YC@p VW_ Bu h0P Džt V ;WtZtQff=(@FfNjjjVPtNfNSWjSjT t@NfNjjjVP{htjP裘XZC9u;Gt h0yG9Bu h%0at0A @t ;t9t %=@u=zq vRN u BzYXuP PwVK4tpuNKu fNfHq jjjhtjPY['=hZtjP軖^X[C$ Cu h0P{ tEpYuu7Urƅ1i9ttsh;0Yt5t,4ЉjjVWWjsË`=htj PyXZt 蹄Xt 褄XUrtq聄XvxX评Xtgj u#GOfG# Y_؍e[^_UWVSDE@UBR fv xPp @WRvB @  S-ƅXujp S* t1rhULWsSP Kf@8Cfǃ@fHjjjRP[BTxD~4 4CBPjp hjjSRǃǃKjhHVjpHP_jjjSPt3XH%ƅXukVS3Vkƃ u1htjP[_EP4JJfCfǃKYphUhJe[^_UWVS EPUx@ E싚9tz|t#WW蜀Yu蓀Ct E{uMq vSg u EBu t ENKEjpSWEtFCkhtjP蝐XZWmRfNfKUBT@@@^Mq PjjSuE!RY}htEjP/XZWxupEe[^_UWVSP]ss VsC@̠P EC=htjP̏_XS16эyFT;xD}.WPR\K "jjC p jjjjWRVjAE,V~Ee[^_UWVSTE@EȋPH MUX@%)u \)ڋEȉUXUȋXMQBTxD~q juR`Euȍ}ԹjjSẺEEE]ẺƋEp jEPUr EuI+}79މs+AQAfAfQt 9r 9EruWVEă jVkXZ}#Myuȃ~u~t hV0QEȋHMȋ+E)‰UEUUEEUȋz 9}]r|-9us(fKft1EUE9}|9ur؋M)MuEUMuQ AEjjP׶uUFFEUUEuȋV 9U]F|49Es/C1EEUuCV Ã9UF|9ErыUEPMIMuFMȋQ 9׋Arw9v1ۋuEče[^_UVS]KAT@D9| uusVP1s jsQe[^UUJr PrTPUUJr PBPTPͬUE@TEdUWVSQEXS\EB8w hq0NCP9CTuWjCTPjsPRSt%C4C0C0j@ESFWNW{Tu/{HK<1C@{Tuj@SFW UB PB|@ CDR44u1e[^_UVSEpCf1 RCPsh0DQPssh0,Q Ph@0P~8uV^CTPThn 1Pe[1^UUBH`4R VUUBH4R VUVSQQuFx@EPzdCZCuFCt EStECHSLtM|UЉ@tBCt EStECHSLt |UЉSV VЋ`4e[^UUBH`4RVUUBH4RVUVSQQuFx@EPZcCZCuFCt EStECHSLtM|UЉ@tBCt EStECHSLt |UЉSVVЋ`4e[^UEPJw@$0Ћ@ *@ @ @  @ 1UEPppp pPRZUWVSPPE |4ЃC8w^$ĸ0ЋE C4uS$t t9ǃ VЉC4SvSyw^XEC4uK<EPbGHUWLGHEiGHWLEe[^1_UWVS}E UfuPEp WRtUrhU;?z  UB @VxÅXujEp Vx t1UrhU>WvVP Iuu $fN |4ЋP8Ffdžt0Ep X[_uUr Yt fjjjVPu\SuVMjuSu u/E@uphU=XZu ntU1IEphU=u GtFfdžN @8t؍e[^_UEPHBtt@uB8$4B844B8D4J<B1UMQ<9u A9HtR9JuB@BUMA<} @ufIQ4+BA uA,t I 1y U} @EufH@ UUE B,t B@u fJ 1zÐUWVESuM}^ C tct;CtX;Kr1Ʌu FH1s( +C1s$h5QPVe~ NE1$h0wS+ Ph0OHe[^_UWVESUz rE %=@u W XUBH1w(G(hu @PQuFT@uSvTP tu SuUft8ft.PsPPh 0_Hhi0 E1 HVB|U9‰HVs |UУHVСHVЉ1'h0ЋEpWPh0Fe[^_UWVSSSUB119ΉEE}61ۋE,D;E|t D ;E~ T UF 9|ZY[^_UVS]ҋuK t@9E uB&tUx uJyCH1q(A A@[^UWVSV] E]x uuSPUuw9}'9|)ujSuUuM拇9|ًE9Ή}%ujSuUuC9u1F9|1e[^_UWVS]C EU ,f| }t;EPjM,PC p/tu21E@HEMIUM)ȋZ$1;E t1t8+E1Љ׹ыUtdt+E11ҍK)9ʉ}]<t2@9|19}M<t@9|Wuuƃ 1xY4ѺM]K E ,fL ƃu0E C$SЉE e[^_UWVS }w U ],Kf|t9EPj,DPG p?.tu 11NE@HۉEt&1v(йәыU؉љEF()؍xEEPWh u>}uGWhEs uPSu h0Dh`0>E)ЋMt%C=~Ph0Ch0t@عѺMNU ,fLƆe}@u ,fDu.E F(E De[^_UWVSu EX +C1s$;sr,UrVh0Ch0ЋMPSEPj,MPUB pR,t u/E@HE+s1҉s$ЉUM LjMu$PuEph0lBh0?Ѹ EEUC ,MfD ƃu-e[^_UWVSWWEU p ;w wPRUrh0>Z1v(EEPjE싖,DPUB p5+t u.ExH1҉v(у8u.PRMqh 0dAu hҺ0>؃ 8FU싆,fDe}@u ,fLƆu,e[^1_UEWV1S}t +G1w$_$E P)Sh| u5u ^Sh{1 uPSjh 0@h0=3)‹E  t&@~Ph0C@h@0҉UMUJ(Mu  }F E;UMA,M9FB U;EMA,M9tMAMBE EEPEuSu{&ZY9}t u$XUBjjMqPSu&E‹@0u;EH(B0 zTB0R9L_Ћ@@,uX,ZYUM]BQH}uuЋHHMuQ EuuEu܃~ZEtPX}GTfx@xEHEȍe[^_UWVSDE@ E̋URUMIM싙]zu1SuF8tXwHt ctm\EtuMAQ _] tGSuӋV 9ډF^u9t+Euh0h0 h0h$0E@ EMQI ɉUMx{u^]1uUMÉ9Uw@r9Ew9]M{8yu4t0QG1UMċp9Xrw9vjW耤.uvuuE1EEЉU܋E[1ۃxhM]Q A tЉ‹E苳@!Ɖuԋϋ])C9s9~MeuЍEPuEvPRuMAQ uEU9UYr?w9Ev8EXp VSu M1ҋRPu uw]U+B@9Y}uWEBHPV Et u#uԍ>U;u uHuXutMIu~UȋE;PvMAtxt uft@Et^EpeuuuuUE+BM1)AQ uȃq$UȋE;PvEtjjjuHÃ؍e[^_UWVSU MUMEp UXE }tEUEUPjuSt uotE#UBHEM1e[^_UhUWVSPhHPuwEuE؋UpHB@PV _EZtu!E]MX߹S+SK t1KǾAA FЉ |81҉Eu umMȉ1ҋC($(9}E}~MQjEЃE@PuPE}EăE؋pH,MuEЋE; ^|EԉEEPhЋUM uUM]J3e[^_UWVS0UB|@ }EEt MAEu;E^u7H[~E;Ut jjuujuBEvujU J@DPuM迊EDuujEPhhduHEPuhjuEEE|uԋEpH ZEYajjhX7kVEщNjEjjh0kNjExEExEpHu7EEUԋX@ }u1f{:fC:ƃS+SK t1KǾAA FЉ |81҉Eĉuĉ umC(M1($jj Pi,EE ; URjE؃E@PuE}MȋEpH,uEEE; _zU M䉊EBhB @BlBD<J@UQEAA$A(A,UB|M H1j,j[^EtP'Yuhuh1}uuЍDPuuju谌(}t'jEpTjjuJjU ǂE܍e[^_UWV1EStuPu E{u$jSY^uG:ufG:jSXZCx8t @|@uhs|uj1DPss- j,oijWgijS_iEǀ`@e[^_UWVSEu jP}. u+WhvWjG0v詈Wjv6e[^_UWVSWWUPfz8St h0(MJȉEzLt[BdtU11;]}Ov>9Ǿ~9~9$9t9t9tkkk9~9~9~C@;E|]싂 @]M AAB+EA B A+BAABAEH9t2jZTPEP E jZPEPjUB PE DPt>e[^1_UVSu~8] tE@u~lt9{t3shV * usss VtVZ+e[1^UWVSUE^}tPh0'h0EEE EEPhR}E+E tE} t5Whv膂Wu uvNtEWjvӈ t!ƃ|UЉC0u VZYtEEe[^_UWVSEEPUu u |UZ1҅Y EP5PVuj%jjHh"dǹGjjh0jFTPZEEFUV z~ EFU VdždžV{ÅXtu)^]/EPE jH1҉Ew(,E܉1$UDPEptu&)uhP1ҋE$EPHRFuMt džfdžjjV EP5LV5TVu衱tu(UWF @@@u;HVB|U9‰HVs |UУHVСHVЉE@T@@uNUE1ҍe[^_UWVSS} ]O uPwu^B(9wPESPQSR t@Mftu G9tu'F1e[^_UEU f ABB1U-UWVSEXjjhjphpHS1I } u VV ^e[^_UWVS EXu PEEEXE; Z}zjjEE@PEpu,xH} u P*EPtEE; _|}u }tEEEe[^_UUfz8St^JLwQzwKtEzT ufzXth`0B`th0} uBdt1ÐUEp pp@@ |4PUVSEpXp SpF |4Pgu9HVHt3G%@83o(1e[^UUB tB t1҉UMAAyt!q PPPP1UWVSQQExpE싟PCZtBCt E쉃StECHSLt |UЉSCFCF%FFF FFHSFV F(F,F0F4F8F<X1 FDtFDF@G8u F$u F$ GT@PF$1 FLVPG8CHSLVXFTe[^1_UWVSSSExP XU@E;u*{u${u{u{$u{Hu {Lu{@t {DtiGT@@U9BtRuYωSDu t NCDt1E0t 2{ u{t*GT@@uuss WS BCu@tDW8wJu GT@@ujs sV{(u{0tvGT@@u~U9Bt)RutZtC\twuuhW'{u_{(tGTfx@xN{0tNjC0PC(PV,u*1{t"GT@@tuusW e[^_UWVSEu9F} t VsZus~t7Ex8t OuWVP=sZYu u6ff%f fKE@<t uP^1e[^_UWV} SEuuuMQ9u9u9tQVrZYu urYuV9ffu9tK9tExt f9tMyt f1e[^_UWVSSUz8rt0u t Er VZEYu fK9uVWV4$NEe[^_UWVS EPxUp FEz8uVW|E>UBT9GTtVW~|E#;}t%ujuv EtVWR|XZEff=vVW.|Ee0tVW|EL@KfjjjS8EuVWS Et fKvhU^;}XtujuZ| W"Ee[^_UWVSLEPŰHMȉË@EЋKMċ[]MI MY]EEE]ȋ@T;CTu ;BTtTuu{EZ;EYuPuXE̅tPuXuuzuuu0u]ȋ t9u~y8u uuuzu uu=u5UB$ BMEQPuuuux+ujQbt UЋEfvujRz0u tujRwz%=@Mqq hRuu$E̅tUrr hPzuƃtujuz @MyuA8.t9tE@ uUB uGtujuy [G]EuXE̋MȅEt EfOjjjWtujuPy <Epp hutujuЉ#yC9EtE}}}t uXUr SW MAu h 0uEPuL EȋE̅Et E}S;W}tA}t;ff==@KfjjjSǻuuW@ t3}}fKjjjSzu_MA9u;Gt h0GU9Bu h)0t/MA Pt"9tM9оbU%=@uGMq sRf t Efv B}ulX}uWSg }t}u fKuMfBf}Xt2Bfft h0]s jjjuYƃEHuAUB$ [Buh@0WuEPu EЃ u}u3Mq?1qE9}Eċt}h0}}fKjjUr jjjjjMQujk,uT}uf}..th0j W(u 4jEjUEr j jjjjMQujj,uYuuOƅXZuEfHUbt uX}t uXMq"W}t EpXs[}tgujuin ufOuuYe[^_UWVS0E@E̋UJ BMȋŰfv ExEPMq @WSEEЋUȋB f@ffNffE@8fdžjjjV胷fKjjjSl E }FEfE EF xLt @`tEE.CEM̋@ f fEEF xLt @`tEjjEE.E.p j jjjjEPujh,Eu^ŰM̋P AT;PL~ h0ЙRPV EuNuuV Et)fK}tfdžNux[ EPEЉUrhUuREče[^_UWVS EPUx@ E싲9uWYufuEp sV7 u EBn u 0t ESuWZEYuAfKW$WfUr jjjV聶Ev1 tWc^uZEe[^_UWVS]ss VsC@̠P%uqS16эyFT;xD}.WPRRWS<u'K!jjC p jjjjWRVjJfǃ,Ve[^_UWVSPE@ES蝲M‰ƋAT@D9_| u uEpVPO1Mq jquqle[^_UESPppp pS*$PPS]UWVSPPuE UfEuEPEp Vu號tUrhU%u EU싘ffUB f@fKf |4ЋEP8fǃt2Ep Pc^_uUr cYt fjjjSвuAuu SM u,E@uphUMXZu EU19EphU'u fǃKE@8ue[^_US]1{ Ps"1{ PjjC]UVSE=|4pt~@t Vh0G[XSbVC @ZYtP>XjHKdže[1^US]SQvX]]zUNÐUU E H;Q| h 0YA UU WVE MxD;G| h`0(4w }e^_UVu SE X0;s|h08}C t$uh0!@t4Ct.PNX%<t h0CSSC4CS Ee[^UU VSE H;Q|h0A <u h0[AqF9tQDAAIe[^UWVSQE u]E}CtK{$uu ;{tSZC$t=@t:tECEE EE}E ]e[^_e[^_UWVSPE ]EC}uu e[^_HCHu CtC{$uu ;{tSXC$t<@t9tECEE EE}E ]e[^_e[^_Uhw4h50jjjj(h`VUE Wu U PR tH x 1Ћ}USjb]sHjbsHjbs HC$tt jbPHXZSh`V ]UWVS0EPLUXH]X P$) UM U UEEX;]|&Ë@$@jQRS sME9H |W@$t@@t=9}jA)PRQ]CM)S$u  LUEPEPJEmEMXA$t3@t0jEjbPE Eujb]s$]GC$_Xj]jbSwEjjbSEjEjjbSE]E$}t}tu6jbu GY^}t jbuFXZt jbSF^_ FUJE+BMЋJ}؋uM؉JR UȋUJuEċz1ҍ=4t h`0RЉ=غRܺRԺR4Mt$=4Rt h04!jh Vx@@XZtttC@~,9vC(PRjcQoC$u6h0 RjcW}5 ‰C u h 0f1׋MtcECC4CC CRЅC,t S,RЉP0RC0RЍe[^_U=RuVhw4h0jjjjTh@VRRR輽hw4h0jjjj4h V蠽UUMQBvBAUUWVSuVBv}BFusV,tF0B0F0^1tIfC(t fC("S訊S$C  $VS= [utNue[^_e[^_UWVS,E UEUEU}EUEEEOt( EEMUEE%UEEUU ÉȉU虁9U]|9vh`0zG EU^GÉEЋEU+EU  ỦE]ԉËE49uE|9]vEE R}t_UREPWE؉U{à 1}t3S$;UsC  ;E;U|A;E6EUU9U|E9EsuuW3{ƃ E t/ wm uf{0ujf{,ucS腈$|[R܃{0uFf{,u?fC(t fC(.SPS$C  $W|S h0}t U9U E9Ee[^_UWVSM E(@E UM19EEEUE<uuuz unEUM Au,y@~jPQb tD UB u)jjjjuuuWtf`(fH. tfC(!t;}tE(tEfC(MEGEU;}-EU1}1;}EUM<e;}t E(VEU Euuux u,jjjjuuuzuUh0ϕX6f@(!t!fC(ujh0hS8} fC(EU<zfH. M<E@t17Uz@~"juRƒ 1tED MA Uu SwzXCjPS觳 t1C(tS_juujPfc(S/fc(j@jSM GEU;}y1e[^_UWVSu^V} V$F  $S4XZtV蓇CXt{tS1e[^_Uju u@ tE E<UWV5RЅS} t3V`WuV-t Vi^,V\Yu1e[^_UWVSuF@}~IN(xjF$t31ۋT;U |9}@PVK[Zu=C~ՋuIy(19}"F ;E |9} SVZYuC;^|1e[^_UVSSSjjjjEP] EP RPuVEE$t@~t9jSVjPEf`(j ju uAYuve[1^ÐURRUWVSSEEk, XRЅ]utx't'u1.1҅$}t(u VSu׃1@mu؋RЅt]E;Ct [ uLtHCt"ChRjh0hSxy븃CCtS||Ycjjj(+ RЃ ɉ‰t$E;Ct [ utjR-XZYBB 4BB BBBEɉBJ tB A$RB$RЍe[^_UE@US]C~HCPCt"ChRjh0hSwxɋS tC$B$C$CtSp{XjS,]UUWVS}WB4M B(t3t5L_jjG P" E@Ek, XRЉE+B 1Z,r0EE9EMEE$uU9UusEUEt5L_jjF PjVЋEp S誫E tR5L_jjVЋF PV 9Ft5L_jjBPi1 Vп}C(tSPwXfC(༨ fC(tAS}XuoXtt5L_jjF PVи}tOE@jp 4E@ SM tt5L_jjF PIj@jS3Spt-tFV+P RHP?;E[_AV`e[^_UWVSE %UVЉE1};4ЉUEkXHf`(HX p$jjjPnrVS$W`r H?t,1HjjPSjjjoHt$@(tPjXHdHf`(_5L_jEjPst hV9pVu VSh0V[^pHt]WPVd(Z@Yt HoXH@(tPjXHf`(HcXDž$ VjSUE+B PHRE @tE0PDw4u؋E0ttOG(tWiXfg(5L_jEjPUhVЃ9pVu vh"0~Xg}u,WaG. Xt&G W$ fg(P$[^WcYG(tWhZfg(5L_jEjP1ҍe[^_UW} V;}Ss7ujSuVt9t SWu ;]r1e[^_UVS5L_j]jsVRuu S5L_jjV6e[^UWVSEUUR] SPd' uh@0$;]EPWu1f u h0)E;x$r@EExDu Wur[^] 4 EtLȉ֙EEk$ V9r;$VsUt!)]@EIȺ֙u1҃t k$kU84VЅtRa`Y;},e[^_UWVSuF FF} ^ tat$lRjhr0jPcu5L_Rh"CP u5L_jjCP FPvv % u0t(} ^ t u5L_jjCPH 1[VB$+F;FsFB4t3} z(^ t u5L_jjCP ~ F Fe[^_ÐUWVSE1ہ}5L_ЉE j4jPC SVW549C 5L_já4jPm =4ut{U9v0hR9s1ۍe[^_UVSU EUp %9vEM u[^A[^UE E%9ЋMvEU A EUUWVSEEEEEEEEE ] E},uC SuCZYEp EC Xj PV54t Ph0萭0${EpƐEEEEEEEEE] Ee[^_LUVS],s {D c,PV54Oh V54 ǃ,e[^UUB@0@@4B@8@<B@ @$B@(@@,VЋR BPBTUVS]hKƋC,Ztue[^K C,V K, jPR54%t Ph0!hJ{1XuSXC,%C,ǃVJVЍe[^UVS U1ۅɾt9y1u,A,u&)9~ˉƋIuDžujjh&0jh U_똃=VvS h00gwYwUWVS U11EEEtgC,%"uOuFC1t |;6;Ev)]E!;4r S>FX 9v]Nj[uu=Vw]u]tS [e[^_UVS]h+IƋC,Zuue[^*I{1C,uS萷XVIǃVSE, PR54fC Ee[^kUWPP=Vu h;01`Vй&EPEPV[uu)RlP&cjh/ }ÐUWVSU B1҅EM ID9ȉM1ҁ߿=߿vU)‰- @0EuM䍄%e9vƒ}EPjEP54Wuu&Et3 %);]v]u SuVFE)]}4Ѓ udt2Pjhr0jP[u5L_ЍPh"CPujUEPPR54'"4Ѓu5L_jjPxEt jP#XZ}u 1}Ue[^_USQ]EVVjjh/VXZju uh R̻RлRRԻRػRԻRܻRRLV̻R E9 RЀEWt1jh'jjjj)SEPh RK$t h`0车4 RЋ]UWV}S} ]u tj 'PjjjjSWu$th0pEU2Z[u$uE07U2ru!h06uE07VUVE07uZ*t h 0e[^_UWVSV} E) U9BvU;}1RSuT t(f@(t fF( PuFVd ;]r`EptVVU1ۋV$9ڋF |=9r719ڋM.|9s(fN(t fN( PuVId uue[^_UWVSP} E) u9Fv,;}sa1RSVS tPcX;]r1}Phu uS>e[^UWVS]u hs>hVSo}e[^_j>U=VSu#:WкљV VЀV19}/jh54VЉVСVC 9|с=VV~ Vjh`] g]Uh0jjhx] UWVSPV9V|jjh0jhVsR1jh54p uljEF;|h?=VЋMPVЃV8=hV.U uUWVSh}<XVЅt VУVtjjh0jhVQV<XV9V} hVTXe[^_US]h<VЉVЉVZ]E~<UVuS1jjŬPVuu PEe[^UVSuV,]F(VDVHdždždžE FLEFPdžjjh0jFPdždždžtKh;VЅZtVЉ5VdžVЉMe[^U;e[^USP]udt2Pjhr0jPOu5L_ЍPh"CPuuEPuu SBu5L_jjCPEt jPY[]UEUS]HjsPsLS 3OjS]UWVSE p~ ~9_t { U 9VuhFtpV[FFU BtF;0tU PU EE 0FPMU ZYBt S9ZCu ] CF G txW ^GGCt G;8tXE{t#x uC F G } U 9uiBtpV[FFU BtF;0tU PU EE pFPkU ZYBt SWZCu ] _F GG txW(^GGCt G;8tXE;_SYC[t SZCU rt ~ U@ e[^_UWVS} E79Z_{ ubC GG txW}YGGCt G;8tXE;_SSZC[t SB^C_3t~ uC[x QCtx uktF FC tXSYCCFtC;u0 pU2^sV^ZFt S^C_G C CG t@ _GtxWrYGGCt G;8tXE;Z~ ubFF G txW$ZGGFt G;8tpE0~wV[^ۉFt SYCtx uStz uC tx ulstF C CtXSZCCFtC;u0 pU2sVY[^ۉFt SHYCG C G t@ CtxWZGGCt G;8tXE{_S_C[t S^CUtx u U;t@ e[^_UWVS u uҋFuEUۉtދuFEV ~Utxt97uMEGW9YGMU E9FuUBFBFB F Bt9u0pMYSZCE0UpBtptSS^C[u>N }~MtExt97uUMOW[GUE}uuWu Ee[^_UWVS}11ҋ] t,B 9C s} ~RAuԅsCC ty^VZFSW1e[^_UEҋM t*B 9A s} ~Ru1UEPt:t28u)Pt;ut;BuЋRt;Bt@UE1҅M tɉy@uUU S]JC,9R$uCPA )[UMQt @9v‹At @9v‰UVSu] SVZYCSYC[ue[^UVS] uSVoZYCCSF(P+SVF,S9tU ue[^닍e[^UWVS] u{F(SPSF,Y9[t RVX[Xt} ue[^_@e[^_UESu =$4t?h?1VЅۉXtCVR;1Yuhh0hCT0;4ujhV@Tjh@VՄ@TXZ؋]US]CTt&h0VЉSVY]E0tShVSh@V萇XZ]á4U(VЉ V$V,V00VVVV VV0VVVVVV0VVVVVV0VVVVV4VV(0VVV11\RЍ@RЃXJyhw4h?0jjjhh VЉ V|hw4hF0jjjjXh@V`8jhN0jjjjXhVDUWVS MEU MEUPhËuXus$E+K x(t u1N,V0UE{LP tQEHPCHP< MuVSF@CZCXSQR_XF4tC(Ee[^_tUB(Pt ztPR[e[^_UWVS EU EEUEuËuXEUC +J {(B$t1K,S0UzLtQCHPЃHPd uukEUBCZCSXSusUB4tC(Ee[^_tUB(Pt ztPRXe[^_UWVSEUEUE$U$0M$UEU$E !ȃ;EU܋}M %u/u45L_ЍPhGPt uE$ udt2Pjhr0jP;Au5L_ЍPh"GP uu$u uuuu uM 1W$u)u5L_jjGP ;=4uEU 94Vs PgR4VX VЃ}u E}u}uM 4+BLEEE$FS$E ;8G,9-M9K(!t+S 1C,S0;U;EC4E9C8U9S<M9K@E9CP{DCLtNxuS讫ZEYt2u5L_jjGPtV[UVЃ}tUBxtRPYMK$SWEX}(Z`}VEM(Q :E$uG,S9tEM 9B uVW{U ƋF EF$MN(UEV01҅ɉF,XV4E$tЃF4E$u V4UV8MNS$4+PLRS +PLRs(c4C(s$s 7= 9u CSCBCPSWXZ)EC]G,]9t U9S EUe[^_UWVuS} tU~LtWF$+F PvHvLF4t v(tF(PztPRX^VL[ue[^_UVSuM ]FL9sjh j1REPjQSV$e[^UWVSEQP] S}Wu 1҅M9Y uE9A$u y(uyLt1td9ˋVuABPuWE@FpEH1X;uZ}TSWFY;u[X}BuEt jPXZ3Sh V] ]UWVS EuwUt:MPjhr0ЉjP&UuƋE5L_PEh"PuMUPrPrLNjuEǴƴ M ME@HEE, 9ENMQ4th0Ѓ u h 0fMA@tjjjjQuDuËuX{LCDtjC$+C PsHsL0C(tPztPRXEPDSMAD@CZCXSQuJߋuX{LtjC$+C PsHsL賃C(tPztPRXK4 CDEPDSMAD@CZCXSQ6_UXBLt @uzDtjjjjSuMyDALtSu艊[^tHE@4uw@<t0UX H$@82ƒtRQSV~% QSV MI48E@<t/C8ƒs K$tRQVu?% QVuR UER,9‰UMUu5L_jjPEe[^_Ð|UкљU҉u hV%Z4кљ9Uv h UXUUWV1S}t1B1tH|tw wFRu1ۋ 4и)Ɖ  C~[^_UWVS8EE߿ϋ}uM-} B y$`0jhV+]Smj0ShThV5$u48jEPVWu}4XVЉEEPQVWu M\V`VЃ_ XVdȉәLV\VЉEEPQVWu| MXV`VЃ_WxS \VdȉәPVX`VЉEEPQVWu% u\\VXVЋMȃ_y< `VdȉәTV154h VWu4 -e[^_UUW1 UЅtaA,uRy1wI$0Шt"wfB/49s"fB49s tffBIuVЉB, V+VlVЉB lVVЉB V+VЉBVЉBBB B$B(_UNUNUWVS] EE{CE؉9K6C tEx4EPQUr E@$ECSUEEEEE}uWu?ZEYM؋]MA 9v#@9s}ut@%EujuuuEPuuEp 0$u}u1 *M؋]MA 9v @9rE1EtH,E@(t ,P;Xe[^_UWVS E@ E܋] 3S{2E9uj RWuU臰E5L_jEjP蛼EPVut1M܃,U9]9Z Z$;]sB9t9X v E UZ$;]v]B4t7B(@x$u+9EjWEPhG 9rBLER(9މUsw}Et"E+P RHPzZYt xtE}t+}u%M+A 1A,Q0RPu tEjWEPgG 9rEM܋@,9ȉEt ]9X 5L_jEjPAuԋE pu:E؍e[^_UWVSE UZUHtPlHp dHPl1;l|x%9txx1)x|tpt!t% t/Ut9+pE¹t96u luuMA ;slQ!EXZdSCuY[ @,fx t _@$`H8tt;u0t1x|;||;xs u6`B|p ȺZt O,G(t G,P_1u`y8u`x8utDžhfGt Džhl etOt7uUB0EP`2Et lh`\:dDž\DžhDžxDž|utUltLtDžXTUB J Y$I )9Xrw9Tv ZuMAp`|x\VhltEPq ,uEppEtO,G(t G,P)^ٍe[^_UWVSE xput u u%0)Á9غE@ EuW5L_jjPE腶EPSuEHu EX p$)5L_jjuR}t"t PPSuFe[^_UWVSVE P8 >ϸ9EX udt2Pjhr0jPu u5L_ЍPh"CPZuj4>VWSu&u5L_jjCPDuEPVWSu5L_jjCPEt jPLY[1e[^_UVSE P@ƃ9ƻuB%)x(jV PQEp 1ۃt 1ۃ Í\ e[^UU S%B %Zx)SPQEp x1҅t tЋ]UVU S%B %Zu~Aw<$0SPQv G 1!jjPQv e[^UWVE SP49ދ}rD  V;HVv#,jWMZYujjVSw  u1҉Ѝe[^_UWVSU %B%49ދ}r,jWZYujjVSw  u1҉Ѝe[^_UVSE ۋutt.jVZYu Fp`Sv } t t#e[^UjjEp S1UWVSE$U(1Ƀ}]EUEEE1ҋE% ƹE!;EE Eu%U -MjPRuEJEtPWhEWE t jP\[^e[^_UWVS,E$U(UE܋UBURURMq$q u} ]u PEu4U9E |9s]uU;UE|;Ev ]܋u]u]U)ڋuMủ]ȋu  9|9vEU2MA Q$+EU ]EE}EuEEЙ׉ƋUr z$WVu @.u2E @(u uj@S9ZYtfc(fK(fC( uufC(jjS }u mM؉ UM؉]EЙ׃}uU9׋EX|"9NU9׋E>94Eԃ}E؍e[^_UWVSQQ](M$]EM]}U 3t;My tuuRPuu uVQW ƃ$] }1}tUBMu1VRPu]3VW&"u8}}? } huVu uE8 } huVu u}u:} t4t1ҋM A.tAP RM A Q$ Pq e u?}u } t UHPGPM1W XZ} t&] E}u U2W ^_e[^_UWVS1E;0}] ;M }u:A.tt,A@ tjA Q$ Pq@d @(tPXfB( t2B.tfB(3XpaY?B@jRP$XZ/ǀfB(t j j3j@j3fH(FE;0$e[^_UE@X @VЉPVЉVEVUWVSeEp8 )ċUB0|$EtB4EuEUR01ۃ9U}&EEUBHPCCYE9|VEpH1^X9Z}X}u }tfH( =@(@u }t1} t+j j4j@j4fH(f`(C9|VW[[}^tUB0tB\tPqYuh@U)XZee[^_UE$w'$01! ÐUWVSuj@ǡV19L_Zuh 0 7&4XhVlhVSVhhV:}e[^_DUV5 Vкљ9SEC<+C@)G@N C4tF{\tShWYShV7 X~ZtG0G0FG4Fu&~ @uFuVhV W} EEe[^_UWVSV=dV}5kUЅ^F9C ;EPjjjjR0p 0pP$u~FD9‹HuFHH9ыDVuFDDFH9Vu^ FD^ lVЋ(E4DF9%v  ?~} t 1e[^_UuH…Xt E $UWVS]} t=SjW+(S0t Wh0XZ) )=lVЍe[^_U1EU EEE UMUU tVЃt5 pV1EPjREPt tpVUWVS}E    EM]uPuuLE }tj@M}YuV9L_t1Ph@UV2 ۸+{0C, UC!CeECHECTCpj@ԲC\5j\Tzj\SLz5L_ju耜e[^_ÐUWVS MA E싐UE )ЉUƋAP$19׋@ rwc9w_U싂 M荔19ӉUtsvOjhjjjj)PEPu$UtP)Sh 0 2) E )RSu@E) U) 1e[^_UWVSQEM x ;rX )9sR) )UUÉBP4@0 9r w9v1U2Z[^_UUWVS E@ EE}WGG(UEEЋrH,99F4t h`06F8F(t x 4V ߿ϋ^$vϋE;r )9ڹr ujuj jff%u )u؁HUff]MGPEPu j:,EtuWGujuj 1EjUuuuuu j,EuE1EUGEv,9Eԍe[^_ÐUMɋU Eu h0tj%PRQ8rUjjh0jhVkUkUkUWVSx]Ct-PSh0K Sjh0hSC uӋK8uC|@ kURStQCuC@@CE I@kUЅC(t S(kUЉP,kUЁKC,kUCuFK|Q 5L_j|Phhdq kURЃuCE|8F(Ɖ)5L_СL_Ћ@0EPSou u}tC tSZC1{CC4CC CCKCCs {$E t+kUЅC(t S(kUЉP,kUЁKC,kUC@ tSX؍e[^_UE@US]CHCCc<tjjjjjSVCjjjjjS{CtC8tS(tC,B,C,C CtSY]]8]US]CtCKHjjjjjS{t&KSjh0hCPj{uڃ{Kt ȃC-t h@0 tS(tC,B,C,C t ]],]UWVSu} ^VXtV{C_tE{t h0, {u/tS(tC,B,C,C tS^1Ce[^_UWVSU}E UMUEUMDžxDž|EEtEEE%EEUUUMUEUBlEU+EU p hdËh49pE|9lvEUBx }t=Z}uS$;UC |;Er;U |;Esfc([usU|UE9|x| TM9xsI|xuE tf`(x|E9|| U9xr}tMY!UREPux|à EE}t5}ugS$;UC  ;E;U|B;Er=x|u#U9|M9xtC(tC(tcuYEPtt C.tS^C(tj@SsZYtfc(fS(ЃfC(}tCE2U9|'| M9xs|xu訶E t%C.f{,S $蜷.fC(t fC(oS$X[fS(jjSfC* fvuuEuEu PEPEPSuE$Eu}us uk}t&fvf9S*u []MIME9||U9x|xut EUEB9Em9U}EM9؉u_B}t fvf9C*uSU=MIM2E9|'| U9xs|xuE }uM9NTF(tV脼XfF( fF(tjVEZYFfF(u j@jV tC.urf{,ukV4$zZtS}ufF(tE fF(<}t's$s sh0jh0`EV4$5XUEB9E]}t  E9|U9x}tWMyt/EHPjh0ЋEhP)UzuыMAt ȃP%XE`Ue[^_UWVUE uSV}_$9ڋO |9r h@0~6E0xMA Q$9׉|9v}_e[^_Ujuuu uUWVS]E(@E U 19EEÉ}^Et9sTu.Cu(CuC@@CkUЅC0uC0kUЉkUЋ[(u‹kUЅtFj1jjjjS{uCtS(tC,B,C,cS[0^u5L_jjhV\e[^ÐU}U u) 4С4ЉBBhjha0a UUM SE]tu h0ۈt~Kuu ]UE UMtu h0t~*Ju'u1Ҩt 1҃tUSP] ۋEtu h0SffEEPEPu#Eff ‰ ]UVSRE ]tu h@0ffEffEƍEPEPu 1҅t-E8tff ‰e[^ÐUWVSuF@E^L_Љ]EE]S%=WM Ef~>uI~,uC~0u=~4u7~8u1u]C @ tuE=y Yt O{t /?jVSCPD"CCf{u{ u{u 1{uE@tMEDu{ u {u{t.fCCSr*Z1ftTf=juyZYutuPCPjhVu/t@@@E0tBCF,C F0CF4CfF8uuVF,P" u f~>V3X1ҍe[^_UWVSE @@EU RUUEPu@ @ tuEU Bhtf P4f=L4fM; t&juxY[ ZfEXfH4f=D4fEf;}E)ty1f)ЋUfN1MfHf9fwf;EsEf8MA U@fPP$fYZuuPE ,PjhVu7.u)ty1:EfN1xuUf@f9frf;EvMf9EUfB @PMP$fYZuuPE ,PjhVu-uE fX>P11ҍe[^_UWVS(E pEEx ]uK~t /f~t~u~ u~u 1{,u{0u{4u aEЍ}ԹPSuVEPG@4EPC,PCHPEVH=u}uE1UCHt@P{,u{0u {4u{8tC,PFPFPsL, 0{,u:{0u4{4u.{8u(f{>u jSXZC,GC0GC4G C8FCF C FC$FC(fFfCuU}u}u }u}tu,}u(f}t fU΋Ef9PfCB,CB0C B4CB8C,jRS=e[1_UWSE XU@ 1CfBwU1҅tzzutzu\B %uNfZ MffALu ffB ff9عZtMAL9ùBBPuXZ1ہ"i wL!i i Vwixtc i @i /i t1Ii tOw %i tEQi t8Ri t?۹1QEfxt /<1&f۹1 }Wt|UЍ|U9йW t|UЍ|U9й%i %i w4i hwixU!i tI"i tL@Ri twIi tZQi Si tRTi tx}s(UBP}s`}s|틃MA}}(1U0-}}D1Up}|MAAAAt&)9s  UB MAu)ȃ9s  FFUBBMQAt|UЉ ǃt|UЉǃsE@dl Suus ƉZEPu_X0}EjPUPUg,t5(+"^'}t Uu-uVuЉMjq"1ɍe[^_UWVS}]DžDžP} FE@PtM Q-t Ҹ/E PHu t2‹U DHPЃPPXZjP^_u ,}MfqPtF}u@}u:E%u,fMދEffPLu ffUff9ʸU z-u:u=`TRt:h0t=`TRth`0jY[E hP9P v u6=`TRtE P8$h0j 1wjj hDž!Mà ۸7@12C(ǃC)C(|UЉMAPtC`CCC|CEC WЅt tu񉘜WCUBCBCBM yHtb{|tKjP;_Zt3=`TRtC0P$h0jd Dž u {|H}u_u܍{htOCt7jjS` t&=`TRt!C0P$h`0j c{`uU BhBlM QpAtt|UЉ ǃt|UЉ ǃE PSu U BdBdtǃ|UЉu>^tMfyP1tUfDž|ƅuƅtfBLM fEf~EA$EP|WRE' u/=`TRPE$PW$h0jAt ABA}10ЉE0ЉE0ЉE0ЉE}1EE󫡘0ЉE0ЉE0ЉEġ0ЋUEEEfBLjffEEPRZYtIx ut+B8 RS_ HA8Džu]14E8Ej@4PS(jT1ہ} it.hdP jDPE PME@ xuit~jTQP d!Th!Xl!\p!`DT 8tr u 1d@(} i‰B(PEPUMAP utB`PW`P @jS@MAA11׹jRuB(PPMAP^|tF`PR`P 󫋕B|PPS_uuV(hi u-e[^_UWVS h] uEEBwEUB Ztt zuE@u{(}*UtSh i RЃ Et uvluvUB\C$jP u{aujjSZS Eu+K}tC!S[XEfxPy PS^_Ee[^_UWVSUJ q trtxt vu]tYSB ;u R IXHB F st XCum5mUЅt9Nt6uu h 0t>SB ;u RHYHB CF tF XF ^ Cue[^_U mUЉVSE ]tM9AuBQ t2Z2C t PBuA  u[^UmUЉWS]t 9ZtLujj6j<1B ZmUЃ tmUЉPmUBmUЍe[_USmUЅۋEt=9Cu2C tPHC YutCBCj6S=XZuË]UWVS$j0tCBCj6S;XF Zu VSE_HF nr1S艽^Xr؍e[^_UWVS j0]!rƋC HC ZS޽XtCBCStB u RD_HB 1ƅƅCC CCSPh2i Rj6S:Vqe[^_UVSjj6j u9 u7Vuu u j6S:1ҍe[^US]tPYj6S}:1]UEP ҋM t/t"xuxu@ %utRuщUWVSEX t%txuxu t[uۉ[^_á4NR@U4NRVk0SM1lU1ۃuf9uuuof9u"ufyuu:B:J0A NRЈ NRBA NRBAB NRЈB:BCnBk4NR0[lU^UWVS]t:uzu zuz ttxtSP44+Y[uC%t MAtC94v 4Ѓ<uES4_ZU1uC1ɅtuuCHu VЅtSQ[^EM1EtDF t=jjP舱 SpEPVuuLtM9B s hȧ0z 1Eu_~St~UC9J҅Ҹt)JuCU+BPRSR t3)ÅUE p Wut W;e[^_ÐU J1 ufFfCFCFCUfBf%fC MȉKuЉsE܉CUS}}MuvffuNjЉffutW<t0uuuAMy9tC9G;}uW ;Ut BB+C;}tCC+G~jS[^Hw SKLVЋuFDEFZ9EYtU9WHOʉU؋;}uG fx *uvEuxP;}Xt:WWU;Xt;uGwP;jW\};}uƋMqjQu=E@EE[U_(ffBMABAB A BA$BA(BA,BA0B A4B$E܋u;F ysPЃPR Fn  Xjuu? u.uNLVЋU+BDjRLV HVЃ jP:SuE:uuNuLVЋu+FDjVLV< HVЋE@t]1t C uUB W W}tM̋EuM܋U hOK$mUTKYX}tű Wu W3ZhJ$mUJXe[^_UWVSPu^9trC{SE{XuDFWBFB F BF$BF(BF,BF0B F4B$jjjWWI3XjS]_9XuVtLV+FDjVLV HVЍe[^_UU MBABQ JH UEH PQ@H UU MB8A8B8QtMA9B s hȧ0PB11ۅuWWy;F$FE؃4F FC(GXZWj(WVVV~E@t@@HPL[bjhʚ;ju'uWuuu!WuPf!E@t@@PPTjhʚ;ju&uWuuWuPE@t@@XP\jhʚ;juL&uWuuE\WuP9_E@t@@`Pd5<jhʚ;ju%uWuuW cWuPH E@t@@hPl'jhʚ;ju%uuu_XEuP{[^w=`TRtEE@1҅tPLERPx$EPi$UPh0j辜E8x9SWuuLt 6xW|WWWU 2EPuT#e[^_UWVS}/} wWW%G0U9B r BdCEPj0Wu2tMA09B JdDždEddRG0c\DžXdTc3t(+,A<8\U9B r \BB|Pj\u2t|A9B )B 1Ec3Pu‹\T ‹\T\c+\U9B r \ZBxPj\ug1txA9B Z 1EAC{4{\U9B r\1tPV\u0tt9B J 1EQЃu…t DX\c\U9B r \B>pPj\uN0tpA9B rsB 1E,f@u\cG0U9B r zdOlPj0Wu/t#lA09B s hȧ0GJdDždEd1}dXEEuFEFEF EċF$XEBEBEċB ]SEȋEp9jjURSEuR}ԹEEFE܋F EFEF]SEEpjj}WSEt =`TRh@0jɗY[%XEu XUdUE\EUXcTE}Uu#dBffhhEc` Wk4tNRЅtEPEPu҃ 1WWue[^_UWVS$EPXEЋr5QRff} ZtQRQRЅx91}EEE܋CECEC E;u C%uUЋBf@LffEލEP#…XtvB4tWBLuQBP9wuFJ<@t;AXr@@t ;AXs9;qXs W WrPtB8 R7_HB8=QRЅtEPW?^ue[^_UWVSPEEE8EEE@u EUF9B rM*EPjVu/,tMЍA9B JMEE1}}ԹjEPEP]EE蹝Su}VE݃FEf@UffEBM)XM~ ExuMQƒf}uuu EHEPjFPuU܃uE%tu(E݃uE@t@t f@LffEލMԋuM}ܹLj5UhUW E'8x D3U9B r ruEEPSFPuL*tM̍ 9B s hȧ0軒JMEE}Mq qSuuE^}t}t tQRtQR]}t}t^L}E<tO}t 7E<>uEPuuGk8=E~EfEE<EUBPj\(YE[u uHMfAUf%VfBABABABA B BQR-E$MAX}Zv$}pjQ\(E^@_YUMJ Jj(rEp艚Ur^(jSuuEt- ttECfCCfCF8jPEPE CMAfC@8u5UhUU 8@ BmCMAƒA 8A8t t+9I8u&ҋUBtыR0Q$8)U)1RuSu|8MA Au|Euo}[t u`Y1e[^_UWVS}tu Fjj%YXvjS&XCZKts E u C@Pu軘CC tt9[8uS0{$UEM} UE <9Es :.uEEBE 9r}EE;MUM 9MM 9EUs"t<.tEE9Ms }t<.uMD1;EH> AF<v A<}LA<vA<v A< }~S A<vA<vA< v -A<E@EzFw ƍA ƋMɉMEUE 9s:.uB;usEE 9}7;Es"O}~EFM+ss tS _1e[^_UWVSSSE9E u 9u}8¹{UE} UEc}YUE |HUE|7M 1M;E ;Eu+uF;E  }+}G;EUE??uE H9ƹuEH9ǹ18E+EڍD;E wE+ED;Ehu}FG918uOUTE\+E;E U]}+E;EU)UE 9EuU)UE9Et1ZY[^_UWVSEEEEHM܀Uu,xu1U1EUE VЅɉMEEX xurEuu{0uEC0P^tt 7t0EEE tt E@tE[{};UUMIɉMEEe[^_UWVSuu5VEEE} E@}Eu1EsD^ (xt}u}uu }C0P޸Zt ttEEE t E@}u E'|U9~|U)ffUEjWEP覒jWC0P藒{0uC1%ufGmE[}u v}u}tuEE fHEe[^_UWVS8EEȋ@EċE EU19B r } z}EEPju utMЍA9B s hȧ0]JMEE}m1}ԹEEEpEăPEPp86WЃ 86WЉU}GiYr:O,u0u 4u8tEău,Exux u x$ux(tEăuEt U jhʚ;juCh? tPučEPS%u VcuVEPC@LP(GuVkE̅^t;P][2C@LPs@$DS@XYtjC@P E]}86WЉ}Ch? tuučEPS$u uuuȍEPC@LPtFuu XE̅tSP JC@LPs@oCS@^_t.jC@P ui  W WYe[^_UWVSE 'DžDDžLw.=`TR&hhH0j(Ph0j (vStVj(juXSuEx /wj0PQ[E_j(UrVy My /wj0Q ZEYuF(@V4B:(H4I(<r84BEBEB EB$EBBB BBB BB$1}ĹEEBE̋BEЋB EԋB$E؋U4rW]SjjSW}1EEEEEEEUEEEr}W]SO(jjSW4WЃt6U{0։u t u EۉDu&}u E%uUB@t M䉍DDDT󫍅PPjTPjjEPT҉DtB8 R_HB8Du3=`TRPEP$h0jxpD4ABA BAB A`A:uFt@@AQRЋ4BHfA@j(j:u)HfFEf`LPjjjjuoH(t!Lt@L@jRΤY[,P0F0tF4txXuC%t1ۋMȋy`G:GGjPR"jGPẼPG(EG(@@F4t#jG0PSjG@PẼPjG0]PSjG@PSujSun( tlMAUX );EwSB4%=uDJ0yu;t7yt1E@(FE@UUP*RADP-ރ )UȉB B;E])ÃMCQ9s)ЃPQXZ$Йt RuY[UZF^FM)AA UBARQ/XEZ}t uXM̀yuA %ufA Èxu@%u UfBMĀyuA %ufA EĀxu@%u UfBMfA(ffGEf@fGfPj(j:Q@UfBjjjjju:(t }tQMЋ@}t1UЋ@@VV}t ufX}t uW_e[^_UWVSE xE11ۋUMtC }:tJu tSg^tRJ*u4 (u*Ct uj P|1 tOS[F*u<u,jjËEC j sL|1e[^_US5pQRhQRhqU31ۃ u؋]UVSQjuVdXZ1҅tgC4u?EPjjs0VjYu?CLUBLCPBPCTBTCXBXSO]X5QRhL!SI tS+1ҍe[^UUu h0rJ4ȃujQrr0r j BLuBPUUu h0qJ4ȃujQrr0r jUWVSSSEEE E}u]M}urEt |HBw@#EE`VЉM] ue[^_}M]u Ue[^_X}*WQSVuuhQRe[^_ÐUWVSE 11U EEuEt|Et3EӋU׉ЋU֍1REPSQ EUUEEUӉ׍S1REPSQ谵 ׋U UuEe[^_UWVSP}31wW4!!+!‰W8 +ى!‰W< +!ЃGDw+!Pw_DщG@1҉ uK։1҉tODw11ۃt1҉tt C|u|tA1uwQw QGHG,|UG 0GLu I1G0e[^_UWVSS]C9C,s |U;CL~SYƃC,;CrSZF{@EK4CD1sMuFS4us,sC4C uϋMǁ}}f}E0WЅEu{u${$u|}މ}sfC8}fG8}EFu1e[^_UWVSj0|EEXEE쀸4WMU䋱0WЁ0WЅUtttXFttQHFtuI_7j8W蒫 ۉu@0WED0W4WЋUj8V__X ƄuM1uEE}Oujh!h$rU&4кљPh$rUe[^_UWVSE@EURUMfy8f;=SRsk\E 9W00W40WUBlRpf;=SRk\W = rUMA@jj(jQ >@t t 9R8uz 'w j(R'XYSR11ɃdtltZCCJARUqf=SR1f9EWf}s-}t'E 9WtFE\f;us}t E }9Gu䡌SRЃdtlt$FCKSRЋC SRЋCSRЋCAfqSRЋA SRЋASRЋASRhSRR0W5SRЃ0W `0Wd0W7} Wu,$WЃ(WЃT D E4W8W*E胁W Wƙ,W0WЉ| t UB\R`E虉ӋUBdZh1f;=SREWfMT<k\WЉExA8k\WuaWuX]Su poSUrbo9u$]Su LoSMq>o9t W W>E@$P(E虉ӋUB4Z8tuRu/uuu GE\f;=SR1e[^_UWVSE @j0Ejhʚ;juE@t t 9[8u{ 'w j(S ^_fKExu-UUMAEjEPjhrUjSEOUB tzt @uEƋ}t#E؋EtaƋ}u݃}tDrUrUUB rUЋBrUЋB rUЋB$hrUuurU" MBt;AXrB@tU;BXrMAX9Cv=wJrUrUUB rUЋBrUЋB rUЋB$jhrUSurUЋMS[ue[^_UWVSExj0Wj0Wu YX7UCC (jhʚ;juu SlCtt39[8u.C+C$)$Ct ))9~RSÅXZ7G(CUBSRЋB SRЋBSRЋBWУSRCi7@fphSRS0W5SRЃ0W 1҅y`0Wd0W7e[^_UWVSPPEEU :0W0Wp‹E +00W0W/0;9B rZ:EPSWRtM 9B s hȧ0c;Z 1Eu0W0WlЃ< t0W0WuFʸtPWjgu{t0W0WŠ0WfSRЃ0Wf;SRsf@tCff@K/!0W0W0W0WRA%`St0Wu0W;|zUt0W0WjG0PjRËUuRGPRejhSRSRuk\W&]uu EP@e[^_ÐUWVSEE}1DžpDžh1} M Qt'BPREP pl ] St'BPREP p; } Wt'BPREPW p E P}v EtECPMQuA %tu}G u UfB f7MQuA%tu/}Gu UfBf4ЋE}u]MQuA %tu}G u Ef@ MQuA%tu}Gu Ef@EtQPMEfI@YPEPBPRQ yDžp}fgGE@}Eu*;Ew%U2tuuS"9p@}vLMfytBff}`vEE+l|'Džp(4@hPlEdEuEt @_Et-@_,0Džp7 W WMI}_G,lME9ʉExjj_EZt@}fGUf%VfBddE@=UNjUXzXuE B (PlRup+xf+lUffBx|;E|M+x| EfH|lX ffGj|xuU:t:u|l}DGGE@E`PE_ W Wt@pPt|xE9xat@`PdURMUAQ}^tO}E}@pu U2tPuS 6p uɴYMɉMupu W WE9EuUԅuE9huLUԅtEB8 RZ4HB8.ugu_uWuOuDX뚋pe[^_UWVuS} 7VjjYX7t@vjSqXCZu S47s t VsW5 E1e[^_UWVSQQExu3jj8XZ7"qA FUJGƒt t/98u*ҋYQ t A0A$))‰xw FE}7jjYXtjSXCZu S1Xu7yUS Vsw4sW̲EكXG wƃG FA@FFE jffEFPEPN4U@1e[^_UUWV(u S}vjBPj(u艳7t\8t;uCu S S)v C F$jj^X7tBB 1ɍe[^_UWVSE;E EEEÃ҉Ut>B4tƸ }t$UB8 RܚXHMA8EUu2CMCAC ACA CR.X] tq}uA}t UM9HuE0߉tE@Eu}u E1(MQtABMAQLYE-E8u2@; QRu&Uzuzuj5M 1E XZEče[^_UVSjj]u _‹EX Yt|a t) t8UJB tu5@L-JB tFJB u QRF1-e[^US]t/St JtBABRKSXuj5S1]UWVS$}u EzEFU:tYFGMy kE@EЋ%M;Q EЃx)@*-$0Ѓ UЃ Vzt#EЀx uB%u fBffB^S;4Ft4Ѓ<3;u{u{u { x1}ԹEEE܋CECEC EEPK…Xt'^Kt B @L9uu ;19+jFPEЃ P%F@ =}MA 9EЃ F EЃ F@U9to MЃ~A F<@9t:1v\UЃ VBM9u zuzu.UЋMAEЋA )ЅA 1ɍe[^_USjhʚ;ju @ux 'wj(QXZtiQZuB %tuB ufB ZuB%tuBufBjuQuo]UVS]{ (svxjjYXu S7afCf%VfBCBCBCBC B CBk (fcC(B (j(rVW# E 1e[^UE1tCB1Ʌt @ Bt@LBt@LBZEYItEjj誧Y_$jj)DžXZu VҗV>FF@F (Nǂ`A:}tUB0AB4A B8AB<h0ЉAl0ЉA p0ЉAt0ЉA}tUABABA B UBAB ABA BA$G E GfGfGfGUBGB G BGBGuG ufG jj(j:VPfG1}E =SRExV|Vۉ]Et@} t5 } t `} tfCC }t%FUPMADPu FUU܈B =PTRM Q@V9׉A<B u RrXHB G E x@U B5@jSfCC[f~P_M Q BEB EBEBEfEfFLffEEPV]SEEE++ M=`TR@uS.$F$Ph0j6E @5@f~PP BEB EBEBEfEfFLEfEfEEF titzt @uTtPEtCƸ}t EԋEt#Ƹ}u}t u9,Y rUЋSPSCjSE `4@HXC ZtPXjSg^_e[^_UWVS0E=liH]EE4wC=Li0|w=Ui=Vi=Ni0=WiH=Pi w=Mi  =Oi r=Ji(t=Ki[} EܹJj0Y5WЅۉEX} wCGC GCGCGuG%ufGV,$h@0j CG fCfG"CG$C f@LfG(E} x|} Eܹj0蟜5TRЅEXU} EEFGFGFGF GFLG FXG!F8G$F[^1}DEP\rZB8 RVX-HB8'UtB8 RVXHB8|Cme[^_UWVSxE@EMIMAEAEA EA$EE1yU utM=`TRE$PȃPw$EPh$]CPh`0jM9A rQB8 R_M_-HB8'UtB8 RAM^HB8|ce[^_UEPT5t2t+"#tGtu1UrUЉUt 9Ptu1UVS]u shT#"Ѓ S覜u ] e[^魜UE $UWVSQQE =TRuEurUrUrUTRu%F H[0tP$RF0PW $h 0ju =8QRuuF u h`0@PZVEZHjj|j8"A u-F H[0tP$RF0P$h0j2ǹE{ rUЉC=`TRrUt"F0P$F $Ph*0jsF 8QRЉC CCCC}u-VSp_XF P&4BљE CE8uY15&4$Y=&4ЉƉ1҉MEU ]e[^_e[^_UVS=TRutQVÅXtDSXCtBrUЋSj|ScA[XF uue[^JHF e[^UWVSuj0wXuh0VÅXuh 0j~Y[Xt#F H[0tP$RF0P$h`0&u*F H[0tP$RF0P$h0jgTR9C~(=`TRF $Ph0j C 9C}5VSF P&4BљPSY1{t{t@tV}e=`TRt"F0P$F $Ph 0jZҋCtBrUЋSj|S?XF Zu V IXHF }e[^_7vUWVS}WYuh`0jppp_0Sl$G $Ph0jV S5$G $Ph0jG $Ph@0jwҋFtBrUЋVj|V>XG Zu}e[^_4HHG e[^_UE SMX ASPt@tAjj0PjSb]UVS]u h0JSd=TRs0Zt*=`TRt$h0jjhuuEPu0 W4 WWU[e[^_UWVSE@@][CEC ECEC=$QRU }Em@]{tH=`TR<ȃ$P؃P\$؃PN$CPh0j}uE%t-=`TREP$h0jd M9A rqB PWRujt 9B s hȧ0r 1EuWWk]SWFPSy =`TR8h@0j^_%1} ^EEEEEEEEFEfF|UffEۋUEtiff=6wU9BtJBQQ ! ȉ1H TRЋBF tffAFt CEPFE[;E؉;C<t=`TRPh0Kv"=`TRnPh0jWVStu.C%u =`TR1CP$h@0빉% u7@t2=`TRCP$CPh0j1$ƅ1ƅ0C8CEЅ_tP>^(6W,6W:MȋA@LPq@s}ȋW@XYtjG@w@ EEĉEȋUċR86WЉU:}MAh? tSu̍EPQoT} 7SQCuSEPUȋB@LPvu(SV=XEЅtPH=X(6W,6WMȋA@LPq@r}ȋW@^XjG@w@ v6W6WCt 6W$6W};u S<[7E 0SVXCYt@(P,+SRjjS  W We[^_UWVS E x}]8Gvu1+t RRtSCUsS U1E0EtMuHjFPE jPh86WEKt@rt;EuEuSXZhJ1uWjVju h86WTe[^_UWVSp}GU UEUEEUEEEE@EU1zyU}Ut P]Su~ E] EEUB fx:u& wjWhA[^tjGU@EGtt/98u*G+G$Gt)$)'v o(G (jj(W;;ǃ t GtG( E79UwFBFBF B F$EUEPuuFPUEPЃ,PЃHPuuu}E1FBF BFB FUBHt@<PL4ЋEUBl$`BrFuRFUB fx:ZYtUtcB9Es EEPj(RWIu E7]Xfuj(FPW4fU1Bk tURUPЃHPuWqwEUB fx:vEV@EH=0$1ЋEt@}E@E@E@E@eEZ@>E3@E @E@E@ E@~Etw@^EtW@>Et7@Et@ExV|V06W46W tW6^E9Eu"}tUЅtB8 Rb[HB8}t u5YEe[^_UWVSPME )}EU]t:i e}tJnBwfu3uRxWƋ t!P4XuSuR8Xƃ {E]EE)E }e[^_鵈E]UME }e[^_ƄE]UE:E }e[^_9Ou tP$4_e[^_UWVS$UrME1ҀyE y uuuuuu)pK$1Ѕt h`1;u E 0j0jK5\QR5XQRujEuh86Wu`^E_t SEKS:KEpUVrdžjjj 1҅uVE BvMAh0ЉFl0ЉF p0ЉF$t0ЉF(Ef`WueYu hl1;U;SRuXtjdžXZVb)My Y=V{Cu){ u {u{ u {u{tS{_tzuqCF,C F0CF4CF8{Ex X=Vt;{ EPF,PFHPSZu}'E1F,BF0BF4B F8CFC F CF$CF(uVcugYUBtA}t E8E}ԹjEPFP]EE艳؃ D}u E9{Uz t EiMq}}Et E/FuPuuE>1=E-"uV; uV荵XZ hx1虩}t u1XEЍe[^_ÐUWVS|] CL_ЉxEEMA@1Ҁx}yE}|t$RuVu EU wus~t E/f~Myuy u y$uy(t E8Z}juuEVfUPEfUt EEPE,PEHPMVu}E1Efx>u]xPW裭 EtFUzuz uz$uz(u E9MME}f@<,fECtt/9[8u*C+C$Ct)؃$)؃0r k0C 0jj0S/à t CtC0 E7 SJ(MMfA>fB(fUEfP}wMEffA Ef@UfBMAls$`FAH1҅tPu%EE RЉt;īRu RУīRЍe[^_UWVS$4Džph1蟦jhtP jt=`UR`URt5xt%~1IQtPva t >uˋlV׉h1э st<`~ uhn 1̤_= RuDRS^twRf1 ‰ЃaPRSl$h1tERЉf1 B   R)Љ īRЉ HURЉ RЍe[^_ÐUU1;fRuf1 ЃvuUU1;fRuf1 Ѓ uUfRЉUS]S>ZtuȋC%  ȋ]ÐUUWVS4E@EEEUz(wB(My8u E1]{<uC<EfǀEƒǀǀ9~E u ǀǀUr(蕒MEHD]1Es8}E[EEEEEE9EEsE؋M؋UJT]C(BWEVu WEVt}u>E15fw Vq[t E1e}EUB(MAH-9v}tlRu ueL uE}uu ug EE1E}}]CX1E@0UB<+B, ]KTEP(v ʉKTӸ11҉UBTMA(]C h ThRЃ jh$ [Ztuh ThRjj hn 1~h1{~h1q~e h 1_~q YUīRЉVS;WR| Rh 1zkURЅtzRЉÃX~o=DhR DhR1ɋ5;W9s@hRЋ̈́:W9sA9r@hRЋDhRЉ)H9@hR~@hRС@hR)ÍC9}DhRЍe[^UīRkhURЍP5DhRDžDžRUEuUUWVS h@7Wa=īRUY=@hRuDhRЅP5īRh@1|īRPkURЉh 1|Cuh 1|DūRkURЉEE;;WEŀ:WЉ DhR@։E֋E4ń:WЃt{E+DhR @hR )Ph.#|XZjjW5uUhEW:h5uUu5īRU$uNEuEuE;;W>w1$31и 1( 1! 12 1B 1 N 1e 1SP{h@KLThRЍe[^_UWVSQ}G ,E0t jWlXZ4=t:Wtfdždž dž'C'C'C 'CC߿ϋE $C4UB4= C8C<EC@CD'E@e[^_UVSM] fEfAEAEUƊA  ȀAfY[^UEf@ff@@@UE UMfAAQAUW} VMS]AƈAfAEUƊA ЃȀAEU   ЉAQ[^_UVSjh 54hV5hRЉ}jjjj8h P 5hR0$h5hRЍ]S hRe[^UWVSjhlhsUjhjhp 1С$4УLUУL_TjhlhtUjjjhI.У:WT8jjjjh 7WС hRjPjjjjh hRЃPjPj8jjjjh hRjPJjjjjh hRЃh@;WP*8jjjjh hRj P jjjjh hRЃ(jP8jjjjh hRj0Pjjjjh hRЃXh@L_P8jjj jh<h@;W hRЋB P;WЋB$T;WЋB(X;WЋB,\;WЋB0`;WЋB4jjjjh Уd;WС@;WУ;W5hRСD;WУ;W0jjjjhRh ЃPjjjjhRЃh Pd0jjjjhRh, ЃPFjjjjhRЃ h@ P+0jjjjhRhL Ѓ(P jjjjhRЃ0hX P0jjjjhRhd Ѓ8PjjjjhRЃ@h P0jjjjhRh ЃHPjjjjhRЃPh P0jjjjhRh ЃXPbjjjjhRЃ`h PG0jjjjhRh ЃhP)jjjjhRЃph, P0jjjjhRh4 ЃxPjjjjhRЃhD P0jjjjhRh PjjjjhRh4 P0E jjjjhRh4 PoMyۻEhRPM_yjjjjhRhLP%j_]5 hRS$S~h5hRSh$4P}$4Ѓ ^u$4=~hw 1qjP5$45 7WRth`1Ojj5$45;WhEW2zK_ЃCW:WEEh 1pHU܋rOwP9)߁v{=vn=vajWS5 7WQtVSh1cs E ŀ:WЉ UՄ:WB UCW=:W9։sУCWЃEU܋B/E-CW@=:W;Wwh1rް[1;;WEEŀ:WЋń:WЋE 9s9v¡CW 9v9s?w)vjVRVR'9vjSVSVjSRSR'EU;;Wr "؍e[^_UU E PAUEPQ @UU=rUurUTOUWVS(7WЅtгdhThRЈd1$ThR=hRйh5hRЍ]SZϹ "U\hRUEǀǀUWVSPEJ}u]M $31Ѓ} UЅt@\EVu QSVE WHPEPd} Ep} Ep輘EjEPSVWjlhh$4SVWl5H$4U5N_MhRh,hR=U~5;W.h;WQSVW-5t:W5:W5,7W5:WSVW-e[^_UWV}S] t}t =:W= 7W h@1l1=uUPuSWN}uE=w$4ЍU1VuuuStt<1=uUPuSWSQtuSh1>oh14oe[^_US}M ]UEtEU] M[[1UWVSPu] M}tt :W 7Wh1;Zr;J v h@1dkEP1=uUPujuWQSRM$uxuEU$U(1cu(u Wu\tA1=uUPWu5 7W6PtWuh1!nh1nEU$؍e[^_UWVSQu%EE +}W54qÅXZ tvEtbjuS  =:Wt6 }tσ=:Wu ";Eu1e[^_UWVSSS}} u :WЉE}u}ue 7W+$4ЉE EvNE8EPVhEW)SV54Ё}' h1fi1=uUPuuuNt.u}u5}1t2Ph@1jlh1`le[^_UWVSVE} u}jHu]+$4Ѝ EvNE8EPVhEW)SV54Ё}L h1h}tEUe[^_UsUEE U1UWVSWu] E؃Pjuƒ Ҹ t91ME EBEB E rZBB1e[^_UE EE UVSPP] u;3CCv9jEPEPuuVuSuEX$u sE@CЍe[^UWVSPPu }FF9Gv]1҅Et:{ t$PEPEPujs sVuƒ$1ttu GFE@FЍe[^_UWVSE E}@@_U;v uOME1E;W}ZtVUMt9vPEPEPuuVUE4u uEM)1$;O} ttuGM AE@AЍe[^_UWVSPu };~E;vTF t419E})EL;Nwۋ؋U!D#E9¹uC9|׍PF Pun~1ɍe[^_UE @@UáCWU%Pju$u uuuuu u:UWVSUEE9UEEM] <ˉD9 4 EtLȉәEEk$ V9r;$VsUt!)މu@EIȺәu1҃t k$kU84VEBEM UUD9XE]9]2EPQhVSRE =:Wu ";>e[^_UWVSUE9UEEi} t] f{,UE 18tUJ0]K, tuWuu} t(U fB,HffB,wuuWuuX 4 EtLȉәEEk$ V9r;$VsUt!)މu@EIȺәuk$U`@V uYF ؍e[^UVShhDWЋ] uXTEWЉChhDWЉTEWYN e[^ÐUWVSRUu BFBF fB fFfBfFBFBF1MAVt ?! ? ‰VUOVpMt ?! ? ‰VpMk 9H @ BAZCfAfC}_UFlX[^_UWVSSUfu ffBfFB FfBfF fBfFBFfBfF1UB ?Vu !  ˆVUBp ?OMu !  ‰k EH@B AZ CfAfC}_UBlY[^_UWVSu^f1f^fFF[^_UE0U HJ<J8HJ4H J0H fv4h`81Z1u0$ujuj  Pjj PjjjV]<PXtF-u Ѕt V_1uΊ=,N_t;jPYtF-u Ѕt VZ1uF, t+EpUPSV; Ble[^_UVS]߿Ϻw(jjS5L_v 0lu SV1ҍe[^UWVS<VЋL_ЋUUE0MXZVЉ]]6UE8E陖UWVS]4u}GfC8fC C(PVYZtPVYZDž$HDž(C(VjWj j,1CRPCP$Pu jɦ,u7VjWj jSCЙRPh4Pu j藦,uC1e[^_UWVSVV] U }4ω t[EEE=:Wt#Et:Et=:Wu ";u=:Wu "Y[[^_UPEPuhEW u h81%EUWVSQQUB0u u h81%EXHځXL)ӍV5LhRЉUqNjEXHXZt:EPuUB,@ 0qjuW5Euƍe[^_UWVS}G0u u h81/%GH%_HVSVS5LhR؁GLGHGLe[^_ÐUWVS=K_K_ =PEEǡUЅEZ6U:RGD^5L_h jkSURURЃGTK_ G1uZY u1҉UWVSE8h>1Pu MQ Rphh;1G(FHEX^8FL`>1Љ~PUBFTFd MQI  ƒCPu  ujSv$W4 tNT FLVPFTFT [FHutjh@ 0PWz[jh!FH &PWa[ jh FH&PWG[jhFH #PW.[ jjFH#jh@ +PW[jjFH PWZe[^_UVS]CPjs8s$P4ƒ⟋CPRjs8s$P8CPjs8s$P4ƒ(΀CPRjs8s$P81jThRЋCPjs8s$P4fy F~ًCPjs8s$P4€CPRjs8s$P8CPjs8s$P4ƒ(pCPRjs8s$P8CPjjs8s$P8 CPhjs8s$P8CPjjs8s$P8e[^UWVSuM F(}Yu t2vC%;FHS;FHt%FPjv8v$P4VPPjv8v$R8A@PЃ$?1ЋFLVPFPh@jv8v$P8FPj jv8v$P8$8FT;FLVPjV FLVPC%=YFPuh!jv8v$P8FPh]h jv8v$P8FPhCFLVPC%=ZFPuhjv8v$P8FPj@jjv8v$P8FPj jv8v$P8 v~S;FHuoA@PtfuTFPjv8v$P4ËFPjv8v$P4 Ãu,F`@;FdF`~ FLF`VPjV 1҃tVWV1ҍe[^_UWVS u^PC,C0 FPjv8v$P4EFPjv8v$P4 EFPjv8v$P4$FPjv8v$P4EFPjv8v$P4NjFPjv8v$P4$FPjv8v$P4EFPjv8v$P4EtK,E@tK0VTtE t% = t K0 u#fyK0!@C0tC0 fyK0 C0t  C0FT ubEtt K0KE% =u% = u K0%e } u uK0e[^_UWVSuFTuX FPu(h jv8v$P8FPhj v8v$P8 hjv8v$P8FPhjv8v$P8} tH1FPjv8v$P4ËFPjv8v$P4 Ã1 uUhGThRЁ[;뺋FTu-FTF`Vh"Ѝ^hSܾk&4PSe[^_ÐUWVSE@ @p4й]u&K S t=Zu  t1[^_UWVS}u h?1C(FHGF8FL?1Љ^PGFT{(XtFE E?1Ѝe[^__V?1ЋFPjv8v$P4#GFXfFXtue[^_e[^_UVS]U C(uBum@%;CHt h @1tt 6t1t$*B@Pt!SYSLZ1҃tSa S{VS1ҍe[^US]SCPh1js8s$P8]ÐUWVuN V ƒ u t@N V ut1"E@ @p4й^_UWVSuV %=] >uRhL@1hh;1 h`@1XG(CHFC8CLt@1Љ{PFCTS|@1ЋCPjs8s$P4#FCXfCXt]e[^_e[^_UWVSuM F(yu W;FHt h@1}t&}}}tA@PtyЃt ty$FPjv8v$P4 1u_jVZYB^Pw$jv8v$S8FPw jv8v$P8 A@Pu V,VFuVL1ҍe[^_UWVSSSE@PE@,@0 UxBPjr8r$P4MËAPjq8q$P4 ÃtuN,UBPjr8r$P4 tMI0A,4@t uN0 u EH0 UBPjr8r$P4MËAPjq8q$P4!t\t uN0tEH0y UJ0@tMI0 uF0t{~MI$MA @4ЋxދUBPu"jXr8uP4 MA0t#&jUr8uP4 MA0tA0uF0 GUB0e[^_UhA1u4ZY u1҉UWVSuN V ] >uuCL@1ЋN V uuCL@1hA1VV Rphh;1G(CHFC8{PFCTCLSPCPjs8s$P4#FCX$fCXt]e[^_je[^_UVS]U C(uBu t* tgttx~@%;CHtny@%;CHt"CPjs8s$P4SPPjs8s$R8GB@Pt1S;Y(@%;CHu%SZ1҃tS SVS1ҍe[^UWVSS}wPF,F0 ^GPjw8w$P4 EtN,GPjw8w$P4 t N0F,n@tN0tWGPjw8w$P4ËGPjw8w$P4 à uN0/EF0tF0EtN0CF0e[^_UVS]SsPjs8s$V4 Pjs8s$V8e[^ÐUhHA1u`ZY u1҉UWVS]} 3hHA1S6S Rphh;1uF(GHCG8GLtDWPP4w8w$CR8<u}~ uThR_e[^_ÐUhI1u\ZY u1҉UWVS];hI1Su 2S Rphh;1qW(VHCF8~PFLI1ЋCFTFdj"hRWP0$FLVPjhFH+PW/0jjFH +PW0$jjFH PW0e[^_UWVSuM F(}Yu nt2JAC%;FH-5S;FHt%FPjv8v$P4VPPjv8v$R8A@PЃ wi$I1jVXZFLVPC%=[FPuj@jv8v$P8FPhj jv8v$P8FPjjv8v$P8 v~S;FHuoA@PtfuTFPjv8v$P4ËFPjv8v$P4 Ãu,F`@;FdF`~ FLF`VPjV$ 1҃tVWV=1ҍe[^_UWVSQ}wPF,F0 GPjw8w$P4ËGPjw8w$P4 É؃EtN,GPjw8w$P4GPjw8w$P4@tN0tZ u}F0t @;N0 GPjw8w$P4ËGPjw8w$P4!Ã@F0t  F0!V0Ѓ F0t  V0e[^_UVS]CTuDCPjs8s$P4`SPPjs8s$R8hThRЃ CPhjs8s$P8} t51CPjs8s$P4 1Ҩ uNhFThRЁX4͋CTu&CTSh"ЃhSS&4PS`e[^ÐUhJ1uZY u1҉UWVS]} 3hJ1SS Rphh;1-F(GHCG8GLJ1ЉwPCGTWJ1ЋGPjw8w$P4#CGX$fGXt}e[^_阾e[^_UVuSU ]Bt* tgttv|@%;CHtlw@%;CHt"CPjs8s$P4SPPjs8s$R8EB@Pt/SyY&@%;CHu#S˻Zu S SVSe[1^UWVSS}wPFEF,F0 GPjw8w$P4ËGPjw8w$P4 ÃtN,GPjw8w$P4 tN0F,@tN0 u N0GPjw8w$P4 GPtRjw8w$P4ËGPjw8w$P4!؃tN0pu5x?@t N0Z F0tKFjw8w$P4 fy N0-@tN0" t N0 tN0 UBF0e[^_ÐUhK1u\ZY u1҉UWVS]u ;hK1S2S Rphh;1qG(FHCF8FL`K1Љ~PCFTFdVhK1ЋFPjv8v$P4#C$FT FXt-jjFH'PW/)jjFH 'PW) fFXtue[^_饻e[^_UVuSU ]Bt* tgttv|@%;CHtlw@%;CHt"CPjs8s$P4SPPjs8s$R8EB@Pt/S膶Y&@%;CHu#SظZu S S VSe[1^UWVSSSu^PCEC,C0 FPjv8v$P4NjFPjv8v$P4 NjFPjv8v$P4$EtK,FPjv8v$P4 t K0C,N@tK0t4 uK02EC0tC0EtK0 UBC0e[^_UhL1uZY u1҉UWVS]} 3hL1S趻S Rphh;1F(GHCG8GLK1ЉwPCGTGdWK1ЋGPjw8w$P4#C$GXtGPjw8w$P4G\ fGXufG\t}e[^_8e[^_UWVSWE }]xt4}|}G%;CHG%;CHt'CPjs8s$P4€CPRjs8s$P8U B@P^CLSPG^$$L1S.Y4@ 1SG%=ZEu ECPjj s8s$P8CPVjs8s$P8 CPjjs8s$P8GCPuj s8s$P8CPVjs8s$P8M A @QCPt MMuj s8s$P8[W;CHuzM A@Ptnu3CPjls8s$P4ƒ uC`@;CdC`~C`S6S:U B09_uB,9u}uS^uS61e[^_UWVS}wPF,F0 GPjlw8w$P4à tN,GPjw8w$P4ËGPjw8w$P4@tN0t uN09GPjlw8w$P4 tN0tN0tN0tN0e[^_US]SuCLSPCX%SPPjs8s$R8hThRЋCPhj s8s$P8,hThRЋCPhjs8s$P8jdThRи]UVS]CPhjs8s$P8hThR1CPjs8s$P4 tj FThRЁ:X~ٍe[^UVS]CPjjs8s$P8CPhjs8s$P8 CPhejs8s$P8sPjs8s$V4 Pjs8s$V8 CPjs8s$P4%SPPjs8s$R8CPhjs8s$P8,CPjjs8s$P8CPh js8s$P8 CPhjs8s$P8sPjs8s$V4 Pjs8s$V8 sPjs8s$V4 Pjs8s$V8CPjs8s$P4%pSPPjs8s$R8,CPhAjs8s$P8CPh`js8s$P8 CPh@js8s$P8CPjwjs8s$P8 CPjs8s$P4%̠SPPjs8s$R8CPhjs8s$P8,CPh js8s$P8CPhjs8s$P8 CPhjs8s$P8CPjs8s$P4%̰SPPjs8s$R8,CPhAjs8s$P8CPh js8s$P8 CPh@js8s$P8CPhjs8s$P8 CPjs8s$P4%SPPjs8s$R8CPhjs8s$P8,CPh js8s$P8CPhjs8s$P8 CPhjs8s$P8sPjs8s$V4 Pjs8s$V8 sPjs8s$V4 Pjs8s$V8CPjjs8s$P8 j(ThRЍe[^US]SshThRXZ]]~UhL1u̳ZY u1҉UWVS]} 3hL1S袳S Rphh;1F(GHCG8GLL1ЉwPCGTGdWL1ЋGPjw8w$P4#C$GXtGPjw8w$P4G\ fGXt}e[^_,e[^_UWVSPE @}]Et7}}UB%;CH|UB%;CHt%CPjs8s$P4SPPjs8s$R8uU B@P/S`EPЃ_$L1jS蘬Y^@ 1u CPjj s8s$P8CPVjs8s$P8 CPjjs8s$P8UBCPWj s8s$P8CPVjs8s$P8U B @QCPtWj CPh js8s$P8(YUB%;CHuDS:Z1҃t8S<U B09_uB,9u}uS ^uSR1ҍe[^_UWVS}_PC,C0 GPjw8w$P4ƋGPjw8w$P4 ƃtK,GPjw8w$P4 @tK0t uK0_GPjw8w$P4ƃ tt tK0#K0K0PGPhnL1 tK0e[^_Uu蝬hThRUWVSPuFPjv8v$P4%ËFPjv8v$P4ӃfEtB^Pjv8v$S4 Pjv8v$S8ftfuE t^Pjv8v$S4 ^Pjv8v$S4߃ Pjv8v$S8^Pjv8v$S4 Pj;ftfuE t^Pjv8v$S4 ^Pjv8v$S4߃ Pjv8v$S8RFPh`M11 e[^_ÐU=vUu&jhM1jjjhhEWvU覱UWVSPj@uC,{t1Cth@BThRXu8jjhM1jhhUlCHC@tcC,*{us Ss,h`P1 ]UWVSEp }F48tu[p<wW1ۃ $lQ1ЋMA$9A(A(E@@uYMyG t :t$G t |uwmE@,DffUMA t1^A )tfFtfFExxFu. tMA uQ>Y؍e[^_UUBPBPB PBM1tPRhM1肺UVSV]C4Es CP}qEPs4N1t #4PhP1kNVA A RhN1@jVFY[PhN1XFZt\h^1۹~ Xyj hN1ƹY,XF@tPhN1讹X,ZF tPhP1薹[Xhn 1芹YNVA A A t >y30.PRh Q1H ~NVA A A t Ph O1 XZjVN8Y[t Ph O1XZFtPh3O1ٸ[XjV8ZYt PhHO1轸^Xe[^UWVS1W!wUЋ]u CKS Ѓ{fEt5NttLh4 mRhwU@ C PC Ph[O1hhwU޸{PE$Q1@Pu.urO1Ph}O1hhwU耸=wCt:PhO1)PwUPPhO1PhO1hhwU4e[^wU_UWSjjhe1Bj@RFWЃ҉tZPFWCFWRe[_USj@]eR҉XtCBCQbRjS]UVSj@u/RFWЅۉYt C9tuR&Re[^UWVSu~0uv YER1WZuv _ER1Ѝe[^__C[FXCZF,wn$R1ЋF$+F(C$C[rCXCY PC(PF4P*C[SCXCY PC(PF4P7R>h@S1C[[^&C[ C[Rv,hS1C[ }e[^_闪UWVS]S1_uhO.舵^B 9CXZUUWVSSS=$4u Uu mRFBV0fzufBV0fBfF8z$uB$F8PhT1аF8EjjPF4uhW1>E Ef~8tD^4jjj UF4M u h@W11׋MEF89E|hThRYEE FEe[^_U?UUVSu1f~8tF4<t j4XZCF89|jv4e[^UWVS] C }7t F19u!C Pt F19u WSuPe[^_UWVS]} uu+1;mR}6mRЃ<t VWS- C;mR|u} ]e[^_ e[^1_UWVSPUҋ] }x;mR| mRЋ4V0fBfEu BH1ɉEx(B9} ى]u B$HE(xB$9| }t F48u E};M]E9tO1}:}tjEPF40] u"};}WSEPVtG;}~C;]~1e[^_UMWVSUu ~k< t< t < ttuIF~O< t< t< ttt~5D1< t< t < ttuI~D1< t< t< tttɿà  }\t =u < t B M\B\\B>C<_Bv-\08B0B0B>IFr[^_UWVSE ]t Ph2ǬY^PsH@DƒS~%@t*DžL #4t4 t `tDžL]1hW1tV1ЅDžL #4uvSwe$[1лV1\V1UV1NX}1GV1@V19V12V1+V1$V1V1V1hX1菨C2jFPEPjFPtPjF PTP$LV1uV1PSSPFPTPtPEPDHh@X1Pe[^_UWVSUB4MU<Cjjj`#à ۸5Mq0EfCmRЃ PhwUЋUSfKfSC`mRC Et}wUЉ%@ t `}uj:u hwUv AKmRtmRЊMu$CuwUй:} u EAEPjj#hX1hwU=wUЉЃH~"wUШtfctfc tfc}tfAf CwUЈCwUЍ{%:=wUyfKuVuhO#Љ]EwULs uEPVh3^ }uACt;UB4Mxu){$v#mRЃ PhwUSfC6fC UB4MUmR PjShR#VWu^u1 jS Ee[^_UWVSEEURMUM}EEU :M;Jru܉1щˋUKM9ۉ֋}܉unE@EU R U܃1эYu9ۉu@]E @E܉ǃ1эYu }9ۉu]UE;~M MuMu }:E[^_UPEPjjh\1ЋEpEUWVSREE8u f GmRЉwvfG F^0F\džmRS}VS GuUB@uEn 1Ѝe[^_U1UWVS}j@]BS$҉Xt$B$C$B0B0B4RƛS$XuV@B1ۋw;WRY})URЁ?tY#ujFPVSC;WR|1;fR})XRЁ?tY#ujFPVSC,;fR|܍e[^1_UE0|UWVSQUf1E ЉRhmRЉExÅXZC0P}ƅX~t'G}u } '}u} tPj Wr uhjWƃ t}} 1}hjW fOjSZYtfgBjSu}t)9E}EuM} t }`t"M M fOuhjW2fg C0PG|S+we[^_UEf1WV SRhmRvÃXZC0P{ƅXt Sv} t }`t !! uJh@j`f` @tjjf` C0PE{S)v1e[^_UWVSP]CDf1 RhmRuY_u C4@u C4K<1ҋw(t C4itnCDt&1 PS ~=j@>SPuVZVYu}e[^_=C0C0C;t E-jjh$j@j Pjju< $EuQM@VuBffBM@u ffff> v zvB1jVrjCPCPCPP*jSu,jSujjjjjuPjjjjjjjjjjjjjjjjjjjjjum jjE jjUqhjMfftft EfJjjE jjUCj1;PMfJ0wfbpu E_bCPPuE ISu[ SuE[^.EuuuSVWEEu9iEe[^_UWVS4u1eEE}U F(F0F,dd1@F4F8dU @t$FATAPF I CDF-ROMFfF "FSCSIF CD-FROMFfFFfictFitioF usF$M F1Esf}t juY[}u}uFEf1Me EEuuЁ%V h[\# Q[e[^_UWVSuU dždžC1} Rjh Njj}Wj EPSE% $ulUE E E ~tUG G G Bcwe[^_UWVSVVjjh}Eƃ EPWjjjjEPVjE(ulUuu\E BUEP UEP UEP}th NWVjEh NWVjErÃjV؍e[^_UVSPjjhu Eà ۸ tZjujjjjEPSjE2(u'UuuB B FB FBFjSU1e[^UWVSPPjjhEb1 /jujjjjEPWjNM(UuB ƊB ʼnB  B ƍEPujjjjEPWjM-(UuusM !B "QEP "QEP Q!EP}th NuWjMh NuWjE}ÃjW؍e[^_UW}1jjh@ jjE jEEEj EPE즋Eq}UWVSPP}E@t1jjhƃ EPu jjjjEPVj(ucMuuSQЃAEHE8Pt9}th Nu Vjh Nu VjMÃjV؍e[^_UWSU }1 ]jjEh@ jEjjEj ME]EEUQE e[_UWVS0]ۋ} 9߹PuHZYC@9~))ydH<uJJuNò;t3P‰PPPPPu e[^_UW1} E jjEEh NEEjEEjEEjEE Ej EPEGE}UW}1 jjhjjjE Ej EPEKE}UhjhjjjjjEpUWS1} ]} EBuMh jhjESEEuEj UE]E@REe[_UWS1} ]} ECuMhjhjESEuEj EU]EREe[_UVSjj] SjjuV|u(CS)jPSjjVVu1e[^Uu uZYt1҉UUUWVS 01э}u ʉЍ}Ĺ $\1hjh0ujjEPj EPEEEM$EFEEFhjh0ujjEEPj EPEO$Sj JEE Fhjh0ujj EEPj EPM$jFPEPPE䤋VEEEUE Fhjh0ujj EEPj MQE$UȈF F VFjPEbEEFhjh0ujjEEPj EPM$E˃FEEFj EEPFPE:hjh0ujj]Sj EPE0EE FjEEPFPE ׍hjh0ujj ]Sj EPMH0tK=EFjjh0uj?jEEPj EPE$u 1e[^_UWVS t1э}] ʉЍ}E䭊EEETChjh0ujjTEEPj URE$uE1ƒCFƒSCFƒSSCFƒSCNVA A A ‰S NVA A A ‰SN V A A A ‰SFC M1e[^_UWS1} ] EEE譊EEEChjh0ujjEEPj URE$uECEC1e[_UWVSjjhu Aà ۸ 1}E䭊EFhjh0ujhSj EEPEEEx$uhFPCPĊ jS~e[^_UWS 1э}] ʉЍ(0E譊hjh0ujhE(Pj UREEE$u8() B=SwRCP,P1ɍe[_UWVSjjhu à ۸ 1}E䭊hjh0ujhSj EEPEEE$u/C VwRFPCPO jSe[^_UE UwC$]1ЉE UE UE UE Ut k DtFdV0 Fy$VNB B B EH$C0C8UB(F@tK0 }t B(UB@~yK0}t UB(UB@F tLK0 }t UB(UB@>yE@ uQCPhf1#W C4tUBuk8UB(;B$S0 Ex$x(V¨@y}UB< t[yE@ u3)WCPh`1V 9~ UB uWQCPhf1cV^EH(}tIUJ@A}u?C4tE@u k8'C0uC0UB$B(}tUB@1e[^_UWVSQjjh}E } jWpÅXZuXG8G8=t=uƃO0 g0jWYXuj VuWjjWtju/t;w8ju1e[^_UÐUWVSL=FWuu'hFWjjj1FWu FPh i18hf1TF8RjjhjhPP tFPh@i1TF8UjRjWjhhPP$ tFPhi1rT[_EF8jRhuWPP,tFPhi1EF8jjhPP tFPhi1PVEYtFPh g10jV _EZtFPhj1N|]j@SjPVj!Sh#u1S=~ dž=~ džjjkE1h19tA v wh1D#E ;EEt7C(9Etu'fL>jCPUBpP uBh#hb#ЍEPut#MApfL8jBPApP踓 EEE$9Ee[^_UVSEۋu t{t VsSXZue[^Uuhg1uu KUWVSu }t"hS7VSh7S0$Jwhg1Je[^_UU B Mt ;At1 QRuPUVShg11I;5nRY}QVhtnR4ÅXZt5C|t/hjjhjShjjhjS0F;5nR|h@KLThRYEg1Ѝe[^VIUWVS0]Eܹ1E EEEEEEEXC8x tjjXjPP EPSZYuQaC8x tjjXjPP ~WtjdThROXuҀ~WtjXPVN1e[^_UWVSuDžxDž|EEE EЋEDžtF8x ttjjjPP SVZYPF8x tjjjPP ?t jdThRKXuӋtPFPhk1G;N8pjRjhWjhPQQ$ tPFPhg1V8jPpWRR,t PFPhh1eV8PjjjRRt PFPh#h10F8jjPP tPFPh8h1FF@ t%~4V0xuDJDىu1e[^_UWVSĀhjuV DžtDžxDž|Ë@juu tWSVE? $h0uWSVSVVSV e[^_UWVS L_ЋB}JuL_@,uPȕXjEPWBáL_ ۉuUEjjXSqƃ t3SVW t jVGlt jP[Xwl1e[^_UWVSĀhju] 1} DžtDžxDž|FjSu tRVEuEEE $}t1PtPVu_Vu Vu e[^_UWVSE4jjWbà ۸ jWSuuC49tAjSjjVÃ۸ tXjVSut jS轨7UBtt jP觨XZMYt$э1UBx1e[^_UWVS}] tPuu jjj ulu Vud .jjjR pu VuA jl ~lF pV}t   ÀDžtxDž|FElEff@fPf@ElfB}u'L_ЋBJuL_@,uP蔒Y1}M jj ltSVuuu uSVuv0}0ut1PtPVu }u3L_upB<ufzt 1ۄÍ}tt/Vu: Vujl膦jpy ؍e[^_UWVS}] }tPju ƀE]EEFEuEPVu Vu=e[^_UWVSh}jWDžtDžxDž|Ƌ@EG EE<pH ҉htb`P\PjjhRjjÃ$\ۉlt&SGPhk1b@DžlDžp htb`P\PjjjRhj#Ã$\ۉdt&SGPhl1?DždDžh L_ЋBJuL_@,uP[j5FW5FWЍtSVWjjlPSVW0jjdPSVWhSVW9 (VWVWeL_e[^_UWVS ]EEEEEEEEC8x tjjjPP EPSZYaC8x tjjjPP ?u jdThRNXuӋtPCPh@l1o>1{4C0uP@@@u!jdThRN_uݍCPh0<> PS 1e[^_UVSdxU@] dxUC UC$u,t XCj@*K$Ɖ#FWЋFWЋCZtʡFW#FWЋCB FW# FWЉFW#C$FWЍC ue[^US] C MutCBCj@S҉XtC B C ]MUWVS uM +ȉEV8z tjpQPRR Ht F8x tjjPP UJEtE#FWСFWЋ҉UtE9H$t P҉Uu}uQFPhl1R<E@ t;EP ~4F0uUrVuVt E@EUz }t E@ %k<;w Ct;{t0SWVhl1;tssVhKh1;rUB tCKECCtU ljCt SX,% =t uSEpPujUrR Ee[^_UVSu~4F0uP0@01ҨtUN4ɋF0uPD@DuɋF0uPD@DútSVX~4ZF0uPD밉XD뫍e[^UE@ Uu@EBE Eih1r:UWVSj@]}$} Yt E @ tF% hxUЉFhxUF~F Jye[^_UVS] uCj@3[Ee[^-UWVS E }1EUzt F Uvt(UB8ujjhjhPPDEEUB8jjWuuPP EP )ЋUR9‰UvUB8U2PPXZ1}uMU vB CIzw r@3Cz1}@UBzEP8z t%}uPWjE0Ep8R U BuE %‹EU JeEU1tUB8U2PP^_؍e[^_UWVSE PUMpA8jjuuVPP OE@E +EN9v{UEɍ|EMV tt4 ~u }t; CE;C]HFtIuE8 [^_UVSpjJEPhjju uVuVj ]SjEPV0Shh1a1j SjEPV0ShF0D1j SjEPVSh.*11e[^UWVS hu 1ۃ}Vu\ E ^(]؉NjF$E܋GEEhEEPWuWue[^_UWVS h] SuuENjC( E؋C$E܋GEEhEEPWu uu!WuUe[^_UVS j] SuVES(U܋S$UPUUjUURPVe[^UEf1S RhtnRFÅXZtGjP^SW G @F4uVtV<%fN=F uN JuN F<`F G1jhhN#ЍG0PWG1UWVSPPE x @i<]}t,E'tEF V$z1hz1uj@j@SEx1#A:C@1tSPdXC(!lC@0F@~jFPjjjhPS>LF quj@j@SEx1@C@1tSPdXC(!F t jF@ tfjF PjjjhPSK F Euj@j@SE^q1#@:C@1tSPdXC(!lfGfxu @\1PG@,PjG@0HPG@4PhU BPS-KF cuj@j@SE1?C@1tSPdXC(!tZjGPjjjhU BPSJF Kuj@j@SE2)?xDC@1tSPdXC(!uzF E @0$PSfK$}tU 1ҨuU BPsCPhtq1wG$F u S1luU BPsCPhx1@C( thx1-G$YC+Phx1C+G(G$XZF u SMe[^_UM S]S8A$B(y A$ tA$@t-A$R+Q(fC t yfC1A(t f@f1[ÐUWVS 1]u ߹󫍽UBt!ƅƅ@ƅDž ,ƅƅƅDž'ffPuDžDHZYfu{hSV% =ufC6f=NEtQf=FXtK1ɍfB6f'fB6v1ɍfBffBv1ɍfB.ffB.v1ҍe[^_U1W}ܹ E EfEfEEPuEEEEECH_ZufE1ҩ‰Ћ}US]C @<C v{wSBC C{v C C]UWVSQQEE #41xu~ EoREoRЃ} uh{1uV 1ۋE t6E4uEh3)P7P1эyE2ЃC~e[^_ÐUUWVS@hn 1Ћ] jh_$ЍEPSEp3EE}Z1H$4jEġL$4h_$ЉEȍEPSE{1EEE$Ft7jh_$ЍEPSEԧ{1EEEREӯ5$4Ё60йu0jh_$ЍEPSEԫ{1EEER舯=FWu0jh_$ЍEPSEԬ{1EEE`ROe[^_UE WVS]tP3h7S0? 3{1йush2.XZe[^_UVSu Fp]3! Z1҅YuF t;Cu 1ҁ{e[^UWVS`uu ueBhn 1E@EURUMIME@PQEkBEUBM A0A8QhA$U B4ME[9M^juuu6BjPuBCff|j Wu!C ExEEE9EFuuuuAjPuBf fjWuBjjWu u> Wu uZ>VWu u>ux t=؃!؃t*}tU2}tU} t E 1ҍe[^_UWVSE]E܍C}u EEwth{1}tC'~ h|1%hwSVWEy=jSVWE= SVWa=uSVWE=}t4SVW?=jSVWE=SVW*=(uSVWE=udwEZ}tEe;EE11ۋMƉ ߃}tىۉ!!ڃ E#EuiEtwu }u}t@}t eUE}tE!EeEM} t U 1ҍe[^_Ujuujuu uQUuuujuu uUuu u;ƒ tUWVSVEEE} u]MU t [[^_EEU M]u} EY[^_UWVSM]u}(Ct9EPEPEPQu s s y4EPEPEPQu s s uf[t9}v}EP uVuuSiu7}tE}tEU} tEU }$tEU$1ҍe[^_ÐUf$|1f9EU uf;&|1и$|1t1U=D62U@62tf9t xu@UWVS4E ]]]܉ËMUMEE]1=D62u@62tCf9t9xut1=11t#f9uf9Pt xu @ExE1Ѓ=1t&E܋];Ct ];u E8tX1ۅt;tE;Ct t;uu PPh1h?2uV'}t uWh1 PWh ?2uV}}uh1VT 1ыEQ uEPEPh`?2tu EPQh?2PQh1ЋE)P2P1эQ)UEˋMEE1ЉM &1эQ)UEˋ]EE1Љ] 2Ee[^_US]1Ҁ{+C(u u{+C(u u1ɅtAjs s 7 1Ƀu'j3 ZYus3ZY1Ʌȋ]UShn 1Ћ]qjs3u ' ]UUEE UÐUWVSSh}FWsq=txUYtPxq;=lxUZtYh?2EPjjj"WetVFq$h@21$EVpxUЉ=lxUtxUqXlxUЍe[^_USh]p=txUXuQp$?2;SuE E ;SuBZQpXË]UVSPE]u Ehtp=txUXuQyp$?2;Su;SuBEEBMe[^9pUWVS EU MEUE  Љ1 1ҋM ډ1ɉƉ ߃}t9uE PuEPI tEu EEtbEEM܁@pRЉMM܋LpRЉHpR!ӉU!@pRЋDpR9ډEԉUu E9MԉEtEE}=vEEe[^_USj,]s s 4sPs$1҃t xtЋ]UWVS,] u1ǃ ƃPAƃ](,DŽ(B~CƃPS肒Fjv v 94Ej,v v )4 vPv$8 Ejjj5 uh@@21׹F F BFB FBF(BUSRYbjjjEPEPjjjV$thC2Z2E܉ E jS辪j@v v C3j@v v 63 /th@2XZWj@v v l3/teпujv v L3,@S| ǃ9$ǃB;$Ћu ‡@ɋ5u ‡ u ‡t׋$tu  tuBuBƒŰ ɋuBE؅ɋuEEEEjSHY_>% u ŸuȁŸȀ ȃȀ u[B[ u Ÿ u xƂxEPV2_ZthJ2iuuuuv 3ǍCPShsj@uuuuv "38u+h@2EYt Wh35XZhn 1)u[0PhO.Y_ $u „Ƞt࿋(tȀtu „j v v /? (t!ujj v v 0ǃ$tj@v v p/ u$jjj@D1 ‰01EPS XZuBu ??B$ tu wƂwu †Ƃ,tpu.}t(h@2h, ,_XEE u ẼZ` Ẽ`BZÜRS EYt ,j@v v .jv v -j v v - $u „$u †u Ÿ!ƅuŸȀ Ȁ uBu B u B  ȅfu Ÿ u $ t$ u t$ u S_ZuSS螊e[^_US1f} EMUuAfu:f9t5ɉʃtt tuʃtw u[UVS] j@p0+  $t# u Fv1v t ɸu1e[^UWVSSSE EE]E% }ut* u @ @ ,%,t ,j@p0* $tW u „}ttu „4,t }tɀt}tME@PU Ee[^_{*UWVS]SEEEE^jjjjSsS=E uP`1@` u ƀ u ƀjjjjSS躋 ɉƉϋu tɋu  uEu ƀ u ƀjjujSPS9uG ɋu tɋu  uE%@t3juujSS譊9|?E~ , uP`@` u ƀ u ƀ}tG}@u }PB2u #4Ѓ}PC2uC2PRhA2PuuuuSe[^_UWVSu u @jp0'  ËuPb@bȋuPc@c PWh@A2 yhA2Y_@thA2sXZ thC2\Y_th;C2EXZthXC2.Y_th B2XZSjp0&uh`B2_X! u ƀ ɋu  u!ɋ4u e[^_UVSM u „ u †% ۋu Ÿ!ƅۋuŸȀ Ȁ uB u Z u ؃   \ u Ÿ u % t$ u $t$ u M[^XUU(ȃ%(ƂPAǂ ǂ$xt 5(ǂ1UU(ȃ%(ƂPAǂ ǂ$xt 5(ǂ1US]SZu $1]UEƀPAǀ ǀ$(%ǀ1US]SZuSY]US]SZuSY]US]SZuS`Y]UM(Ѓ(ƁPAǁ ǁ$xt%(ǁ1UE,EUS]SZuS#Y]US]SeZuSPY]UUƂPAǂ  ǂ$V,@xu(ǂ1UEƀPAǀ  ǀ$,@(@ǀ1US]y °B(ЈPyvǃ  ǃ$1b@ǃ ǃ$1`jq1 Pjp0J!( (,@ǃ1]UUx B(ȈPǂ  ǂ$v,@(ǂ1UUx B(ȈPǂ  ǂ$,@(@ǂ1US]SYu $1]UhB2¾US]Btt ƃPAƃPBrhB2耾ƃPA[X1]US]Btwt " tƃPA(ƃPBƃPCrhB2#ƃPAXZ, 1]US]Btwt0tt$ƃPA1ƃPB(ƃPCƃPDrhB2豽ƃPAYX, 1]ÐUWVSE%11M Ӊ1ȉ =hS4Ɖt ƉEE@uRЋMQ A!ӉU!R9ډEUu E9MEtEE}vEE[^_USj,]s s Ps$?]UWVS u ]CFPV<_Z*js s Ej,s s Ps$ {&y fu SVPZYj@s s C% =u? vRЉ`jQjEEs s A1u:tVО$hD2薻YX?js s tuhjjjPPjRjS$tnRhhPCOVt14PV$hD2Ժ1 teujs s CEt}jjjPPjjjS9$jjjE؍PPjjjS $}Etteujs s u$}t}uVH$hC2jEPjs s |t1EPEs s  tPus s Mt!j@s s Pj@s s V:džM$jV?< EPS^_ZtV腜$hJ2Ksuuuus ǍFPVhj@uuuus 8u8V-$hE2Y[t Wh3XZhn 1ָV:dt WhO.迸Y_j s s PjjV-Vu&V IZuj@SV9SSV蟯e[^_UWVSSS]x p jVWEZEPjVWɋuB<Cɋu BS茜YtjjSf ɋu §u §jVWPjVWjjS (uBu ƂhUZhS/hS;=UZuSuBBt2jjS胚 u §uEuBBtyjjS0 ɋu §u §jVWxPjVWuBu ƂujVWEe[^_UWVSH}WEÅXt}j-j PuVW薑u VWW[^jj - PuWithC2y1 uRÉ<$YhWMhW=/hWϧAYZu:hW轧DYZu(hW諧PYZuhW虧TYZhW胧BYZu6hWqIYZu$hW_OYZuhWMSYZtLhW;AYZhW%SYZushWPYZuahWIYZuOVWKXuEZEPW6fE[}?X~uYtu0WRjþ  LJuW{SËEp"XZۉu VW 1e[^_UWVSPPux X j@SW tPj@SWt jjVu EPjV襓 E u!EE EtEE t#MtV<$h@E2_EXE u!EE EtEE t#MtV$hE2農YM [E}󋖜u=B=؃࿁t @}u ȃ=ȃB=u=J=EPjVI tVH$hE2XZe[^_UWVSUH M@ E䃺uP@t Su|XZiuה$h[D2蝱uҕuEstjju1tlUu % E Uu % GFv1tU1D/t@ wRЃxxUuu xxUtD24vRu$5xxU詰 CvGvjuuPjuu EPuE$uP@uKe[^_UWVS}P U@ EPuR/PWE3$hI2W0E1ۃSSWs ɍuu –3ɋu —D+ɋu –3 3u —D+ D+숂ɍuꋗu ž3ɋu ŸD+ɋu ž3 3u ŸD+ D+舂C11D+t*4vRWwRУ|xU‘$5|xU臮 w5D+t(h1WwRУxU舑$5xUM FvCvu؋PuuuBEPWwe[^_UUǂǂUFUUǂǂU#UUǂǂUUVSu N(]w-QS螐$hI2djjv v ~°B(ЃTw3T@Tw Tt tTƃFTVjDv v PjDv v jDv v (1e[^UEM S E1 1ҋM ډ1 [UEP$fDut1UWVS]C hM1Ћu EjjjF0PPjjjS(t hK"3CEPS_Zthd2duuuuu~,WVh,j@uuuuuJ8u(h{2m^t Sh3]Y[hn 1QVZt WhJ29SVle[^_ÐUEE "J2EE5UWVS ]C } EfLJj s s C& =t=u0=uƃw0 Rj s s . EPEPjs uuEPjuu3f:t GPh@J2SG0E؉G4CG8fC$ffLJW^t hJ2ڦEPS ZYwt VhJ2xuuuuuy VWhNj@uuuuuԉ 8G@u*VhJ2輩Y^t Sh3諩XZhn 1蟩ShO.蒩Wte[^_ÐUWVS]{0s4uV F u V1ffFfǃƃ@ƃAƃƃƃƃƃƃƃCƃƃfǃƃƃƃƃPk&<ƃƃƃfǃqfǃPVWm < < fǃƃ ƃƃƃ ƃ&ƃ,ƃ2ƃ9ƃ?ƃEƃKƃRƃXƃ ^ƃ!dƃ"kƃBuuV `F `SvQuV PEF P?ƃƃƃ#ƃ(ƃ2ƃ<ƃFƃUƃBfuuV `F `ƃVW f=YZuuV IF IfǃtVW$XZ1ƄƄ Ƅ@~e[^_UWVSTEx0p4hj@VWEfEVW1VW7 t VW3 ZYt VWUiP; VW Y[gu V ffF uV ffF ft 2]u VffEfVfUu VffEfVfUE0t f%υfEfE@uVfUfVMPSVWfuUuVffF@tRfMEuAfUf9tfM uVffFfEf9CtfM uVffFfCfcf f;KtmUPVW < uHC CCCCCC fCC C CCCCCC EfMCMCCC CfCfCCCCCCVWYZuIU%=u CC )fKfMu VEfUfVCC {wC {vCC8C vC { wC MS"C8tSfMUCtPVW_M C C Uf%=fMu@uƂCEC1҈EK EEMB~مuVffFfC}tEPSVWrUҍe[^_UWVSSS}G0Ef}w4fEfEu Vff^À0tfσ}fE@u Vff^"8t fM}uVffF@tfMAtPPVuQftC}u Vff^%=t=f}tf}u-f#f=uhVu Ee[^_UWVS}_4w0SVbZYtMSVW^U2Ph`L2jSVp ;`U2кuW: f_t SV1ҍe[^_US]ۋM uQA<%u ufff=tf=u1[UWVSSEx0p4Pjh@VWu jh@@VWU$PhA@VWjhC@VWEfE@U :sZ]CPEPVWEHPE@PVW EPEPVWz]fE@E:rhEPVWSUHPE@PVW6U PEPVWEfE@U8EwR]SEPVWE@SPVWE SPVWEfE@U8Eve[^_US]SVX]]UWVSP]{0s4jjHVWoPjIVW^ jjXVWPjZVW@ PjOVW(PjPVW PjdVWjj0VW jj@VWtjj6VW jjKVWjjhVW jjLVW@EjSVW,E}ve[^_UVSu] uSffCuSVrXZuSCh` 3hsSVhbSVuSCuS C h2Xu SffCSVh2] u e[^U}E uP@fЍBf@v&Bfwf!Ƀခ BfɃUVuSM ]uQAӃ*tt uQA[^US]ۋM uQ1AuQffAt1[UVuS] uSCu S  ChbSVhsSVuSffCu1e[^U}E uP@UWV}uSȋ] uSffCă9uJuSffCĉ u SffKuSffCă[^_UWVSju }VW] uV ^ jVWBe[^_UWVSQQ] S}EWEuE,YZtPEPSWSWE:Ee[^_UWVS j] }SEMWEME uSs1ɉи9tA~u SEMKEMeuSC;Eu7jSWK u S EMK MuS C 9tEjSW uSKjSWEe[^_UWVSSS] SuVEj1ZYuS E7j6SVjAj6SVE SV1ZYujd.XG~EPj6SVUe[^_US]ۋM uQffAtuQA t1[UWVSVEu] EjSV u SfEfCE] ue[^_UVuSM] u ȍS f ȃfC uSffCtf[^UWVSWE]E%} uPWu3 t f%‰EE]} Ee[^_3US]UۋM uQ ffQ uQffA[UWVuUSы] }u S ffS u Sff{[^_UVuUSM uQ ffQ u QffYuQffA[ ^UWVuUS}] u S ffS u Sff{u Sff{[^_UW}VUSu] ЋMuS ffS ~u SffKNu[^_UWVU}Su M}uV ffV 19} }fZIuVffF9|[^_UW}VUSM] uuS ffS ~u SffSfNu[^_UWVU}S} uW ffW 1;u]}?}fuWffGjThRЃ}XNfC[uWffG;M|e[^_UWV11;uS]}#Pu uGǃ ;E|ݍe[^_UWVSPPh@|] }SWEI @|fEu S ffC @|u SUffCUj a*Xu S ffC @|uSffCf=UuEPh@|SWEEe[^_UWVSEx0X41U2PFPSWF6~uUPjRSWEPjUSW$jHUR3 1҅Pj8SWj@jM؈ʸEUψEEM8Mf]̊]saEPVWf@ fEujuhJ2EE!ẼjPVWEЊEу8ErPjZVUBWU M΋EtPfEf@PVW"UϋM : s)jKVW]!PjKVWiVhO.1iSe[^_UWVS]C0ptS4VRPlfDžhfDžj= f;EfDžjtHtt!U2 V2 trV2 tftUu᷃pul1 l@pu l lBtu)PlpfDu GNyۍtPlp2 fzfugfPf~EffbEu|af^EufRf\UfZfEuefMxUfXfVufRff*fRffEffEffǃPfffefbfaf^f\ffZfXffVfg<wvfǃ11Ʉu fu f!uffh uffhhtf BfhAvfwfwfuEEe?weweuE?EE8EvEEgt=ƃEt$ }t usƃ @dE1҃t  t0t 1fjEttttʀfjje[^_UWVSEx0X41fEu SD @fD @fCuSffCfDMA'~ϋUt|HttHf}UfEf ffv fu?fHu;u S 9fC ;u SzffCzuSffCu SffCu SffEfSfUu SffCu SffEfSfUu SffCu SffEfSfUƅ|DžpfDžnu Sf fnfSpuSCD)|Ffnp|vuPSWfE f}PEPSWG fEf}Zu S8ffC8uSffCUfu S:ffC:uSffCuftWu S"ffC"uSffCu S"ffC"u Sf fCUt+HttNu S C u Sf@f fC@fCu S C u Sf@f fC@fCu uWu S"ffC"uSffCu S"ffC"u Sf fCuS SC SEu^u SffCUfuSffCu SffCufuSffCUt/&61ƅ|DžtUtt|| ƀ|uu S|uu SfC| u+u SffCu Sffs10|u'u SffCu Sffs|t|u SffCUfu SffCufuSffCu SffCUfuSffCu SffCufuSffCu SffCUfuSffCu SffCufuSffCu SffCUufSf P$f ff P$fCut Ht Bt&;EPSW"EPSW EPSW fE f}EOu SffCUuSffCuFH7v@XZQ FH7F@+P A u S`ffC`Uu Sf@ff@fCu SbffCbuu Sf@f@fCEuu S@@Cuɉ Q FH7F@+P A u SdffCdUu Sf@ff@fCu SfffCfuu Sf@f@fCEfǀuSCu S(ffC(uSffCu S*ffs*u S @ffC @Uf}Uu SffCu SEfUfSu SffCu SfEffUfSu SffCu SEfUfSƅ|ufDžzu Sf fzfSuSC|AfzF|vu+ HZtfEEe[^_UEWV<Su] 1uS8@C8@j XuS8C8 uxuS81C8j XuS8C8 uJG~uS8C8j ]YuS8C8@uuS81C81ҍe[^_UWVS,EE} t0Ht itEb k2Ћk2ЉMf k2ЉUE @2Ћ2f 2ЉEUE@ ܘ2С2ЉMEf 2E}u W1ffGɻ19ˉM Uk 2t/hs s H% =t=D3u1҉Ћ]UWVSj}Ew w u fhEPjPPjSjWef0th`2@Ku*dždždž%dž/dždždždžЃGEPW/[Zt.hb2%@uEuuuuw vÍFPVh|j@uuuuw 董8F0u=hy2?Yt Sh3?XZhn 1?uDShA/y?j,w w 苠=@2ø@2t9E8u}G$f=u#=t =`t Eԛ2Eܛ2Ѓ}uff 2fҸ 2t9f9t fft)f9uf8tSPh2j hxU?Sh0j hxUj?EܠxUhw w 趟 =2t=2t2WYtk 2t h2;FPSuh2:>V8t)v0w >F0ue[^_ÐUEx+P(uu Ht1҉UWVS]C hM1Ћ} E=XVs u t'~(u h2hjjG0PG4PjjVSc$tGPh 2R=CG8CEPS&[^thd2auuuuu蔠ÍGPWh#j@uuuuu诠8G|F-h=|5=~$-`w$dždž džuffv=u džjUREP}W]SjjPu`$tCjUREPWSjjPu`$t h?2EEE؉E܉UBjEPEPEPEPjjjR`$t h2BjEPEPEPEPjjjuE_$t hQ2 EEEE t Eԅ}عu 1}UuuzfdždžP$džT $džX$dž\$dž`$džd?$Eԅ}عu 1}Uut hg2fdž@džPF$džTK$džXR$dž\W$dž`\$džd$ }Uu ǂ]ԅۋUu =t uh@2m}؁۹u 1}Uu 4 B4B4}Uu,B,}Uu 1Ƃ}Uu 1Ƃ}U؋Eu }Uu Ƃ}Uu B jThRп,Ou!ۋUu Ph~2ejThRЋ]ԅYUu uۋUu ۈUu 1ƂtPh27XZ}Uu 1 ǂ}Uu 1 ǂ}Uu  ǂ }Uu 1 ǂ}Uu Ƃ}Uu B jThRпO1jThRЋMԅXUu U uJ&uP @ UEuP@UEuP@ÐUVSu@21ɋV$f9u C9t Av1҃t/j,v v 臑1ɸ2Ѓ ;t A v1҃ te[^UuZUWVS$}G Wu EeEEEXSw w  t}u&!Ѓt]}u!Ѓt]ԃ~}t4jEPjF4PF0PjjuW4U$t EE}t+jEPjF4PF0PjjuWT$tE}u}uFPh2'/GF8EPW ZYthb2auuuuuzÍFPVhj@uuuuu蕒8FDu6hy2._t Sh3.Y[hn 1.uv4v0N*Ur Sh2~.U܋BBPVe[^_US]S8z tjCǃT@xRƃjjjhb ‰X31~$wuGǃTxRƃj jjh ‰X{31fǃ`~$w@uGǃTxRƃjjjhˊ ‰X+31fǃ`~$wuGǃTxRƃj jjh{ ‰X31fǃ`~$wuGǃTxRƃj jjh+ ‰X31fǃ`~$wuGǃTxRƃj jjhۉ ‰X;f1fǃ`~$w!uGǃTyRƃjjjh$苉 ‰X 1fǃ~$w"uWǃT@yRƃj jjh$; ‰X1׹ fǃjv v  F$=w#t=w#t =wcǃTyRЁ~$w#u ƃj0!ƃj@Vq Јqjjh$蜈 ‰Xuh02v%1׹ fǃ@jv v n fr frFEȈkjv v 9j 0u࿀/vq PPjv v vj v v f1 @Pj v v S,j0v v օPj0v v 2EPV薇$thJ2$Uuuuuv uؠ2ЍCPSh$j@uuuuv $uWh@2,$WhO.$_jXtǃ,ǃ0@C @trrj@6‹@^HuR,Y+ SHZu?jTtjhjSP S_tCS^Bwǃ觾YjXSZtBS茧B_wǃM^jX複ZY*BwǃXe[^_UWVS]jEu T f  f4u T f  ff9tE1}fuEu T f  f4u T f  ff9tE1}kfuNf u T ffD fEf u T ffD fEEPEPh2hSjEtUffEfUu 1fE fUEffjurEu f f4u f ff9tE1}:띋Uf2+fu Ѝ ffUfe[^_UWVSMu }f u T ffD t>f u T\Sh2hQ蒬fxfZ؃?HwO$L2ffff1Ef$ff ff!ffEf1e[^_UWVS ] %1=@uuZEf u TffD}f uTf ЉfD Eu"% F  ffE% F f fM@u$}f u Tff|E [^_UWVSQQE] fE%1=@uuZUf u TffD}f uTf ЉfD u"% F  fEf% F fUf@u'f u Tff|XZ[^_UWVSWWE %1=@ut=AueEf u Tff|E t}f u TRf\[=uTf u Tff|f uTf ЉfD Eu"E % F E  fE % F U fft$}f u Tff|[^[^_UWVSQQEfEE %1=@ut=AufUf u TffDE t}f u TSf\\=uUf u TffDf uTf ЉfD u$E % F E  fEf!E % U F fUft'f u Tff|XZ[^_UWVS]hjjPE } ‰uh2G1׋MhjjP| u)j~ǃh#2jS蔦1fhtwEEPjjhjhVVuEGh9|9h?2jS8h 9}OG4VVYOXy0jEPjURjhh@VV$ jRh@u}WPP,Pjjh@jh@VVjjh@VV ^@ jEPjWjhhVV$ +jPhuWVV,  PjjhjhVVjjh PP  @ jXEjPjURjhhVV$ uuj$PhuEPVV,uU$PjjhjhVVu3jjh$$VV u$@ $1jhV2jS1 fht4VVGXh9Z|j{j{ǃǃe[^_UWVSdEfEUMff fM؉EM}WTU] K$u fG} G t @Ej]fC t оK$fC  Ћ}fG E x M UQRjq$q uPP t] eC,}}WE p @ tp2x2PU r$h2j@uzMEfA]9]9u}UM]jfBT$Yt}T,W}D MD(}T$MW}D MD E}t$t UBPh2j@uС]MfA@fA]9]} 9Y}9}]fUE@f%fMf9fUfE}G1}E19EEE}SUMD$DD Dt$t }GPGHPh2j@ufGEEF9E}~SURu؊ 1ҋDռDDD B~MME@EUËx tjj@SPP M9M]z t!} 1G D@PEpjPRR Ut.HtF8uuu "uuuMA]CACA C fA fC fA fC fAfCfA fC1ҋ}DMD B+~hɡ2ju謟]uPP} fG,uuuhUBMABAB A fB fA fB fA fBfAfBfAfB fA1ҋ]D}D:B~C$G$1ҋMD(]D(D,D,B~fE}fge[^_USPP]ETPEPEPSu1.ǃEPEPEPSCǃ]UVSuU\z t(E @ tPsjSR SPPe[^USh]h@`S + u!jTtjhjSP ]UE S]tPh2jS譝jq Ph2jS膝]UVS]u SVuZFCFCF C fF fC fF fC fFfCfF fC1ҊDDB ~1ҋD D D$D$B~e[^ÐUf=2VSu2tV$f9u C9‰t f;u1[^UuZUWVS}Wu E[u h2SG G GDdž$jw w 4 t1u$jjjEPEPjRjW4$u h2E܉<E@j0w w 1pPj0w w pEPWq$t h٢2uuuuw [rÍFPVh j@uuuuw vr8u#h 2Yt Sh3XZhn 1.ۉu[0PhO.jVV&t h@2M+V XE@tV_jVY[uV+e[^_UWVSEPEPEPu 1n;=W4;~WhW4DÅXZtsC tl8yRud9uVEPEPEP ,nE9Eu.E9Eu&~0tCPh2V$  G;=W4de[^_USj] ?nj &nj  n$j m j m$j m$(j m,j0 m0j< qm$4jD Um8]US]j mj ~m j bm j Im $j -m(j m ,j l0j0 l 4j< l8jD l]ÐUVS]jPfƁ djSP VXue[^GUMS@u* @&4Ѓ әPPPe]UWVSjj}[X1jv(SsjFPSdFf@ F@F@F@FF   8G<u 8G<u VWRZYtPXe[^_UWVSE uE҉U:t t~8N<u 1 t5~8N<u U]~8N<fCu   @F8tdUN<fBZ u  Í Éj2ThRЋU~8[N<fBZu  Í$ É#UN<fBu ]~8N<fCu  HU~8N<Zu1Át$%;M AVCY~8N<u    j ThRЋ]~8ZN<C u   U~8N<Zu1Át$%;M AVPBX]~8N<CuE~8N<X u  M@Q Aҍ0lEtej ThRЊSX~8N<UURU[uEEMMUB9|MAAEy0lRj ThRЊSX~8N<UURU[uEEMMUB9|Etbj ThRЋ]XC]~8[N<]u Ml]l EEUB9E|MAEytbj ThRЋ][X~8N<]]Cu Ml]l EEUB9E|t]~8N<u ~8N<u 1 ~8N<u 1 tE ue[^_$uPjPV ŠM ΃ t}v RjPV%!e[^_UWVS]u u  f9tI tuu %ǃ ǃtSY_X9 tS>^]e[^_@UUtt% t %UWVSSu1ۺ%=udž HjPVjPV à tUjPV!؃ ;t5PVf ZYt VdžuuACE~8N<[u  EE !9/u3xud~8N<u  u t7t(Ou dž ~ %1ҍe[^_UWVS]u u(u$S)Zr su9u0CPRǃ;]e[^_;f  %k ģ2Ёǃǃ tP1tǃǃǃ  ǃǃu tuǃ  u#ǃǃ  ǃ PS6 YXwt,iwa @ ǃ? ǃt QSXZ]e[^_u ` H u?@uf ǃǃ  tu ux tǃǃS"9 S8߃ S _wP$2S99 ^t:[xu-{8S<uu5M ]e[^_]e[^_fǃe[^_US]tU{8S<u ʀ j ThRЃ{8XS<u@u>u+{8S<u jSP PSY[]UM U ǂwlǂfǂfǂfǂǂfǂfǂfǂtufǂfǂ fǂfǂu1ǂfǂA0fǂfǂ UjuUSj]SjSǃ]UUSفuRT]USj]SYjS.ǃ]USj]S]UMǁf@f@?f@@f@ f@"=f@$@8f@< f@>=f@@@Tf@X f@Z=f@\UEǀ UEǀ EUWVSu ]u0CPǃ]e[^_4uZf{8C<u ǃǃ ǃ jtS{8C<u C<u u&v@t ǃ  E x uK~ 1ǃ, PSu߅tU ]e[^_Y u!ytǃ,SlYr>y$ǃ,!fufǃ:1ǃ, PSXZ]e[^_e[^_UWVSSjuEPVjPV ؃1ۃ(jPVjPV ٿ2Ѓ1ۅȃ9t fG ft+PPVw_ f#C f;Cu EpfGft)PPVC_f#C f;CuE}u8fGft)PPV _f#C f;CuE}t/fGft&PPV_f#C f;CuEE`2Ѝe[^_UWVS}] jVW t=t=vۉt6KFvՅۺ u&jjW\ t=t 1=w e[^_UE U@t ǂ Rfy ǂ  A t ǂ 0t ǂ t ǂ 1ǂǂUWVSVE uEtOrhjuV dž džjuV> fy+fdž juVjuV ÃjuV 9tRjuV_WjuVJjuVdždž juV{juVn ǃ u.~ue[^_dž7juV(juV !WV u e[^_UWVS]1t tb t]uAtu%3 G!Ju{8C<u1F $2Ё@@ǃd ǃtuA 3 ǃtu  {8C<u [^_UUU EMEBEB UVS]{8ƃƃ S<u ¸{8S<u ¸  {8S<u    {8S<u % %h@BThRЃ{8XS<Nu@t ǃ ǃh@j jVSh@j jVS(hj jVShj jVSe[^UVS]{8ƃƃ S<u ¸{8S<u ¸  {8S<u    {8S<u % %h@BThRЃ{8XS<u u ǃh@hjVSh@h jVS(h@h jVSkhhmjVSU(hhmjVSEfFfF?UfFfF=fFE@tEM9ME}t CEC9EEx 1 CH?C?En$$2Ѓ?1=2t9Ĥ2t G<2u 2Ѕ4UCF ;Mv u F MSCЃqf҉UFy FMF}y1FECC*EVl҈FӊC*ElVFM҉Ӄy8I<u    1~tTj ThRЍWXEx8UȋH<FuE lEl }F9rFM1~tTj ThRЍWXEx8UȋH<FuE lEl }F9r~u)~u#Mσy8ICfSfVCfSfVCfSƒfVwHtZt t(}fF fFfF{EfF fFfFXUfFfF?fF+MfFfF=fFCSV CSVECC*EVl҈FSC*ElF}V8l19׍SEsnj ThRЍXEx8Ủ}ȋH<RUNjU̍RUuEEMM̋}F9rF}F8lE1~tnj ThRЍXEx8Ủ}ȋH<RUNjU̍RUuEEMM̋}F9r~u'~u!}8O<u1F h'ThRuu/ OFt< t<  UCf fNCffV CffV CffVCffV}u@t NEuF t NUuf~y NMuF t N}uF t NjFPujFPu É^1=2t9Ĥ2t G<2u<2ЅECSVCSV CSEqFf}yF1UF ЈFMF}y1Fxu }EE9E]S+u<iҷm۶e[^_UWVS]ƃuq{8S<u ¸E1F{8S<uy'~܋U䈄lBUvǃ (2u ǃ d2 ǃ 2S-j~lP%5 у 9u hfuAEM䀼 lu AMv}u;~u2t)vǃ 2tHSJZt=t ǃ 2Ѐv  Ml|8EteEE䀼l@Evllj(PlP qU䊄ltu E}v}&SJ yRЋ< %$= t1Jyޅ99  j\P\P  8u0hlPlPS$j(P(PC*G- $$$s28¹O{E슃zE튃yExEwEvEuEtEl}8¹j(PlP( v*vv,vr9ui`SM@2XF=@2Et6E}(D2tEEE<@2uс 1ɍe[^_UWVSu11ۃtjj42ЍFLPGC v؅u@jjj"^LSj"^Lujjj Sj S#42SVwe[^_UESCPǃǃt81҃t&;2u%RSB vʁ_SS1]UEU t'BtB2ЉBUWVS]⹉ @f4ǃHN%RE쀻y@@@10󫋓0҉UtVJM}uuju# } XEZEtPU@jh4 ¾E <_Xt8j(P ƒM Y^6@(}쉇*,@UE0ɉMt]y}EuljvUMBB}M}tGEE}uUE}U3(M*,E}M~@t fe[^_UWVS]ǁu xtSPX{8SXf@ft @*%߉ȃ࿀@t  ? !uSXf{8C<u {8C<u !Hu"]]q f]]]UWVS(EEUhE܉UEM܋Y11Ƀ}EEt}HE܋P 9%=uEU@҉Ut-B}@u LJDE@UHUu)};_u9EЋt׋E@Et-@}@u LJDE@UH}U~PB }@t)@@u LJD@EHMЃ}C%EЋ}umf;xg)ȉB E̋p}Mt-9uur ű}Y^EmUBh@t M}GdE;XuU܅Zu}uujjQÅXZtjS2RYC_u SB1Zt'M̃Ai }ЉyE؉AQEPu ۉ]uEUjM܋Q B% BŰB ϋ}%O ‰QG G ;GG uG M̋A}Du@M̉HE̋}DH@҉HUUe[^_UWVS ]EEE‹@9B9EP)B @t @!S{8YC<|u {8C<u {8C<u * "(2tBG(u ǃ,G0tWXZW9@X t$t RSP _XEfy\tlth tp@tttx@tK|CxuXv\td򄓨y`UB;BBuBE@E u fUB9BUB9Bt u}~EEe[^_UUWVS]} g{8S<|u‰4 tI Јt #t. z t1PSR XZSXK8ɋS<uy tutlɋS<uʃK8ɋS<|utɋS<|u ¸S^Yt(%{8S<uf# tB%=t@fy t QSXZ{8S<u(@ tS Xu ChPFX{8S<|u4rtS8^]e[^_e[^_USP]EtEPS$YXuE]UPEPuEEUVSjjuJYXtC~v jS*KXCZuV;S;1"svjV{?FC CVu;؍e[^UWVS,]ShM EU؉MEEE@ U EUEMIƉME܋@ E̋U܋z%)ƒ}DM9ʉUvME}~j}E؋t*BM؅u ǁBE;U<u EE Y6CEtiMuSEZuEMU;JuEEȋN%?U  ω% ЉFN7 ω% ЉF UȋF % ЉFM)Mσ}EE܋E}uL uCM؋t'Bu ǁBE;Ut h2űU B,u(M HE ,0UE EtF%F FF%? ЉFEH A %? ЉAUB {8C1ۍxG8VjjhjhPPC~1ۍx W8PjjhjhRRtPSGPh/a1ۃ}DŽt C~WPX@=0$t=!&u LJx`2LJ2LJ2]0LJxp2йG4uP@0G4uP@t LJ2 LJ2LJ2LJ|LJLJjPEP苢jG`Pw_UWVSEE@P%@@UMɉM1tE@EC8hQus8Ptkjj-ƅXZ0UzvjVN.YF_tfvMqjQ"UBF FC8hVus8P HM9A~)EfHPC8Qs8PXZV]XU҉Ut-BMu ǁE@Ut uuXC8x tjMqjQs8P E胻Pup19։tыEtD AMD$t؃%;t F}EG;p|j19։}bEtD t@MD$t؃%;t F}EG;p|uEtHEtHtHM苓A4~1K8y t )jPRps8Q 1ҋK8y tjPRps8Q 1Ƀ{0HC4uP@{0C4uP@HMU BEB U苃+B@MA8vuP*_Xft u EfHPU9t MfANe[^_UVSuSYt&CPh 2FpVE ue[^UWVSQQEjP] E12u}S j@vpvlM fxFPhL2_ juSu 5tvh%ЍEPEPjSu JtASZtM!Pj@vpvltSV`XujuSu EEE;F8e[^_UWVSE@Ej@pppl]EUJ!E,R EE:fCt.>t%SA9vЈEECAtESU@ȈEzR8zRuzR8zRƃ@E>St8AʈUЈEzR8zRuzR8zRtQCEG@w CEE/<wƃ@EU9vȈEEC@1C1u)G<IvUMAvPjUBPjD) PjEP E 11ED3t!P ED3Xt M EGE<<vȃ}t)UMz|QM䋁u TEMLuj@Epppldu[e[^_UWVS EE܋xpj@wpwlŽjDwpwl趽EjHwpwl覽$EjTwpwl蓽EeE U!]!E fEJ EuE]X,E؍ p !UfS¨fUk0$t`!$tXJ$tPK$tH$t@$t8$t0$t($t %to&tS&t'uMvH$t@$t8$t0$t($t %to&tS&t'u^{vE؍ pEuCSv U؍ rE؍ p!Ev  E !E䋇8$uD{v.U؍ rEuC{vE؍ p EU؍ r!EM܋A@0t;E t5fefEfCU؍ r ECzR EGfc߃}SuPjP PjP@ E@ E M ES& E}XSuPjP PjP E@ E E؁<}Q}t|u TEUTuj@wpwl躺ujDwpwl誺 ujHwpwl藺ujTwpwl臺M܉M e[^_qe[^_U} EMtzR zRzR zR UWVSSS]C8@E1C;t{Cu 1CEeMeKzR8zRЋuuzR8zRtC{wM EQ[vG} ƀvѸ ƈѸ ƉZY[^_U} VSEMt$ɍ4ЍFzRzR"ɍ4ЍFzRzRЉ É[^UWVSE @)uu VEZYh2 Wu V ~xF0tF0Fd%F4F5=Attw =tt=itu F6 F6F6F`8%ЉF ;thjSP { CuP@j ThRЋYt#jSjSjSNjjSƃ IK ɋCuP@ɋCuP@ɋCuPxɋCuPpj@ZuufK.fK.PsEPh2W=E%tt hվ2h2,=XEn 1Ѝe[^_=usEPh2=e[^_UWVSu uV[_jjhl֟E1}[E hp p 违 PhE p p (hPThRShE p p hPThRjjEjPujjj$u ah%ЍEPEPuSu uuWSu SXG;~8|e[^_UWVS EEExPd^uE,FENuP|R H|R:vF9~AF M EVU|R M|RSUBMADPwpwl{SUBMAEPwpwl[ E<}B}t#E|Hu TEED}~3jAwpwlݱUJ!ƒ RjAwpwluEE|[HuTDDe[^_UWVS}_s|Wu ЅɋWuTD WuЈ [^_UWVSujAEvpvlEE1 ;F8EME䃸umEua~|u MTDtWFPhͿ2& t(u`zZuWFPh2z& EGEE;~8rEe[^_UWVS E @)uu VEZYh2&u V ~xF0tF0Fd%ЍFF6U BEt EtPFPh2F8*F8BwF6u}°(ЈF61F89EPH~1u܉}vpvlP uFPhL2@ vuWVa te ?EUEth%PRSu ¨PRuSu C CCC SlSXZEGF89@u Evtt tuojQvpvlk% PjQvpvl聥jUvpvlH% PjUvpvl^ jZvpvl"% PjZvpvl8Bv u0}u*j[vpvl Pj[vpvle[^_UWVS}wjZvpvl蚤EW Ew sIt ptTiCwE{RE{REܸ{R_tEh{REx{RE܄{RCE{RE{RE{R,E |RE |RE,|RFPh2^XE_,CUGB@PvpvlzfCЃ t+fC+OEt {vCCM(Kt2vC9~ACCM M E MRGUB@PvpvlzE<}*}t ~|Wu TEML}e[^_gUWVSuEE1;F8EE~|u MTUD؉؃uGWElZu5uFPh2] ~|u MTU\EEEEM;N8rEe[^_UESHy|Xu TE U Ty|uTD[UWVSu=hMt==hbt6=iMt/=ibt(=ut!=uRt=urtjPvpvlxE u V[_ =hMt.=hbt'=iMt =ibt=ut=uRt =urteE =hMt0=hbt)=iMt"=ibt=ut=uRt =urt}yEh2u V蝥F0 =3Mt=8Mt=0 t=0MuN0~xtN0Fd%F4F5=iMt=ibt=ut=uRt=uruF6d=0 t8=0Mt1=hMt*=hbt#=iMt=ibt=ut=uRt=uruF6=8Mt=0 t=0MuF6F6=hMt/=hbt(=iMt!=ibt=ut=uRt =urx%u}%ЍV`F{RЃ E1;F8}:1 @PG`Pvpvl8vSGdPvpvl(vEM ;N8|ȋ=8Mt=0 t =0Mu ~|uZN|ɋuB؋u ؃؃BN|ɋuB؋u ؃؃BE1;N8,uuV =hMtq=hbtj=iMtc=ibt\=utU=uRtN=urtG=8Mt=0 t=0MuMEuFPhL2. zuuSu 菪[=0 t8=0Mt1=hMt*=hbt#=iMt=ibt=ut=uRt=uruh%hB%ЍEPEPuSu QuuuSu g=hMtz=hbts=iMtl=ibte=ut^=uRtW=urtPSq_tE=8Mt=0 t=0MuuuMSu !E٩=hMt*=hbt#=iMt=ibt=ut=uRt=uruSwSjYEE;F8=hMt==hbt6=iMt/=ibt(=ut!=uRt=urtujPvpvlre[^_UWVS]C{ES蜢E=8MZt=0 t =0M\|uP@jPwpwlqM t8C. t{2wj t#nv{2vC2nvƃnfC. t{2vj t#nw{2vC2nvƃn t{2wj tnvM M!ƃ|uPPS.u jtM tj0tj t 0u1@|u uT UL Es,fV¨ t,fVFA{RG{RЃ  M't2F;{R>{RЃ  ‰U M E ;{RЃ E>{RЃ EeVU1{RЃ6{R Ue EFtMM}vM }uM@uCMA`PwpwlpE<}}t#|u uTE UMT]e[^_ɦUWVSuFEVUj VMV脟F,11 EMfQ¨t: t'fQ Ã}tExv@t GE<~t"Ex|u MTU\ue[^_UWVSSSEEƒx|J8uPp19}d]Eèu8Mt*S`YuVEWPh2 EGEE;x8|Ee[^_UWVSQQuE11;F8EtG=hMt*=hbt#=iMt=ibt=ut=uRt=uruj SI YZtG~|u MTDt&S_ZuWFPh2 EGE;~8HEe[^_UWVSWWME ʉEiЋuM썼G N|ɋuZɋuM ÃM ÈZG@G t  ~|u MT MD EMEM u[^[^_鱟UWVSQQEE} EEUiutfN|ɋuZɋu ?!à ?!ÈZ~|u T 1D EEEE} uXZ[^_6UWVS0jjhXuTmÉ1VEPu !mthJ2luuuuE p mEԍFPVh%j@uuuuU r m8Ftu/h2 }Ytuh3 XZhn 1 EjEPjPF|Pjjj u -/$Fxu h@2f EU BjjjCPSjjjR.$t.h-20 uv|ܛvtE p -mhK2 F0FdC%F4F5F6F`e%ЉF<;XSu l3Bl3;SuHBHtF8vDFH %FL%FPR%E9EE]E8FtU܉LJWwjjj9k uu܍FPh2ỦB4BЃ8Pjus36tu܍FPh2EEEkEE؍D P1}D@Pus3tu܍FPh2 E؃E}~ŰBG GB GG P{RЃKVu [^UWVSVu }iE: E|ukTTL@ kTTL@ |ukTT22ЃM 22 U]U ZB2Ѓ2Ѓ ‹MEt:fCEU B ECS9‰~Ǹ M E 1CC CGC{v M EE<EE}uj@vpvlXSujPvpvlHS u1}TPvpvl&S}t#~|u MTE UMTEEe[^_UMQ$fu 1@0ty+Q(u t1UWVS ]s hn 1Ћ} js VRuGPh2>Eԧ{1ЋE؋CE܋CE‰uEC,EC0jh &ЉEEPW苼e[^_UE t Phr2XZEph2.tÐUEE 2EEyUWVSuF&} f@jv v FQ f@ujv v )Q tfSjv v yQjv v PÃMDHt!jQjPRjjjV_$t0h3jQjPRjjjV>$th2EPVmR[ZthJ2^uuuuv RÍGPWhyjPuuuuv R8u@t;W2u uu uuZ4Yu3E@P@tW\X1V(Puu6$Ãuje[^_UVSuCFpPhČ/S-SStue[^ue[^UWVu~4SfGN|t hPYfgPu ff fBfBu ff fBfBu 1ffBu1Bu1B$tjP2ǃ$XZ,t)t WPPYX WPPǃ,XZ9~1 tPQǃ X,t*~ WPPYX WPPǃ,XZ 9~1e[^_U7UMTE PuffBTPu T D UMTE PuffBTPu T ffD UMTE PuffBTPu T D UMTE PuffBTPu T E ML UMTE PuffBTPuT Ef MfL US]TE MPuffBTPu T L [UVS]TM Pu ffJTPu ȃT ȃD EPu T D [^UWVS]TM Pu ffJTEЅPu ȃT ȃD !Pu T D [^_UVS]TM Pu ffJTPu ȃT f ȃfD EPu T ffD [^UWVS]TM Pu ffJTEDžPu ȃT f ȃfD !Pu T ffD [^_UWVSj juV}  t jjV jjVf jThRj@jVjThRj@jV? uj jV.j@jVjV j@jV e[^_UWVSjj]Sj@jStjjSj$j jS]jjSj@jS$hS 1^Zu SZYtjS]Y^PCPh@2j jShjjS^j@jS$j jSjjSj jS3$j@jS&j@jSjjS$j jSjjSj@jS$hSE^Zt&jSZYPCPh2j jS j@jS-jThRjSbt j@jSxjThRЃuj jS_jjSUj@jS$j jSjjSj jS*$j@jSE1e[^_UWVSQu119}E}(EP;PuЃ uEM  C9|1e[^_UVSjjuV jjV*jjVKye[^UWVMISۋu} t;jjV\ t jjV jjV? jjV uōe[^_UWVS h]} .aSEEGGfGjSƒUthjS jjSPjPS1jGPS$$jGPSjGPSjjS~$jjSqjjSjjS]$jS)jjƒSU}t!jjS#jjSNy6jjS }ujSZYtf wjjSt ujjScjjS}thjSC u_1}[e[^_UWVSS]Su h_EFFjS8!thjSH jjSjPSjFPS$jFPSjFPSjFPSw$jFPSgjjSpjjS$jjS thjSE u^e[^1_UPPE EEEEEPuEPEUPPE EEEEEEfEEPuUU%=u jjR jjR UWVS] ރ}u jjCWx uHjjCW ujjCWjjWAjjCW5jjWe[^_UUJB2 2B B2B ȉ 1Љ11ȃ?UWVkES} p1;PPuC ~e[^_UWVSjj(u}Ejj,4u6fgPtP1ɅtAtRtfOP11Sj(uVj,ue[^_UVSu1hLjSVC~hjjVVjjV fxhThRЍe[^UVSuTPù̀TPu1j0VCSXZv1jjVC vhjV7 } tuuhjV hjV{ uth jV TۋPu ۋPu   TPu @@ jjVhjVhThRЍe[^UWV}Spl1@ʃ?u ǁ F X?~эǁǁƇt[^1_UWVS El}pƉEEEESu7YZ7tj}uLJEǀ0$C C ω% ЉFE E}~1ҍe[^_UVSjju QÅXZ7tkjSRYCXu SB7N^Ff@C % ‰Q @f@01e[^UWVSE4EEU`M`@@EC`su@SQE7ZYu$E@hf@f@0@Ud % ‰MdXduFϋUVu u?AX.EUP PMA8t uP^_uuY[u`Ee[^_UWVSS] uSVZTTYpPUu  ETP`u# ρ% Љ ρ% ‰Qe[^_UWVSu1htGh@@t9Chs?CpCpG8Zt hue[^_UVS]C4u f@NhTƃtPu   1TPhu# ρ% Љ ρ% ‰QTPu% Pu1f`Pǃlƃt[^U} S]t*TPKuBPQh2[ jSSS SmTPu1]UVSj]SfVjS4VSh2e[^UWVSPuT1Pu ffB ɍ^4Pȉ]u ffB ȃˉw$2ЃTPu1SVqSVUVSVRFPh21YX3t SVSVSVX뵍FPh2XZt&TPu ]tSDYe[^_UWVS4huSEЍ}1󫃾TX~4]ԋPMu P0ff@0]̃TˋPIuP @ Ủ]ȃTˋPIuP @ Uȉ]ăTˋPIuP @ Uĉ]TˋPuP @ UTًPuP @ ]ԉ%GlUEGtM؉%GdEUGh_pt7jCVzÃYP_t#hjCVCPjCV 5&4Ѝ PtXuZu xP谘Xu}Re[^_UWVSPu1EC t: t@EE C % ‰T E C DGujjIY_~v jS!JXCZuS:svjVr>FC CVo:CU % ‰Q C EމA}AU +MKEl@ ρ% ‰S MGE pU  UfPU f@01e[^_UWVSQQ}Ep1Eu fOPlBu LJBpFpFRVS }t%Ur ρ% ‰uG8t vPhXZp`hE쀻thlƃtTPu %  % ȉBTɋPu% ɋPulUPlfGN e[^_UWVSP]h!OESohjCSjjCSo j"jESs4{ FQt jjSL jjS FPt jjS jjS! hjFSxjPS&SVS 7u)CPh/SEE e[^_nNS;T_PuTPu   TPlu %  % ȉBuuxP豓VsT^P 8u  uMSh G&Vo5&4VoShW&Wo&4Ѓ$PWoe[^_UEutPXZ xP X1UWVSE} 0G uxt;jCVZYD#GjCVo[^Gt  GSC0GC,GYe[^_UWVSPPEh} mLuWS4RuEU[2i w!1i  i t*i tY-5i 6i(EfHPUxuSuu SUfBPtS@@ueu jjS %@@uetjjSZS@S8 @tSXUBP1d_u uu uu0^4_ub&jPuuuuW}8, u(h@2蠤Yt Sh3萤XZhn 1脤4ShO.w_=UXuVhW&jhu4@Vq[e[^_US] uP1@ u P @  u P@SoYu` uP1@ u P @  u P@1҉Ћ]UVS] uhThRЃ Xu11 u@B@1҃ t6hFThRЁoX~̃ uC #4PhB2͢e[^UWVS] ɋu ERUɋu E EB ɋu ER Uɋu E  EB 1 u@B@ t!j2GThRЁ'YvhR2 u BEPEPhp2o tPh`2財oMMv2й}t h~2M胻 Au,B, u 0B0SZt h2}1E;p s)uuVWSxFM;q x r׃ u 0B01 u@B@tj2GThRЁ'Xvh2蠠XT u EMJ u EMJ ju1h2M1 jue[^_UVS1] uP@uj2FThRЁ'Xvh2E u P@ uP@@@1҃t h2諟e[^UWVS$] Dž1ҋu}M+E9rWh2(9rWh 2jEPRVtWh233u܍C P2fDžDžDžERPfDž6 fSf9t%PPWh 2躞Džz tjEpjPRR  u,B, fCu (B( Cu$B$ ]u Z EuB u 0B0VZtWFPh`2Dž z tjEpjPRR EPVe[^_UWVS]1 u P @ x tj j,j PP  uPH uPH 9t P PS 9t$ P PS VF9uSYt t*x 9p t@ Pd PS t* 9 t\ P| PSW uPHx tj j,j PP  K0u P @ QUe[^_UWVSE0EEU B8BӉ1kEE 9Ez tjjkEPEp RR @t#C PEPh"2#UBh jEPCPE y tjUBpjPQQ EEpRREEpRRE0jPfCF FUB8t VP9XZC tM C tMC yM@ C tM C @t MC tMEF Vul^XEz tjjkEPEp RR  uEU 1EU B9n] Ce[^_UWVSE0EUUBErFu1U ;ujjjt ÉEjj,E[8Zbj0,EZ@Y=UPE@ @EEPjjhjhRRUjU2rPPEz tjjPE RR jGPEP藞E@1ҋ@ WU y tjUBpjPQQ Ez tjjPE RR FUBu E1 ;u!EpRR[^E0Yjue[^_UWVS E0EU BEZ BE:U;]썴,}Ez tjjPEp RR HuTEz tjFpjPRR UvPPZYtPPGGE@lYUCfbPuE u81ہ,M;]>U Z EBu UfBNe[^_US] u P @ jjjjjjjjS$jjjjjjjjS$jjjjjjjj]S]UWVSuF0jE썆 PjdVUth224 ׹U󫉖 jPj,VthN2軕[ 󫋆 M A j@ PhVthh2bY~H ]苆@ CD CCH d džh ,džt džl džp x 10SjjhhhPPt2190PPDŽ0CX9Z|G~j\ PhVth2_Xld U苆\ BM苆` A Ad |  dž $dž dž dž  jPh Vth2ē U苆 BXM苆 A\A`   ( z tj pjPRR j$ Ph Vth2)X, ]苆$ C ( C$C( , P z tj0 pjPRR jx PhVth2蒒_r 󫋆x UB8| MA]UUVSE0L % uwЃu1ہ0u1ہøf)؉u*f9 tjjjjjjPjVPf 1ɍe[^UWVS E0] H ECC jjj}WjjjjV$jjjWjjjjV$jjjEPjjjjV$jjjEPjjjjV$UtKEt KCy@tKtR uK]EtKNt K@}yK4@t K' Ct UB@CKce[^_UU t t9B PBPfBPfBPfBPBPPh22B PBPfBPfBPfBPBPPh2} B PBPBPfBPBPPh`2&B PBPBPfBPBPPh2]}@B PBPfBPfBPfBPBPPPh2}$UWVS]0ECQtfEfKPfECPtfEt fMEEEtMHM}ܸu܉ujuERȉ DE^E_u}~"jjjjuujj%ufM$jjjjjjEPjue[^_UWVSQQ}G0jEEPjjjjjjNWE$MAq AX AQ !Шt E새AQ !Шt AQ !Шt jjjj jjOW$Et jP XZe[^_UEE @2EE5UWVS(E@ E؋UBu džB&=V`t?w=UPt=U`t#L=Pt;rC-w9$dž+dždžo džhEp u hUr udǃ EjUr uCjEp u1EЋUju E9PXPXjP EUBP^t@uSYS Sk XZ @tSXu Xu uu\ uu艹Y4^ufE@P@t:jPt E$)S XZuS!XS(uZ _X1VPuuǃe[^_UVSu 8@uP@tfFN(PWCPh2ooffPSFpe[^UWVSW]C0ESUBP^tfǃBfǃxfǃB fǃx BHU w|= Ƀ(8|= Ƀ() ǃ 8@u jVWtSRtCPh`2^nSYt CPh 2"SS S tCPh`2nXZ]e[^_SS UfBP@fBP5&4ЍP+PS&ǃe[^_UVSujP É4$EX]e[^ UWVSQQjPuEE싆 8Z~0@u u u1z t7S+džPSUV8 5&4S*GP@tjV]"V MuGP@ttWwXuCe[^_UVSEPu T 8Z@uP@t*uCPPPY ƃufǃfǃƃFF tlFu F+Sdt t "=tF#F&F0fFu  Fe[^UVSEJ% ȃw}$2ƃfǃ/tƃfǃ bƃfǃB%=°(Ј6ƃfǃB%=CPh2jY^ǃS.1e[^UWVSlE EEEEuEf@f wVf@f Zw ULRjjh?j h?PPt LjuuPPtLuPP{Uf@J9~LR*8t }EE9M3]ET EPEt$1QR#1ۃ9ÉEUUf@9EHE4MMEQIĉHUB DMAA GB9u1ECEE ;]r`HE4ʉUED BEUD$ DMAA GB9u1EEEU;P8t f@f+Ef@Uf+Bf@EMEALz tjEpjPRR UJ ufuVr 8@uv886v*8(U8LuPP7 88 uMqV_X1e[^_UWVSWu 1f88@f]uv886v*8(jP$[^8f;E4fHC@%f;Bu1ۅt`WVZYu 8@uv88v88ÉWV_1Xf;]ne[^_UVSujPÉ4$X]e[^UU Mfu&+9|Q>Z1UE M9Љr)ЉUWVS} ;Cu8w8v880;Cu8w0v809V;Cu4wv40;Cu4wv49; Su (4(4>Fu 4 49 8@u 0404 8ƋPu >Vu؁ ؃ 8@u4w4w 8@u4w4w 8@u (4(4 8@u 4 4 8@u  8@uP@LJ1[^_UWVSu 8^0NjPu ?Wf[Put t% 8@u [^_UE 8@u 9Qu UWVS E0U1ۃuk 8f@u tEP_U 8@u hThR^҉JtfHPt,kj(PUgC ҉u~BU 8Pu 9Au %jjSPEP2jUuc 8Pu 9Au hThRЋU[tPDYe[^_UWVS]jPǍ$gHSLS =TRs0t FP@tSu,XS5&4ЍP} e[^_TUVS] 8s0@uP@t8ucPPP2L ƃǃFW!u+fǃfǃƃFWue[^He[^UVS]SEP0PtPs0effPSU ]e[^UVSuj0s s ffC$fC&fjs s Ϳj,s s 躿f$fP.YtFPh2h^XZ w dže[^UWVS}0F Ejv PC t h2:jhPlP(P$PjRjV萃$th26vqSv v Ѿ uՃu'~jxP|PpPtPjjSV$t h2LJ`EPVBZYthJ2duuuuuÍGPWh+&jPuuuuu8u-h@2\_t Sh3\[^hn 1\ShA/\$ 1e[^_US]<t PRXZ|ǃtxpt lǃ|th($ ǃl]UVS]V-ǃV^YZy CPh22PVcYZy CPh2V#1ZyCPh 2[nVC 8Y@uP@t ƃƃtPPPG fǃfǃ1e[^UWVSuFjPFT~0PG`ʚ;fGPLJ&LJ&LJ&BHv0LJh&h&hS袮ujjh+S軮jjj+Qjjj#S觮jjh#S蘮 jjj&S艮jjh&Sz jjh0Shjjj0S\ jjj SGj SŮW}e[^_鳟UWVSWu{na T}Wj SVI f}&Wj S?I f}Wj S(IfE fEPj S J S;^WjSH fEfEPjSI uj}Wj SHfEfEPj SIt5S:Yu*WjS_H ufEfEPjSII @u dže[^_UWVSQEu8F } VPjjWjWRRtPEPh`20X VFjPjFPjhWRER$ tPEWPh2WVFjPWvuRR,tPEWPh2WPU8MujWvv PP u1~IPEPh@2rW FWvPP0 VFvPRR( Fv PPXZF ؍e[^_US] Cs PPCssPP0SCsPRR( Cs PP]UWjj}BP ‰HuGPh2V B11}UWS]8LS_ uCB14fBǃ8ǃ<f@ǃ1ҍe[_UVSu H 1ۃ8@uv8 v8  8@uv8$v8$ 8@u v8(Bv8(B 8@uv801v80 8@uv881v88H v1Ƀ ` 8@u  8@uv 8@v 8@v# 8Pu ,8,8 v 8@u džD t džD[^UWVSuHtL1fBt>;t$LsPPLsPP3GB9|‹HtjPdžHXZLt džLe[^_UVSE @ ]UMtRt% ǃ:t% ǃ84HBfB!B"fB4ȋuB2 uB(B D BAB9u1f@Hf@8[^UWVSQQ}G0Ef@f;Bf@E<H4@ @ E;tNE@lLz tjCpjPRR LsPPLsPP3FB9u1H4@ w<} ~8Ef`PB9Eu Ef@Nf@9Eu Ef@NEf@e[^_UWVSu ]0uUjjY_u E jP`XCZuSU 7CC C$CC C~Xw jS^^_M U4Ћjjs svPP t SFM peF]H D] z tjFpjPRR 1e[^_UWVSPjjuxP譲 ÉuFPh2O x1 󪋆819щ]}:EPjjhjhRRueEGx9|1fxtjVW& uGx9|1\p8D83PFPh2N džjqdž؍e[^_UWS]xp1SZ u ǃt1ҍe[_UVSu 8@u 1 ǀ 8@u!v ( v ( vI 8P u ,(,( 8@u ǀ\H 1ۃ8@uv(v( 8@uv(v( 8@u v(xv(x 8@uv( 1v(  8@uv((xHv((xH ÁuÁ|=tv&= t=@t   t v9 8@u PP9Qu PP 8@u [^UWVSutR1fxtDStRPPsPPtP,XGx9|tjP螯džY[t dže[^_UWVS$]C0Etp‰UB } y 9{YuLScC8Z@u ǀC8 ThRЋ@uP@hXS2{XuRC8@u 1 ǀC8 ThRЋ@uP@hXtSX1K9SpuvRQ1 vRArt/{w)C8ƋPu >Vu Ctr tm{(uguVhSEPhSfUЃ E`fuf9vVh SfUI S{XvTC8@u (8(8%uAC8@u (8(8{uS6T_S;e[^_USP]{uHSt1 u;EPjjSZ'u&fEftfEPjS~ u1]USEQPjj]S'{u%E%0u C= CSucw ucCChu#MC8@uPH{uSSC8Z@u P(@(C8@u P,@,C8@u P0@0C8Pfu p pCC8S@uv`!h1v`!hC8S@uvh!`1vh!`CtM8S@u!v`!h Fv`!h B8S@uv`!hv`!hC8S@uvh!`vh!`ʉЋ]UWVS]C18PKu2IuCׁSYSKZS XCtrtt!   C8@u xxC8Pu2C8@uP@KlhThRЃ{XtC8Pu%9uJ1h'ThRЋC8_@uP@uF1vփ2uCpS ^u Cp1e[^_USQ]C8PKuSv@:Ru! @:RuSZuqSYufSGZu[Ct u&EPjSfEfEPjSCv t t t u ǃ1]UWVSP]S_h:ThRЋC8^Pu  9Qu jSrGZYjSH^_}WjS C t uǃfeƃDǃfE€fUt ~t fE fUfMEPjS {LsDuCLu ǃf ugWjS, fE$fEPjS Wj S fEfEPj S umEPj S uZfUt 1@CHtwNt t fUEPj Sr u1e[^_UVSQ]uVjS7 fEfEt!~tt @fEfM`fEfEufEEPjS uKVjS u;fEpfE{`wfEPjS u SZu1e[^USS]f/ffu fǃ/S_YuQEPjS2 u>fEfEPjS u t S Zu ǃ1]US]{v SX SYu!SZu{ ujSi@ZYu1]UWVSP]S-_S BwS u S^uttSSZYuVP1}WjS0 u9WjS u'EtS!Z1҅tj FThRf Xv1ҍe[^_USPEPj]S EPj S fUMffUfMt fUtfM@tfMtfM tfMCt&r tt fefEfEfM *EPjS uEPj S u1]UWVSQQuFF8PuEPjV RfMʀfU<t<u fU fM<fEw f%VfEF8ZPu~ Eu=PjV0 EfEPjV fM5PjV EfEPjV lEPjV TjThRЀXfE}WjV WjVn EuhThRfK_ufu~ uVYEu:h}ThRWjV WjV fKu~ ]SjV utEpfEPjV uWSjV uGEfEPjV u*Fwuw VGZu1e[^_US]C8Pu % 9Qu C8@uP@[UVSQu~wtF8PuEPjV  uHE tVTE%=Zu =@uF8Pu1e[^UVSMA8Pqutr tt&,+"yuA8Hu؉1[^UVS ]SBw{pu uuSH^4{(uVjS VjSt E EPjSS EPjS< UtEt1{hDCj% =uE% = u CC% = uE% =tChtt t CCEPEPS uf}uCS[u1e[^UWVSuEF18Pu9VAUuPHEHwBF8@u }EuFׁt džV"]SjV SjV EdžV7F[F8@u ǀVCF8Y@u 9Qu F8@uǀ jV7u jVi7X~Zv VM_V[}VYnEPEPV[ f}tMF8@u 9Qu džFdž8@u 9Qu h]u %9t E uw~pu FpfF8Nl@ux xF8PuA9QuV?ZBwG@tBE t9F8Nl@u xxF8Pu㿉]㿉VugF8@u xxxIj ThRЋF8_@u @tEudž dž~u@F8@u xxy"F8@uP@1e[^_UWVSV]{} vFC8@uP@yf@tfdf 1Ҩ¸f)ЋUf fEf{ u_tVuVjS uEEu Uf3VjSh u%ffduEt f uE@uEf1e[^_UWVSP}-uVjW u(VjW  uE uhThRfKXu1e[^_UMA8PE u  A8 ThRЋ@uP@j UMA8PE u%%A8 ThRЋ@uP@j UWVSPuMIF8} Pu ۉEtbVEt %E:ERuF8 ThRЋ@uP@j эEPVEPV+ue[^_UWVSPP]C8Pu%E9QuC8@uP@EPSEPS1EuVSjYXC8PuEtVSEX}ZvVS0VSne[^_UWVSuF H] }wvPjV/ u}] ue[^_e[^_UWVS] u}~viF 8@uP H 1j2ThRXF8@uP H u C?w;@u,f%j jV jSVVOf1e[^_UWVSuF H] }wvPjV' uǃE] ue[^_e[^_UWVS] }Uv\ G 8@uP H 1jThRXG8@uP H u3Cw'j jWPj QW1e[^_UVSuV>YA~Nv[9Qu9Qu F8 ThRЋ@uP@h'ыF8ZPtcg9AuPX9AuPXF8 ThRЋ@uP@h'ыF8Y@uPXF8@uP@hThRЋF Zt u;F8@u  9Qu ue[^<e[1^USS]S=1҅Yuf{ uS~ZuS?EPjSb uf~Yu f}vE FPEPWkFPPW1W;]stjW2f ‹EfXCX;]ZrMuH1;]sAFPjWFPfEPWjW UfZWC;]XrW1ҍe[^_UWVSQQU1ۋE 19Ӌ}fEUs[E G8@uPHjWÅXZu(G8N@uP@Ufr;Mre[^_UWVSQQE UfE19Ћ}ƉUsVEpEjW AYZu0G8@u ,,jW[ZuF;ure[^_UWVS} 1ۋUBu8@uP@8@u ,,t1jCThRЁXre[^_UExu!@8@uP@1҃tUWVSQufE~uUVZuJ]SjjVEu3Sjj#VfEfxSjj#Vf fEVD11ۍEPjSVYxfEGfECf?v1f}Je[^_UWVSV}fE11ۍEPjSWxFfUFUCf>fUvָf)fEEPjj?W#x,uW[1ҍe[^_UWVSQQ]Es,EuU fFf9‹Ms)9fumExuEEu} ]e[^_ZSZu;{,uuVWS8ƃuVWS"h'ThRЃSe[^_UWVS U1ۋuE f9fEfU~,VEqZVGPjVVfu f}vE GPEPVGPMPVMf;]sVUfBf jRVCEW љ tf;]rV f;]X01ҍe[^_UWVSPPuUE fUfE~,fEfGPjVfGPjVVEf9EGPjVGPfEfEPVjUEBPV$VW1XF8@uP@uj2CThRfXv׃ft@VfEEf9EYqfGPjVFfGPjV31e[^_UWVSUB8J@u <<1UB8@uPXtjFThRЁXr̓u&UB8@u ǀUB8@uP X1UB8@uPXtjFThRЁXr̓t1e[^_UWVSuPVjj}W] x&EVjj WxE 1ҍe[^_UWVSRu11URfjPVGxhE>fE>fvFwF8@uP@t11ҊCBfv1ҍe[^_UWVSujPV( N9FuvT@Q1!vT@AN9F{uvT@Q1!vT@A\e[^_UWV}ES]O9WuvTP@Q1!vTP@AO9WsuvTP@Q1!vTP@A\1ۋO9Wsu"vRQ1$vRAr1;]s>EËu VW1Z}YsuVW$E PW~Y^C;]re[^_UE@|1҃M t r t+t8CAA/AAAA AQ UWVSWWE ƉNjEX;Pu vRS vRCE EEx;FSu RE RU;u!RwSE!RwCM EH9PFuvRQEAvRAMD;u!RwSE!RwCM [^[^_UWVSU B B B B}r Ƌ_;GuUvT@SUvT@C O9Gu"]vT@Q ]vT@A4[^_UWVSPEXu }H9FQu VE VU9u VwQVwA<EH9PFuvVQEIvVAM IEH9u VwQVwA<X[^_UWVSQQ}EEu)fftfMуEe1;E]t1ۋO9WpuvVQvVAvXZ[^_UWVSSu~F8@u EPjjVfEftf@ufE1] |N~ D # # ‰CwG$2## ‰Gf@1ҍe[^_US]CrC w2PjS uy%PjS u]Cu/C8Pu $0Q9u C8Pu 1]US]Cr$v? wPjS u"C8Pu 1]UVS]C8Psu rv u{uD;Cu@%u!C8PuC8Pu [1^UVS]C8Psu rv u{u@5CuD%u!C8PuC8Pu [1^UVSP]C8ƋPu @@U>Vu @@U>Vu @@U>Vu @@U>Vu @@U>Vu @@U>Vu @ @U>Vu (@(@U>Vu 0@0@U>Vu 8@8@U>Vu @@@@U>Vu H@H@U>Vu L@L@U>Vu P@P@U>Vu T@T@U>Vu X@X@U>Vu \@\@U>Vu `@`@U>Vu d@d@U>Vu h@h@U>Vu l@l@U>Vu p@p@U>Vu t@t@U>Vu x@x@U>Vu |@|@U>Vu €@@U>Vu ˆ@@U>Vu Œ@@U>Vu @@U>Vu ”@@U>Vu  @@U>Vu ¤@@U>Vu ¨@@U>Vu ¬@@U>Vu °@@U>Vu @@U>Vu @@U>Vu @@U>Vu @@U>Vu @@U>Vu @@U>Vu @@U>Vu @@U>Vu @@U>Vu @@U>Vu @@U>Vu @@U>Vu @@U>FKu @@EC8ƋPu @@U>Vu @ @U>Vu 4@4@U>Vu <@<@U>Vu @@U>Fu @@E_C8ƋPu ´@@U>Vu ¸@@U>Fu @@ EC8ƋPu AAU>Vu $A$AU>Vu AAU>Vu AAU>Vu A AU>Vu AAU>Vu AAU>Vu AAU>Fu A AE^[^UE t`u-fǀfǀ(fǀPfǀ fǀǀ@8@u X1 ǀXUM 9vnff;ǁfu fffA8fPu XBXDt;w3fǁǁA8@u X1 ǀXUWVSPEHE] Su1%1 t% uU}u}uX[^_UMAr@vt4A(A A$A(A A$A8@uPP1 @fA(u HD Hu1@A A%=@twt $=tA A A A 1@A$UVS]CSXxPM r@Lu CxP@Lu[^UWVSuFVXxPM ]z@Lu FxP@Lu[^_UWVSEu fEffUB 1ۅEPjRy .E%$2fEf2f2UfPfPEfnfnUffEfHfErfErfErfErfE}EPPu urfMfAf}w\f9MvfMfEf}vfwf+]ع1fff2ƒ y1fB Uf1ҍe[^_UWVSP]C } uEPjS ucEKHwPuVjS u?fU%=u%VhS uExfff1e[^_USP]S BwEPjS u2E!u#EPjSc uE 1]UWVS]fEqfEqfEqfEq{ } =EPEPS f}EPEPS& uaf}1vZ11EPD=PS fEf%?fEPD=PS YFfvǃ{L9f}1.EPj SfEF1 1hThRЍEPj S Eǃv$CLjih5S tfEdFf;urEPh[/S jh[/S ih NThRh@jSF11EPD=PSZ 'fEf%?f fEPD=PS7 Ffvh3jS h NThREPh[/Sǃ{LEPh[/S jh[/S urh NThRh@jSuSj*h5Sv u?h3jSb u+h NThREPh[/S@u CL1e[^_USP]{uY{uSEPjjSu@fEft4fy/j jS u hjS u ǃ1]USR]C H1҃>C t uEPjEPjSz } u{C t ufEfEPjfEfEPjS8 u!EPjS fE Yff/t ftfutC t ufEfEPjfEfEPjS u6EPjS u!fE$fEPjSp u1҉Ћ]UVSQ]{ uVjS7 } fEuDfEPjS usuVjS uXfE 7uIfEPjS u/VjS ufE$fEPjS u1e[^UVSS]fESt 1 EPjS` jjSS uVjS4 uqEfEPjS uTjjS uCVjS u3EfEPjS uEPjS u1e[^UWVS11ɋUB8@u GU A<r[^1_UVSuF8@u t>1ۋF8@u thCThRЀ XvЀ t1ҍe[^UWVS}EU ffEUt=~ fMfmffMuF8UHu f]fEwMAMD*uCfvUB8UpMu 0f+]f)fEf)ffEf9}fUs[1ۍUMAMuCBfvUB8UM]puڍ 0fEf9}rf}th11ɋuf;]suFuD D CT EAfvЋUB8UM]puڍ 01[^_UWVS u VFI0fuڈV1EE1ۋUB8@Eu}荔YX4 U0R Pf@f@ UfR$fPfx UB B$H%19t h2e[^_UUWVSu} ]u=U,RjjhjhPPt)FPh2 u ,RPPXZEۉ86uNjj$GYX7CC jS=,jSuPP7uSC$CCC 40UR `Pf@f@ UfR$fPfx 1ҍe[^_UEWVSu} uwjjhFÅXZ7VyYuSC77C$CfCC:#C :#fCC0:#C(hI'Љs,C4[<[8Ë@$CC0:#jS<4C046+8RA @BfBfB fC fBfz 1e[^_UVSPu1jjSVz77tXC~߀(uC EEPVYX!Cu CfLR1ҍe[^UWVSPu1E4 t0P5DŽ4 ,4.PPDŽ4. }01CE ~e[^_UVSQu1jSV 77tXC~ှ(uC EEPV$XZ!Cu $$CfPR1ҍe[^UWVS11ۋU4tP4EDŽ4_U0C@1 ~e[^_UVSu1jjSV77t6C~߃Cu ,,CfNR1ҍe[^UWVSPu1E4t0P44DŽ4,86PPDŽ86 }0`1CE ~e[^_UWVSPu01E4t:P3DŽ44&`RP4&`RXDŽ4&}01CE~`Rt0`R@`R,7PPjW`RuЍe[^_UVSP]ǃRfǃDRu1,uPP7sǀǃ`R1U,Rjjh:#jh:#PP7u3jjjD tEF`RB`R~1ҍe[^UVS uEE(] tfuf ffSfCuff É؉ff ‰EPVEYRffEfSfCffj EPEPVUE}FPh2XZe[^UVS uEE(] tfuf ffSfCuff É؉ff ‰EPVE :RffEfSfCffj EPEPVUE^FPh2ѫY[e[^UWVSE0EUBQEtPuEtPuE E^_u EUɋu ǀETRt:UTRVR6UTR@TRY[jVXETRZuƋU싚CE{޹t5Uu E U䉐EfHPjjj u h20jPS膰UTR FTRVRO]^_fUu E U䉐e[^_UMSۋu\B\ۋu 1 ǂu 1 ǂuUU ǂUUۋu =UUu1(u#ۋu \  B\ B\1[UVSuƆ*u @""B@""ɋu @@tFPh2Ǩɋu@ @ @ɋu@Z@@t `t Ɔ(,Ɔ(#hn 1IFPSh2:G(urɋu@ @ @u D BDBDu P  BP BPu \vB\v(u&u \  B\ B\u \$B\$B\ۋu B ȅۋuBtVtQw tJ t@w@t4QFPh2 u  BBu\B\B\u \ B\B\u@ ǂ@u  ǂ u ǂVZ1҅tFPh@2e[^UWVS]u LJu 1 LJ@Ru@ `@ ` SE@R0@ ` BfB@R@ 0 0ǀYu (1 LJ(0p fǃHR1BfBfB Hu 1 DŽ?~Ѓu ,1 LJ,u 1 LJ fǃJR@R@ 0` 0@R@  BfB fB @R0@   @BfB :#fB @R0@ ° `BfB 1( fB@R0@ BfBfB @R@  0 u Wh Gh 01󫋓0€ 1( fBfB (u B @R@ B@RR 0@ ,x tjhh`@RPP hRu0 1 ։10lRu 44dRu 88pRu @@tRu <<xRu $$u d1 LJdu 1 LJu@%@%@e[^1_UEE T2EE+UWVS,E@ hu E?# ǁ`>#EPSE_XZufffffVfFuff Ɖff ‰EPSE YGQ^t URE EE PSXZS(XuEPSEY^S7Zu h2 S(^uSYu 1 ǁfǃFRS>URSE  u 1 ǁfGP@fGPF@^FW ^e[^_UVSPE V% 2Ѓ"$p2ЃuH` ǂH`]uL` ǂL`E uH@ ǂH@u L1 ǂLF%=u/uH H HEPE u H1 ǂHuL@ ǂL@Fw%uL #L $uL L LF%=]u%uL #L $uL L LE SQ_[^1ۍe[^UESM AA *A*uT)u hhۋAt AAt  Auz)u llttItItItI tItI [UWVS E8hu q&uVW0RuEU2i w%1i  i t=i W5i 1w i tN<6i(+EfHPUxuWuu WjXEPB="E9PXPXUfBPtP@@u}Ru E %@@u}RtE EPW^XW @tW[UBP|R3u uu uuZ4Yu3E@P@tWX1V PuuÃu$e[^_UVSuCPh2=SS6Fpe[^USP]fu ǀEPSE Shh SSS SSS 0ǀ0ǀ 0ǀ@fǃDR]U8U2Љ`2VSus V$f9u A9‰t `2r1ۉ[^UuZUWVS$E@ u} E[uhn 1އh`2芄EPEPjEp u蹬t h2EEPjuuSt hë2EPjjuSt hz2HE؉LEԉ LJFFFF EPuZYthJ2duuuuuqÍGPWhljPuuuuu8u(h@2识^t Sh3蟆Y[hn 1蓆ShO.膆jW诹e[^_ÐUWV} Sπ]`t\u $B$\u $ B$B$jdThRЃ`Y\u $ B$B$hThRЃ`Z\u $ B$B$jdThRXTe[^_UWVS]1`\u $B$u SX`Z\u $B$`\u $ B$B$jdThRЋ`X\u$B$t ɋ\u $ B$B$jdThRXu`\u$1B$Ef8e[^_UWVSQu19}fE}3EPEPuE XSfEtf9f|͍e[^_UVSu`\u $  B$ B$1ۃ`\u $  B$ B$jThRЃ`X\[u $% B$%B$jThRЃX~e[^UWVS]E`} \Hu $% B$%B$`t\u $ B$ \u $% B$%B$jThRЃ`X\u $% B$%B$jThRЃ`X\u $  B$ B$Pe[^_UWVSPh]EE @@f@`X\u$1B$`\u $  B$ B$SjU PS|jU BPSljU BPS\(jU BPSI `\u $% B$%B$jThRЃ`X\u $  B$ B$jThRЃ`_\u $% B$%B$`\u $% B$%B$jThRЋ`^\u$z$ɋ\u $  B$ B$jThRЃ`Y\u $% B$%B$jThRЃ`Z\u $  B$ B$jThRЅXtm1`\u $% B$%B$jThRЃ`X\vu $  B$ B$jThRЃX~`\u $% B$%B$jThRЅXu/`\u$B$tU f rjThRX`\u $  B$ B$jThRXg`\u $% B$%B$jThRЃ`Y\u $  B$ B$jThRuX1Ze[^_UWVSu h]gFF`Nj\Xu $  B$ B$SxjPS jFPSjFPS(jFPSjFPSjFPS$`\u $  B$ B$jThRЃ`X\u $% B$%B$jThRЃ`X\u $% B$%B$Wge[^1_URRE EEEEEPuEEUQQE EEEEEEfEEPufUELPUWVSE4EEEEU`\uPUfJPXMAPU`tc\uPXU`\u P8@8M`\u P<@<U\uP81@8M`\uP<1@<E苀Et]PU}ܸu܉ju^_  E  EEEEu}tM`\u P8EUP8M`\u P@t;W2u uu脫 uu豬Z4Yu3E@P@tWX1VPuu9Ãue[^_UVSuCFpPhČ/bS-SS]tue[^1e[^UWVuS^4fCNP fcP`X\u % B%B`\u1B`\u1B`\u 1B tP>ǃX9~ދt1tPǃX9~ދt1e[^_UUEffUUf% Љff33f% Љfff% fU S]HDHuɉ[UVS]HDu  BBSHXDu  BBS{1XHDu  BBSPHXDvu  BBS$Y~HDu  BBSHZDu  BBSHXDu1Be[^UWV} Sπ]HtDu BDu  BBSHHXDu  BBSHXDu  BBSX]e[^_UWVS]SS1XHZDu  BBSHXDu  BBS{u S HDu  BBSBHXDuBt SHYDu  BBSZuSEf8e[^_UWVSQu19}fE}3EPEPuE XSfEtf9f|͍e[^_UWVSSSME] M}EjHs s 蹾ƃ@PjHs s 1҃9}MpqM B9|濉uEHC E C Ee[^_оUMSHDuHDuHDu H% BH%BHHDuH1BHHDuLBLfHDu HBHHDuLBLfCHDu HBHHDuLBLfCHDu H BH BH[UVS]HDu  BB1HDuBtjjjPSjFThRЁX~HDu  BBe[^UVSuHDu 0 B0B1ۃHDu @ B@BjThRЃHXD[u  B࿉BjThRЃX~e[^UWVS]EH} DHu  B࿉BHtDu BDu  BBjThRЃHXDu  B࿉BjThRЃHXDu @ B@B`e[^_UWVSPh]-EE @@f@H_Du  B BS0jU PSjU BPSjU BPS(jU BPS HDu  B௉BjThRЃH^Du @ B@BjThRЃHYDu  B߉BHDu  B࿉BjThRЋHZDuzɋDu @ B@BjThRЅXte1HDu  B࿉BjThRЃHXDvu @ B@BjThRЃX~HDu  B࿉BjThRЅXu,HDuBtU f rjThRXHDu @ B@BjThRXrHDu  B࿉BjThRЃHYDu @ B@BjThRuX1Ze[^_UWVSu h]AFFHNjDXu  B BSNjPSjFPSjFPS(jFPSjFPSjFPS$HDu @ B@BjThRЃHXDu  B࿉BjThRЃHXDu  B߉BWQe[^1_UVSPPuL<M ]u`1҅DHDu „u hThRXHDu M1҅HDu   ZHDu  BB1ɋHۋDuBt A~ځuFPh`2T1EۋDuB1=t&"EPVEEM]Ue[^UVSSS]Lu MEu0HDu MHDu  ȉBHDu  BB1ɃHDuBt A~ہu6CPh`2oS$EfEEPSEUMPZYe[^U*UWVS]C4EUBPHtYDuWH%MfIP͋GH%GHHDuWH GH GHDu WH GH GHHDu WH% GH%߉GHHDu WHEH}1HDu WH6 6GHHDvuWL1GLvU҉UJM}uju虘_HZDuWHGH~HDuWL GL ЉGLEEt PUcHDu WHEUWHe[^_UWVS]C4EUBPHt3DuWH MfIPˋGH GHvDu WH% GH%߉GHHDu WHEH}1HDuWH GHHDvuWL1GLvU҉UJM}ujuҖYH_DuWHGHHDuLEe EGL ЉGLEEt PUUHDu WHEUWHe[^_US]HDu1ɃHDut A~ށuCPh~2NXZhThRЀLXu?HDu <B<HDu<1B<]UEE 2EEpUWVS0E@ jPEEԋUB&= _tw t#+=pt"M ƁL} ƇL E ƀLjPUr u/ jTMq uǃ EjUr ujMq uЉjjujCPFPjVWu uUBh-jS_XMA8Adt VP)XY[Vu賅XZETkE|MUXe[^_US]SmX]]UWVSQu4EfFNE`;\UkTEыz tj j+PRR UB@tMGd1uFpE@tFtUB tFtMA%FtFlY{t.Ux tjsjSPP MSPPXZUB tPPMA XEGdu1fFNU;\M`}tffPe[^_UWVSQujP ES>#XN~4Zu(C,t"C0tƆNtWk_h5&4P([E^Ee[^_UWVSPuE~4t1HDu1BHɋDuZu@tkEtVXtVX$tVoYtHDu@tV+VmXZrɋDu BtWI[Ee[^_UWVSPEju VPP7M]1;~}fEd)H7UkTL$ @BD Bt J]Cu1G;~|Mx tjvjVPP kEMTM UTMkTdx tjh hPP 1ҍe[^_UWVSQu1N\EFQkT tdEPRSj uut$Bu džBF8Gt RPSXZkET tt4EH\DufNPՋfFNe[^_UWVSP]jPZES ǃYLX{4HDuH1BHHDfu LBLHDu HBHHDfu LBLHDu HBHDuH1BHHDfu LBLHDu HBHHDfu LBLHDu HBHHDfu LBLS7Zu)CPh/;e[^_UWVSPPuF4E]E@p~SWh/#V'Vat%d=Ej(ЍCLPh'Se[^_UWVS|uF||~HuaFHPEPjtHuRhhjv@ zF4FDuj|cV]VDx~Hdžxdž|Vh(豟 xuWGuNxhutj|cj |bE2ЋV0UȋV4ŰV8U׉UԉuERЋVhUV>>hVW_ tShVWG`jjVW9`jj VW.` jj$VW `jj(VW` jj,VW`jj0VW_ jj4VW_jj8VW_U zDRHu ࿈jDue[^_UWVSuFt} CCǃFhFDCFHCC (C(ЉdždRjPjSS Cu jjSЃ jjSjSS 2ЋdGG G_PDGHuP@EuEuPh2 jjVVjDWjVV ÃPjVV(jVV ȀPjVVuWj ThRЃ h@ThRh NThRSjVVh NThRVjjVV(A"HYu RjVV1ۃ F$t SVCXZC~1ۋFxt SV_XC~e[^_UVS]3jSS %PjSShThRjSS  PjSSjDVhThRЍe[^UE0HZUWVSQQEU 0 h}uYEPEPj hCPSjEv@ u#F4EGEGE G _G1ҍe[^_UUE jppr@UWVSE EE uE܉‹@(z, RQVˀEVۋESPVVhtEPE @PVV PEPVˀVۋESPVVM܋A0 ?y4u@PEPVVۋESPVVjVV M  ƒ RjVVe[^_UWVSu}1ۋEP$ЈtC~to ‹EP$E MM9B4t h2ZEHU%)ƍ|8E)ΉH(x,p0U P4SuR1e[^_U} VSu~ h 2jVV M !PjVV!^$e[^UEUE eUEEU} u2 #4UWVSSUҋ]}uMuE E;C4u vq$E;C0uFv]w u(u$u RQVWu  tCPh2_jE(0VE$0E 0Sp1e[^_UWVSVVE EEE}EuWuSV;^4t;^0u"EE EE}Ee[^_e[^_UWVSuE 9F4u uuuuSt&9úI.t:"3RFPh`2m u VWye[^1_UWVSuE 9F4u uuS t&9úI.t:"3RFPh2 u VWe[^1_UWVSjjj}] Oƒ Ҹt`EDBEB EBt+9XHrɉJZptY_PrɉuBGBBG1e[^_US] ɋE tT9A uHAU+J9tRA+P1h2 -QҋAtBCAQjQP1 Iu]UWVS(E EEEEEEuUE,9P4u E!EԋC!E؋CE܋[}SEu9uZUU!9rLC!E;EuT9u3EE؋K)!E!)9sEE؋!ECCMCEE؋!EC!ECE&9ЋCu!E؋E Ph2_X!E[LU r|uuSV!LEu؃PSVL EuPSVKEu PSVKUE ;P4u4j~4 V0uffÁ؋V0uff[^_UVSR} uMT@ (ȋ8 z4R0uff1jThRX@8E (y4Q0uffu C~uFPh21"E (y4Q0uffe[^UWVS }@ 8u(z4]R0uff4@ (U Ѓ8  ؃~4V0uff1jThR@ 8E(z4YR0u ffE ffU¨u C~e[^_UUju)Ѓ?UjuI)?UWVSuEŀ@8 ؋} z4 R0fuff@8 ؃z4 R0fGuff@8 ؃z4 R0fGuff[^_UWVS0]8ES01}UEEMAD tW-IEu̍EPSẼ }~@8  "1Ƀz4R0u‰@8 ("1Ƀz4R0u ‰@ U4(1Ƀz4R0u‰ff@8 8(1Ƀz4R0u‰ff@8 <(1Ƀz4R0u‰ff@8 @(1Ƀz4R0u‰fUfJPfMAPtEEEu܋uFEȋ}ĸuĉuuFD< u}uuSFẼ Q t|"-w uuE^}M EMЃ  E؋uȅubUBD ti-[8@~4 H"V0u̠V0u8@ z4 "R0Euuԉ48@ z4("R0Eu8@ z44(R0EufEf8@M z48(R0uff 8@ z4<(R0Euff8@M z4@(R0uff e[^_UWVS]|E8@1u1EM@u*Eu#8@ @u_% 8up  @@fǂ@fǂ@"G E t1|2jWS7uWCPh27G~ǃ2ǃ21e[^_UWVS]8|EU苳81󫍃8ǃ88EEEM1U܋M}u8@ ?"E܋U|8MH ȃ UDMUAdRjjh<#jh<#qdP7jjj> uUBdurdP7E8Bu B88EE E }ǃ2ǃ2ǃ28Pdz tjh@j8pdR 1ҍe[^_UEWVS}u uwjj-uu( DV%-X8EPB="E9PXPXUfBP@@8UBD tK-=08@{4 H"S0u@8 (G4EW0uffÁ?}؋W0f%@@8UBD t-<8@{4 H"S0uS0uGB8@{4 (S0ufff S0uffVVZ+ @tV]3XUBP83u uu uu[4_u3E@P@tVY1WPuu(Ãune[^_US]j,s s g4S$ f7u2u=7t]EE `2Ћ]:]US]{4C0u Pff@{4C0u Pff@CDt!{4C0uf fǀhThRЃ{4XC0u Pff@jThRЃ{4XC0u Pff@CDt!{4C0uf fǀ{D {4C0u f fǀ{4 C0u f fǀ {4 C0u f fǀ {4 C0u f fǀ {4 C0u f fǀ {4C0u  ǀ{4C0u @ ǀ@{4$C0u L ǀL${4C0u HƀH]UEf8UWVSUu] @8\hf:u ǃ8hEf8u ǃ8p1ɋU~4yF0u ~͍P$hr3AX~4ZF0u VXNTtȉD@AщDȉLPDHP~4F0u Tt tǃX%ǃXTFPh2mFdUjRjURjhh`PP$ tFPh̓/4[_FdUjRh`uURPP,th`CPh@/B8FdRjjh`jh`PPtCPh/Fdjjh`u8PP t CPh/(}8SpYtE$Ph2eXZC0E[0f@Pǀ=)(ǀ;(ǀ<(@`ʚ;ǀjCTPCPVDƒ t|-wS"SPFPh 2 U_FD t|J-w@ ǃ4q(ǃ8(ǃ<(ǃ4c(ǃ8J(ǃ<(h )(h((jW2!jjjjWS ($u'CPhk/$jjj!W1!j!W! j W!Y^ShC(ЁdS襊5&4S贊uux@Fd8PPXZFdh`uPP0 FdUuRPP( UDhe[^_UU EftfRAPh)2a fAPh:2EYXUWVS(E@ EjHEUr P4- jLMq u-ƃ j]s u,jEp u,EЋUjSV7ZYEt/UuLBL@u@UuLBL}Eu AƀAǃ,} HutPPP(-JftP(f-JhThRЃ XHutPPP(ftP(ff=-JtVCPh2螖$v E؅t PuW9) uuu()uuu)uuW)S1e[^_UVSuEjEPjEPEPjjjV] 賻$t hi2|E쉃(E$jEPjEPEPjjjVr$t hë2趕-E E䉃SV6ZYt#uuuD(uuu6(}UuAAǃ,1e[^UVS uEjEPjEPEPjjjV] ʺ$t h3CE쉃(U$ ǃHSVxZYtuuu'V}Eu PLff@LhThRЃ}^Eu PL1ff@LhThRǃ,L1e[^UWVSu M y Hutd21ftBdB2f Huth4ftBhB4fEPQZYthJ2`uuuuWBÍFPVh5jPuuuuW_8$u-h@2肓_t Sh3r[^hn 1f ShA/T1e[^_UWVSuƅƅƅƅƅƅƅƅg1ɋ($uHH:u|A~܍1ɉ1ۅ$uTH,DH,)uC)A~FPh2Eae[^_ÐUUB$f=u=t=uR$fJu t1UWVSjjjEPEPjjju} 蘷$t GPhC2.E܉G0EG4UBG8EPRZYwtVhJ2訑uuuuEp VWhuuuuEp VWh4j@uuuuUr 8u+VhJ2_Xt Sh3ݏ[^hn 1яY%t ShO.迏XZjhhN#ЍGdPW[e[^_ÐUEP$1f"u1 UWVS$jjjEPEPjjju] $t hC2ǃ RЋE܉ E$UBǃ , EƃHƃƃǃǃƃǃ(ǃǃPRZYthJ2juuuuEp { WShj@uuuuUr (8(u+h@2K_t Vh3;Y[hn 1/t VhO.XZ0,RjjhjhPPtWh2,EjPjuVjhjDRR$ t PWh@2~,4jPjDuVRR,t PWh2U8,PjjjDjjDRRt PWh2*,jjjD48PP tPWh2/Wh2"jh RSOoe[^_UE M $u USPUM ] ȋ$u ] [[Uju%UM $uP@1@@ǁ<UWVS u0E싾@E $uTZTtW $Nu@uuB@Qh@2,uPP+tKFPh"2踋Y [$u@1 1B@dž<<u h2Ddž<u[=@X4jV:_ZPjV,Y[PjV_ZjVY^ Sh2XEu*jVYZƒUt=@X4y Rh2NJXZjVƒUXJY~jVƒU[JX냾 $u@uuB@1Ƀ $uTBT u A~ۃ}t HEjV jV @tjVZY ]uBDu6@u-E$u $uTZTtჾ $u@1 1B@,z t$uPEpjP,R ,uPPD+]Y}_tjV]UXCZyD=@X4yHuS@tjVY_1PjV_ZPjVZYPh@2赈L)H1e[^_UWVS}0E ]Mu$u@1 1B@U HLD@>&@@,Pj3E 0uRR tPGPh2 $uDBDUR4EU@$EUJ Z E)M $~uHJHU)U}~m};U}AED$EE\ m}~m}B;U|1e[^_UWVS]D08@,z t1D@PqjQRR ,x tjvjVPP  $F uXBX $u@uuB@ $u@uuB@ǃ<e[^_US] $@uɍP@uɺuP@ǃ<[UE $uP@@@t1ÐU S]Huɉ[UVS]u  BBSXu  BBS{1Xu  BBSPXvu  BBS$Y~u  BBSZu  BBSXu1Be[^UWV} Sπ]tu Bu  BBSHXu  BBSXu  BBSX]e[^_UWVS]SS1XZu  BBSXu  BBS{u S u  BBSBXuBt SYu  BBSZuSEf8e[^_UWVSQu19}fE}3EPEPuE XSfEtf9f|͍e[^_UVSuu 0 B0B1ۃu @ B@BjThRЃX[u  B࿉BjThRЃX~e[^UWVS]E} Hu  B࿉Btu Bu  BBjThRЃXu  B࿉BjThRЃXu @ B@B`e[^_UWVSPh]EE @@f@_u1Bu  B BSjU PSjU BPSjU BPSt(jU BPSa u  B௉BjThRЃ^u @ B@BjThRЃYu  B߉Bu  B࿉BjThRЋZuzɋu @ B@BjThRЅXte1u  B࿉BjThRЃXvu @ B@BjThRЃX~u  B࿉BjThRЅXu,uBtU f rjThRXu @ B@BjThRXru  B࿉BjThRЃYu @ B@BjThRuX1Ze[^_UWVSu h]FFNjXu  B BS0jPSjFPSjFPS(jFPSjFPS~jFPSq$u @ B@BjThRЃXu  B࿉BjThRЃXu  B߉BWe[^1_UPPE EEEEEPuEEUPPE EEEEEEfEEPuvUWVSSS} Eu (ER(UMY0u8J8uM e?Mu (EEB(u8J8UB0uu  @B @u % B%BZY[^_UWVS]C0EUBPtiMuʃH%EfHPȋUBH%BH]uڃH MAH AHEuƒH UBH BHMuʃH%UBH%߉BHMu ʃHE URHU1M䍆uʃHUBHMvu ʃL1 E@LvU҉UJM}ujuƉXZEuƒH6 6UBHMuʾL MAL ЉALEEt PUQ]u ڃHE MUJHe[^_US]u1Ƀut A~ށuCPh~2/xXZhThRЃYu ǂu 1 ǂ]UEP$f u "t1UWVSTEp hEjPUr VjTMq Vǃ EjUr VmjMq V]Ej/XM UjRh uVPP,t/E h Ph@//U uVPP(0=tR~ h3.XM ʁ<Rjjh jh PPtE Ph/.O=tR~ h3._U jjh u<PP tAM <PPU h uPP0M uVPP( _=tR~ h3.^E }̉fBU x#RYtE Ph2-XZM ǁ<@Bǁ<ǁ<@ǁ<,ǁ<x fǁ< E fǀ<u 0U R0fFPdž@(džU(dž}(F`ʚ;dž=tR~ h3-_E jTPE P3dž =tR~ h3,[M `ǁx(ǁ|(ǁ(hT Q\=TveKZYuhX u F_EX'jhEPu EȃffEȋEȃ0 u E ƀj,Ur ue =ADu M ƁE tfh(h(ЉhÄSjjj+S jjh+Sjjj S j SpU @lh(h(Ћ] jDSjjjjSu ^ M (hu)ȃPhk/r+jjj!Sj!S j SY[E @t%jpUr uR u M Ɓ=tR~ h3 +ZVP=tRX~ h3*XVp=tRX~ h"3*Xu E h(=Pt u(e[^_UWVS uj s s 請Ejs s 蛋Ejps s 苋$hjhEs s t~ɋu ,~,~`u"ɋu,~ ǀ,~ @t,uh ǀh WhhVhThRЃtV@u2h ThRhs s 蚊̀Phs s hPhs s ۊhjhs s Ɗuj s s 越 ujs s 裊hhhVx'u@ ǀ@hTveKhP V1 hP Va=ZYthGThRЁX~ׁuFPh`3(X1jps s 苉U% 9t"j GThRЁY~̍FPh37(XZuh4 ǀh4u 1 ǀuQtHۋu ɀۋu tT@tHۋu ||ۋu| |h'ThRЍe[^_UWVS]C0EEEx tjjPh<PP <ȉ)΍`y+<)ȋz tjPW<RR ދx tjVh`<PP ff9<<`EBH Й<f<UB <@֙f<DŽEE@ tUBhW<PS -jRS{ 7jujuFPGP9W<PS@ u E@hjVqXZ<@֙ f<DŽ E싴.DŽ.VPPYXE@ tUBhVj<PSl7uE@hVW<PSN4UBduFG GWB8t WPF9XZWuf^_ff9<&f<u „ }t+f<u l l}t+f<u t te[^_UWVS uF0E싆x tjjPh<PP <)y))ϋz tj WP<RR ۋx tj Sh<PP ff9<<E@tMAlEt`DŽz $=tjpjPRR 3PP =C =[XDŽ$=uʦY<@љ<f<Ef@Nff9<*}t MfaPe[^_UWVS]{0u1u ǀu 8=ǃ<PS~XZu ǀjjS2jjjSЃu u TT@u+u"t=ǃ<PSY^u@ ǀ@u GP@tSOSXZSXu 1 ǀGP@ttWXe[^_UWVSP]h^ED{0XxSS Y5&4Ѝ=P<XZu A<u*u%%u 7ǂ+V<Xu+F,t%F0tǃ<tW}YEEe[^_EUWVSuF0041{Hu v̋TP`d0Bt[^_UWVSP}G0Eu <<u DDUZtu \\u dd)؍UBtX[^_UWVSQQ]Es E)u}t}tyUBƒt tgM9I8u_}ҋOW t G0G$ ) U)‰9r2VMA APs3#}w C S虠 toCƒt t`9[8u[ҋSt C0C$))‰;E|5E9A r*uC CPp"MK )H H }W +EwUjj+}@ƅXZ7tauvExW_"MU)J s FPsE"{ }EF U2S蝟]a1e[^_UWVSEE}EEtu [7F =U}7.Eju SPP7 1;sMEuZD BǁfD$fB fBU<)Ѓ7U@%UEEF;s| ;s}7yx tjsjSPP <9E7tMEfE U쉄 =@ =E䉄$=U<UE1ҍe[^_UWVSQuE1<u ufNPEt^EPRS uŋt$Bu džBF8Gt RPY.XZEttQEu  t!Eu fFNe[^_UWVSQ]h艴E{0GP@Zu2SSgSSt"CPh2_XEEe[^_Rx#u <>#!ǁ<>#"u< ǁ<ufffffVfFuff Ɖff ‰GQt!u hh u hhhu hhhSSrY0^u:1jThRh`S =tF v݃ uCPh31XZxSXfǃ<S^u \\\u hhhu ǁuh h hu Qh AhAhu Qh AhAh=u 1 ǁW*fGP@fGPuN5&4Se[^_UWVSE0DBP% WЃt .u D1 ǂDɋu °ɋu؁° @ @jThRЃ_u °Tu!u  u C2-dž<(t_$tSk[0^uW1ɍe[^_UVSEu DtxFF  u tN؃ Fu t ^SVC0FC,Fe[^UWVSPPEh} 迮uWS0RuEUR2i w%1i r i t=i 5i w i tN6i(iEfHPUxuSuu/ iSt_]UB-Iy =5=(#*U9BX#BXUfBP@@u/<u&u h7h8%@@u6<t-u h%hhS @tS1^UBP<3u uuY uuZZ4YuEE@P@tSX11t WDWPuunfƃu转e[^_UVS]3FPh2&fcPVCpe[^UWVS}Mu u!!ȉ1ۃuEt$jdCThRЁX~uVGPh3e[^_UWVSRE0EE=PMfaPjhhuPjh,uAjh u2E(xjh4P jh$ujh(ujh0u$jhujhujh u$jhHujhuMxjhdQy jhugjh<uXjhLuIE$xjh8P- Mu \ ǂ\Eu \1 ǂ\MxjhDQjh@uEu h BhBhMu ǂEuh%h%huMXxQXu$XEu7MfAPfAPDZsC"REsEfxPXMǁ<fǁ<e[^_US]SY]]UWVSu} 1ɃYu9~[^_UVSuuPp1@p1jThRЃYuPm@mx C'~ҁ'uFPh3 XZe[^UVSuuPp1@puPq@q1jThRЋXuPm@mx C'~с'uFPh3p ^ɋuPp@p1jThRЃXuPm@my C'~ҁ'uFPh 3 [^e[^UWVSP]1M ulBl9t1h(SEZ^Xu qEEBqu p@ Bp@Bp1jThRYɋupBp@t F'~с'uCPh538 XZɋu rffzrS"u脦Ǎe[^_UWVSQ]M u}ulBl9h"ESTXZuqBqu rffzru p Bp Bp1jThRЃYNupBp t '~΁'uCPhM3 XZSXEEe[^_oe[^_US]u i? Bi?Biu i@ Bi@BiuhBh1Hu T1D~كuhBh1Hu T1D~كuh1Bhu i? Bi?Biui BiBiǃ\[UWVS uE\@u tEu ƒi? UBi?BiMu ʃiȀ UBiȀBiM芆\u ʃhȀ ȀUBh1ۋU M{uT MD ~ЃEu ƒi UBiBi1jThRЋXMuʃiUBit C'~Ɂ'uFPh@ 3e[_EMu ʃi? UBi?BiMu ʃi@ UBi@Bi\Mu-غљǃE|Ee E*غуٺMNJD ЈD\Eu ƒh1UBhMu ʃi? UBi?Biuu i MAiAiEe[^_UWVS]C0SE1EEYuP@uP1UfJP@MAPtEu P@u P@EEt;PU}ܸu܉nuSe_EZuEEuŃ}SMɉM^tIAEjuKXZw E N EEEtPU뽃u PEUPu PEUPe[^_UVSuu B 1jThRЃYu B y C'~ҁ'u7FPhf3XZu @B @hThRXhThRЃXu “  1jThRЋXu “ t C'~ˁ'uFPh3Dɋu x BxBxe[^UEE 3EE,%UWVSS] Pjjh@jh@RRƒҸ  UjRjVjjh@PP$ tCPh3  jPh@jVRR,‹1tCPh3P jjh@PP tFCPh3 PP h@PP0 uVPP(a1 Wjjhj hPPF~΍ PjjhjhRRƒҸ 3 UjRjVjhhPP$ tCPh3 jPhjVRR,‹1tCPh3 jjhPP tTCPh%3 PP hCPh/ CPh/~ 81 Wjjhj hPPuF~1e[^_UWVS8Ep jp V} 9a uh`2pMt#jQjPRjjju%$t*h3:jQjPRjjjul%$thI"3EPub[ZthJ2uuuuV cÍGPWh )jPuuuuV&c8u%h@2IYSh35XZShA/#UB WjjjEPWb1҃ DUԈDUfDUՈDUB~jSEPS)D$h 0W_00fCPǃ)ǃ )ǃ)ǃ)C`ʚ;ǃ@ǃGjPEGTPBG,LJD(LJH(LJL)h`)hJ)jVQjjjjVW44u&uhk/jjj!VQj!VtR j VgR^XWh)Ѝ`PjSX#SMCe[^_UWVSVV}EE }u>jj踐YE[7RjPXZUBuR芁7/$E@@  juVPP7~U UyGPh` 3^_fF$f fAF 1҉AfQ AT@Tu3] M싇E K+T9uLJTE U x tjvjVPP 1(=ЄRt h@3&[}t uWY e[^_UWS]1󫍻󫋓 z tjpjPRR ǃ ǃ ǃ e[1_UWS]1󫍻ǃT1jWS 77tTG~ዓ z tjpjPRR ǃ ǃTǃ|ǃx1ҍe[_UWVSuF0EE z tjpjPRR { ?UU@E z tjpjPRR  PPXEZtI=ЄRt h[3,XC xu|xfc||j4fE uHE@hxtP~dž|džxXSWVG׃ kjWV 7xuvtQ}dž|džxYjuEjPCP SWVE }u E@hjuDGXZGɉtbEщS w|J AB S}XBC fc|xdž|džxE EC CE@dCE%D=DuK EtE tK UB8t SP YXSu:EX}Zt z tjpjPRR  u P^EfUfP^e[^_UWVSQu z ~0 tjpjPRR ; ts؋Ex^{DŽ  PP EtGtf}yGpGlC ; u; t fgPfGN tuP @ e[^_UWVSQQ]h'EVYXZX`F,{0Utu ǃXGWW&3t0F0t%ǃXGWW_&XtW_5&4u[E^Ee[^_饑UWVSQuE~0GPu1kuP@ ЄRuP$X$~ Shk3XZtuP$X$9EtVX0tQ=ЄR~ h 3dXVgXuP2@2uP2@2tVBXt=ЄR~ h3XWYf`P4VXZuP @ tW[Ee[^_UWVSu EF tEtMtMEU EU jVuPPtPEPh`/)}M?xy1ۋE;Xt.UfD$f%fAD 1҉AfQ CE;X|҃ugjjÅXZt~v&jSh_CXuSwVw7svjV{FC CVwރ~;.<f+FߍJf%fAE@ B1fQCF<M Cx tjUrjRPP Fډ U G~~ WMUE  MeU 1e[^_UWVSPE0Xw@Qm` OUyEUCu ǂCEUB8t SPYXuSVa t2UCuEfHP/fL8}GUCE; tt z tjpjP R u P0ff@0U uP @ Ef@Ne[^_UWVS}S[SSW 7u CPh 3S1Ƀ7ZuCPh 3S79 qu~؃u ~ B~ɈB~u ~ B~B~u | B|B|u | B|B|u Ȃ BȂBu y ByByu y ByByu Ÿu@B@u RffBRu8B8u PffBPu ^ffB^u2B2u2B2u 0ffB0u`B`GQt"u  BBGPt"u  BBfPy"u  BBSS^Xu B u B u B u B u Ÿu tffBtu (9B(9u$1B$u B QfGP@fGPtǃPǃXYu5&4Ѝ`PNXZ1e[^_UEEUVSEPu @F<Fe[^UMSSЃttw ttdt+u Ÿ$%u Ÿcu ŸC%=u!u Ÿ@@ u Ÿ&࿈RAPh3 ]UWVSPPE0h] EEukEe[^_UWVSujP7ǍCPhČ/FpSSV}e[^_UVuS^0fCNtt `PѦXfcPuP@uP@u P$@$u P4ff@4uP6@6uP81@8xtPkdž|džxX1ۃt+  PPkDŽ C~1ۃt+ PPzkDŽ C~e[^ÐUEE 3EE) UWVSHu F@ffF>@}u V<1ffF<]}fCXu f fEǀ}uVl1FlU ~W}u V,ff fF,fF,}u V,ff fF,fF,}u V,f f fF, fF,EPE5&4\Pk]fCP@fCP }tEPh/oXZEe[^_UWV}Sx t1G8| PPx x eRǃx Nye[^_UWVSPE ]E3\PAfcPfCNPӯ[~0_F4u P\1ff@\~0F4u Pl@@l@V~0YF4uP1@~0F4uP1@~0F4uP 1@ ~0F4uP1@xt'F8|v8PxNQǃx Oyʃ}tue[^_e[^_UVSu1hThRЃ~0XF4uPJff@Jfx1C~θe[^UVS]Su YtCPh 3rXZ{0S4uf%Jf f%fBJSfYtCPh 31XZ{0S4u HffRHEfe[^UWVSjUE j47_ÅXx Z79jS_YCXuSP7C$CC x tUB8wPPXZx UB8jjs0s$wPP tPEu Ph`/\h 3EP8z tjGpjPRR Uku xG@ 1ҍpCSEtE @%kB ppǁpCC EP8z tjjpPEtRR 1e[^_UWVS]E)LJCA)LJE)LJK0 ɉ[ $uh2dǃ|S)ǃT)ǃU)h`V)hAV)jVjjjjVSY4lujjj"Vj"V  j VXZ{0C4 u ZZjjS(% PjjSjjS @ PjjS WWShV)V虀e[^_UWVSWWEjP] E^uuSDŽE@l C1ۃ9u9 u Ef@Ne[^_UWVSSSEjPh0 h h0[${0S4u ”{0S4u   Vh0S1{0ǃ ǃ S4u ¨{0S4u ǂu {0YS4u ǂ{0S4u ǂ{0S4u48 ǂ48{0S4u ǂ{0S4 u@ @@ @1ǃ {0S4u= ǂ={0S4 u@ @@ @1EEu,VSjDžXZtsWVCPh3蚷ShU@@ @BtC8x tjju s8P FEEa{0ǃ S4u $B${0S4Hu ǂQ5{0XS4 u ,,,5&4QltUfBP@fBP1e[^_UWVS ] Cu~0N4SECEC}Eu1EE EE EE  EE!E E E ‰ ~0N4[u$  $~0N4u( (1ۃ~0N4u ((yj CThRЃc_~ՃduFE E3Ѝe[^_Pe[^_UWVSjju} vHÅXZ7jSHYCXuSL97tF8PPXZF8hjs0s$PP V8z tjpjRR @@ @BtV8z tjjP RR 1e[^_UVSu1ۃt(F8PP>8DŽ C~ȍe[^UWVS]3 } PrHfcPfCNP谕X~0ZF4uP$1@$dž j ThRЃ~0XF4u, ǀ,1ۃ~0F4u ,,tj CThRЁX~҃~0F4u 1 ǀ~0F4u 1 ǀj ThR1Yt*F8v8P7DŽ C~ƅtue[^_se[^_UWVS]K0ɋS4u ˜%=ɋS4u 1 ǂ{0S4u, ǂ,1{0S4u ,,tj FThRЁY~ҁuCPh@3ޱXZ{0S4u 1 ǂ{0S4u tC1{0S4u  uj FThRЃcX~ԃduCPh3^^X{0S4u 1 ǂ{0S4u, ǂ,1{0S4u ,,tj FThRЁY~ҁCPh3ӰXZh0h h0%{0S4u ”{0S4u   Vh0{0S4u˜ ǂ1{0S4u ˜ujFThRЁX~ҁuCPh3¯^_1{0S4u œtjFThRЁY~ҁuCPh@3zXZ{0S4u˜ ǂ{0S4 ThRu ˜j у{0XS4u˜ ǂjThRX{0S4u˜ ǂ{0S4 ThRu ˜jыK0XS4u œtɋS4u œ1 ǂK0ɋS4u t ɋS4u% %{0S4u˜ ǂ{0S4 ThRu ˜jу{0_S4u˜ ǂ{0S4 ThRu ˜jу{0^S4u ǂK0ɋS4uu!ɋS4u,,ǂ, fyɋS4ujdThRYe[^_UVSufFPt3fFP{0S4ufFP{0S4u FPC0tS4u S4u {0S4u (1 ǂ(jQS {0S4u fNP{0S4u (((e[^UWVS]{0}K4u ǁ{0K4u&u  Ɓ`U  `1{0K4u uj FThRЃcX~Ճ{0K4u duPWu CPh3,1%e[^_UWVS]{0}K4u ǁ{0K4u,E u Ɖ ƁP$U E Љ P1{0K4u uj FThRЃcX~Ճ{0K4u duuWu CPh36e[^_US]{0S4xu 00tu{0S4u 0#$u"t{0S4u 0 0jjS% PjjSjjS@ PjjSd]UE@Pt HPŠX1UVSEHPu xFtFe[^US]HP赊ì 5&4Sf]UEfP$fu@&PPtQZYUWVSEx u xjp W u h3u h@3jjjEPEPjjju$th3oE܉$ E( E䀎4 Pu8 ZYu?uuuuW ÍFPVhjPuuuuW 8|u hJ2[nShO.UB, VhmX)jhu4SDu h3谧Y!VUB&P#YZtShu4|DXZ|W [^e[^_USu ]S)|xq 1]U,*UEE 3EEQUVS]sVSh:jP $1҅uVh3զe[^US] ǃ]UWVS}G u E܉G h G(jEPjw ut|EPw u\ƒ r[vt,OFPRh3ESPw u%h2ESPw udjjjEPEPjjjWd$jjj1ۅEPEPjjjW@$uE@ EtE艆@ E h2D GH j w ug%T Gth Gth Gth @PW[_th٢2|ubÍFPVh:jPuq8u(h 2蔤Yt Sh3脤XZhn 1x%ShO.kdž X)dž X)V]e[^_ÐUEE $3EEUUVS]sVShjP$1҅uVh3٣e[^US]ǃ]UWVSu  E܋Uz B  B(jEPjr WtyEPEp W^à rYvt)MPh`2ESPUr W&h2ESPEp Wj>jjjEPEPjjjuh$jjj1ۅEPEPjjjuB$u EU܉Et EU܉E h2BUB PRF[Zth٢2xWÍFPVhjPW8u(h 2ޡYt Sh3ΡXZhn 1¡%ShO.赡džp[)džt[)VAe[^_UEP$fut1UVS]Cu  C ,j4PEP P PjjjS$t h43EPS[ZthR3juuuu,rÍFPVhhjPuuuu,80u(h@2譠Yt Sh3蝠XZhn 1葠ShA/脠V?e[^US]S10,u1]ÐUExu-=K_tp3m3ЉERЉE Eu3U=Ru URЉVSE] Mt t0h3@3.)  ʁG ~ h3Ff fƍ   ڍe[^URЉVSU M]utt1h3t %t t(ttƃte[^URЉVSu] tt%h@3s ؉ É1% غ  É1e[^URЉVSu] tt(h3 ؉ E1& غ  E1e[^URЉVSK_Ѕt"tR R1ۋRЅtjPjRЃ ;DtpCv׹ 1f%=u 1t4 1 uuRR R1e[^UVSEX4ۋH P0u @5t_~Sh35F^VRQDF t=u C@Ph3 ~Ph@3袜ZYu h3菜X1 Fe[^UUt ƒu uh3 Rh3j@hxUxUUESt u uh3Θu(u$u ujPjtE PuAXZ؋]UEUU1}Ruuj@jPjUEU1UVuSF\Pjhjl1҅u&v\^Sh&3\SVu jpjv\j9e[^UU/USjh3Ћ]SB 1҅u{+C(u t1҉Ћ]UWVS0uV$=f} t =tjDv v <ȺdRЅx УdREԧ{1ЋE؋FE܋FEMF hn 1ЉEgjhi)ЍEPW>f8=1%wW=0%d= Yw$=Lw==B=!(w=0.=%'=qw+=qs;="qw= q=$q=ĄtB=˄~(wjtv v Pjtv v OjHv v ĉ t tPhG3 Ph]33_X Shy3Eԧ{1ЋE؋FE܋FE]F hn 1ЉEjhi)ЍEPWdFtt+tIjjjv hPv ?jjjv hPv jjjv qhPv |P.Eԧ{1ЋE؋FE܋FE‰EF hn 1ЉE!jhi)ЍEPWc3jSv v PjSv v qh3ۗFW4G0RjhhP'O0ɋW4u _ _ @jɋW4u _ _ _  j ThR^Kt0W4u ` ` tՋO0ɋW4u ` ` ɋW4ű XhRu a a V[O0ɋW4u ` ` tɋW4Ku a a uÍEPXhRЋE+ẺE̋U+VVYy HE̍@BFE̅t i@BFh3hV[tzљPh3KZYWhi)ЍG@PSG<WTt hn 1Xe[^_UE S]tP3h7S0 sh2.]UWVS]{0C4{@u ` ` tCK8{0C4sPCPCph[3|q$T f\C f@fEC f@fE‹U4f{ $(v4iTCphx3pXZftjPEpDr -=(v4tCPCpCph 3pfuEPh`3p^Dž_h)ЍTRPuPftȸU BHfftȸU BH$T󥍕TRPuP =(v4tCph3oY[jPtCPCph3o VWuP \ftCjPEpD u-\PCPCph[3@ojW=(v4tCPCph3o h)Ѝ$PWuz;EftȸU BHfEft=ȸU BH+=(v4tCPCph3n jWsXZe[^_UU3t* Ҹ33t3t Rh3 kUEǀɸUWVS}=GW1۾FWuG@VjRRjRPPt h3jC~En 1Ѝe[^_mUM VS˃uv QFPh3VHtQFPh3m h3Ij VHF8uVLu ؃B VPu ؃؃B˃F8uVLu Z VPuZe[^UM WVS}]v QCPh3-u9wGSHtQCPh#3l h;3oi DXSHS@PuVWjWRRe[^_UM S]v QCPh3SHuQCPhM3\l hi3i!‰SHC@tXPP]UWVSQU Ћu } }MEvu GPh3k E t1}w EutBQuu GPh 3k~}vuu GPh|3kYE \Xu$}tËFWЉDX u h`3hG@RuuQSPP EG@t'x tjsjSPP M  %x tjsjSPP M !E U[ TxPW*M !XE ZG8MWLRu  B 8 6WT4Ru 8WLuʈ8WLu ]8WLCuTD8WLu TDURЋWPu  B8 WT4Ru 8WPuʈ8WPu mU8BWPuTD8WPu TDM E G8uWLu J WPuJ1 h3ee[^_UVS] uvSFPh3eSVLF@tXPPٸ!e[^UWVSP] } vEu Ph3teu uEU ^TxE p8_Uu@<@LuTDUHBLuTDCUBPuTDUHBPuTD;Mu1ɋ] EE p8u@LuP X UBPuPXe[^_UVu S]vVCPh3fdC8uCLuP@CPuP@ ȉe[^UWVSP] uvSFPh3c|XSVrSVVuSFPh 3g F@Ex t+uRwjWv@EP F@WPPٸ!e[^_US U EvRPh`3KcuH@uEPjEPUShRQQ$ u EU1]UPPE UvPBPh3bEEEER@EjPRR(UPPE UMvPBPh3bEEMR@uuQjEPRR,UU EvRPh 3db@@uuPP0UPPE MUvPAPh`33bx$EEEEI@u uRPjEPQQ4UM EvQPh3a@HUWVSPPjEP]Su V}WQ1҅ujjEPSuVWu!uuj uSuVWSuVWt1"8pXEA U`RЉQA `RЍe[^_UVS`RЅUu `Rt9PtH@t9PuuE3Ѝe[^CdCsRs3ess s3u ] e[^U`RЉSU ]t9Xt @t 9Xuuh 3cjuRpp p0 ]UE S]C8u.SLu ȃ ȃB {8SLu ,B /SPu ȃȃB{8SPu1B[ÐUWVSQQuF|^t`uu\ulf8ftfHu[fuQj`S?YZEPjjj`S1҅EPjjjdStjuSk1jjuuSChuS u1'jjuuSUtPhI 3[bX1ZjuS juStF|`dždžhe[^_UWVS EPu VPXFTFX FL)j`S&_Zt!$UЉE UС(UЉE\UqEPjjj`SuEPjjjdSEt h[ 32^jjj<~‰EEBEBB `B r V0hn 16aVEe[^_UWVuS^SVh:Mjpj} tTvPu4\4Sh 3` 4\4tTShv 3`e[^_US]C|t=u7\t= u%ht=uf8u ft1Mjs荕ZYussXZ1҅Yt*C|ǃ0ǃ\ ǃhЋ]UShn 1Ћ] `jssu “]Ujju uqÐUWVSPPEPjhh u V}1҅Uuff Uu ZffZUuffUuff huV 1fZu,EPjjhW61҅ujuWe[^_UWVSRREPjhh u V}1҅Uuff Uu ZffZUuffUuff huVV 1fZu,EPjjhWp1҅ujuW#e[^_UWVSQuE E}U^$F$F0S~4Pjh u PR th!3+CPjjuPut h"3ZF!3FF ;CuP@;CuP@CuP@;CuP@ x!3!39|1ɉș=!3FF FVE ue[^_ӆUS]C|t=t =\t= t = ht=utf8ujfu`s ZuW{|t\ tssZ1҅Yu@{|t"\ tssMZYu1FtyUЅt҉C|ǃ u \ǃh]UWVShn 1Ћ]} [sAYE^t@yUG4$yU}jjj8о {|t!\ tssYZtj({|t0\ t$ssWYZtjssV  h!3Xw0Ejh-*ЉEEPW}E(!3E@!3'e[^_UVS] SuV)Z1҅YuSVZYu6RSVh@yUj5XyU5TyUh@yUh!3 yU1e[^U= yUt=$yUuE;dyUu1UUUMy4~ (EQ0EEEA41UEx0@yUu h"3VH4U1UEEtp1UWVSuV|1Ƀ^EPjjRS1ɅEPuS t/EPjEPjjuSE@EބJ}@ufjuS' tRf8ft;Eufft ;Et1*Ef8Efdžhdže[^_UWVSEpHhn 1ЉM܋] XEPjEp|VtCPhG"3s0US4MA C8EPRV uCPh`"3C@Et Pu7SEgu"3(ЩYtCPh"33XXZC@sVShhj@juuCDu Vh"3W"EPSտM GWЋQ|@GW@ GWЍe[^_ÐUWVSP}E_Pjj w|S1҅u3uS\j uSKtLJhLJ e[^_UWVSREpEPjj Ur|V} 9_t Sh"3Sw@EGDhn 1WSWhLj@jU8Pr GSh)ЋhP~ &4љPhPs WhB<9uGhe[^_UWVSWWU EEUuPh`.8Mh$3I{,MAt u C,xPEPh.QUBtXЃtt!(MAt{4C,1C,(PEPh.L C,C(C{$C~{0uuEEe[^_M싑z~`C tMA@x tjrjRPP C t$EP@z tjM싁pjPRR UMB@PPY^uuXZ]e[^_UWVSEp|} jdThRлX<0thThRKXuutqhThRЍEPjURjWVE EЃ t tBJt%@t€t1-&Ph %3)KEЃt1 tt? t,t1@t%* 8 1 * #Ph`%3J~}t MtEwDWH_LN1Ƀ}uHMf8fu f8 9йu%Uffu f 9عu1ɍe[^_UWVSpE@DuEP.#3йuUEPh%3IEPjURjuuE( jEjEEPjuuE)EEPjURjuuE EPjURjuuE EUƈЃ03.u0.ЃQ4u:.PEPh@.7I1ۃT+΄y=рu t*Ѓk2PPESPh.HC~jjEPjhhjhEE u*jh'jjjjhEP54ƶ$t h%38EEUBh]tjs4uE u1ۋUBhBhD@C~BhEPhB@UǂEEBh %jj MQjuEuEUe[^_UWVS}wDjhC2Ѝ_PS蒐URjEPjWVE$t#<0thThRKXu~uhxE1wF$&3jh4#3+jh9#3"jhK#3jh.#3jhP#3jhW#3R EGbGc.EGdGeGbPGPPh^#3Fe[^_UEx<~@<E騳UWVSPPE@ EURp RVUY_EUBEt C'My$ACPCPqWL EP$$F@jjRUr v@P 1tSVMA,;x}EK>T AAQT$AQG;x|Et V@z tjpjPv@R Et V@z tjpjPv@R P >CЍKAQkPCЍKAQCC@@CC@@CƒSMQ ЈCQ ЈCC C CCC C @@j@SVDE x$x0@@u jjh{#3jS@tx~cEt V@z tjpjPv@R Et V@z tjpjPv@R F@v@PXZSVuW7HW/X1Et>uV7 t#SuuVtSYXe[^_UWVS]}ۋwDt+VyWXE @t1hThRKXuոe[^_UWVS]j@nV@z YtjpjPv@R @ p P(hu1BXZt h.BX2hn 1B@,ǃSV8 }e[^_UWVSPPU\1҃+3ЋU B@J$4- U BD1EE @D+3Љ+3ЉE싻+39tE} vЋU B@t"HunEU BHEEU BHEBLU BDƀBDƀZBDu ZtE PhO*3~A1%Efǀǀh ǀe[^_UE t PhJ/6AZYUVS] Suf[pfCVCl̈RCdRfCZhn 1@CPSh)j@j8Pv¢$CG,G$CG j@'SuEM u>Shp)ЋChPY&4GљPChPTu1BuwWu= t"S hWu" tSYe[^_UWVSPj@u} wEXtSҋC tB S Cj:jjj t19FPh*3=_X'ujjh*3jPmue[^_UE M@P ȈRЅuUWVSSSȈR1;REEDRЋUj@NYFP BJVҋF tB V FWCH$$Zu S^YVSxZYtLj@NjFYVt P N WZvKuCH$$uSiXWoXt SEXEE;R}ȈRe[^_UWVS] uj@CNjCZSt P {K uQ^}e[^_UWVSQ]sF x Phu1(;j@E Ct$h. ;C@KSWe Ghn 1:KSWk Fu)Shp)ЋChPw&4PChP~EEe[^_ UWVSEPH2 uPEPh*3@%$ t It %$uUBL0񊂔uPЃPh`(3):VU!ƋBHEPH Pt At uEPHPu IttUREMQEEPuEEEyPEPh(39 EڋUtTCx ѸO9u%fEf;GuSҋC tB U [u S CۉuVEډPPEPh(39EUEEEE BHMhQEPURu Me[^_UWVSQE EUE}21ҋGHuBO~GPh )38XZI@uƒ ƒ ɉʃE9uWLKvuuU2EGHt U E tUE 8t1e[^_UVSuFH] `VLFH01ɋVHx A-~x9 FtPh*37KPh*37KYFH[`jThRЋC@ HVL FHjThRX1ZVHu A~u `KjThR1XVHu A~FHt5C@ @EEEEPEPEPVEE FHuFPh`)36XZC@ HX ЈFH1e[^UVS]u t#9ƋPuҋ@ ҉u݃t1t}9urPSZ1҅YuoEEEEE CHhEPEPEPSt)9ƋPuҋ@ tB V F ҉u׋@ue[^UWVSu ^Ch}PFC(FZu C(tC,FtC,CCPVW] e[^_BvUWVS]ۋ} t8j@mXȈRЅuVmG^t1hThRKYuȸe[^_UWVS EEEE1ۋUBH@EtЃPh*34XZEuZ1ҋMAHEuHB~u>ȃPh)3_4j@}LJƋE@Vu Mu~@uЃ Ѓ ȈEE:EEtE8$P,3Ћ}?u h+33_UB1ҋMAHEuBO~uȃPh )33Y^u~@uMщЃ Ѓ ȈEMʃE9u^}?}܀MUILBMu}2U}܋uع:-MA>Iu~<VEEEPEPEPuEEЃ$,3Ћ}Gh)32UBH`WRj@MǁPuF@ H}X!ЈGH`VWEPh!+32XZij@aƋE@UMA ȃBHǂ`4$2HPEPh>+31 EEEPEPEPuE}ubEPh*3`1j@}ƋG@ HX‹M!ЈǁGVWEhuF@EF@EEPEPEPu-EEEPEPEPuE}WEBX hZ+30XCEPhn+30E@Pue[^_ÐUWVSDu^Pjjv|S71҅PSLjSt^f8ft ;ufft ;t10f8fdžhdže[^_UWVSQQ]sChn 1Ћ} E/EPjjs|Vdth-3w0EG4WPVz u h,3+GSh)ЋhPk&4љPhP`t9uwThe[^_UWVSu ۋ}Eu e[^_ËS,uj C4PP<tVƒt(t O@tAHGPhx.3"C,YX[F<uu }e[^_<u>C,5C(,FPPGPh/3X" C,C,PC$tC tPs 3( VWKXZ]e[^_cUWVSExu1u@uF1}u1u@ uSCh'ThRЅXuS1Ch ThRXu@tuSCtAuSC<t0uSC} P.3tE Ph.3! u@ut} .3tE Ph/3 Y1Xu@uhԻ. Fh'ThRXZ~ԅu@uh / 1Ihn 1 X} t3E ǀxx@XDU8U BHUU BLe[^_UWVS]C@E܋{D1DTƄB~CTǃt1`GWdGW`GWЋ `GWЉi ǀGXGXЍrGXtdGWi GWЃǂGX`GWУ`GWЉ~ExExCTE0EE % ‰j MQESEUEEO }utjEPSE+ }uWGe[^_UWVSjju uEPh03ǀǀ(1FEx@@DuP@j@VuSǹVuuQFPFPh.3(FV ЋUBPF <_^wPh@2CX <_Zvhn 1Vue[^_UEx<~@<E霊UWVS UB @ E@@EURDUE@EtEPh.3nu U1zPPuR uE@,hUBB%tEPh@03UB ~ PFPEp"EP B BFU B t1FExP0UB$"EËB E ϋE%~@ EWʍGۈPHtQG%E)9Év‹E%U)ӉEt ρ;MtEEGU؈WEt%}cEjPh03 F@ % ‰FЍNAQkUEH$~EPh03cUB tQr B! 1󪋆 % ‰FЍNAQEP$FЍNAQ!FF@@FF@@FFFF@@Et!}u UUB}u U E@ j@觵VuS譵1EtjuuP tMVuu2t/V^&EPh.3Y[UB,Vuqe[^_UWVSWWEEu V"UC,xPC$tC tPs  }1EC @UBB FF!F9F % ‰F3ЍN3AF0QF0@@ j@GVu] e[^_AUWVSP}]G@EۋwDt4}uyWXE @t1hThRKXu̸e[^_UWVSP}]G@EۋwDt7}uyWdXE t1hThRKXuɸe[^_UWVS]j@aNj@ p P<]hu1 t h.Z2hn 1@,ǃSV[ }e[^_UWVS};u'1Ҁ;uZ9uB~KAS A RWYXu$GPh13XZ/GPh.Y^봋hPJPVW9u;ve[^_ÐUWVS140]󫍅DSPjj@s|Ro4LSPjjHC|PR;uGE @tX@WdƅXtǃǃhjLH跨 jD@表 e[^_UWVSPu }]hn 1WV|GG40Pjjw|R聥u&PjjG|P[tFPh#13P[XF|FE^pPShSj@j8Pww8fft*<N0vDFH)FL)FP)VYV0 F0F @t V0FlF4^lF1t4V\Z}u>G9|V(YuWjV_ZuD}u9¹u!}u S CC1ɍe[^_UWVSPE] ps4P|1fEPjjRVƀ1ɅJEC8uP@EuP1@1hThRЅXEuP@t G~ׅEuP@ƃƃSBYSZt1҃BA9|fA t1҃tfBA9|\  f fEǀǀhjuVXC8C4juV81ɍe[^_UWVSSUBu UF4RjjUr|P>~3藺 f8ffff8fuh >3^1{uɋuBt fǃ t fǃ fǃǃu1e[^UVS] uC$jPCPϿǃFJ*ǃS*ǃ3qtHtth8>3h=>3 hB>3hG>35C$ShvO*jPj8Pv ]e[^UWVS]{ qhBTfCNNjXuuQ A ftu Q A 1҃ruT D ~Ճu Q AAu Q AAu Q? A?Au@@fuQ܊R% ܊RЊA% ЈAk)ЃBǃuQ1Au Q A u Q A u Q A u QȀ AȀAu1uQ A uQAfuQffAfu Q f fAfuQ ffA fCP@fCPujThRЃ^uS[}e[^_Pe[^_UWVSE8hPEUBQYMɉMu1ɉuEH ҉UutI I+x )ڍA9}t0U܋BUu ǂE@UEȉE䋗9v(+Ew EM E)ЃE䃿u EfMfJ u ffBu 1ffBu EfMfJu ffrU1ۅ҉Ut;MAEuufoffuN Fu)ك4fo)ٍ4ffEP )؉Ãt MADEu6uYt0uufoff9;EtGfu ffB u EfMfJfu ffB ɋuffB؋fu ffB u ؃f f f fBɋuffB9u=ɋu EfMfJ uu艷ɋuE艇U䉗MA8t uPXZufFNFlu5X EfHPUBQuLe[^_UMu@@uB BBu1u  ǁuBuBBuhThRUWVS1]Tt#ɋuP@S0,1t'ɋuP@SDXɋuP@uttS<[e[^_UVS]9fCNfu P ffH uPff@uPff@ȋuPff@ tClCpKt9gfcP[^UWVSSSufɋuffB؋uffBɉuffB EjjAZEYu EpU҉P@ }vjSAYC_C S E9vЉC {u fmffK t{uBD9C )E}~jj_@_ZtP@ MF8t uPY[uVFdXZFhfu fuh1XfB ɋuffBf=9sɋfu#ɋfu ffBe[^_UWVSPPu>] hEG2i EXw!1i  i ti tRi tk!i t#{fNPUxuHW.uV蔸EjPP$ GfVPЃA@ufVPWW^!EPB=w 9VXt VXEu0GEe[^_UVS]hFSrSu e[^FUS]fcPCpPX]]UWVS E }fEE胿uu B EEMtu J u B jThRЋE[Xu J jThRЅY]mu B E]u B jThRЍ Zu B  fMۋEXu B jThRЅX]u B jThRЃXu 1B jThRЃX]u1e[^_ÐUWVSQQ]EE}} Mu‰fEf<}u UfEf XZ[^_UWVSVuE] u‰fMf uUfMf [[^_US]Sݧ1҅YtSЧZuЋ]ÐUWVuV} WEEEEEEZYuVWZYuVW(Z1҅Yt}Ѝe^_UWVS }EEPjjE p|S71҅:ELJLJLJW^ujuSN:ۋUuE 1ۋUu B ۋUu B u|ۋUu B 31_1NۋUMuUM7uv؅ۋUuE ǀfǀjuS\8e[^_UWVSQ]EEPjjE p|WY51҅EǃǃǃS 1ɅZujuW71>Equ vߋE ǀjuW7e[^_UWVSVE xEPjjE p|Wu41҅Edždž džV^1Ʌ[ujuW 71>EYuHHvߋE ǀjuW6e[^_USjj]SjdThRjS1fuLPjSdЋ]UWVSPP}EwPjw|V] 3tCPh"36E4 Rh13Z^Xu{$4\- P1;hs B;hrh19ʉMs 8 uXB;UrtUfǃLǃThXYjjh@ PuCPh?3 CPh>3蠢fǃLP$yTǃX@YsǃGǃkǃGǃ kǃǃV*ǃXV*ǃǃ Vh2Sf ftP5GW4XZVShW*jPj8Pwe[^_ÐUWVS11j jjhRj4HPC&~ӿ !!!!h 栰(桰桉案案栈栍e[^_UVS1hRP&KXye[^Uh@?3jO1UU`I_@`I_w A3w #4QRhA3jUWVSR1ۋH_1tJ R ƅu4@H_t !C~111ۋ@H_Љt  C~  I_F I_~1 (I_ ,I_ 8I_ I_ DF~1ۋH_о1Eu 5LI_*J  4 I_Ѓ}t;M}M9~ϋRu։ I_9tPVWSh?3IE4I_ЉI_Љ tt~S9~Hx[@E}uEAE AEyE@ptC9tj`hK[^e[^_USP]ۋM uQAۈEuQAuQAu QAuQAu Q  Au QEEAX[UWVSPEPjjhj}Buujjuju GD fR9J_}1XRЁ:**t@,9|J_J_GGe[^_UWVSh}] XuSCtu3uSCQe[^_UWVSP}] uhEIXuSC uIuu`uSC uIuUUe[^_{UEEEEE@f1 ƒw DpJ_ pJ_htJ_jj5pJ_5|J_t hG3Dc5R5tJ_5|J_ J_UWVSP}] uhEXuSCVh gZYuu SSuSCuSCuSCuSGCGuSCEEe[^_"U5tJ_5|J_Uu 5tJ_5|J_ UÐUWVSjjj}pà 1} tjSjjjjjJ_PJ_Ѓcjjj1 t'GUVtuF ZujVjS1Cu$Su uuWjPF~3CECCC C؍e[^_USPP]CtP"sYXEJ PEPrQ j36jS.]UWV} S}tE 8uG'1;7}GjSu ? tF;7|1ҍe[^_UWVSu] }FSPhH3c ~DPhU0cXZD<@ ED<@E EH3Ѝe[^_cUWVS} uE |<t uv8_XEV0PEPEPEPSv4RusuuuuSujV uF0uv4P ?E \My yptAl w/\<ۺt"jpFPjp FP1ҍe[^UVS] SҋutBhjRx4XZ1ɋfR9}XRЁ85*tA,9|1;\J_t~u F t EudVW@jp 9wpuGpU D<PF [tVYXVG0Sw4P u GPhH3=a1e[^_UE @ ttE8t 1҉UVS]s ssu F @ p3V;tCUЁRu51ҋ fR9}XRЁ85*tB,9|F ‰Se[^UE t PhH3y`XZUE t PhH3[`YXUWVSS}uEx W VYvhH3 \XZu hI3\ds\x WhH3_Y_E TtujjjjjjjV^ F<5J_5J_hH3Љ5J__dVDtPh I3_XZFu(R)=(R(Rtj3V t;ue[^UM AUEBA$BAB ABEBEBEBUWVSuuu} W]SJ_VJ_C$J_t hJ_jjj hJ_jjjWPtEF hJ_FLFPFTdžFxFtFpF|4e[^J__U}WStJ_(jjh转u uuuu P$EC$jjs葬CLjjs 肬CPK 1CTjjh`$jjhICpjjh8Ctjjh'$CxjjhC|SSNe[_US]SE ESCLtjP袭CLXZCPtjP芭CPYXtjPoǃXZCptjPTCpYXCttjPA|/D`#ApAt AxD`[U} 5Mu ApD`1UE %S1ۃ5Mwj$N3л\ApD`M=6/(!  PQqXZ؋]U} 6u juUYX1U1UUS] t [U} \u u1 UU V0S ]|49~;t"( Fk DЉ1)@ ~ ǃ $tv [^UE pU|.q~)tu$vuǂǂ UE W3VS]!$dO3Ѓ{TC19sjV6PssR CF9rs4C)PVssRSPCCT{TCNx6jPVssR NyC19s&s4jWssPCF9rߋCSPCH9CCTv?C:1;{ s%1;sss0jEVWsFP;srG;{ rCCe[^1_UU ƒ!VS]wB$|O3Ћ Zk ҍDЉB:2*@ ~ ǃ PSX1Ze[^UWVS]C,@} utSKTRsjstGЃ uRSC(t}tuRS RStEJ?tI&i? h?t} l?p$?j h8P3ZSo S[^1;j!SF ;|1;j!SF ;|e1;Wj,SF ;|71;)j,SF ;| j7SRvj7ScSYjhDP3s$11 ;ss]CL<tNFPv/u #4PhRS0jEP7u1 vPEPs$x F;srjhQP3j hJP3uKM{TmCEE+E9vЋU‹M)хɉƉM~euReussP s4KTVCBuK+CD9vЉ)‹CPStR<2uCHCDK)H9vЋSP҉Ct<tCH9CCT@2CT2uKTCK)H9vЍCuC9Љv)c,Ks,KPtuCH9vCDuC 9vHɉCt C<tCH9CCTv CCTuCKT9vHCs,@uCH{DEK8)9vЉƉȋU))‰SHKD}Lu VSVS4XZ{DMKHuCKTEM{)9vЍ8ƋE)ЅE~MeuWRssP s4KTPC)PssR6uSKTs)9v‹s4RVssP- j hTP3t tSLC{LK1C<{8ES@U1;}y/wd$P3ЋH91EE<72-(#E (EF;|EPEPuuWSB/EC0EC4{8MKtE}xuhH3(_XEt Cl@{U.jjj$菋Clǹ EFpRSh*ЍPClX FCpF CtǃǃCxPPCl0t hsX3$Cl@4RЉ8RЉt/({UhX3'SEC\Y^tPh I3j'XZhn 1^'}_x3Su$$#Y^tECE EX3Ѝe[^_$'e[^_UE@{Uph@{Uh*ЋEh*УD{Uh*ЋE H{Ub${UU@{UD{UH{UM${UUWVS]jpXtst*{\t919}3ClDpPs\FTY;X|Ss t!&4Љ1PPXZ}e[^_xU} u Eƀ1UWVSu~`tV"[tdžP Y~|t ({U^X{jpNjHZxC@CC=vCCPZ{XtCSY{tjjC$Ƴ jk&4EEU9‰E} ۉtEM9} ۉuȉEEPhZW v\Ge[^UWVSVE]E=u} t* = t :=t1hj7vl]h h@j7vl?FlP u`1`~\Í .$ Y3j-Pv\jjv\=;Wuyj5U;W萦Y[^1f%P1f$DPj:1f(P1f'DPj1f+P1f*DPjV41e[^_UWVS}} _ uEu g t$;k ЉEEPVE7 t#Uf:tBPPE PSE؃UB-w{$Y3jjj0j*j&jj j@hhhhju W ^hju WG %PSR2tXt%E u ;u ;t&tǃPHX} V}LfG tG 0u E܃E U܃UO tDEfPfov1҉%=t uUfr-ȃuUP21YEfpfov)Ӊ%=%=uvthtt)uMDf uDhjjWSG uhjjW5Gf_fu W1G~fu!E܃9EuUfDrf9DrtGWt9)f\GB1҅GGPhjjWWKfoZӉ%=ty%=uu]G 0t7Cf:vf u#f2u1Cfw f8uG tGtfGf_ ˀf_e[^_ÐUWVS=REU܋RЉEfMfRЉ}kfEfMRЉRfRfRЃKx%fRf9u MR)xkUFRЃEUfRkR1۾יMkff9RufAf9Ru R2tי\Nיu[^_UM fwA@RfovCщ%=t2%=u%=ufw@Z3ЄtUE VSMu$@[3fFfFfFfFsff^PJYfFf^TffVfAfFfV?ffFfAfFfAfFAP ZffFfAfFfAfFfAfFe[^UWVSEU ]EU]ffCfCfCfCUB];~ 9t wO q9Mffov'Ӊ%=t!;0f,Ӊ%=u%=u;E;UffovӉ%=ttf tftfu fUfE_]G E܍X9sm΋UfQfov#Ӊ%=t,u 0ft]U܃ZE9r}~P7h`[3 ]E]E Me[^_aU؃r9}G>e[^_UWVS}u9Ƌ] t#~ j3rXZ7jjk Pp 1;}61ҋffDfDfDfDA ;|̍e[^_UWVSHUB1tG{~t 9t { u rh[3 { \ċCGuHEEU\ċs u[^9ffov#щ%=tus0fuhщ%=u%=u;E;U~4щ%=u U%=UueMY9IM%uEu @P) O}E\ċs CF9ffov#щ%=t!u 0ftщ%=u U%=Uueffovщ%=ttf tftfuU fkU fEKMC EH9smUf Vfov#щ%=t,u 0ftMUJE9r}~P3h[3QkE M PuVE4FS CB 9yMX1e[^_UUS] ff f9u RC)‰[UUW}V;=RS|zjjP5Rm uWh \3 1tRPSV RЍW9} @9|GRУRt jV{n[^RЋu&WhQJ.sZYu hD\3v XRЉ؍e[^_UEf1VS R] ƅXt<1t2~`tVAX~Xt^4SECSV1e[^Uu u1UWVSu^pFp} 9É~XtC0WSPX[dFp9Zue[^_UEf1V SRЋsXtS-CXVe[1^UE@XP1UVSu^pFp9tC0SPCXFp[d9Yue[^USEf1 ¡RЋ@Xt E[3[UMf1R ʋEUWVS} EUMaWuEUMrbWv`WuE vt7w2}fw|f?1~f,bW)waW `WtcW8^X1^jp_E܋sFיK ;XuuN%~1UBABAB A APCsP<_{XtCS^{tjjC$ uӡMtt\u }GEe[^_u UBEe[^_^pFp9t"MS09u A9C@[dFp9u޸8^pFp19t#C0}DCD[dFpB9u݋E^X۸U1:C^X۸S}$@;J4^X۸C$@U9w~Xu ~\u dE^pFp19tOC0uuuWSP uE[dFp9uՃ}t1ҁWuMFx S1Ѝe[^_USEf1 ¡RЋxXt @XE[ [US] u4Zt8x`uxXt%ۉt 9tR`u]E ]qЋ]UWVSjjj|u g1 t<1VuCphRS0ЉCpCtjCP߉sC0RCxe[^_UWVuS] Vps`SdFtCh9Vpu^pFtXd1~\^tt:C0xt1VSPǃXZu1u~xtS0jjFxPhWSR VXt C0RSPYXt.FpKd9C`ShuVtQhSh9‹CduFpBde[^_UVS]s`~\tC0xtjSPXZ{XtC0SPYFpKd9ShuVtQhSh9‹CduFpBdC`e[^UWVSu^pFp19t7C0xtuuuu SPu[dFp9uυt1ҍe[^_USE 1Ʌ]tH\ɋS\t Ҹu Ҹt M ][[UWVSPE uu1F\E^pFp19t/C0xtWSPYXuE[dFp9uك}t1ҍe[^_ÐUVSPj] SuVG EtDjjjjPSVEEIt@jjjjEPSVEISV,G1$jjjjPSVEEIe[^U1҃=K_tE;K_uE ;K_uUSS]{t E @ 8tXs3FjEPjjEPEs36I$ts3ZY:E x5huS)juSdždžhjuSjuSe[^_UWVS}EwPjjw|V] uEPjjG|PVt ht3s@ECDE܉CHCLCpCxCpCthn 1CPSh+j@j8Pwv[ {CLPPPh u3Ph`u3Pht3Phu3(e[^_UVS]j@4SXZue[^3UUWVSEU B My@qDt19B 8u 1ɃBUBuٸ ؍V ؃FhThRjVWPVWhThRЃ jVWu3hThRЃuVFE@ uuU% t1e[^_UWVSREEEX ۋu 8t@t;@Hw/$v3лR! RTRR RRЅt3ss s0hDv3: hbv3+XdžEt`DP^0FF\dž RSVSrQVh+jhu4cVh+Pq(Vh+P\uE s+ЉE e[^_:UME ɉt0RtNRtB1TRЃ Pt RЃ@t `uRRQuhw31UWVS]CD% REEH љEKTș}u C/jSS0tFxFxV2Y}e[^_mUWVS}_$0u>C| }t +t$CxCx Cx jH љPjhv3h1V[PPPh u3Ph`u3Pht3Phu3&F0@F0F4VW^_C|e[^_UWVSE%M  RЁAF]}4zw,>F4@Pw@F@TeedAtNXmt0wmd==Fgd 1f;1Te󫍽󫋆H ≕|@@@ Dž\flopDž`py dDždiskDžhfDžX DžlfictDžpitioDžtusDžx@$ fDž,fDžDžDž TPƅfDžDžTWEVDžWEV۸fjPTPh +uA߃Te1 jjSTPAHuijTPh +uuCPh"3SjS#Se[^_UWVS|} Eċj juVEȍEPEEEEEfEfEfEfEfEfE1ۃt1fVB|f;]t1u ,=$419fE}uD]D]t tt f E Cxu T  L x9|E u2B2 ufmE3 fmEЈB3UЃRUt @t@E t , uZBZE t ,e[^_ÐUE @pE0ZZYUWVSu }t$hSGP\VSh7S0Fwhy36e[^_UU B Mt ;At1 QRuPUWVS8uu u/$hn 1EPxŰ@PE$E9EĉEEUB E܋ẺE؋EĉEEPjhuUW}ԉUoi1ɅtE uăPhz3\>EЍYu   D)~uyhuWk %1Ƀpu*E uăPh@z3huWkEЍYu   D)~ډЉЃ|M@Eȃ% ƒ@UUY0ЃEY0ЊUEhuЊY0ЃW@EY0ЈMEEjh%+h>%+ЍEPu EċUE9USe[^_Uuh #4hy3uu ÐUWVSEx0p8+u  tj ThRKYuuEPhhz3h{3-uu Zu XMA@u@ M H @ U P e[^_UWVSP}]G0Eۋw8t<}u  tWXE @t1hThRKXuĸe[^_UWVSPEx0X8uEcu  tj ThRMXu}uEPhhz3\h{3u  u ƃ uE  E  e[^_UWVSPP]Esz3йt=sz3йt,sz3йtsz318uLEPjhC Pu}e1Ʌu)juu hu3he[^_UUWVS EP 0] EUs0S4PjhUB PVdth|3EC8SPVI t hz3SǃXffǃlRǃRfǃuz38¹z3thuz38¹z3tGuz38¹z3t&uz38¹{3t2Qh{3EPs{ts[^hn 12O1۾3ЋE6PZYt C vk 3Wh\3M 3ЉjQbie[^_UEx0@4uP@UWVS} ]fGfGS8z 4tjh(+PsQtBQtkffCVC ЈCQrBQrk\xCFV ЉCFV ЉC FCF2Qrk\xBQrCF ЉCC CFCgQuBQukXCVF ‰SVF ‰S FV ЉCVFQvBQvkCVF F F ‰SVF F F ‰S V F  F  F ‰SVF F F bQvBQvkCVF F F ‰SS CVF F F ‰S1ɍe[^_UWVS1@uDžDžDžjjh‰E@B 1VZI~8VHu~8VPukE :\Yt3t.u!E W@PFPh33Džt9G~Vg_~8VHu~8VPuÄV&[~8VHu~8VPuVYY~8VHu~8VPuf 19lj}QV{Z~8VHu~8VPuBG;|fv*E @PFPh3Ř trPPPPPP*@u%E @PFPh@3h t-Jh=_t)PjPY[u׋E @ Ph3|3PFPh3֗1e[^_ÐUExru@tu xsuxtv1UVSUB] C|BuBxBxC|B0CPspVhSj@:P8Pr4ClK0C4slCVXY5u uu8 uue_4ZuUBP@tV[1VYuO(e[^_UWVSuF8E~0^4h (EVXZuSffCu~0F4u Pff@1ɍQUuM~1ɍSu1ffDK~h(jVhXjVu SffCVXu SxffCx~0F4u Pff@1ɅuA ~uS ffC uS ffC ~0F4u Pff@uS C u S@ffC@~0F4u Pff@VXu S ffC u SHffCHluKEyuExEfyuxfSu SihffCihlHuSwuvfwuvfSWkUfBP@fBPu%5&4VHEEe[^_EUVS]jP%SSIu e[^}%UWV}SG8w0_4f`Pf@NHP3HYu SffCh@jW u SPffCPu SffCh(jWphXjWcu ShffChu SxffCxu SpffCpu SffCe[^_UESX0ۋU H4u  EfEf uQffAu[UWVS }G0E}G8_4EEuSffCt&}Eu ShffChWXt2}u ShffChG8EfPDXt7WVGPh3}u ShffChPtWEFu^X}u SAhffCAh}uSffCP Ee[^_UWVS]{0s4uV1F t9t=hcd=vdǃhSX<t'u VHffFHfh@huVFȄMe[^_UVSuc~0F4u ff tjdKThRЃXu1uFPh/|e[^USECPhw/YXZ]]UWVESH8x0p41҅t @BuuAQtAQtu Vff^[^_UWVS}0G4_8uPff@fxE@u%PW<ƅXZuChh@jWC8Cdt VP6Y_VSe[^_UWVSE@0EUR4jjuU_8X1uu u 1sE CCUhEU` } EY}t:jjÅXZt}t} vjSyYC_t;u vE ~*E}{Pu fm(ff}Ku UUBs E)u } ]Sh@ju%uEe[^_US]{0S4u ff fBfB} C0tS4u ffBS4u ff fBfB{0S4u ff fBfBjThRЃ{0XS4u ff fBfBjThRЋ]UVSujV-XKZye[^UWVSSh]E1{0YS4u ffB{0S4u 1ffB{0S4u ff fBfB{0S4u ff fBfBSLjSjS~jSvjSn$1u PSWXZu1uPS=ZYu{0S4u ff fBfBjThRЃ{0XS4u ff fBfBjThRЃ{0XS4u ff fBfB{0S4u ff fBfBjThRЃ{0XS4u ff fBfBjThRЃ{0XS4uffB{0S4u ff fBfBjThRЋK0XS4uffBt ɋS4u ff fBfBjThRXu{0S4u ff fBfBjThRЃ{0YS4u ff fBfBjThRu'e[^_UWVS EEE]} EhE{0XS4u ffB{0S4u 1ffB{0S4u ff fBfBSjSjSjSjS$1PSYXu1uPSXZujSjS1uPS_XuEEe[^_UEP`1UVSEPu )a4F8Fe[^US]h{0XC4u Pff@8%=C0uC4uP @ C4uP1@{0C4u Pff@M]+UVSh]ƍP5`VH5&4SOC K_4C K_*C K_ C K_vCRs VX[;uhn 1y]UE UtrP2h3xUWVS=K_EK_u11M1Ʉ-=Uh54;1XZjjjjhVPE䍾EjjuWhEW6%9ErjjuVhEW6E}rEU fBM EUPHe[^_UEf1 ¹u1ɉUEf1 ¹u1ɉUUUUUUUWVSV] EME}ut9t $4t'Ht ~tYw5$4{[tgCuYq[YtGEEE u} Ee[^_ K_ЉEEu} Ee[^_-e[^_UK_Љ1ҋMt1:t&%=u9J9 t :u:u1ÐUU3:33tt3ЃZ3t`R3ЃD 23tJ H3t>_3Ѓ $v3t' @3Ѓ` 3Ёt`33UE @PPI$uh3uh@BThRRUUj=$4ZtjXjjUjq=$4XtjYjjU L_XUPj0E pujgUЃt 5u4XU=L_MuA4uL_/K_BЉK_tE  RA0P1XZ1UWVSu EF ]$p3E= L_=L_L_vSG_Z(L_= L_L_Ѕ=K_u =L_t L_E@L_vS[^^K_S= L_F=L_9L_?= L_ L_Ѕ=K_u =L_t L_E@L_vSgZYL_}Wjh S uoUtc;Rs[C4%=tL=@u9S8t@WSb_X5VSbXUPKvS]vS6<L_vS+=L_v6]SjhSW tShŒ3Y[Sjh S4 Ee[^_UWVS=L_uEt jjXZ]1Sjh S t}xShӌ3E^_ SVhY[t=L_u}uE=L_tL_?!=K_u =(L_tL_C L_Ѕ(L_L_K_L_L_tH L_ЋEe[^_U1W}1}E=L_EPu1PhS tEPh݌3AY_}UWS=L_] tK1}1}EEPShS tEPPF$Sh3pe[_UW=ؖRU t=L_u vC1}}WuhSU 1҅tWh3wXZ1Ҁ} ƒЋ}UW=ؖRtE=Rt<=Rt3&L_t*1}EPjhS R}UWVS=ؖRth= Rt_RЉ L_9΋L_u9tA1}EPjhS8 &L_RtL_УRe[^_U1W}$L_HEu/u*EPjhS uEL_ЊEL_f1}EPjhSE uL_L_+$L_$L_Є҈L_ТL_uL_L_L_PL_Ph3gn &L_t R Rhn 1 R1n}U1W}=L_EPuPh S tEPh3&XZ}WjhS t Wh3EPh.3mY_}UWVSQQE=ؖRXuY0T3йuHCtBS t;C= w = w(C= w C= wC= wC= v1gEPjs sEp 1҅uGs uEp EPjssEp 1҅usuEp e[^_UWVSEX$L_S C@%)‰S CS@%)‰SCS@%)‰SM Q fzt$L_f9BJt f1 ȣ$L_ЋU B @t  RM A @t Rf L_8CL_Ћ{C9ljvlj‰S C9sЉƋS)9w>9s 9whC9r_CHD>9s9׉vщ)9׉vэEPjVQEp UU܋C9s )E<)E2EPjFPWEp CEPjC@PsUr *(S9Mu C)) Ejjjjs QjLjjjjsuj78jjjjsuj u &L_tjkYjj}1]Sjh Sau Su Shk3XZUjjh@3ЋE j @Pu u @uu _ RRPu h +[^?jjjjjjjIjjjjjjj68jjjjjjj 5 R5R5$L_h3ie[^_UVS]sVh2ЍCt%7E`4?UB4?̀B4nuF4?@F4ZENu E =E}EP3h SD uuEuPhL3Yfs3EuVjh S ߋEUtECEC=L_uEƨt'ttt tEftWf}x<ȉ1K=Rt-fCfCVhe3E^_E5L_jEj@P訿E܍e[^_UVSu^<5L_jjC@PC09uFC09ptR9ruB@B5L_jjC@PBe[^UE Ut z uB UWV=ؖRSU} tuȖRЋ4uIft;G8RЉw<5L_jj^@SF0G~05L_jjS褾1e[^_ÐUSVW]KS ] = RtE.L_PX}G_OW u1_^[]UE @pE0螢ZYUE M@0QǀQQQ En 1zcUS]tSXt  "M$4 t " L$4t "t  "]ÐUWVE0X318hJN_hDN_h$PCI TRt'5NN_5JN_5DN_HN_Ph@3b1t/EPEPEPEPEPEPEPj ue^_US] C @TRЍC0PEPEPEPEPEPEPSE 5NN_ЋE5JN_Puh3aTRt`}s0t3Ï3Ѓ}PtǏ3Ï3Ѓ}Pt3Ï3Ѓ}PtǏ3Ï3PCPh3a1}@TRR@N_uDSYt9jjS tHt"CPh3TRujjC0PCPh3aTRus0jS ]UWVSPPN_EE$4Ѝ=$PIRt =_PIRfCf119} B9| PCPuCPCPEPh@3ЉER`t uh3&fCft uh3f{tuh3`^_V`N_йjjC P £N_C PRC PeC N_Ѓ E}=N_jjhN_ N_u EPQhjN_hN_Pu#MAt?Ph3D_j5N_N_N_ uh3_105N_Ph3^ uTR [t?N_Ѝe[^_UWVSPPDN_иfO.r0h33ЉPuUM uT}PCI uFEEEE 8E ׉ڋEE$U1e[^_UWVSPPEU fM1׉UfE˸DN_Ѝ}fN.r0hF3Pu& uEfU}f 1e[^_UESM] _3tPtRt:1t|at/Wt: t)Ct-t,1h34|3-3&33M0Ɛ3 SQRh@3PQRhא3]؋]USf=jN_EtDPh3\Y1XjN_Јt ShW3\XZC~En 1Ћ]\]UWVSP1;N_E}u1uh3\N_ЊT8R8Ph 3`\1ۃ17 N_DPDPCAPh3C5\~EE;N_|e[^_UWVS 1;}Wu EZ9EEYjuWu ׻jPu ffPPDj Su 豼x tFt EE1;u};VuWu `jPu lftft Su uU F;u|EE9E>G;}e[^_U=ē3VSu3tf93uC9‰t {u1[^UN_ЉUt 9t @u1U塀N_WV1ɅS} t/1ۋ5N_9}!;EuB9t C9|1[^_UVu1ɅSt1tA@~E [^UWVSP5TR} E'Ottf jN_Ћ_ RЅ{ u<{u, CtPsh3Y qH3Ass5N_P ujs5N_СRP #4t &>/EtTR tRssh36Y1҃}tFGv6j<7u.‹O% 9t0 Qj<7uye[^_UTRЉVS=N_ 5jN_t h@3XYN_Ѕt={ u0Ct)=t"TR t PhW3lXXZK Ƌ[uTR t h`3DXX1ۉu*TR t ShW3#XYXjS5N_СRP C~TR t hn 1WZ1e[^UWVSTR}rGEG E EPEPEPu uLuut kG\uTRh`3pWX SƅXu0TR G@PuuuSh35Ww Ewl3G [F=u#=RuGt = #4u5~3.}t }u3TR@t 3ЉG3TR tNju u迷uSv ‹F=uPvG@PPPuuuh3bV/Ph3IXZe[^_UWVS} ?u]$uu Z1҅Y}uEP<EP@;Vr#DN 9sWjjjSSQRVB($tTRtXh3+I[K7uuu 褪uuu & P;Yt#juuu u7h 3H1ҍe[^_UE t@ju$Pu&1҅t)TRt h3HXjuuu UEu%UWVS j] SuVfǍEPEPEPSV֨ P%Puuuh3He[^_UVSj] SuV uAjSV t.j4SV %tPSVب <t ąu1ҍe[^UWVSjhXRЋ}ZYtYTRuP}tp4p8Nt7E ;Av*A P!9vE  t E ;Aw։1e[^_ÐUjjjƒ ҸtEEBE`3ЋE1UU JwE1US] Uw,j@r2ǧk t3ЋE1]UW} VSu]ww u4j@v6ik!‹3 Pj@v6谧1e[^_UVS] Uuw u(j@r2 3Ѓ e[1^UWVS] u}w u 1Cj@v6試 3Ѓ u  !Rj@v61e[^_UjjjJƒ ҸtEEBE3ЋE1UEWʃVSu] t tNAVu؃؃>VuBJ1[^ÐUSu]Suu u;u31҉Ћ]UM AS]wA@Aw 1҉[UWVu FSM}w2Sq q)褞 y1ҍe[^_UW} GVSuww u>SEp p)8 ! VSMq q1e[^_ÐUWVSu}W]Su uVu 03jDSVΝ PjDSV,1ҍe[^_UU JwE1US] Uw,jTr rx T3ƒ uE1]UWVSP} u}wuwptcjTv v"ÍEPu VzU T3и!؉ QjTv vU(MQu V? u9}t1e[^_UWVSRRu 1ttE1ۍEPSu 9uu0jTEp pj D3 EC~uVu u}t U;:te[^_UWVSQQu }1ۨtEPSWM 9uu;jTw wћ }‹ D3u !RjTw wC~uVW uEPVW uE9Et1e[^_ÐUjjj>ƒ Ҹt!E EBEB E3ЋE1UU JwE1US] Uw5jTr r#3Ћ Ğ3 uE1]UW} VSuww u]jTEp p}3Ћ Ğ3jTڋMq !q! P% PjTEp p蟚1e[^_UWVSP] }wn1t_EPVW 9]uFjTw w%#3Ћ 3 tHt E M1 F~e[^_UWVSR] }E1EPVWS 9]u~jTw wC }t}ug3!3Љ!Ë 3и! jTw w% PjTw wC1Fee[^_ÐUjjj蚚ƒ Ҹt!E EBEB E3ЋE1UU JwE1US] Uw/jTr r@ ƒ uE1]UWVSP} }uww u^jTw wÍEPu WpM jTw !w讗 % PjTw w1e[^_UWVSR] }w1uSEFEPVW 9]u-jTw w4% uEF~1e[^_UWVS ] }w u 1EEEPVW] 9]ubjTw w詖 }uM! M jTw wt% PjTw wƖFEEy1e[^_ÐUSu]Suu u;u31҉Ћ]UU JwE1US] Uw3jHr rǕ  3Ѓ uE1]UWVSP} u}wotbjHv voÍEPu VxM `3! PjHv v裕(MQu V> u9}t1e[^_ÐUExu x u1UWVS EEPU@ ] ECSHSLC0C8C<CHCDS rPh3s3 }tjh+uSBtC8}t+h'+hU+uStCs0v6u DH1 dPvve[^_UWVSPP} Epj@ SV %? Pj@ SV$jEPj VStCEP SV  Et%PGPh3 EjP SV$UB SPUBjhSPj SV Pj SV$,j SV e[^_ÐUEE D3EEUWVS0u ^$CHEȋCLEċ}WE PEPEPEPjjjrr6$uE܃ EԉF4EQEPEPEPEPjjj pp$uE܉ ẺF4EhH3h`3 F8E @tDtPRh3 hn 1XGF< ppVeVhUjPs8uu$F0uh@2Lw,hǩ3?$w,h3j]SG( SVVe[^_UWVSRRuF$PHU@LE싆 ppp RURNj PjWpR ɉt# PQjWpR$jfuUR+ t$ PQjWpR$jduURjhuUR PSjWpR$e[^_UWVS] Sb\Yu>s0v6 1 s8s4Pvv#e[^_UEE 3E EUWVSPP] C$HHMUxLrBC<B B,84ǃ$PEPC4PC8PjjjvvU$tCPh3H $ǃ(dǃ,E0vv5SShbjP8Wu$uh 3 pp=8h3 ƃ\S膠e[^_UVS]S躣Zu?tPv6" ,t4s4s8Pvv1e[^UWVSEE8pjEPjU VWEPE WV ƒ ÉUjE WV EjU WV Eh`E WV E܃$EuPh 2 ESPU WV$ujE WV$,ujU WV$uh`E WV$ UBU(WPUBjhWPE0, WV$ jU WV ƒE $Rj WV$j U WV ă(w0 Rj E WV$e[^_ÐUEE @3EE|UWVS ] C$PHU@LE}GwC UB$Ph*2jQTW$Zt4Ph82|<40LJ<,Whjhu4בjh,WW(e[^_UVS]8u S#YZu\<tP40ǃ< lt'Phdjvvǃl1e[^ÐUEx+ P(u<u ƃt1҉UWVS }w] ECVE荃lUPjhPdPjjjvv%$tUU E3dhu P@EU쉓G`FjfuPFjhuPjw uUR Pjw uEP$,Shj@w,uuuUU E"3Ѝe[^_]w,h3Pw$ƒ G$҉@0tjRQ< G$Ph*2jQS趰Zt1Puh82ǃ%ShBVDjh,SS虾|e[^_UVS]u S讫ZYuhD`YtP ǃ lt'Phdjvv`ǃl1e[^UVSP:W @s@hEPj]H u 7WЋB9؉Es]r +ujVuRE p>e[^URhEPjE u:WjhuPE 0ÐUEt =t0t1%UVSjj]SSjSS %=ujSS ^Zu jSS Z=Yt = =t1jjSSjj7SSj:SS  @Pj:SSjSS t$j:SS %Pj:SSe[^UWVSSS}G8G<LJLJ!,LJN!,ЍjPnZYP1ۅ^tLJ LJG80G<4LJ,LJD@LJ8!,LJ<N!,Ѝ,jPZYP(^t CLJH LJHG8G<LJLLJLJ!,LJN!,PYujP^ZjPZYP^t CLJ LJG8G<LJLJLJ!,LJN!,ЍjPZYP^t CLJ LJLJLJLJ Et3$(dž$jjSjSƬMyEu HP|4RкƋEљPEGPh@3tHthC3thN3hW3\YtHt@EX}Me[^_UVS]t PXìNye[^US ]ǃC$CxǃE2ЋBDE]BPEBThe,h,ЉEEPRxt SXc]US]C@`3t* d3=h3t=l3th3=RPhp3ЍPSh,~DtsPh3hv3]UWVS];uuh,Yu"P2jjh3j P5P&4кљjPh3j h,ћVS"XZtǃWȞjDUWVSQE ]Eh萆NjZu W耆UB^tHt{hLYtLxuF0t@~u䉳jPOYZu jVsOXZWS_Xhօ^tLxuF0t@~u䉳jP%OZYu jVN^XW莅jS Eph3UE Ue[^_NUVSuVhJ,BC\PjVVjjVV jVV FY[wjVV [Zt PjVV jVV Z YuVF [F e[^UVS]C@@M t+tt=t3=tHdQ @1wmB@,Q @1wZBtF5Q t1HuAB@1w6(Q t1Hu%Bt1Hu h3pSQuPƍe[^UU SEҋXt Rh3XZC@tt:=t=t*h3hժ3 h3h3HX]h3UWVS1]tPYìNy1e[^_UWVSP}jp@EXt P7XìNy&4кљPGdPp[E^Ee[^_UWVSj]SS !XZtOjSS !Y XC ut jS:XZC  uSjS 1C 1e[^_UWVSu} jjjJ u h@3xh4$/YEe[^_US]Ct h3CK]UUBM tBM EUS]@(tPXjjSSjjSS]UVS] }3tFxtXFdEe[^NShYtPSXZu&4кљE FdEe[^郣e[^UWVS EE  EMp1E{H!9uVEuP Vus4s0yuJCLE!CHUC0EBMJE B zr1 B+EE9ve[^_UEE @ BHUWVSSSU uD4MEtIuEC( %Pk@RVVC(}u PDRVVC,C( %PHRVVC,C($ PLRVVC0 %PPRVVC0?}u@PTRVV$jVV  XRЃ PjVVe[^_UWVSVE]uE1ɋEP$tAvtm ‰ϋEP$E 8UM9A0t h3EH؋U%)Ít0E)ˉH(p,X0U P4Wu\1e[^_UVS] uv h3jVV kXR!PjVVٸ!F$e[^UWVSEE0U F8҉EtEPjuRuUrFXtwEf8taNP9щsCVT9v9r,);Er#EPEPjjuuRQuCs$t f;uf;u>YEPEPjjuuEFTFPPvPur$u"EUEBEBEB EB1ҍe[^_UE S@HP t RQSuRQSNt ]UWVSW]ku F|Pk} $RSSF}PRSSF|H%PRSSF|H$PRSSjSS RȋD:!kE EEE LQjSS jSS  RQjSSe[^_UWVSP}EpuU1ɋWxtAvtQ ‰ˉWxEUM9A8t h3k p|UU SW1e[^_UVS] uv h 3jVV k$R!PjVVٸ!Fxe[^UVSu1jVV ZYuhCThRЁ'X~ߍe[^UVSjjuVVhThRЃ~uj/VV %Pj/VVjPjVVhThRhjVVjjVV(j ThRj@jVVh NThRVKjjVV$jVV % Ku PjVV1ۃ F$t SVYXC~1ۋFxt SVHXZC~e[^UjjEPPhThRUM S]t{SCuȈ{SuBB[UVS] uMt~VFu؈t~VuBJ[^ÐUWVS}GEW|1Ƀ_{EPjjRSm1Ʌ_hu LJh@u싇hVjPE\umt7h@v$Vjh@\umE@t11ۋUu1ۋUuBBPYtۋUu@@ۋUuBBPZtFۋUuۋUuBBPYtFۋUuۋUuBBPbZtFjuSuouuugo1ɅtLJE䉇he[^_UWVS]CEE{KPjMs|Wu BlthI"3&EPjh\ulth3J\FLh HFHEF@FD`RЉ~8EF0jV% tCh,V=F`ZYu/FPh3jhuWluv=19DžsXUMȉPu ȍ9 ȍ99r9FEPh3#^_.u"эF1 MU]u Bȍ BȊk@9Dž9g}MU]ukDȍkDȊMąɉUM]ukDȍkDȊMU]ukDȍkDȊ MU]ukDȍkDȊ MU]ȍxukDȍkDȊ 9ωuEPU Y[6* P XZuѥPEPEP1h@P RumEDžDžDž9suѤPEPEP1h@P Rum@EuąMU]u ʍʊEMU]u Bȍ BȊETMU]u Bȍ BȊ,/Dh3=h36hƯ3/hѯ3(h߯3!h 3h3h3 h 3h3(^ Rh/3Y[Urr h<3EX 3UE2Ph@3ܽCtHt hU3 ha3hj3赽C4$h|3褽X{ ZtKsh31荽^;{ X}5DDHP|tZ0 #4Pth3GY;{ |˃{8t^h31?;{8Y}LvD~DtWA0 #4PF<F@HP~<tZ0 #4Pv@h3G ;{8|CTt Phİ3ۼXZhҰ3ϼCXt h԰3込XCt h3譼XCt h3蜼_Ct h3苼^Ct h 3zYC t h3iZC@t h3XX{y h3GXCt h)36XCt h33%XCt h>3XCt hH3Xhn 1[X_E@E'UfftPEPh3跻 e[^_UWVSĀUw'w5!Ww }y=nM yaAh tXjP^_u] Chǀ Sh $CCl u F}E XhOG Wu  ȊMU ΃yZhA VIu  ȊC1Dž|1ۋ}G OWu D DȊЁFM Ah҈TuQh|DC|FCC=~UzrM yhB JRu  Ȋu؋NF Vu  Ȋ fUrE xhJB Ru  Ȋu؋NF Vu  Ȋ f2}%U Blt xtBlM qlukjjjd} ÉGl"M BCCCCCAh$AlQh$}u ^lG OWu  ȊCbEXSƒxJ@ Ru  ȊЉЃ@EЃ<@EEE9} wlurjjjd ÉGlM BCCCCCAh$AlQh$Al@}u ^lG OWu  ȊCU Bl@ 1;]s[M Il4Mu}G OW}w {u D DȊM Ƌ]s ;}ru Fl@1;]ss} lu}E܋U{3zB JRt]sutDtDȊM Ƌ]s;}r} `RE u Fd;}.] G OW{du  Ȋ؉މ؁@?EuЉE;t]jjj\ Eu hO3JU rd}MAXBl@u ȋVlXB}t+Nd&}}u} uE } Gd}tzEƒxuJ@ R~u  Ȋ؉}EGyG@tEH tUJtMIu^}]؃G OWsu D }؍DȊ؉؃ډى߉Eĉ؃`%u؉UM}E]E9]URMU˅ҋA SIvu}؍D ]؍DȊ؉uDž|؊|t;}}G OWvu}؍D }؍DȊux||~EԋE9EO}taUzB JvRu}؍D ]؍DȊ؉%=utFu؉؃tE؃tE؃}u؋}9w(]G OWv{u]؍D ]؍DȊ؉ϋ} u؉GtG@tEH كUۉJCM˃yA SIvu}؍D ]؍DȊ؉؃@u؃uF E9E؃0 t_w t0Eƒx}؋J@ Rwu D }؍DȊUԋMDxu~F NVuu؍D u؍DȊxu؋}G OW~u D u؍DȊ xUԋMD}uvu}G OWuu؍D }؍DȊU}JB Ru}؍D }؍DȊU }B JRuu؍D u؍DȊ }G OW}؍}|u}؍D }؍DȊ UԋMD|u؉%=t_w @t=}G OW}؍wu D }؍DȊUԋMDxu~F NVuu؍D u؍DȊxu؋}G OW~u D u؍DȊ xUԋMD}uvu}G OWuu؍D }؍DȊU}JB Ru}؍D }؍DȊU }B JRuu؍D u؍DȊ }G OW}؍}|u}؍D }؍DȊ UԋMD|u؋}ԋEDG};x UB BB}M؋]9KB }؃{C KS]w{u]؍D ]؍DȊ؉%?}ۉu؉Gy@G@t EH t UJthMy˅A SIu D DȊ}؋OG W~u D DȊ ؋UfB4}ٸ]fC4}u u؋}9w7 } E@8wG OWu]؍D }؍DȊUu؋JB ~Ru D u؍DȊ ؋UB<}B@BD}@MA8]sC KSu}؍D ]؍DȊu؋NF Vu؍~u D u؍DȊ UBur~vl1ۃ~F VNu DЍ DЊ U ~F VN{u DЍ DЊ U D1[^_UWVSS}E1ۋWfftf;3ufft f;¸3tMĸ3Ѕt_ȸ3ЅtUtL tCPZYu1VG ZYuWԸ39u3ЅuE$}OX1ҍe[^_UWVSUBu 0BXtbC u{ th 3BX:u5CC u*EPB H0Pj j sB p4Qt [XuuhC3 HLPjjQR.th`3#SUrEp thr3胙p,džPSjjjUr(th_3D_%(PSjjjEpthz3j h3E }OEk]$EPfftf;3ufft f;¸3tPĸ3Ѕt^ȸ3ЅtTtK tBPKZYu0WUB 3ZYuEPԸ39u31t-ExPwV Eu PV[EXE$}O#}Puh3Y}t"GU8uG8BuG8BtEG tUV7Z[dž/@džD@džt@dž@dž?dž@džHLuHɋLu B dž#>džS>džs>dže=dž=ЍFPVhljP0E4P08t Phm1o_Xhn 1cuV to0B H0(B p4QY[0B H0,B p4QXZEp.0B H0$B p4Q_Xdž,e[^_US],tau SZYuT0B H0(B p4Q0B H0,B p4Q0B H0PB p4Q1]UWVSP} jP]0Es8XtOt5e0FCPShljP04S2FP@fFNtSC^400 uH0e[^1_UVS]sVShljP0[4t0Ee[^Vh"3~e[^US]40wX0Z]EfUWVS0u 11E0B ]ԋH0Sj B p4 tEPh3E0B H0EPEPSj VjB p4QtEPh3趓YUԋE1ۉUȉEċ}؃}Ečsu X: UčZ8U~ՋE׋0B H0uЋB p4Q ^XE0B H0EPB p4QY[e[^_UWVS}11Y uTD~1un1Ƀ YuTDU ~փ uP@=t=u LJ LJU [^_UWVS(]0B uԋH0VjB p4 tCPh@3@0B H0EPEPVjhjB p4QtCPh3X}M؋Ůu  }M؋Űu T D 0B H0uЋB p41Q 0B Y^H0EPB p4QXZe[^_ÐU1S]fĢRf9u%ĢRfDf9CuSȢR9uAv1[UWVSPEExu _tU{8uB{ u~ u1WB H0Pjv1}uFPB p4Qt#vXuƒ}u E멅u E3wC4Vw½S t hr3踍XǃPPj1F @PwWtEI"3Ѝe[^_jh3TCC|ǃ,s,ǃs,ǃ PSh!*jpw PK8Y^t Phm1XZ]e[^_EUSu ]SdZYu9B H0B p4QB H0PB p4Q1]UVS]sVSh!*jp!t]e[^Vh"3Je[^UWVSuS:Yu?@ fRf=bt f5tf=ujSݶ^ZtPjS e[^_US]XZ]]UEE龽UWVSPP}w4ƇƇu SESUuSCuS1CuS1CuSCjdThRЅXuSCtt "tƇƇƇƇu[u ESȀ EȀCuSCu Ƈ(uSCuSCuƇu ESȀ EȀCu u SESUu1uS1CuSC<uƇuuȉ u SEUSu SEUSuwuSKuSCu SESUuSZCZu SESUuSK}u}ZtƇLJ$l3hF3:hF33hF3,hF3%hF3LJhG3̈t@ Py u LJ LJ hP3菈#PhG3tLJY hdG3 XuSCuuS1CƇuS1CWhԒ*ЍGTPEWh*ЍG  ؃D> jThRЃ}Xu T> \> jThRmXuEMhM؋M܋EM lp u}u ؍T>  ؃D> jThRЃ}Xu T> \> jThRmXuEMhMЋMԋEMlp u}u ؍T>  ؃D> jThRЃ}Xu T> \> jThRmYuMhlpu T3 D3 jThRЅZu T3 D3 jThRXEhlpu T3 D3 jThRЅXuT3 D3 u T3 D3 jThRXEMhM̋Eɋlpu T> D> jThRЃ}Xu T> \> }u T> D> jThRЀ XtM MmuEhlpu T3 D3 jThRЅXu T3 D3 jThR_Ee[^_UWVS,Ehlpu TDEEhlpu T3 D3 jThRЅXu T3 D3 jThRMXyEMhMEElp u}u ؍T>  ؃D> jThRЃ}Xu T> \> jThRmXuEMhMMEM lp u}u ؍T>  ؃D> jThRЃ}Xu T> \> jThRmYuEMhM؋M܋EMlp u}u ؍T>  ؃D> jThRЃ}Zu T> \> jThRmXuEMhMЋEElp u}u ؍T>  ؃D> jThRЃ}Xu T> \> jThRmXuEMhMȋM̋EMlp u}u ؍T>  ؃D> jThRЃ}Xu T> \> jThRmXuMhlpu T3 D3 jThRЅXu T3 D3 jThRYe[^_UUE@Pt0X1UVSE$Pu tIPFTFe[^UVS]jPSKS: S.ue[^USECPhw/jd ]]US]hlpu T1Dhlpu1hlpu TDhlpu T 1D hlpu TDhlpu T 1D h@ThRfǃ]UWVS]hs8S$>SzGfFP@fFP }e[^_mUWVSEEhU싈lM苸pUEBP%@@Cu h3Kbs;w E<)u}u MT1ED}u MTfUfDf%MT19=Et*CUu ǂCMUB8t SPyXZhD}EXuMT M1fU2MfD }uEMT1fU2MfDۉ]C v+M}su foffC t"}suMTD0 D0UDhCfFP@fFNtS%Y$8tPp衊XZp藇Xue[^1_ÐUE8UWVS(E@U M 0Uǁ8hn 1UU pPM  th<3T<E ] B H0ShB p4 thX3TXM B H0E 8PEPShjj B p4Qt+h53gTE B H0SB p4Q GU ] $ @u ߉B9s} ?;tM Ph`3U ,jP<u Ste[^US]@tSNY<ǃLǃ0ǃ4ǃ8ǃ<ǃ@ǃDƃHtP调XZǃ<]UWVSP]@tS_n~^j1ǃ󪍃Hƃ ƃ ǃǃǃǃǃǃ,ƃE$ @u }B;us?}E8t+PCPh 3[MUuUuƃ 1Ƀ $rIu1>~؋x,P0@Du T1Dff @fSu!1ҍe[^_US]PP hǃ P ǃXLZth,XPtLh,XfE]?~UVSuLB L~2 ufFPh`3KP; jP 9 )PFPh3ЍKS V)k&4 PSn e[^UEǀLUUfUWVSLE}jPu WV0Ru9i hw/i w i taϖi w5i :i _Zi 16i(=E@P@u-ÅX#UfJPxWV_XUBPt&@u1'@1i B0u PWPWGY4^1(NVPWuʞÃSj5L_%ÅXZ:hPwP V)-hVwyP V*hwVOj5L_^Xj!EPwP E< wv D(@~}Ĺ!tOuĹ!E@P@t0f Y"j!wPNà e[^_UEEkUE@ :tRX1UEU BtBu BBUWVS0jE0uEU^BP@_DM4'EEEx,P0@DuTDtjuEu-ƀEjPuUfJPEuuu =Y[t͋M䋙Cu ǁCE{v @pSA{ w jSRXZKEfq f@Qt"fwSUBpXOEfvECtt$9[8u+K$;Mt)ٍA)ٍA;Es}u M)KK juSà t&CtECE9C s PSYXu UBpSE Eu4BBfAfBAB fA fBMBf5BEBEffBAB fA fBBfAfBBBBBMAQufv3ЉBf3fB}u}uWsuۉE}܉}؉]t|E@ EtcEEЋU=rw@M}$ u MB(9sEЍt0|8M h3AEEU҉UuMy8t5AQt Ck kSEp8XXZUBQt kC CSEBX }Mx,P0@DuTDt'EPh3CuuUԋEPpIM $uEM Ux,P0@Du TDEԋMAle[^_UWVS4EE0EEu @QŰE ۋ$uT D Uۋ$uT D  ȉEE=v E@hjjEY[u UBhE=v]juJXE@ZuHUBhP E@huEXBuh3QBu EUE܉BzEBB zU̅҉}EUԉUZEE EȅU$uTDU}$uTD ϋU}$uTDU}$uTD؋U ˋ$U}UuTDEԋE9E}?;UU$UUwB}4u}؉ىB;usE؍t3|}؉E)}}4u}؋MB#;usEU؍t0| }؋MEM}؋$} u B9s t1|9U]؋Eą҉EUt !E̅EԉEtb=t[eUuЋ ɋ$uTDEԋUɋ$u1EԅEt=u}"UZЃ u6%=t=twSu^_jUƂ^uQ}vSs3й8¾t UBQt+1Ct K t&u KUUEEe[^_#StSBfAfB CCfCfB)RuU܋B8Y[t uPLSXZE@dUU Ee[^_Āe[^_UVS]u FuB@<u0jF PS6 u(ƃF fFf <uƃe[^UWVS,j]ESEE_X}uhujSEE԰EU EfBfE܋EffE⋃EfUfE1EЈE$Uȃ u UB;usEu}}󤃻 $uEËx,P0@Du TD1e[^_UW} V SwAE $u  0t]A vƅtH19s=11ۋE $u  0tA9rǺ[^_UWVSQ]E EE } u$uʰ $u T D $u TD $u ET ED $u TEED $u T D $u TD $ uT D $u T 1D $u T1Dt. $uE2UEZ[^_UWV1}Su ]uCPh 3:YXt6hSN X Z$u UPtLhS _ XP$uTDǃPh,l,[e[^_UWVSP]jP4E_thPǃ^t1t6x,P0@DuTDut S3YF~t PS XZEEe[^_UWVSPP]jP{Eǃ XE3jt? M싃$uTDrvu$t FE?vq?wiu(Ht23ju Ƅ3ju?j#QSd^_t.SY(&4кљPPPǃ XZEEe[^_UWVS } E$u t|}$u }$04u  ș։04}$u 1ƀ E$u t|}$u }$8<u  ș։8<}$u 1ƀ E$u t|}$u }$@Du   ș։@D}$u 1ƀ $u  H [^_UWVSQQ] $u M Tu DȍQ$Uu u U } EE$3hSsf!XZE,}Vu SEhjS"L^_S $u u TU D L$u u TU DA$L Hxu B9s t1|9ǃLh,YhS_XZE,Vu QSEvftfE,Ѕ$u M 1Ou FjSY_E,t%ǃE,QCTPh@33 u SXZSEe[^_UWVSQ] E$u M TU D}$u M U 1t5w ttnlu SXZE $}pu B9sp D,Cǃ7SUXuUuE -Ut3VCTPh@32 $u M 1U e[^_UWVS],@,uS2Y1x,P0@DuTDu1 $uP@?wPSwPS"XZPCPh31 tS^t x,P0@Du T1D1e[^_UM WVS}t\ $u  ȋ$u1 ƀu[^_UWVSu ۋM $u<ۋ$u1wƄj[^_UWVSWW}]t,x,P0@DuTDt uS)i E j$Uu  8}tA?v?v}t uS[^1pƄ j}$u $u TEUT $u TDE e[^_US] E u5&4ЍhP;ǃXZ]UVS] fut$jVYZt e[^Ã] ue[^}UE#E UE Sҋ]#ftfu u thPǃY]UU Sf]t Ѓ Ѐt1 u(&4кљPPPǃ [X]UE#E UE Sҋ]#ft(ft%PSXZu tPPǃ X]UWVS} ]u1 A2vWSl_Xt VS$Y[1mx,P0@DuTDu $ux,P0@Du TDVSre[^_UWVSP]Su EPuV*1tSuV* te[^_UWVSP]jS^@_tpE1fftYjSFZYuKx,P0@DuTDu*EH!fuEt S3XGe~e[^_USQ]jSXLZ@jSZYt jSijjEPStT L$Uu T @@D  $Uu T D juS]USj]SiX@ZtjSZYu jjSC]UWVSWhu-]ESE1KUYU^u }u{C"MC$ffC(C*C+UuC,C-C.C/C,C-C.C/C0C1C2C3C4EUuC5C5NC6C7UUuC8C9C:C;\C8C9C:8C;C<MUuC=C>C? C=C>C?UC@CA CBUuCCNCC2CDCECFCGMCHCI Uu0CJNE?@@@@(@(@@@@ FCJOUB?BBBBB(B(BB B B B B BBMx,P0@DuTDt h3U$ Ku B9ssJJMU$ u:ҍK u uBV9}su T@u8ҍKu uB9}suauhju1 u h3$e[^_UWVS8]hS_@XbjSY^thSDhVEPSEE$!(u88u* $uMT1UD1}Ĺ#ǃ󪊃Eč}ō󥋃$ uĹ#u B9su捸"󤃻 U$u TDhuS tk&4 PPeXZe[^_UM $$uP$(QUWVS4]V}hS uǃk&4 PVYx,P0^@DuTDb!u88u* $uET1MD1}Ĺ#󪊃Eč}ō󥋃$ uĹ#u B9su捸"󤃻 $u MTuD $u ETMD $uUuM $ux,P0@Du TDhS1iE$ pu B9sp 󤋋 Mɋ$u uT MD }$u uT uD U uƃ  Uuƃ }$u ETMDtw$}#}ču B9s"}1|(t@v󈃼u!󤊃8Et,'h SX} ZD,tǃ,Ѝe[^_UVSP]hS^X@jSZYthSY;hjEPStp $Uu TD $Uu TD $u huSoe[^UWVSP]hS^P_@jSZYthSohjEPS P$Uu T @@D  $Uu T D $P pHu B9s t1|9huSfe[^_UWVS]hC0SE_UXAM苉ɉMt+AE}܃uuU҉UtJMۃ}~fSftfSp^@jSZYthShjEPSp $Eu TEMLEE苀EtYPU}$ u uB9}su܃uMEɉMtAEhuSe[^_UVS]@u u8jjh.3hh,u@thSZYuhSZYuPhSS >u jjh93jh,'>th,.1e[^UVS]@u u8jjh.3hh,uv@tjS ZYujS6ZYuLjSSG >u jjh93jh,g>th,n1e[^ÐUUBxu#f:_uBt  u1UWVSuF] (FpPMvM tEr3Ѝe[^_vVB H0Wj@j@jB p4Qt h3FY=$PWj@jjvPt2hI"3VB H0WB p4Q FEe[^_OD H CPSh8jP(vP( P(R8t Phm1XZ]e[^_HUVS]s4tCPh`3mZFP@tSX(B H0$B p4Q(B H0PB p4QVgbVBǃe[1^UWVSP} jP]REs4XtOt5e(KCPSh8jP(sO( S 2FP@fFNtSX( (P(M ue[^1_ÐUUWVSu ]7 ^0@F0fF8\4Rh3!Y_|~th3FPhn 1=$4Zt F0=FtPjF4PjWjv0VM2 uCV@zTuFFPPh3^F0P8=$4t?F @t$F0RTp8XPFPh3TFP =$4t F0=Vh,2se[^_UESXSh2ЍPLRPh,mrtSh3h3S= RuOh3hФRjh#, RN_N_ДN_rth3h3I]UVS] j@ݴ{XuN_ЉCN_ЉN_ChN_Xue[^鳴US] j@莴{XtҋCtBN_ЋSCM]rUS]C0ƀ<S{PXu.Sjk&4t EN_N_RЋUȀzPt Ut$wU@xUt5F ^  EE> EjYGUȋB0|<6tmF E̍Ẻ]ЉEE]EEEFjjMSEMzx }EuEPSu9 EuQhFPFPučFPUȋB0t<t Et}uEPSuE }t juy[^MfVB~wUMȋA0D<tBjVP{0 2EȋP0DHFLFPF 1ɍe[^_UEf1W VS] uUPPE EjEEPuEEEEEEUPPE EuEEPuEEEEEEUPPE EjEEPuE EEEEEUPPE EjEEPuE EEEEEYUPPEEjEEU PUuE#EUEEUPPEEjEEU PUuE#EUEEUVS uV*ÅZ t;EPVOEEEECEu EPuEEEe[^UWVS }W] ƅY t;EPW]E!E ]FEjEPuEEE"e[^_UWVS }W]cƅX t@EPWEEE E!E EFEuEP]uE]e[^_UWVS }W]ƅX t@EPWEEE E!E EFEuEP]uE]e[^_UWVS }W]ƅX t@EPWEEE EEEFEuEP]uE]e[^_UVS uV,ÅX t>EPVQEEE E!E ECEjEPuEEEe[^UPPE EuEEUPUuEEEE"UAUVSRuVX1tRLEPVubPH э 9s9w{!t{t9Љr1e[^UWVSESP]S} PS ƺtkS^Y t[P@ ‹EjuR` t0PE0FPu1҅tu7Nbڍe[^_UPPu EPuEEEEEEEEU阰UWVSSh-uEPE0uj}u W j@MWEZHYtVNSjju hWV2tu &EPujjWw}t u XEe[^_UUWVSShB-uEPE0uj}u W- j@蚗WEZHYtV蛗Sjju hWkVtu [&EPujjW}t u Y^Ee[^_USjk&4thVu> #G W Rh*2huE}t$E8tE EEEe[^_T>G W  ‹EUE 3E Ee[^_UESRPh3Ћ] Sutu19rC]UWVS jVtSEu8UVSh3u^1ыL$} tGBPBPEEh"3)PQ1ыLBr Ƌ]B z ] ljh03+P1ыLV)PQ1ыLhv/)PQM1ы$L)PQ11ыLUBPh73)SQ1ыDe[^_USjjhVhPu u؋]UjuWUE=u =$4tE iPThRX0&4E 1j@PhA3jE PȢUEEUWVSRRE EE jEEPu}E#EEEEE u_ j2uWu uu=tGuNӅt$1ju u9huK؍e[^_UWVSSMAQ  19Es9t19w(zuB;EtF1EG9u u9}t9r1Y[^_UWVSMQAuu Q p1 tB@9E}9 9s*t"9wB1<t<uF;ut9r1e[^_UWVSQQ] E}kp4WSpL hUF^~ @Et"jjePzS F/FFVEPLBJ <EU9U9s&9w t{t3t {t9rڀ;t{u H3V0|S3uFUЋEx u6Ctt &@CS 9t KKFUDBE9‰UI1F+Ph3KX~ZtjevTF^_e[^_UkU EP4ztE eBESUPPE EjEEPuEE EEEEUWVS} uuujuSV:01ۀ~It#EPSVN uE9tCFI9|ݸe[^_UWVSPEx tO@Lx19}VuFX9Z|jeMq4SjeEpLRUB4BLB } ujuY[EPu u Eju jeVPE }1uVu juthuGXZ~mMyt ZUBP1 upMQ@tey\t=EPEPuEEEEEEE E u%EEPu_Xu EtUBMA@9~2}t"PRUBPAPPh@3 MfQA UBPQY^upMyjjekPjOU B4uHEMALUB19A },jVub tNxVuXNZy F9|1 jeuP؍e[^_UWVSjjeup4}Nà ۸tlE s{GEC,CC C$CCC(CC@0SƅXt jeSMP@tSYE1e[^_US]SC0SP CHjeS P]UU|<t @~UWVS<E U} 8EEEEEUEEG W ‰UG W  ‰UG W h- h-ЍEPuUgDžG9]ju U BLP@19ӉE}E H41ҍ F;|ꋕjjeEPULU BXa19Džt`E@@h-h-ЉE̍EPukt4U BXBU BXDŽF;|1҃jeE pXMU BXXG9Zvjju h-h-ЍEPuEEEE蠴1҅tCjjejKU BXt&1҉@uEuPh3lڍe[^_UWVSu %EYyE Ph36 jjej\.Kà ۸1E C,C$UEC,C-C.C/C0C1C2CPd3CC?C SBCZ ]tUx tE@tEx ut;HT1y ty<ʉUE9tFA 9|h 3B0C C 8R@8RЉCCPjC$PjUSS fC<s8EEVjjjSt uSEXE}Z~}u ~@tF@~u>wuSFSC0C1}DžXucuSY^tuS Oj SECUE \F ~ uF1F FXEtB8t=jUP$Pƃ3EFXU <t~"}E$E}~VTEz td1ڍJ0A t@.AR0 uu 1UdBUw VTB 9E|FT@  LJ e[^_UWVSuFtPY~4t'FLx19}SVCX9Z|jev4F_XFLt jePFY[FXt jePFXZjeVFe[^_UWVSQE }_ ECXtk18tduCXPh|3G tPh)/XZCPh3~jCX4述CXCXF<uSjCD<G ^_]e[^_UVSUB fr B fZ B fJ f=`3`3t#f90uf9XufPftf9t f8u[^ÐUS]s{ Zu x u 1]UWVSHE@U EEB0jPghn 1Љbu SVh0PSojju(My vjVh@3]SuVuEEEE)EEE EUƃ US~)@љSP V uUˆEw 1;]عD(uFC;]~My tm3~1P}V2u #4PE uPh3:Ex tt/ȹ #4t2Qz>ur3y3Ph3 hn 1}_uE Ph3<jkEjf0PA *EXTU S@#-Ѝ{u x u#MA@tx uЃPh3EPju tE Ph3yjuwY^uE Ph3Y@tE Ph3?hh&-ЋE j8PE u 4PjBPu$tE Ph3XZ!huEu ujU B0x>t+jjfx>tEP@ E1;u}d1S0B MFJBy tfBfBdBBM A0H>tɋEtBBF;u|UBT@ ;]tAjSu tP$E SPh 3VuCA_;]X~M A9t jfSiAY[E@Te[^_UWVSUBTPU@Ex9u JEx v 7EUz!kuEpT^SuP Cv C{ SUCtsjuuB u[tEuPh`3:{tEuPh3 SBCvBEuPh3j }uuC 6&juu { tuSKjuuuEuPh 3 h,u{SuutEuPh 3 Suus C3 tpu 1@SuPUB @P2ut&EuPh`3?juuCC PTtPXEUB9E1e[^_UWVSPM E@0ɋPT-tMIuHtDB t<E9Eu6E9Eu-tE܉EFEF} tE S^EPSZYuSA1e[^_UWVSE 81҅Xtd9EEމUs&E+M U;urڃًUH!¸ )[^_UWVStju Eu}E9à 1tJ0Sw;Eԃu }uuu 9u E9EtЍEPSwZYuS71e[^_ÐUS]S 1t!RkZtxt1 Cu]UWVS4EM X @A0Y4S'j}whn 1ЉFPFPu Vh_3$jjSjSuVh 3E @\sPy @t Vhu3‹M A<} ju:u4jjfj}Dž}>3 ljt19s2U!#E9tMEufDMG9r΋E {PU9҉t}1;}s9T;Pt*1;Msu D19tA;MrЀUfDUBUG;}r19s1E Tt 19sD P9tA9rEfTE@EG9rϋUSLu FCPFCT}tctM፻uE>jp1`;}X}'T}P1@P|G虠 ;}|V`e[^_USPU] uq9`ti`EtTu \Et<u DEtHu PEjEPjR;]UE = W@MUt&w =W@t '= Wt 2Q?`1UWVS E M={U]EMu1={Uuh 33{UYEjSXZEǃC0p4蒿X~닋Iǃ1@ME}tE ]e[^_e[^_UVSEQP]C0u p4ĹXZtj@^{U^ {UЉ4$uݾe[^UN_1UWVS|EP|P]s0ǃju|V1sPx}Uf}C49EUtJ333%FEF EFE G_3U3M3t 3ǃEPxZYxj<PjC4Phu| jHPjC4Phu|tjTPjC4Phu|Q1e[^_ÐUS]{ t/CPC P ZYtH@s >…Xtzt1'BHwB~ Puȋ]UWVSS}u jwhn 1SFPh0SGF0G F4GF8GPG Pa$t%@FXCFYCF\C F`{tVSYFXFYF\F`v4ZEZI~Xu3@t t/tPt FX FXFX~Yu.UBH$3FYFY FYFYFX3t3H3ЃtC2FYHC2w($3к3z33 33QRFPh3It{t VS[)E1ۀxt{Pv4X…XYuFE E 3Ѝe[^_JyBuN<*BuN=~XuyBuN>UCB9|~<~=FX<u ~>u6PVZYt*P$[EFE E 3Ѝe[^_JƆFDPjF=Pv43F@PjFPv4dž1wZYC~FXt Hu h谰_ZFXt |up FT|3FT3VYBw)$3V.Vf&FPh33Y[8RFPh@3 ZtFPh3[_ue[^_uF0E Ee[^_Ϊe[^_UWVSu11ۋD@tPD@YC~j@XËHZxVXSWXt-;tu 3赋YXjS5!džXZuVTVv0j+1e[^_UM S1]ɋtIt -ƃt tR赌[]UVSu1ۋtP蒯DŽXC~1ۋD@tP0D@XC~e[^US]U t wt'tPRCPh3GǃR Zvu tǃ1]UVS]ut TCTpEf PuuSu V訮C0 =t VS [^V}Yw1e[^UVS]ut MCTpEPuuu hSs0V脮C0$=t VSY[VZw1e[^UUBYtqupBsBr tt?ZZtS$~Jǂ$Bw$:~1ǂBzB{~ǂBwBr UVS]u u?t@衯D3RЈCj?RЈCk@oC[7t(0v#oF ZYuvo71ҍe[^_UWVuSp{pCC u<@jPjhVj!PjhV(j"PjhVLu@x uGPttjRjhVVK\PjPPDd(tP4|$hh 47`PjTPDNdt.P{$hh 4+t EEe[^_h-jj0sS\sg sefGP@YfGPuBjjSs1S 2Vhd-Sa1 5&4Sm1XZe[^_UWVSSU E12i }w!1i N i t9i tv5i _w i tBh6i(DWUfJPSJxYAWC0PrXZ0G=UBXEfPP¨%@=@u0mu'EPjjh SEU j:%@@uGmt>EPjjh S\EU jRjhS<(S@uSg @tSXUBPl.C0u PW0PWa^4_u1E@P@tS[1RPWuƃe[^_UWVSWuFphh[4qj@ ǍEPjjpjsdf uSs^ tV^W e[^_UVS]SC0f`Pf@NP/X\Zt]Pxf^tPx$hh@ 4p \jbYtPx$hh 4p ǃ\`t]PfZtPcx$hh 4p `b^tP7x$hh 4gp ǃ`dt]PeYtPw$hh@ 4,p daZtPw$hh 4p ǃdtP!ǃXtPcdžX|tPǃ|XttPLcdžtXǃe[^ÐU UEE t1AEEEPEPEEEEEEh 1҅uUU UE t1JEEEPEPEEEEEEh 1҅u EU ‰UPPMU Et1?EjEUEPE@EUEE$h HURRM EUuEE@EuEUEPMEEUEg HUSQQu EP]EEEEEEEE{g 1҅tCPh 4mЋ]UWVSQQ]0CQt3fKP1UƄ<@?vj@<PhhR1MƄ<@?vEtRPU}uuju脳ƒM<E_EZufCPfCPt/jh4<ƒM<[^Ej@<Phhu0e[^_USQQ]uUjEPE@EEEEEEEe tCPh0lXZjy]UUz t1(BPB PjjhR$h u1҉UWVSEpjV} xhn 1kSWRh0ЉUkSxjjV|(t uh4hUfBf"fB f ELJ-ЉƇLJp-ЉƇPjVa t&uh 4kDSGPh4j0EP`[1ۀxtgPu`…XYtJyBu"$,Bu (Bu ,CF9|]SWxjPSwE謯$Vhp3AjjPSGp_0$0fCPǃm-ǃ-ǃ-jVGTPS蝏S蒯jjP' Ƈu@WjWe[^_UWVS]P'PPPP>Ps0t>j@FP@XtS XV薯VƃWSj"We[^1_UU Ҹ-tJu Eƀ1UEVSuu\jj0YXuFPh@/h$jSXCZuFPh@/hS76CC @@ @$CjSE X 1e[^UVuSÉsC$jPV? 77tE{u=[C^7t'hs&[CZYus[71ҍe[^UEVS{މCC u;?[C[7t%hPZFZYuvI[71ҍe[^UWVSQQE EE0uaCP@WtyJAEPMcZt2VnU$Ph4fEǀU0R\jEPjju[U B xrMr Ff@ ƒf EwCh[CdjVEF F^jPju uI7uCh{8t Vs8zYXVSlXZW^hB-jjhE pPU0pY E pWe[^_UWVSPPu EÃ0}jPEfcPfCNXt?t]tXCpWNm$EPh84}e u3E4Z"Clv F ^tSF[EEe[^_e[^_UUtuPuKUVSuu6jiV^0CtjkVCtjmVCtjoV tChe[^UWVkE}S8CPu vjVs SFNFSBhי-h'jQsS4s5X0s!VZt0Pk$GPh 4&dPJ1e[^_US]urCQultbjRP tfKPJt$Bu ǃBC8t RP5xYXfKPfCN]UWVSVVu~0HGP@>jPEVj j"VE1ۃUPg)PVCj ~GQ tPj`VIV7uFPhh4bY[oV\7ZuFPh4bY[UUQVjj$Vjj#Vj j"V(jhV 0uV\ZtEEe[^_fGP@fGPuS Vh-S5&4Se[^_UVuS0Pj$PQtPi$FPh454Pj(PQtP^i$FPh4a4hB-jjhsS0sJU s6SX1e[^UWVSPE1u t `jP2i EXw!1i  i ti t]i t4UfJPSgUxYRC0P/mXZUB=UBXEfPP¨tg%@=@u}uj`SY^"%@@u*}t!j`S_ZPj`SS@uS @tS^UBP|2C0u Pu! PuPZ4YuE@P@tSPX1uAe[^_UWVSPuuZCFpPhČ/_j@ǍEPjjÄjs\T uSs tV]XWe[^_UVS]C0f`Pf@Njj`SSPm0tYPeTYtPf$CPh4^ 0YPZtPf$CPh4^ ǃ04tYPT^tPTf$CPh4^ 4OYtP*f$CPh.4\^ ǃ48tYPSZtPe$CPh4#^ 8O^tPe$CPh4] ǃ8tPǃYtP}QdžZtPǃXtPEQdžXe[^ÐUPPUE EUjEfPE@UEEEEEVURR} UMEuE@EEfEUuEPMEEUEVUWVS,EP}YY[HEU ~GPh 4\EPEPh 4#à GEtSh 4Ph 4Z\uh` 4ЋuC\6F PjhjW tPc$uh 4hv PjhjWtPc$uh 44vFD0 PjhjWt'Ptc$uh 4[juw*jufj iZuW1ҍe[^_UWVS]C0E@Qt%MfIPf<f<f<EEtpHME%9Et}uuM@MMfQMfTEEtHMEE}uEf`Pf<kEP@EPjjS=<PjSe[^_USjj]k uPjP tCPh0ZXZj g]UUz t1(BPB Pjj!h 4V u1҉UWVSQQ}WZtGPh 4EPjSP tGPh 4EPN1ۀ~XtkPuNYXJyBu" ,Bu $Bu (CF9| t $u GPh4Vj PjjjWt GPh` 4/jjf%kP袻 @wu$Vh 4zXSGPh4fXjPSE訝$Vhp3=XjPS_0@^0fCPǃ-ǃ-ǃ-jVGTP(S}S莝Ƈ}uOe[^_UWVSVVEEu xjWdhn 1WSVURh0WSdjjWh(tEE E4Ѝe[^_hWUfBf fB f=UuVh-jhu4Va[uE Ee[^_DUWVSj@uQNj@^0YtjfP赻dž@XZ}t CP@tV XSSO}Ɔ}We[^1_UU Ҹ-tJu Eƀ|1UEVSuu\jjYXuFPh@/HV$jSXCZuFPh@/(VSb7.CC @@ @$CE X 1e[^UVuDSÉsC$XjPVG 77t;{u3*IC^7thsHCZY7t1ҍe[^UEVSD{މDCC u1HC[7thP9HFZY7t1ҍe[^UWVS E E0EEE쀸|]}E@P@ptzcZEEPP_t0SM\$EPh4vTEǀE,IjEPjjuIME X p{C@j SUY} ^wE@haE@dEC CECjP2ju uO7uE@hEx8t Sp8QhXZSuە_XV^h-jjhE pPE,E pMG E p6Ee[^_UWVSPPu EÃ0|}jPEfcPfCNXt?t]tXCpWZ$EPh84R u3E0ZH"Clv F XtSXEEe[^_e[^_UWVS kE}8DCPu vjVs FE@E)Ѓ@ESFFSBhk-hjusS0sE0sCZt$PY$GPh 4QW<t1e[^_US]|urCQultbjRP tfKPJt$Bu ǃBC8t RPfYXfKPfCN]UWVS]s0FP@jPjPjjjSfǃ< FQt fǃ< <PjStj@jSjSk7u CPhh4S7ZuCPh4P[^)S>,Yu S*ZufFP@fFP}e[^_e[^_UVuS,Pj PE@tPW$FPh450Pj$P@tPW$FPh4O4h-jjhXsS,sC sAY1e[^UWVSPE1|u t ^jP2i EXw!1i  i ti t]i t4UfJPSUxYRC0P[XZUB=UBXEfPP¨te%@=@u9u f<%@@u+9t"f<f<PjS' @uSD @tSXUBP82C0u Pu耖 Pu诗^4_uE@P@tS[1ue[^_UWVSPu|uZCFpPhČ/Mj@RǍEPjjDjsB uSs{ tVXW'e[^_UVS]C0f`Pf@N,tYPBYtP5U$CPh4gM ,>ZtP U$CPh4=M ǃ,0tYPB^tPT$CPh4M 0t>YtPT$CPh.4L ǃ04tYPBZtPoT$CPh4L 4>^tPET$CPh4wL ǃ4dtPǃdY\tP?dž\ZPtP`ǃPXHtP?džHXe[^UVSuF 1҅tHPA1҅Xt9FPF Pjjh 4H u{u {u1ҍe[^UWVSjuv} qXhn 1lKSGPh0ЉEZKSyXFF FPF Pjjh 4pG0t f@fhhtnjj$ u uh!48@E1;^,}=F(t-P?EZt@;EuF(F(C;^,|ËuGPh:4P?ELJLJ U1ۀzXtxP?^XJyBu" 3BuBtGPhu3IZYUCB9| u GPh4 GEuPh4 GPh 3IjP$SEPfE*OjPh`UxO S讎$uhp3AI_0$0fCPǃȹ-ǃ3-ǃ-juGTPSnS蟎ƇjVbWj6e[^_UWVSuj@%jǍ^0Xt CP@tVeYSSAoƆjWe[^1_US]urCQultbjRP^ tfKPJt$Bu ǃBC8t RP\XZfKPfCN]UWVSSkEU<su vjV E1ht(vs@EjFCPEPMs h-h'j~WsSUs_; sK9HYtu E\1e[^_UVS]C0f`Pf@NtYPSuh70>SKjjuP(t h4JLJ-ЉƇjjh4jPFELJ _-ЉƇPju4 tP F$h44E܉G0EG4FPF Pjjh4d:f@fw453G@GXe[^UQU1Et'ujEPu R1҅uUUVSVV]1ۋU Mt`uWE@EMEUEEEEjPs0d3ƋH yS=[e[^UWVSS}7DE8jPjW j4PjVjVZY%PjV'(jV0ZYPjV GQtjV ZYjVZY%PjV V7Yu FPhh4V(7ZuFPh48sVVjVZZYPjVjVAZYPjVjjV(ZY%PjVR(u~HYt~DuV.Zt S:fGP@fGPS^PoSIVhn-S5&4S1e[^_UVSuu_jVY[PjVjVw[ZPjV1ۃjVYZYtj CThRЁX~h'ThRЍe[^UU Ҹ-tJu Eǀ1UWVSEÃtCPtju Y[9tDfKPju_ZPjuju[^%PjujMQjEuMEE<EtMHM}uhju|ƒ?D*EZEYufcPju^_%PjujEPjuPe[^_UWVSu1t FDPjF8Pv4%tPn=$FPh4,FHPjF[1ۀxtkPu=…XYJyBu",Bu Bu CF9|tt u'GPh4u'SGPh4a'jP_00CXfCPǃf-ǃ-ǃ-ЉjGPGTPpCTCUCVǃ#-C`SLSIƇfVRWje[^_UWVSuj@fǍ^0XuW4CP@tVEXSU>S)MƆfWVj_e[^1_UU Ҹ-tJu Eƀe1UEVSuu\jjmYXuFPh@/&$jSǹXCZuFPh@/%S.7.CC @@ @$CE X 1e[^UVu,SÉsC$@jPVG 77tE{u=C^7t'hskCZYus71ҍe[^UEVS,{މ,CC u;C[7t%hPFZYuv71ҍe[^UWVS E EE0eu?CP@5ty(hElP Yt2V,U$hPh46$EǀhU jEPjjuE @ EU MxrCdUEB BZjP%ju uv$7uCh{8t us8H8XZuSe_XV^h-jjhE pPU pG E p0e[^_UWVSPPu EÃ0e}jP|EfcPfCNXt?t]tXCpW*$EPh84" u3E$T"Clv F ^tS[EEe[^_ e[^_UWVkE}S8,v] sjS蝪^ hq-hjsvV$v,0vZt$P)$GPh4"W\1e[^_US]eurCQultbjRPG tfKPJt$Bu ǃBC8t RP86YXfKPfCN]UWVS]es0uvFP@upjP購S7YZu CPhh4S7ZuCPh4!!Y[" u S*ZufFP@fFP}e[^_ae[^_UVuS PjP tPp($FPh4}$PjP tP9($FPh4Fjh-jdPV(PjP $tP'$FPh4# 4h-jjh@sS s sY1e[^UVS] euC0un@P@thtdt_tZltPZt*VV'$hCPh4ǃtu Ee[^e[^UWVSPPuEe} t jP肺i EXt6w i t Ri tHfNPS[AE@=-FX/FPt @uSY @tSuYEEu Ee[^_UVSueu7CFpPhČ/|S'Stue[^Ve[^UVS]C0f`Pf@N tYP^tP%$CPh4  |YtP%$CPh4 ǃ $tYP%ZtPw%$CPh4 $^tPM%$CPh.4 ǃ$(tYPYtP%$CPh4F (ZtP$$CPh4 ǃ(LtP=ǃLXDtPdžDX8tPǃ8X0tPhdž0Xe[^UWVSQu ~jP]߷E9Z|V詠XuϷ7CFup{|CQuS_u臷1e[^_UWVSjj &4u] 菚j0h0jP7¡ VЃ9 Vп V|R$ V+6C VЅu VX V@RG_FdC Fxe[^_ÐUUz t1(BPB Pjjh4 u1҉UWVS uFEj} u܍GE (hn 1Suh0S(jju$,(t uh4PLJ-ЉƇjjh4jPgtELJ -ЉƇPju tP-"$uh4FE܉G0EG4FPF Pjjh4f@fw4SG@Gdžuɲ Vv0j9e[^1_UVSPP]1ۋUMtkub} uEE@UMEUEEMuEPs0ƋH yS2Xe[^UPUEt1 jEPu jRO1҅uUURUt11jEPu jREE1҅u EU ‰UQEUEt1jEPu jRHUPEEUEt1jEPu jRHUPEEEEUEt1jEPu jRBHUWVSQQE0DUfjP褰juE썾4W 1ۃ ;P PVC ~h/VT_Z$.Ph/Vh0VsY[ Ph0VE@Pth0VL_Zh0V:Y[Ph0VU BQth0V_Zh0VY[Ph0Vo V7Zu FPhh4VZ7_uFPh45DVh.VnY[ Ph.Vuk~Ht~DuVZtu\?UfBP@fBPu^P9SVh-Sh5&4Sw1e[^_UVSuuOh.V[ZPh.V91ۃ h.VZYtj CThRЁX~h'ThRЍe[^UU Ҹ-tJu Eǀ1UWVS]EEEtCtE@Pth0SMZY:tFUfJPh0S-^_Ph0Sh0SZYPh0Sjh&Sjh*S<ɉMtcAE}ܸu܉qjuX_X  E  EEEEtPU룋MfaPh0SZY^Ph0S }th0S5_Zh0S#Y^Ph0S uh&Suh*Se[^_UWVSu1t FDPjF8Pv41tP$FPh4,FHPjF71ҍe[^UEVS{މCC u8p0C[7t%hP>FZYuv71ҍe[^US]u{trCQultbjRP^ tfKPJt$Bu ǃBC8t RP0#XZfKPfCN]UWVkEUS] vsjS~^ C;~<)1<h3-hj PvVEpHvU vUËH^yRJYt5S$EPh!4 EPEp0 U1e[^_UWVSSSEE} 7^tjP輨EfcPfCN}YtY}tv}tpCpu$FPh84 }uKvHHZy+Ve"Clw $G XtS_EEe[^_/e[^_UWVS E StU胻uttkClChPYt$V$shCPh4M ChsDHZSjEPjjuM A qxMUvM AfDfEEuE@hhUBdEM Eq VF FjPju S7uE@hUz8t Vr8 YXVuMXZWͦXh -jjhM qQsDu uH_yS^e[^_UWVSPE01] t |jP82i EXw!1i  i t9i t|95i w i tE6i( UfJPRUXxFtRP^XUB=UBXUBPtV@@uh0VY[@u!h0V_ZPh0V Q@uMugB@t?juY1Ftu PuQ PuS_4Zu3E@P@tV[1SDPuu^ǃuܤe[^_UWVSPuCFpPhČ/@ j@藤ǍEPjjìjs uSs tVXWle[^_UEjtPUVSEf`Pf@NS'CPP CDY^tSPZtPZ$CPh4 sD^tP3$CPh4e CDCHtSPYtP$CPh42 sHZtP$CPh.4  CHtP/ǃXtPdž^tPǃYtPZdžZǃe[^UVSEDu3ǀ~(t^$tSs[0Xuue[^e[1^UVSUu Du(BP@uF"FSC0FC,Fe[^UUtuPr00UWVSQuD~tt|jPESXZu+C,t%C0tdžtWJX^PSVh-S5&4SEEe[^_鉡e[^_UE5L_jjPQ`US]5L_jjP2`Hy ]] ]UWVu1S]1} VfX1}ktt-t!|7t9@=B6D/F(Sh4ЍFPh841h7VSSV[XV Ǎe[^_UWVSuE ]}VX}jtt-t!|7t7@ ǃt[PXtV$CPh4 uƅXtV$CPh4 ǃu9Spje[^1_UWVSQQU EEE F,XDEE;  }@ ~h@ E Sh 4BEǀ| ǀ ESpV.ExM1)h .h'j uEpPEEp,EpZvCPz$EPh4uREh4ЃPh`41e[^_UWVSE EEEEEEEEPE? uEE ue[^_u: t1 j b DŽ Y[uVV{XEZt džx ffGEfGEfGEfG11Ƀ@hu .h'j j@sSsc x PSV ux džx VVe[^_UWVSEPEU@u tBuF= t =t +fE(Efxv fE#fEuu]Ü{Ul ǂp ffGfFfG11Ƀ@$u .h'j j@sSsWE p PSu f~u'EfFuFU;(u fFE@UB=t#= ti=*tu=ti=DuufVHw8$,4иSLE>7 0)Ef1F EffFUfBu Ep Uǂp R؍e[^_UWVSTEP] EfCf=u"f{ufEfEUf(8U@=t-= = =CH fEfEwM$h4и CfE(fEtIEf\uuMtHtEfFuʐfU+fE#fCffE#fEfE]UDEEs1}&}fEEf-ufEEPV]zSu E1҃}u> MMpCP@ yXU~"h@ Vh4u\ fffGfCfGffvDPGPCP +M}1hu .h'j VMqQEqhE p Puu u Up Mǁp Q ڍe[^_UWVSEP F} ~ jjW[ u  E01e[^_UWVM SEɋu}Py; } >; ~ WSu1e[^_UWVS] Eu}Pu uu t *xC; }; ɸt>>; ; } >; ~ WuQ1e[^_UUVSuE pÃXv'Sj$FPh4V%j5&4h4juΦt<HyVXe[^UWVSE uupjP膑YtStNtIV$CPh84 u*nHZySCX}e[^_4e[^_UWVSPE C0EujPXtTtstnV4$CPh84f uOH^y,S#jSS E tP[}e[^_ue[^_UVS]މǃth4Xu$FPh4Fjdh.jPVPjPt$t!P$FPh4( 2h? .jjh@ sSs sXHyVIXe[^_UU t tUU ҋM-tJu Ɓ@1UWVSQU EEftht tuP$jCPh4-5HZSfjEPjjuME Pf2%= u QRSfu QRSQ QwF$4uu ^_0u %u u h4h 4DYh? .jjh@ U rRr E pHZyShXe[^_US] EuBt>t9t4u/;HZy ]] ]USEPfJBt 9u4ft tu1x x ǃt E[鴣[UVSEl pfVfFtwf;At ǃp ef=uf;v ǃp +ffvDPAPFP ǃp p ǃl Ee[^e[^UEPRp ǀl p EUES@ Sɒǃ ]UWVSVu] jP蒊E| f~0[u! dž| Pw ftW7YEEe[^_WUWVS]u jP- Sǃ XZ}e[^_UUBPjRh|.FUWVSuPhЉS<ZYt V[4  xtP赡Y}e[^_饉US]PSZ4XPZ]E>UVSEPhIƋ  x[tPBYue[^3UVSEPhƋ  xZtPXue[^UVS]3Puu S[4Pe[^UWVSjjj u8P @Vh`RV謀V4{tHyVMYjEVj@"NjYZtVF0P[4XZ&tV [4tF0P[4XWVY;_nh踇jjh4jSC虜WC訇5USh]{ Zt1ǃ Pt]UVS]hAY t) jjh 4j P uǃ ue[^ UVS]hǃ Xt ǃ P͞[ue[^龆UVS]h蕆X tB 9L_u B > jjh4j PM uǃ L_Љ ue[^:UVS]hƋ H Zu* t! ǃ ǃ PXue[^܅UUz t1(BPB Pjjh`4 u1҉UWVSVVUBu jrhn 1SFEPh0S jj (~0tUU E@4 Pj  tEE E4 Edž dž U[1ۀztpP ZYuF]E E4Ѝe[^_1Py@u ‰ @u ‰ UCB9| t  uFE E4Ѝe[^_dž8 a.Љ< Ɔ@ VhD.Ѝl PThV VP-$ P$ FPh4QLJ LJ LJ LJ O, 4Љ4Љ4Љ 4Љ$hSk}fRfDŽT@Y@X~ٻdhS?}fRfDŽT@XZ~ֻhS}fRfDŽT@YX~֡4Љ4Љ4Љ4Љ4Љ"4Љ&4Љ*4Љ.hS|fRfDŽTCXZ~ۉ7fGPLJ27.LJ*.LJ).LJ*.ЋFG$FG(FG,F G0W= Wx LJ.h@h.WJ|jXjW Pdž @džd @f f fd f& dž dž( u E E$e[^_UWVSj@]>Ǎ0 P l P$ s0tP $ YX( tP( XZSSV6VyV WрS jAe[^1_US]ǃh T X Yt$hP&\ YZ1҅u&CPh@4 CPh4XZS Ћ]UEVST p0CtPqCXCtPVC[^e[^US]D H YtjhPyYZt8jjwP YZt.jPwP Y@Zt#@L 1FEh Glǀ fgPW+ ]e[^_5|e[^_UWVSU E0t2G$ ^0jPjju+w&PPh4'Bh U BP@t@hU z W@%fOG GjP&{ [Á C ffC f@fC C BCfGf%VfGG GG WVDž 8xd V w|jBPSWLS$zjjqU B uPh(0{~jP.rU B @ZYu+Ph)0OE p bU B =@U Bh.jjhE pP$ u ue[^_UU Bjw4$4ЋEf t!  0UM SU~#t҉tC(Й҉tCtEtC`[UEjwX$41RKD= 6/ (!   UWVSPE0UEMЋ] u ~ t fFdF ~tff? *Й҉tu)кיtN AfN S_FtU tFF Fe[^_UWVS EE@l@EU fƅY E PRVUDžXZuVe jhjjEPjE( Vd VzÅXuUGPU rjRcuE phDWug$jhj uWjU( V V V؍e[^_UWVSE0}DžT WUBl@U Ӂ$ CC ffC f@fC U CU fBf%VfBBB RVDž CsUd U VE U W EGZCuDDž j fC% Pu DžGPE pjPaU ru$U Bh<.hj PwWE( w w^v u W] Uh 1e[^_UWVSE0Dž } t,f ftERDUDX tjWQayǃ 7E Á$ CS ffC f@fC U CfGf%VfGG GG WVDž pMd V D]T C{ USwFu;DžpaZY Pj fFCPwjWV_wu($Gh<.hj PsSE( s sÃXv WZ Uh 1e[^_UWVSQQuljE0T ttE샸h CT u LJX C\ CEC tS XZuSu  Cu džCE샸h ~,CufNPF8t SP=YXEPSV  tP XZuSuR tEt PW耲[_FpEǀ fFNe[^_US]fCN ~'H uBPhw/Cp]fCN]]qUWVSPPEu jPE0 p1i EXtHwi i tϖWUfJPUxu RS^XUBPt@t u- u [@juZ1i u Su) SuXZ4Yugcuhiu茗 4uK u% u1^X.uVuYǃ 4uUBPAAuR [1une[^_USPPE UEfuEUEP]EE EEU  tP$CPh` 4 ]US E EfEEPEP]EEEEEE tP$CPh 41E]USPPE UEfuEUEP]EEEEU - tP$CPh 4C]USPPEU EfjEUEfP]E@EUEE tP$CPh 4 ]USRRE UEfuEUEP]E@EEEU \ tP@$CPh 4r ]UWVSQEu} E1hV7YZtC~uFE E%0Ѝe[^_fE EE ue[^_UE VS̀PhuV1ۃ hVZYtC~uFPh41hVe[^UWVSSE}Eu 1hW[fZYyC~uGE E%0Ѝe[^_B] ÁPhWShWE e[^_UWVSQQu] F0ESPeDžXZ{y> 9vЈEE r$t4hjV44jVE@PjhjV44jVE D&hjV44jVE@PjVr$hjVJ44jV;E DPjV&$tPjV hjV4\4jVE$ DPjVtPjV)hjV44jVE DPjV1$P44jV]PjVDhjV7$4\4jV%E DPjV1PjV$f1ҹ49t B$vM$wH4jV4jVE@PjV$4jV E tR tIjFV ZYuPjFV|hVhThRЉue[^_e[^_US] t PjS PjS]UVSjhfuV^0$ @2PhdV 1ҹ@t PhhV u PhfVe[^UVS] Cf Rh uV|CfS Rh V_CfS RhVBe[^UVS] Cf RhuVCfS RhVCfS RhVe[^UVSuhDV^0ZCQYuPhDVe[^UEw8$4и%0/&0( &0!&0&0"&0 )&0C2USSjEP]jSfUf  f  f f f jPjS j PjS~j PjttJAG?u)[^_ÐUUE 9sÐUUE 9~ÐUWV}SM] ȉt2vOȉ )É ؉[^_ÐUWVSM] uډ[}!^!_ÐUUE 9~ÐUWVSM] uډ[}1^1_ÐUUE 9sÐD$ffUMVu 19SU]rw 9r@[^ÐUVS]1҅ۋuM t A)A8uFtKu1[^ÐUWVSM] uډ[} ^ _ÐUMS] ډ[ÐD$t@Ð1ÐUWV}SM] ȉt/v O1Љ )Ɖ ؉[^_ÐUWVu} S]tItBCtIuutBu[)^B_ÐUUS:] t9؉tB:u1ɉ[UUS1ɀ:] t9uB:u[ÐUWVSQu1҅} t\ )PEEEG8؈ˆt1B<w`v zw Ea<w @vZwK 8utNu1҉Z[^_ÐUUE 9}Ðlunchannelirqiomemiosizdrqdrq2drivecontrollerconfigurationvendorproductreleasereportidbpfilterccdwsmux{)=H>*u+;Щ,p;80x25P`J. 80x25P`J.80x25bfP`J. 80x40P(`J. 80x40P(`J. 80x40bfP(`J. 80x50P2`J. 80x50P2`J.80x50bfP2`J. P4P45Ѓ5Ю5^6!7A9h:o@М>vga_init_screen: no fontvga_init_screen: no font vga_free_screen: consolevga_doswitch: disappeared vgavga_common_setup: couldn't map vga iovga_common_setup: couldn't map 6845 iovga_common_setup: couldn't map memoryvga_common_setup: mem subrange failedvga: pcvt font support not built in, see vga(4) drive at %s channel %d drive %datapiscsi at %s channel %dwdcspl drive 0 drive 1atapi type: %s c_bcount: %d c_skip: %d missing untimeout%s(%s:%d:%d): using BIOS timings using PIO mode %d, DMA mode %d, Ultra-DMA mode %dwdccmd%s:%d: %s %s(%s:%d:%d): %s user_strat: No ioctl %s channel %d: reset failed for%s: transfer error, downgrading to Ultra-DMA mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to PIO mode %d physio split wd ioctl request... cannot proceed Attempt to queue invalid SCB tag %x:%x%s: WARNING no command for scb %d (cmdcmplt) QOUTPOS = %d ahc_intr - referenced scb not valid during seqint 0x%x scb(%d) %s: Interrupted for status of 0 (?) %s:%c:%d: no active SCB for reconnecting target - issuing BUS DEVICE RESET SAVED_SCSIID == 0x%x, SAVED_LUN == 0x%x, ARG_1 == 0x%x ACCUM = 0x%x SEQ_FLAGS == 0x%x, SCBPTR == 0x%x, BTT == 0x%x, SINDEX == 0x%x SCSIID == 0x%x, SCB_SCSIID == 0x%x, SCB_LUN == 0x%x, SCB_TAG == 0x%x, SCB_CONTROL == 0x%x SCSIBUSL == 0x%x, SCSISIGI == 0x%x %s:%c:%d: Warning - unknown message received from target (0x%x). Rejecting %s:%c:%d: unknown scsi bus phase %x, lastphase = 0x%x. Attempting to continue %s:%c:%d: Missed busfree. Lastphase = 0x%x, Curphase = 0x%x ahc_intr: HOST_MSG_LOOP bad phase 0x%x HOST_MSG_LOOP with invalid SCB %x Unable to clear parity error. Resetting bus. data overrun detected %s. Tag == 0x%x. %s:%c:%d:%d: Attempt to issue message failed %s: No free or disconnected SCBs Bogus TAG after DMA. SCBPTR %d, tag %d, our tag %d ahc_intr: seqint, intstat == 0x%x, scsisigi = 0x%x %s: Transceiver State Has Changed to %s mode parity error detected %s. SEQADDR(0x%x) SCSIRATE(0x%x) No terminal CRC packet recevied %s: ahc_intr - referenced scb not valid during SELTO scb(%d, %d) Unexpected busfree %s SEQADDR == 0x%x %s: Missing case in ahc_handle_scsiint. status = %x %s: Infinite loop in critical section %s: ahc_alloc_tstate - Target already allocated%s: target %d synchronous at %sMHz%s, offset = 0x%x %s: target %d using asynchronous transfers %s: target %d using %dbit transfers Bus Device Reset Message Sent ahc_intr: AWAITING_MSG for an SCB that does not have a waiting message SCSIID = %x, target_mask = %x SCB = %d, SCB Control = %x, MSG_OUT = %x SCB flags = %xTarget did not send an IDENTIFY message. LASTPHASE = 0x%x. No SCB found during protocol violation No or incomplete CDB sent to device. Completed command without status. %s: Issued Channel %c Bus Reset. %d SCBs aborted Protocol violation %s. Attempting to abort. HOST_MSG_LOOP interrupt with no active messageTarget MSGIN with no active message(%s:%c:%d:%d): requested %dBit transfers. Rejecting... (%s:%c:%d:%d): Target Initiated PPR (%s:%c:%d:%d): Initiator Initiated PPR (%s:%c:%d:%d): refuses WIDE negotiation. Using 8bit transfers (%s:%c:%d:%d): refuses synchronous negotiation. Using asynchronous transfers (%s:%c:%d:%d): refuses tagged commands. Performing non-tagged I/O (%s:%c:%d:%d): refuses %s tagged commands. Performing simple queue tagged I/O only %s:%c:%d: Message reject for %x -- ignored %s: %s on %c:%d. %d SCBs aborted %s: WARNING - Failed chip reset! Trying to initialize anyway. Unsupported adapter type (0x%x). Ignoring %s: ahc_init_scbdata - Unable to allocate initial scbs Twin Channel, A SCSI Id=%d, B SCSI Id=%d, primary %c, %s: unable to allocate ahc_tmode_tstate. Failing attach %s: Host Adapter Bios disabled. Using default SCSI device parameters Infinite interrupt loop, INTSTAT = %xfound = %d, qinstart = %d, qinfifionext = %d Waiting List inconsistency. SCB index == %d, yet numscbs == %d.Disconnected List inconsistency. SCB index == %d, yet numscbs == %d.Disconnected List Loop. cur SCBPTR == %x, prev SCBPTR == %x. %s: Program too large for instruction memory size of %d! Unknown opcode encountered in seq program%s: failed to allocate DMA mem for %s, error = %d %s: failed to map DMA mem for %s, error = %d %s: failed to create DMA map for %s, error = %d %s: failed to load DMA map for %s, error = %d NONEaic7770aic7850aic7855aic7859aic7860aic7870aic7880aic7895aic7895Caic7890/91aic7896/97aic7892aic7899in Data-out phasein Data-in phasein DT Data-out phasein DT Data-in phasein Command phasein Message-out phasein Status phasein Message-in phasewhile idlein unknown phase80.040.033.020.016.013.410.08.06.675.75.04.44.03.6SXFRCTL0 == 0x%x SEQCTL == 0x%x for safety%s: Spurious SCSI interrupt LVD%s: Someone reset channel %c %s:%c:%d: CRC Value Mismatch Illegal CRC packet request non- Unexpected %sDT Data Phase Selection Timeout TagSCB %d - Abort%s Completed. Bus Device Reset%s: critical section loop DT%s:%c:%d:%d: Abort%s Message Sent Unknown protocol violation. Unknown REQINIT message typeorderedhead of queue%s: No SCB space found hardware SCB structuressense buffersSG spaceUltra Ultra160 Ultra2 WideSingle%s%s Channel %c, SCSI Id=%d, %d/%d SCBsshared dataqinpos = %d, SCB index = %d Loop 1Inactive SCB in qinfifo First/Second Qinfifo fixupscb_index = %d, next = %d Waiting List traversalInactive SCB in Wait List Inactive SCB on pending list Bogus resid sgptr value 0x%xahc_loadseq: Could not malloc%s: BMOV not supported%s[0x%x]:(|ahc_createdmamem error (%d) "eYj$@@h>@@h@<`>` Bh@xM0Lp90j^Q 1W jvQ^Q09`0pj^r0@~100MW@ 1eX` @xj"` x@ h x jjjxP0jHj]jjHj]j&z=znx=z=1=21NyeXfxf1f21f|@fhie AWe@aj^Q q xe@z=zx=z jeAe^e@ h j "xee>00  0T0xee4T4x 44 x4@ 10z0?|eX y0jp]@j>] y j]]x0 yjp]e@@le "|e 0e]?*d# e]?*d"De"deBD@je 0e]?s@j:0jteAdjj]dldtdtjbtdt#dJtd^taj^e]QqeBD\|Qj`]Q\dT|^lAj^e^D!j^e^DjV]0eAX| 1f fQ4L=(d|e> 10eeLj"j eeTj"j eeeLj"jeeUj"jl0QuQ]Q 1e6E?>6ue^Pefj Bnj jDj^ j];&1;\nj ee^eTf &eFjj `nbn|n|n|ndd0fpffv`f=d(e`F& ~nbe^e^e^e^00000004l21l21l21l21l21l21l21l25~& nj nB~1jv4jv e BfAfj^jA 10jvFB 14A~14e"1jj ppp p  p p ppp pp"kp%0Wp%Cp* p- /p1 p20p2 p3p5Cp7 p8Cp< p=CpG pHCpK pLCpO pPWp[$@p] p^p`pipm pn0pn pokpp ptpupw pxkpykpЃ|pЗpШ pЭ pЮCpй pкCp pCp pWpT pp p pCpm0p) oo9p. p/Cp2o7Cp8 p:o>o@ 0Cp@ pApF pGpKpR @kpRWpSpToUpe0oepkoupzozkp| o}CpЀoЇoЌ%0CpЍ pА CpИ pО% oОoЧ oЩCpЫ pЬkpЭkpЮWpЯ 0pа pбCpвoг oгoе%@CpеCpм pо0Cpо pп p kp) pWpap p0Cp p p p0Cp p p p%pCp`uo puo ppp pp pao%pH pIJoLWpNpPpV pXp[ p\Cp]0o^p`uoi pkuoo*0pq"py& pz"pЄ pЅuoІ pЇ pЉpЊpЍpЏpБ pГ pЕpИpЛuoПuoТpШpЫ pЬkpиBpRCp pCp pp3o:kpCp cuo po p0o p p#0o/K pApYpZ p]o^pa3 Z]agikkmܭܭܭܭܭOOO#ЭШШШШШШ33333333ahccmd fail %s: board is not responding SCB 0x%x - timed out again Other SCB Timeout%s%s: Hung target selection Queuing a BDR SCB no longer in timeout, status = %x %s: Timed out SCB already complete. Interrupts may not be functioning. sg[%d] - Addr 0x%x : Length %d BDR message in message buffer Timed-out target SCB but bus idleSCB %d: Immediate reset. Flags = 0x%x ]]РЬ]ии%s: Illegal cable configuration!!. Only two connectors on the adapter may be used at a time! aic7901aic7902aic7901ADiscard Timer has timed outSequencer Parity ErrorData-path Parity ErrorCIOBUS Parity Error/usr/src/sys/dev/ic/aic79xx.cahd_run_qoutfifo recursion%s: hwerrint, %s BRKADRINTFor safety%s: ILLEGAL_PHASE 0x%x %s: Issued Bus Reset. SEQCTL0 == 0x%x Lun ResetTarget ResetUnexpected TaskMgmt FuncSCB completes before TMF %s: Tracepoint %d %s: Unexpected SEQINTCODE %d %s: Someone reset channel A %s: lqostat0 == 0x%x! LQISTAT1LASTPHASESCSISIGIPERRDIAGLQICRC_NLQ Need to handle BADLQI! Acking %s to clear perror LQIRETRY for LQIPHASE_LQ LQIRETRY for LQIPHASE_NLQ found == 0x%x Shared Data: %#02x Last(RDSTRM|DT(DT|IU(IU|RTI(RTI|QAS(QAS(QAS)LQIRETRY for LQIPHASE_OUTPKT %s: Returning to Idle Loop SG data structuresSense Data structuresPrimary LowPrimary HighSecondary LowSecondary HighTerminated CorrectlyOver TerminatedUnder TerminatedNot Configured%s: %s Channel %s WAITING_TID_QUEUES: TID LIST LOOP%s: SCB = 0x%x Not Active! Waiting TID List traversal %d ( Inactive SCB pending MK_MSG Removing MK_MSG scb Queueing mk_msg_scb %s: SCB = %d Not Active! Inactive SCB in Waiting List SCB LIST LOOPUnable to parse pkt_failures No packet failure found Invalid Command IU Field TMF not supportd TMF failed Invalid L_Q Type code Illegal request ahd_loadseq: Could not mallocCard was paused Completions are pending SELOIDSELIDHS_MAILBOXSEQINTSTATSAVED_MODESCSIPHASESCSIBUSSCSISEQ0SCSISEQ1SEQCTL0SEQINTCTLSEQ_FLAGSSEQ_FLAGS2KERNEL_QFREEZE_COUNTMK_MESSAGE_SCBMK_MESSAGE_SCSIIDSSTAT0SSTAT1SSTAT2SSTAT3SIMODE1LQISTAT0LQISTAT2LQOSTAT0LQOSTAT1LQOSTAT2Pending list: %3d FIFO_USE[0x%x] SCB_CONTROLSCB_SCSIID Total %d Kernel Free SCB list: Sequencer Complete list: FreeActiveSEQIMODESEQINTSRCDFCNTRLDFSTATUSSG_CACHE_SHADOWSG_STATEDFFSXFRCTLSOFFCNTMDFFSTATHADDR = 0x%x%x, HCNT = 0x%x CCSGCTL LQIN: SIMODE0CCSCBCTLCDB %x %x %x %x %x %x STACK:%3dnot SCB %d - timed out  xnY0 xnY3hY3`::hM5x412!`513!`M 4@PK:h1;p0Q1-pQ1)`(30Q2b:@!;p@KirY@Ki KiBDx@Dx^ MHx^0? 0P`JR@J^XvXX@3hY3RxXP1 oxPKjh:tnY%_h[^@hY0~hfYhYfy "hY"x, 2yhxxZ Y2`^x03`6(3P6Z XV|2 x@2={-`)`@WxUhSTPR1VHxP0`00  0@xZ TU"m3 I2Z^1@11=) 1P11qyyM26X7!q"Q1\3D6@2D6M!i@Ri-Wa)p(U2ZD0D1(Q1`1a1=a11VTU"KqJq JiJQ1.A1 ZQ2$0\A,Q10\AZ51 150 04 0 0 Q1L(yk0d@:tvX3hY30? 0a ?i?y~hY0NQ5~hYNQ5JAyW%d aic_minphys aic_poll sending DEVICE RESET sending ABORT selecting %d:%d %d:%d busy idle requesting sense aic_done resid=%d sense=0x%02x aic_msgin n=%d imess=0x%02x message rejected %02x sending REJECT aic_msgout retransmitting %02x%02x %d> extra data aicintr sstat1:0x%02x %s: SCSI bus reset %s: SCSI bus parity error sstat0:0x%02x reselected backoff selector selection timeout %s: BUS FREE while not idle; state=%d %s: unexpected disconnect; sending REQUEST SENSE cmd=0x%02x+%d dataout dleft=%d datain %d target_stat=0x%02x AGAIN acb@%p xs=%p flags=%xready list: nexus: nexus list: nexus=%p prevphase=%x state=%x msgin=%x %d senses flags=%x %s: reselect with invalid selid %02x; %s: reselect from target %d lun %d with no nexus; should call debugger here (aic6360.c)%s at line %d: assertion failed %s: unrecognized MESSAGE EXTENDED; %s: unrecognized MESSAGE; sending REJECT %s: reselect without IDENTIFY; %s: unexpected MESSAGE IN; sending DEVICE RESET %s: unexpected MESSAGE OUT; sending NOOP %s: target mode selected; going to BUS FREE %s: selection out while idle; %s: selection timeout while idle; %s: unexpected bus phase; resetting dp=%p dleft=%d target_stat=%x aic6360: SCSISEQ=%x SXFRCTL0=%x SXFRCTL1=%x SCSISIG=%x SSTAT0=%x SSTAT1=%x SSTAT2=%x SSTAT3=%x SSTAT4=%x SIMODE0=%x SIMODE1=%x DMACNTRL0=%x DMACNTRL1=%x DMASTAT=%x FIFOSTAT=%d SCSIBUS=0x%x msgpriq=%x msgoutq=%x lastmsg=%x currmsg=%x tinfo%d: %d cmds %d disconnects %d timeoutsЧоИ:hЁУЊУУУxУУУУУУУ5УУУУУУУУУУУУУУУГdptPM3334SmartRAID IVPM3332PM2144SmartCache IVPM2044PM2142PM2042PM2041PM3224SmartRAID IIIPM3222PM3021PM2124SmartCache IIIPM2024PM2122PM2022PM2021SK2012SmartCache PlusSK2011%s: unable to create CCBs %s: %d/%d CCBs created! %s %s (%s) %s: interrupting at %s %s: dpt_cmd failedshutting down %s... done %s: HBA not ready %s: HBA error %s: ec_hba field invalid EATA%s: EATA signature mismatch %s: DMA not supported dptccb%s: HBA status %x %s: SCSI status %x %s: dpt_scsi_cmd: more than %d dma segs error %d loading dma map %s: dpt_cmd failed AGAIN, resetting HBA %s: no CCB for inquiry%s: inquiry timed outunknown adapter, please report using sendbug(1)%s: bogus status (returned CCB id %d) %s: unable to allocate CCBs, error = %d %s: unable to map CCBs, error = %d %s: unable to create CCB DMA map, error = %d %s: unable to load CCB DMA map, error = %d %s: %d queued commands, %d channel(s), adapter on ID(s)%s: HBA timeout on EATA command issue; aborting %s: HBA not ready after reset: %02x %s: cfg data didn't appear (status:%02x) %s: can't create ccb dmamap (%d) %s: unable to init ccb, error = %d timed out (status:%02x aux status:%02x)%s: inquiry failed (hba:%02x scsi:%02xadvadvccb%s -get: Chip is not halted I/O port address modified EEPROM checksum error IRQ modified unknown warning %d %s -set: %s: bad signature%s: unable to load MicroCode AGAIN. Resetting Bus %s: unable to allocate control structures, error = %d %s: unable to map control structures, error = %d %s: unable to create control DMA map, error = %d %s: unable to load control DMA map, error = %d %s: unable to initialize ccb, error = %d %s: unable to create DMA map, error = %d %s: unable to allocate overrun buffer, error = %d %s: unable to map overrun buffer, error = %d %s: unable to create overrun buffer DMA map, error = %d %s: unable to load overrun buffer DMA map, error = %d adv_init: adv_find_signature failedCouldn't get MicroCode Start address I/O port increment switch enabled tag queuing enabled w/o disconnects %s: unable to initialize MicroCode%s: unable to initialize board RISC chip%s: unable to create control blocks %s: WARNING: only %d of %d control blocks created %s: adv_scsi_cmd, more than %d dma segments %s: adv_scsi_cmd, error %d loading dma map %s: exiting ccb not allocated! should call debugger here (adv.c)IIJIIJIJJJIJJJJJJJJadwadwccbADW_BUSY ADW_ERROR %s: BIST pre-test error%s: BIST RAM test error%s: Microcode checksum error%s: Cable is reversed%s: unable to create Carriers%s: WARNING: Bus Reset Error AGAIN. Resetting SCSI Bus %s: target %d using %d bit async 80.0 40.0 %d.%d xfers %s: bad scsi_status: 0x%02x. %s: bad host_status: 0x%02x%s: SCSI Bus reset detected %s: unable to allocate carrier structures, error = %d %s: unable to map carrier structures, error = %d %s: unable to create carriers DMA map, error = %d %s: unable to load carriers DMA map, error = %d adw_init: adw_find_signature failed%s: Bad checksum found. Setting default values %s: Bad bus termination setting.Using automatic termination. %s: unable to create Control Blocks %s: WARNING: only %d of %d Control Blocks created %s: All three connectors are in use%s: HVD attached to LVD connector%s: single-ended device is attached to one of the connectors%s: adw_scsi_cmd, more than %d dma segments %s: adw_scsi_cmd, error %d loading dma map %s: unallocated ccb found on pending list! should call debugger here (adw.c)%s: host adapter error 0x%02x. See adw(4). %s: host adapter error 0x%02x, resetting bus. See adw(4). %s: bad done_status: 0x%02x (host_status: 0x%02x, scsi_status: 0x%02x) %s: RDMA failure. Resetting the SCSI Bus and the adapter %s: Host generated SCSI bus reset occurred %s: Unknown Async callback code (ignored): 0x%02x 5cccccccccccccccccКcЦcЦccЦccccЦcccccccЦccЦccЦcЦcccccccccccccЦcccЦcccccccccccccЦcЦcЦcЦccЦcJcЈc cЈcЈcЈcjcЈcЈcЈcЈcЈcЈcЈc cЈcЈcЈc cЈcЈcЈcjcЈcЈcЈcЈcЈcЈcЈcЈcЈcJcЈcЈcЈcЈcЈcjcЈcЈcЈcЈcЈcЈcЈcJcbha(bha probe)%s: model BT-%s, firmware %s bhaccb%s: host_stat %x %s: target_stat %x 3.31no parityasync%s: %s, %s %s: bha_cmd, host not idle(0x%x) %s: bha_cmd, cmd/data port full %s: bha_cmd, cmd/data port empty %d %s: bha_cmd, host not finished(0x%x) %s: unable to create ccb DMA map, error = %d should call debugger here (bha.c)bha_find: illegal bus type %c bha_find: illegal drq setting %x bha_find: illegal irq setting %x %s targ %d: sync, offset %d, period %dnsec %s: bha_scsi_cmd, more than %d dma segments %s: bha_scsi_cmd, error %d loading dma map %s: bad mbi ccb pointer; skipping %s: mbi not in round-robin order %s: bad mbi status %02x; skipping gdt%s: bus_dmamem_alloc failed%s: bus_dmamem_map failedoffgdt_attach%s: command %d timed out %s: gdt_scsi_cmd: level > 0%s: DPMEM overflow uio move not yet supported ICP Host drive #%02dgdt_ccbscreen service initialization error %d cache service initialization error %d cannot get channel count, error %d cannot get cache info, error %d raw service initialization error %d dpmem %x %d-bus %d cache device%s %s: ver %x, cache %s, strategy %d, writeback %s, blksz %d %s: raw feat %x cache feat %x %s: cannot create ccb dmamap (%d)%s: out of bounds %u-%u >= %u %s: mode sense page %d not simulated gdt_internal_cache_cmd got bad opcode: %d %s: uninitialized or unknown service (%d %d) %s: no free command index found                                           ˎЯЯЖЯЯЯЯЯЯЯЯЯЯЯЯЯЯČЯЯЯЯЯЯЯQˎЯЯЯЯЯЯЯЯЯ4twe: cannot map commands (%d) twelk: card CPU is not ready : out of ccbs : we don't get it : card CPU error detected : PCI parity error detected : queuing error detected : PCI abort : Escalade V%d.%d %s: done failed (%d) twespank%s: twe_start(%d) timed out %s: undone ccb %d ready 3WARE : cannot allocate commands (%d) : cannot create ccb cmd dmamap (%d) : cannot load command dma map (%d) : cannot get card's attention : error draining attention queue : failed to fetch unit parameters : cannot create ccb dmamap (%d) %s: error fetching capacity for unit %d %s: failed to create kernel thread, disabled uio move is not yet supported МǨǨʦbEǨǨǨcac%s: no volumes defined %s: unable to alloc CCB cac_cmd: nsegs botch%s: timeout %s: CCB not active, xs=%p %s: soft error; corrected %s: hard error %s: invalid request Compaq RAID4RAID0RAID1RAID5%s volume #%02dЍmSЯukk=kkkkøkøkkkkkkkkkkkkkkk%ukkukkkkkkkkøkøkkkkkkkkkkР%s: CAC_CMD_START_FIRMWARE failed %s: CAC_CMD_GET_CTRL_INFO failed %s: cannot allocate memory for drive_info %s: CMD_GET_LOG_DRV_INFO failed cissCISS: bad sign 0x%08x : unsupported version 0x%08x : not simple 0x%08x HUMPPA: cannot set config : cannot simplify 0x%08x : cannot allocate CCBs (%d) : cannot map CCBs (%d) : adapter inquiry failed WIDEBIGMAP%s: adapter LD map failed ciss_cmdlmap %x:%x ciss: dead: she never came ready for me 0x%08x : cannot create CCBs dmamap (%d) : cannot load CCBs dmamap (%d) : cannot create ccb#%d dmamap (%d) : cannot allocate scratch buffer (%d) : cannot map scratch buffer (%d) : big map is not supported, flags=%b : %d LD%s HW rev %d FW %4.4s/%4.4s FREEREADYONQPREQPOLLFAIL%s: ccb %d not ready state=%b %s: unqueued ccb %p ready, state=%b %s: invalid cmd 0x%x: 0x%x is not valid @ 0x%x[%d] %s: cmd_stat %x scsi_stat 0x%x ami: cannot allocate %s%s (%d) : cannot map %s%s (%d) init datasglistFC loop: cannot do inquiry %c.%02d.%02d%s: ccb %d not ready <%d> %s: timeout ccb %d ami_stimeout(%d) botch%s: xs->datalen too big(%d) ami rawami_ptAMI : cannot create %s dmamap (%d) : cannot load %s dma map (%d) : FW %s, BIOS v%s, %dMB RAM %s: %d channels, %d %ss, %d logical drives %s: firmware buggy, limiting access to first logical disk %s: no memory for raw interface %s: status 0xff from the firmware%s: command not accepted, polling disabled %s: bad status, polling disabled %s: firmware didn't reply, polling disabled %s: firmware didn't ack the ack, polling disabled %s: interrupt didn't arrive, polling disabled %s: unqueued ccb %d ready, state = %d %s: unsupported command(0x%02x) ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,_ZZДZZZZyZyZZZZZZZZZZZZZZ(dZZdZZZZZZZZyZyZZZZZZZZZZyTarget %d Loop ID 0x%x (Port 0x%x) => Loop 0x%x (Port 0x%x)Target %d duplicates Target %d- killing off bothRetaining Loop ID 0x%x for Target %d (Port 0x%x)Retained login of Target %d (Loop ID 0x%x) Port 0x%xLogging out Target %d at Loop ID 0x%x (Port 0x%x)Command Error in PLOGI for Port 0x%x (0x%x)Could not get PDB for Device @ Port 0x%xPDB Loop ID info for Device @ Port 0x%x does not match up (0x%x)PDB Port info for Device @ Port 0x%x does not match up (0x%x)Target %d (Loop ID 0x%x) Port 0x%x dumped after login info mismatchNot RESPONSE in RESPONSE Queue (type 0x%x) @ idx %d (next %d) nlooked %dHBA attempted queued transaction with disconnect not set for %d.%d.%dHBA attempted queued transaction to target routine %d on target %d bus %dHBA attempted queued cmd for %d.%d.%d when queueing disabledSCSI phase skipped for target %d.%d.%dLoop ID %d, AL_PA 0x%x, Port ID 0x%x, Loop State 0x%x, Topology '%s'Fabric Nameserver rejected %s (Reason=0x%x Expl=0x%x) for Port ID 0x%x(%d.%d.%d): FIN dl%d resid %d STS 0x%x SKEY %c XS_ERR=0x%x%s CHAN %d FTHRSH %d IID %d RESETD %d RETRYC %d RETRYD %d ASD 0x%x%s RAAN 0x%x DLAN 0x%x DDMAB 0x%x CDMAB 0x%x SELTIME %d MQD %d%s CHAN %d TGT %d FLAGS 0x%x 0x%x/0x%xGeneratedNVRAMbad underrun for %d.%d (count %d, resid %d, status %s)bus %d is in %s Mode&-4;BIPЩФ & - 4 ; B [/0Г0V1a1Ѕ1Ц1з1112;A{AСAШAкAAAЦFЦF#B,B8BBBLBЦFгCmDЧDDEBEгCЦFЦFЦFЦFЦFЦFЦFЦFЦFЀCГCЦFЦFЦFЦFЦFЦFЦFЦFЦFЦFЦFЦFЦFЦFcEЀCtChC\CPCEЦFЦFЦFЦFЦFЦFЦFЦFЦFЌCFFFFFFУGУGУGУGУGЕGЕGУGУGУGЕGЕGЕGЕGЕGЁGУGУGУGУGУGЕGЕGУGУGУGУGУGУGУGЕGPGaHІHxJJPKKKLBLgLЌLбLLL MEMjMБMжMMQQLNqNЖNлNN O.OrO(PPQQQQQQPPХQQ?????OOOO?O!/OO1OODifferentialSingle-Endedunknown mode on bus %d (0x%x)Unknown Chip Type 0x%x1020A1040A1040B1040CDifferential ModeUltra Mode Capablechip reset timed outRam Checksum Failureskipping f/w downloadloadedresidentFirmware Attributes = 0x%xInstalled in 64-Bit PCI slot%d max I/O commands supportedCannot setup DMAEnabled FW features (0x%x)Not using any WWNsPrivate LoopFL PortN-Port to N-PortF PortFirmware State <%s->%s>2Gb link speed/s?????Config WaitWaiting for AL_PAWait LoginLoss Of SyncRe-InitNonparticipatingRemap OverflowNo LoopFailed to allocate XCB buffertimeout or transmit failedno fabric loopremote device not a targetSNS Failed- %sGID_FTGPN_IDGNN_IDRegister FC4 types succeededAdapter not at RUNSTATERequest Queue Overflowout of xflist pointersRequest Queue Overflow+Unknown Control Opcode 0x%xoptr %x soft optr %xQueue Entry%s:%s %02x0x%08x:%scontinuation segmentinternal queues fullbad header flagbad request packetasked for %ld got resid %ldAsync Mbox 0x%xRequest Queue Transfer ErrorResponse Queue Transfer Errordevice reset on bus %dextended message underrunSCAM interruptTransition to LVD modeFast Posting CTIO donePoint-to-Point -> Loop modeLoop -> Point-to-Point modeFATAL CONNECTION ERRORUnknown Async Code 0x%xfast post completion of %uIgnored Continuation ResponseUnhandled Response Type 0x%xstates=>%s GOT_BUS%s GOT_TGT%s SENT_CDB%s XFRD_DATA%s GOT_STS%s GOT_SNS%s XFR_CMPLT%s status=>%s Disconnect%s Sync_xfr%s Parity%s Bus_Reset%s Device_Reset%s Aborted%s Timeout%s Negotiationcommand aborted for %d.%d.%dNOP rejected by %d.%d.%dIDENTIFY rejected by %d.%d.%dnot markedport logout for target %dport changed for target %dport busy for target %dUnknown Command 0x%xno parameters for 0x%xopcode %xTIMEOUTHOST INTERFACE ERRORTEST FAILEDCOMMAND ERRORCOMMAND PARAMETER ERRORLOOP ID ALREADY IN USEPORT ID ALREADY IN USEALL LOOP IDS IN USEerror 0x%xUsing Node WWN 0x%08x%08xUsing Port WWN 0x%08x%08xisp_reinit cannot reset cardinvalid NVRAM headerinvalid NVRAM checksumNVRAM Port WWN 0x%08x%08xNVRAM Node WWN 0x%08x%08xisp_mboxcmdRegister Test Failed (0x%x 0x%x 0x%x 0x%x 0x%x)F/W download failed at word %dBoard Type %s, Chip Revision 0x%x, %s F/W Revision %d.%d.%dLast F/W revision was %d.%d.%dMBOX_BUSY never cleared on resetfailed to set active negation state (%d,%d), (%d,%d)failed to set tag age limit (%d,%d)Initiator ID is %d on Channel %dInitial Settings bus%d tgt%d flags 0x%x off 0x%x per 0x%xbad frame length (%d) from NVRAM- using %dbad maximum allocation (%d)- using 16bad execution throttle of %d- using 16Setting ICB Node 0x%08x%08x Port 0x%08x%08xisp_fibre_init: fwopt 0x%x xfwopt 0x%x zfwopt 0x%xF Port (no FLOGI_ACC response)usec%d: 0x%lx->0x%lx enano 0x%x%08xgiving up on synchronizing the port databaseFailed to allocate IOCB bufferfabric too big for scratch areaunsupported cdb length (%d, CDB[0]=0x%x)Target %d does not have target serviceSTART cmd for %d.%d.%d cmd 0x%x datalen %lddriver initiated bus reset of bus %dTarget %d on Bus %d Reset Succeededcannot find handle for command to abortMbox Command Async (0x%x) with no waitersinterrupt (ISR=%x SEMA=%x) when not readyResponse Queue Out Pointer Unstable (%x, %x)bogus intr- isr %x (%x) iptr %x optr %xunknown flags (0x%x) in responsebad request handle %d (type 0x%x, flags 0x%x)cannot find handle 0x%x (type 0x%x)cannot find handle 0x%x (status 0x%x)Request Queue Entry bounced backunhandled response queue type 0x%xtimeout initiated SCSI bus reset of bus %dstalled SCSI Bus after DATA OverrunSCSI Bus reset after DATA OverrunTransition to Differential modeTransition to Single Ended modeTransition to Unknown Mode 0x%xLIP destroyed %d active commandsPoint-to-Point -> Loop mode (BAD LIP)Looped Back in Point-to-Point modeUnknown connection mode (0x%x)Selection Timeout for %d.%d.%dcommand incomplete for %d.%d.%d, state 0x%xDMA error for command on %d.%d.%dtransport error for %d.%d.%d: %sbus reset destroyed command for %d.%d.%dcommand timed out for %d.%d.%ddata overrun for command on %d.%d.%dcommand overrun for command on %d.%d.%dstatus overrun for command on %d.%d.%dmsg not COMMAND COMPLETE after status %d.%d.%dNo MESSAGE OUT phase after selection on %d.%d.%dEXTENDED IDENTIFY failed %d.%d.%dINITIATOR DETECTED ERROR rejected by %d.%d.%dABORT OPERATION rejected by %d.%d.%dMESSAGE REJECT rejected by %d.%d.%dMESSAGE PARITY ERROR rejected by %d.%d.%dBUS DEVICE RESET rejected by %d.%d.%d%d.%d.%d had an unexpected bus freeInvalid IOCB entry type detectedinternal queues full for %d.%d.%d status 0x%xAuto Request Sense failed for %d.%d.%dWide Negotiation failed for %d.%d.%dSDTR Message failed for target %d.%d.%dBad LVD condition while talking to %d.%d.%dport unavailable for target %dUnknown Completion Status 0x%xCommand for fast post handle 0x%x not foundMailbox Command '%s' failed (%s)skipping target %d bus %d updatebus %d set tgt %d flags 0x%x off 0x%x period 0x%xisp_reinit cannot restart cardversion %d NVRAM not understoodNVRAM: maxfrmlen %d execthrottle %d fwoptions 0x%x loopid %xPolled Mailbox Command (0x%x) TimeoutInterrupting Mailbox Command (0x%x) Timeoutispadded to blocked queueActive Hiwater Mark=%dblocking queueretrying later for %d.%drestarting blocked queuewatchdog timeout on handle %xwatchdog with no commandrestarted command for %d.%dblocked cmd againCMD_RQLATER%s for %d.%drequeued %d commandsNoTargetTarget/Initiator, 16 bit wide, Tagged Queueing EnabledBus %d Target %d Async Mode%sSCSI bus %d reset detectedLoop DOWNLoop UPArrivedDepartedName Server Database Changed Nx_Port NL_Port N_PortF/NL_Port FL_Port F_port E_portfinished command on borrowed timewatchdog found done cmd (handle 0x%x)recursive watchdog (handle 0x%x)watchdog cleanup for handle 0x%xpossible command timeout on handle %x, 16 bit wide, Tagged Queueing EnabledBus %d Target %d at %dMHz Max Offset %d%sTarget %d (Loop 0x%x) Port ID 0x%x role %s %s Port WWN 0x%08x%08x Node WWN 0x%08x%08x%s Fabric Device @ PortID 0x%xout of space for fabric devicesInternal Firmware Error on bus %d @ RISC Address 0x%x 0_ЗЗ=IÉЗЗЗЗЗ=%s: Can't get MPT IOC operationalsoft reset failed: device not runningsoft reset failed: doorbell wedgedsoft reset failed: ack timeoutsoft reset failed: device did not start runningfirmware downloadboot failure (%d)!mpt_get_request: corrupted request free listmpt_get_request: corrupted request free list (xfer)handshake aborted due to invalid doorbell statempt_send_handshake_cmd timeout1mpt_send_handshake_cmd timeout2mpt_send_handshake_cmd timeout! index = %dmpt_recv_handshake_cmd timeout1mpt_recv_handshake_cmd timeout2reply length does not match message length: got 0x%02x, expected 0x%02xmpt_recv_handshake_cmd timeout4mpt_recv_handshake_cmd timeout3mpt_read_cfg_header: Config Info Status %xmpt_read_cfg_page: Config Info Status %xmpt_write_cfg_page: Config Info Status %xCould not retrieve Manufacturing Page %i Header.Could not retrieve manufacturing Page %iManufacturing Page 0 data: %s %s %s %s %sManufacturing Page 2 data: %x %xManufacturing Page 3 data: %x %xManufacturing Page 4 data: %x %x %x %x %xCould not retrieve IO Unit Page %i header.Could not retrieve IO Unit Page %iIO Unit Page 2 data: %x %x %x %x %x %xCould not retrieve IOC Page %i header.Could not retrieve IOC Page %iIOC Page 0 data: %x %x %x %x %x %x %x %xIOC Page 2 data: %x %x %x %x %xIOC Page 2 RAID Volume %x %x %x %x %xIOC Page 3 Physical Disk: %x %x %x %xCould not retrieve RAID Volume Page 0 HeaderCould not retrieve RAID Volume Page 0Could not retrieve RAID Phys Disk Page 0 HeaderRAID Volume Physical Disk PageCould not retrieve RAID Phys Disk Page 0RAID Volume Page 0 data: %x %x %x %x %x%x %x %x %xRAID Volume Page 0 Physical Disk: %x %xRAID Phyical Disk Page 0 data: %x %x %x %x %x%x %x %xRAID Phyical Disk Page 0 data: %sRAID Phyical Disk Page 0 data: %x %x %x%x %x %x %x %x %x %x %xSPI Port Page 0 Header: %x %x %x %xSPI Port Page 1 Header: %x %x %x %xSPI Port Page 2 Header: %x %x %x %xSPI Target %d Device Page 0 Header: %x %x %x %xSPI Target %d Device Page 1 Header: %x %x %x %xfailed to read SPI Port Page 0SPI Port Page 0: Capabilities %x PhysicalInterface %xfailed to read SPI Port Page 1SPI Port Page 1: Configuration %x OnBusTimerValue %xfailed to read SPI Port Page 2SPI Port Page 2: Flags %x Settings %xSPI Port Page 2 Tgt %d: timo %x SF %x Flags %xcannot read SPI Tgt %d Device Page 0SPI Tgt %d Page 0: NParms %x Information %xcannot read SPI Tgt %d Device Page 1SPI Tgt %d Page 1: RParms %x Configuration %xSPI Port Page 1 Config value bad (%x)- should be %xfailed to reset SPI Port Page 1 Config valueSet Tgt %d SPI DevicePage 1 values to %x 0 %xSPI Tgt %d Page 1: RParm %x Configuration %xIOCFACTS: GlobalCredits=%d BlockSize=%u Request Frame Size %uPORTFACTS: Type %x PFlags %x IID %d MaxDev %drunning in vmware, skipping pageretrievalcould not retrieve IO Unit pagescould not retrieve manufacturingpagesassembling SG list (%d entries)sending FW Upload request to IOC (size: %d, img size: %d)wrote magic DiagWriteEn sequence (%x)writing file image: 0x%x u32's @ %pwrite ext image: 0x%x u32's @ %penable diagnostic mode FAILED! (%02xh)soft resethard resetdiag0=%08xfailed to reset devicempt_free_request bad req ptrrequest %d already freempt_init_request bad req ptrSend Request %d (0x%x):%08x %08x %08x %08xflags %d, upload_fw %dread_cfg_header timed outread_cfg_page timed outpage type 0x%x not changeablempt_write_cfg_page timed out%s %x: %x %x %x %xManufacturing Header PageManufacturing Page 1 data:IO Unit Header PageIO Unit Page 0 data: %llxIO Unit Page 1 data: %xIOC Header PageIOC Page 1 data: %x %x %xIOC Page 3 data: %x IOC Page 4 data: %x %xIOC Page 4 SEP: %x %xRAID Volume Header Pageenabling port %dport enable timed outdis%sabling async eventsdoorbell req = %smpt_get_iocfacts failedmpt_get_portfacts failedmpt_send_ioc_init failedmpt_send_ioc_init okIOC failed to go to run stateIOC now at RUNSTATEfirmware upload required.firmware upload failure!firmware upload not required.failed to enable port 0enabled port 0failed to initialize IOCUnsupported Port Type (%x)initiator role unsupportedcould not retrieve IOC pagescould not retrieve RAIDpagesenabling interruptsmpt_alloc_fw_mem error: %dnsegs > maxsglfw_upload reply status %dfreeing image memoryfw size 0x%x, ioc FW ptr %pFW Image @ %pLoadStart addr written 0x%xwrite IopResetVector addr!write IopResetVector value!SuccessIOC: Invalid FunctionIOC: BusyIOC: Invalid SGLIOC: Internal ErrorIOC: ReservedIOC: Insufficient ResourcesIOC: Invalid FieldIOC: Invalid StateInvalid ActionInvalid TypeInvalid PageInvalid DataNo DefaultsCan't CommitSCSI: Recoverd ErrorSCSI: Invalid BusSCSI: Invalid Target IDSCSI: Device Not ThereSCSI: Data OverrunSCSI: Data UnderrunSCSI: Data ErrorSCSI: Protocol ErrorSCSI: Task TerminatedSCSI: Residual MismatchSCSI: Task Management FailedSCSI: IOC Bus ResetSCSI: External Bus ResetSCSI Target: Priority I/OSCSI Target: Invalid PortSCSI Target: AbortedSCSI Target: No ConnectionFC: AbortedFC: Recieve ID InvalidFC: Recieve DID InvalidFC: Node Logged OutLAN: Device Not FoundLAN: Device Not FailureLAN: Transmit ErrorLAN: Transmit AbortedLAN: Recieve ErrorLAN: Recieve AbortedLAN: Partial PacketLAN: CanceledSCSI IO RequestSCSI Task ManagementIOC InitIOC FactsConfigPort FactsPort EnableEvent NotificationFW DownloadSCSI Target Command BufferTarget AssistTarget Status SendTarget Mode AbortFC: Link Service BuffersFC: Link Service ResponseFC: AbortLAN SendLAN RecieveLAN ResetNoneLogDataUnit AttentionRescanLink Status ChangeLoop State ChangeLogoutEventChangeAutoSense_ValidAutoSense_FailedNo_SCSI_StatusState_TerminatedRepsonse_Info_ValidQueue Tag RejectedCheck ConditionIntermediate ConditionReservation ConflictQueue FullDWEFLASH_BadTTLIDisARMDMEUnknown (0x%08x)UnknownNo OneROM BIOSPCI PeerHost DriverManufacturingRunning%s Reply @ %p IOC Status %s IOCLogInfo 0x%08x MsgLength 0x%02x MsgFlags 0x%02x MsgContext 0x%08x WhoInit %s MaxDevices 0x%02x MaxBuses 0x%02x IOCNumber %d MaxChainDepth %d BlockSize %d Flags %d ReplyQueueDepth %d ReqFrameSize 0x%04x FW Version 0x%08x Product ID 0x%04x Credits 0x%04x Ports %d EventState 0x%02x HostMFA_HA 0x%08x SenseBuf_HA 0x%08x RepFrameSize 0x%04x MaxBuses 0x%02x FWImageSize 0x%04x Port: %d Bus: %d TargetID %d CDBLength %d SCSI Status: %s SCSI State: %s TransferCnt 0x%04x SenseCnt 0x%04x ResponseInfo 0x%08x Event: %s EventContext 0x%04x AckRequired %d EventDataLength %d Continuation %d EvtLogData: 0x%04x TargetID: 0x%04x Bus: 0x%04x Port: %d LinkState: %d Type: %d Char3: 0x%02x Char4: 0x%02x N_PortId: 0x%04x %s @ %p Chain Offset 0x%02x Bus: %d TargetID %d SenseBufferLength %d LUN: 0x%0x Control 0x%08x NODATATRANSFER WRITE READ Invalid DIR! SIMPLEQ HEADOFQ ORDEREDQ ACAQ UNTAGGED NO_DISCONNECT Unknown attribute! DataLength 0x%08x SenseBufAddr 0x%08x CDB[0:%d] In ProgressOn ChipTE32 @ %p LOCAL_ADDRESSHOST_TO_IOC64_BIT_ADDRESSINGLAST_ELEMENTEND_OF_BUFFEREND_OF_LISTSCSI Target: Invalid IOC IndexSCSI Target: No Connection (Retryable)SCSI Target: Transfer Count MismatchFC: Send Extended Link Servicempt mailbox: (0x%x) State %s WhoInit %s SE32 %p: Addr=0x%0x FlagsLength=0x%0x CE32 %p: Addr=0x%0x NxtChnO=0x%x Flgs=0x%x Len=0x%0x ,/,/,/,/,/-/-/9-/L-/ _-/!n-/"{-/#-/$-/%-/@-/A-/B-/C-/D./E./F+./G<./HQ./Ig./J./K./L./`./a./b8/c./d8/e//j8/f-//g9//hP//ih//Ѐ|//Ё//Ђ//Ѓ//Є//Ѕ//І//Ї0/0/.0/C0/L0/V0/]0/h0/t0/ 0/ 0/ 0/ 0/ 0/0/0/ 9/1/ 1/!'1/"31/=1/B1/x1/J1/././Y1/`1/s1/ 1/ 1/1/1/1/1/1/ 1/w>/2/,/2/'2/(<2/G2/@K2/U2/71/Z2/a2/.5<CJQЌ    ,m˼Լ¼йԼԼаЧmptEntering PPRunable to write Device Page 1Invalid INQUIRY on target: %dunable to read Device Page 0U320 PPR failedU160 PPR failedSynchronousAsynchronousIM support: %xcontext %u reply OKcommand timeoutrequest state: %sAddress Reply (index %u):mpt_done: TASK MGMTmpt_request:mpt_reply:context reply: 0x%08xinvalid status code %derror %d loading DMA mapenable port reply index %dunknown ctlop: 0x%xEvtLogData: Event Data:%s: 0x%08x%cIOC Bus Reset Port %dRescan Port %dPort %d: Link state %s Device needs AL_PAUnknown async event: 0x%xunable to read back Device Page 1SPI Target %d Page 1: RequestedParameters %x Config %xTarget %d rejected PPR message with %02xtarget %d %s at %dMHz width %dbit offset %d QAS %d DT %d IU %d%s: unable to allocate request pool %s: unable to allocate reply area, error = %d %s: unable to map reply area, error = %d %s: unable to create reply DMA map, error = %d %s: unable to load reply DMA map, error = %d %s: unable to allocate request area, error = %d %s: unable to map request area, error = %d %s: unable to create request DMA map, error = %d %s: unable to load request DMA map, error = %d %s: unable to create req %d DMA map, error = recovered from command timeouttimeout on request index = 0x%x, seq = 0x%08xStatus 0x%08x, Mask 0x%08x, Doorbell 0x%08xmpt_done: index 0x%x, NULL replympt_done: invalid index (0x%x) in replympt_done: corrupted request_t (0x%x)mpt_done: unknown Function 0x%x (0x%x)mpt_done: no scsi_xfer, index = 0x%x, seq = 0x%08xEvtLogData: IOCLogInfo: 0x%08xUnit Attn: Bus 0x%02x Target 0x%02xPort %d: FC Link Event: LIP(%02x,%02x) (Loop Initialization) Device %02x doesn't like FC performance Device detected loop failure before acquiring AL_PA Device %02x detected loop failure Device %02x requests that device %02x reset itselfPort %d: FC Link Event: LPE(%02x,%02x) (Loop Port Enable)Port %d: FC Link Event: LPB(%02x,%02x) (Loop Port Bypass)Port %d: FC Link Event: Unknown event (%02x %02x %02x)Port %d: FC Logout: N_PortID: %02xmpt_event_notify_reply: unable to allocate request structureunable to allocate fw memory, error = %dunable to map fw area, error = %dunable to create request DMA map, error = %dunable to load request DMA map, error = %dhlptx?жж?&tІ)3BdlЙuha%s: scsibus %s: can't malloc mscp uhamscshould call debugger here (ultra14f.c)%s: uha_scsi_cmd, more than %d dma segs ESP100ESP100AESP200NCR53C94NCR53C96ESP406FAS408FAS216AM53C974FAS366/HME: %s, %dMHz, SCSI ID %d %s: resetting SCSI bus [NCR_INIT(%d) %d] ncr53c9x_ecbSELATNS [ncr53c9x_scsi_cmd] [ncr53c9x_poll] [ncr53c9x_sched] requesting sense [ncr53c9x_done(error:%x)] resid=%lu [flushfifo] ncr53c9x_rdfifo: bad flagcont [rdfifo %s (%d):[wrfifo(%d):ncr53c9x_sched_msgout %x %d gotmsg(%x) state %dcmdcomplete got %ld extra bytes msg reject (msgout=%x) (rejected sent tag)noop TAG %x:%xdisconnect save datapointer restore datapointer extended(%x) SDTR period %d, offset %d async mode max sync rate %d.%02dMB/s %s: wide mode %d ident %s at line %d: no nexus [ncr53c9x_intr: state %d] %s: nexus in reset state%s: DMA error; resetting sync nego not completed! <>[%d] backoff selector %s: target didn't identify selid=%2x ncr53c9x: no nexus%s: step 1 & !NEG %s: !MSGOUT %s: STATUS_PHASE: msg %d %s: invalid state: %d ncr53c9x no nexusMESSAGE_OUT_PHASE MESSAGE_IN_PHASE COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%ld] DATA_IN_PHASE STATUS_PHASE DMA activesync negotiation disabled %s: unknown variant %d, devices not attached %s: unknown revision code, assuming ESP100 [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] [ncr53c9x_poll: rescheduling] ncr53c9x_sched: not IDLE (state=%d) %s: QFULL -- throttling to %d commands %s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT [ncr53c9x_msgin(curmsglen:%ld)] %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d %s: tagged queuing rejected: target %d %s: sync transfer rejected: target %d %s: wide transfer rejected: target %d unrecognized MESSAGE EXTENDED; sending REJECT unrecognized MESSAGE; sending REJECT %s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET [ncr53c9x_msgout(priq:%x, prevphase:%x)]%s at line %d: unexpected MESSAGE OUT phase regs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] %s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: waiting for SCSI Bus Reset to happen %s: target didn't send tag: %d bytes in fifo %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] %s: identify failed, state %d, intr %02x (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: ICCS: : [intr %x, stat %x, step %x] %s: can't get status, only %d bytes %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] %s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], qSSS))SSkД:g& & & & & & & & & & & & & & & & & & & & & & & & & <_'yлjR'&&ЦЕ   ГVЇЎЈ%2K} }}}%}2> > >>> > > >>%+2>K}  @@)A@)A)A)A)A)AA)A)A)A)A)A)A A)A)A)A)A)A)A)A)A)A)A)AA)A)A)A)A)A)A)A)A)A)A)A)AA)A)A)A)A)A)A)A)A)A)A)A)A)A)A)A)A)A)A)A)A)A)A)A)A"A%s: unable to allocate script DMA memory, error = %d %s: unable to map script DMA memory, error = %d %s: unable to create script DMA map, error = %d %s: unable to load script DMA map, error = %d siop: can't find my sync parameters%s: rejecting invalid wide negotiation from target %d (%d) %s: ppr negotiation for target %d: no DT option %s: ppr negotiation for target %d: offset (%d) or sync (%d) out of range %s: ppr negotiation for target %d: sync (%d) incompatible with adapter %s: ppr negotiation for target %d: transfer width (%d) incompatible with dt %s: rejecting invalid PPR negotiation from target %d %s: bad offset in siop_sdp (%d) %s: switching to differential mode %s: switching to single-ended mode %s: timeout waiting for DIFFSENSE to stabilise %s: target %d now using %s%s%d bit clear fifo failed %s: switching to LVD mode %s: invalid SCSI mode 0x%x tagged 13.33.334x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`884t5r@`X@`PP``XXP``@4zhh5~~4|X4zhh5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`@@@`HHxx5r6r           xxxx(C|z%2K} }}}%}2> > >>> > > >>%+2>K}  siopINTRF %s: DMA IRQ: illegal instruction bus fault dma fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid scsi gross error error, DSP=0x%x unhandled message 0x%x reselect failed unknown irqcode %x request sense failed %s: scsi bus reset cmd %p (status %d) resetsiop_start: bad statustimeout on SCSI command 0x%x siop: resel switch fullsiop_stat_intr %d siop_stat_intr_shortxfer %d siop_stat_intr_xferdisc %d siop_stat_intr_sdp %d siop_stat_intr_done %d siop_stat_intr_lunresel %d siop_stat_intr_qfull %d %s: can't alloc lunsw for target %d single step dsp 0x%08x dsa 0x08%x %s: unexpected phase mismatch %d %s: phase mismatch without command %s: selection timeout without command %s: unexpected disconnect without command %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x %s: script interrupt (0x%x) with invalid DSA !!! %s: command with invalid status (IRQ code 0x%x current status %d) ! %s: reselect with invalid target %s: reselect with invalid target %d %s: target %d reselect with invalid lun %d %s: target %d lun %d tag %d reselect without command %s: reselect with invalid tag our reject message was rejected scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x %s: extended message too big (%d) invalid retval from siop_sdtr_neg()invalid retval from siop_wdtr_neg()%s: bad offset for disconnect (%d) %s: done without command, DSA=0x%lx %s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s %s: unable to load data DMA map (for SENSE): %d %s: untagged command already running for target %d lun %d (status %d) cmd %p (tag %d) added to reset list cmd %p added to reset list from urgent list cmd %p added to reset list from ready list with status %d, xs->error %d %s: can't malloc memory for target %d %s: can't alloc siop_lun for target %d lun %d %s: unable to load data DMA map: %d %s: can't allocate memory for command descriptors head %s: can't allocate memory for command descriptors %s: unable to allocate cbd DMA memory, error = %d %s: unable to map cbd DMA memory, error = %d %s: unable to create cbd DMA map, error = %d %s: unable to load cbd DMA map, error = %d %s: unable to create data DMA map for cbd: error %d utpauireservedbnc100-TX100-FX100-T4 address %s/(unknown/impossible media)/autoselect default %s%sepstart: no header mbuf%s: device timeout v/# v/%v/v/$v/& v/'@@4&v/(#%$&'&(oonoЗny^zЃz5zKzKzЃzKzwrote %x to TX_AVAIL_THRESH, read back %x. Interface disabled warning: unknown chipset, possibly 3c515? %s: media_status on unknown chipset 0x%x %s: eeprom failed to come ready %s: erase pencil mark, or disable PnP mode! wiLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB)WaveLAN/IEEE nodeIBSSwihap: failed to copy header %s: wi_cmd failed with %d %s: init failed %s: invalid data path: %x %s: wi_start: xmit failed Unknown PRISM2 chipSymbol %s: %u (%d dBm) PRISM2 HWB3163(EVB2) SST-flash: unable to read station address %s: received packet of unknown type on port 7 %s: received packet on invalid port (wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. %s: wi_cmd_io: busy bit won't clear %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: failed to allocate %d bytes on NIC %s: unsupported crypto algorithm %d %s: tx buffer allocation failed %s: mgmt. buffer allocation failed %s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: host encrypt not implemented for 802.3 %s: wi_mgmt_xmit: xmit failed %s: Firmware %d.%02d variant %d, %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), qy/y/y/y/y/y/y/z/z/,z/ {/ Ez/ Zz/ Zz/ Zz/Zz/kz/kz/kz/kz/z/z/z/z/z/z/z/z/!z/"z/#z/$z/&z/ '.JJ5<JJJJJJC+5?qIS]qqqg0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-w~ЅЗЉЗЗЗЗЗА#BBBB.9 *6BiЁБЩ##%3Ae~#%s: read record failed : address %6s OpenBSD%s: command busy %s: RID 0x%04x access failed %s: unknown RID: %x %s: failed to set ssid list %s: failed to set AP list %s: failed to enable MAC %s: xmit failed %s: failed to load config data %s: id mismatch: expected %x, got %x %s: RID 0x%04x seek to record failed %s: failed to set configuration an_cache_store, bad index: %d of [0..%d], gross cache error НЩеБ%s: memory error %s: receiver disabled %s: transmitter disabled %s: overflow %s: receive buffer error %s: dropping chained buffer %s: transmit buffer error %s: underflow am7990_config: weird memory size %d%s: %d receive buffers, %d transmit buffers am7990_config: can't establish shutdownhook%s: controller failed to initialize missing buffer, no_td = %d, last_td = %d %s: excessive collisions, tdr %d %s: command never completed! %s: reset didn't complete %s: guessing TPC (BNC/TP) %s: guessing 10baseFL %s: guessing MII %s: guessing 100BaseT4/MII %s: guessing 10/100 internal %s: rx load failed %s: transmission error: %x %s: unknown XCVR type: %d %s: watchdog timeout : can't alloc list mem : can't map list mem : can't alloc list map : can't load list map : can't create rx spare map : can't create tx spare map : can't create rx map : can't create tx map %s: eeprom failed to come ready %s: bogus xcvr value in EEPROM (%x) %s: choosing new default based on card type %s: WARNING: no media options bits set in the media options register!! %s: this could be a manufacturing defect in your adapter or system %s: attempting to guess media type; you should probably consult your vendor %s: guessing 10BaseT transceiver %s: guessing COMBO (AUI/BNC/TP) %s: guessing 10/100 plus BNC/AUI %s: unknown device ID: %x -- defaulting to 10baseT %s: bad receive status -- packet dropped %s: initialization failed: no memory for rx buffers %s: no carrier - transceiver cable problem? %s: failed to read station address 77c888A8Z8A8c8A8аCлCDC!DC!DD!D%s: warning: SCB timed out fxp, New ID 0x%x, cksum @ 0x%x: 0x%x -> 0x%x %s: Failed to malloc memory fxp_stop: no buffers!%s: fxp_mdi_read: timed out %s: fxp_mdi_write: timed out %s: Disabling dynamic standby mode in EEPROM%s: no phy found, using manual mode %s: unable to create rx dma map %d, error %d %s: unable to create tx dma map %d, error %d %s: reset never completed! mtd%s: can't allocate memeory for rx buffers %s: can't alloc rx buffers %s: can't create dma map %s: can't load dma map %s: can't create tx maps %s: can't map dma buffers (%d bytes) mtΙΙ{ЉЂ%s: PHY read failed %s: PHY write failed %s: bad phy register inside re_diag re_diag: packet received %s: WARNING, DMA FAILURE! %s: expected TX data: %s/%s/0x%x %s: received RX data: %sleaving re_diag calling mii_attach %s: no PHY found! leaving re_attach LSККZhare_diag: transmission started %s: diagnostic failed, failed to receive packet in loopback mode %s: diagnostic failed, received short packet %s: You may have a defective 32-bit NIC plugged into a 64-bit PCI slot. %s: Please re-install the NIC in a 32-bit slot for proper operation. %s: Read the re(4) man page for more details. %s: can't create DMA map for TX %s: can't create DMA map for RX %s: eeprom autoload timed out %s: attach aborted due to hardware diag failure %s: can't map mbuf (error %d) %s: phy_read: bad phy register %x %s: phy_write: bad phy register %x %s: failed to force tx and rx to idle state %s: no memory for rx list -- packet dropped! %s: failed to force tx to idle state #*1   ЧЧFFЧ >нЍЧ%s: MII without any PHY! %s: no memory for tx listSMC91C90/91C92SMC91C94SMC91C95SMC91C100sm: address %s, utp/aui (default %s) %s: large packet discarded %s: device enable failed #%%s: receive interrupt on empty fifo %s: successful packet caused TX interrupt?! %s: can't allocate cluster for incoming packet epic%s: CRC error %s: alignment error %s: receiver queue empty %s: lost carrier %s: transmit underrun %s: PCI target abort error %s: PCI master abort error %s: PCI address parity error %s: PCI data parity error %s: unknown fatal error %s: interface not running epic_add_rxbuf%s: MII timed out %s: unable to allocate control data, error = %d %s: unable to map control data, error = %d %s: unable to create control data DMA map, error = %d %s: unable to load control data DMA map, error = %d %s: unable to create pad buffer DMA map, error = %d %s: WARNING: unable to establish shutdown hook %s: unable to create tx DMA map %d, error = %d %s: unable to create rx DMA map %d, error = %d %s: unable to load pad buffer DMA map, error = %d %s: unable to allocate or map rx buffer %d error = %d %s: can't load rx DMA map %d, error = %d epic_mediachange: can't happen %s: where did the card go? %s: setup failed ne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete >Ш>@>Ш>@ @з@auxkbc: aux echo error 1 kbc: aux echo error 2 kbc: cmd word write error (%s slot)pckbc_slot_enable(%d) failed pckbc_cmd: send error pckbc: command timeout pckbc_start: command error pckbc_start: send error pckbc: cmd failed kbccmdpckbcpckbc_set_inputhandler: bad slot %dpckbcintr: no dev for slot %d ihaSCSI Parity error detected SCSI OpCode 0x%02x timed out %d.%d MHz %d REQ/ACK offset %+2>^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^__'_7_O_d_{_n_bbb^bbbАb}bЛeБeЫedeЫeЫeЂenegnSnDnDnmСnСn nDnСnСnСnСnСnСnСnСnСnСnСnСnСnСnСnСnСnСnСnСnСnСnСnСnСnСn]nкx4y=y=y=y=y=y=y=y=y=y=y=y=y=y=yyy=y=y=y=y=y=y=y=y=yyyx=yx=yx=y=y=yx=y=y=y=y=y=y=yx=y=y=yx=y=y=yx=y=y=y=y=y=y=y=y=yx=y=y=y=y=yx=y=y=y=y=y=y=yxerror %d loading SG list dma map buffer needs >%d dma segments error %d loading buffer dma map %s: couldn't create SCB data DMA map, error = %d %s: couldn't create SCB SG DMA map, error = %d error %d loading request sense buffer dma map %s: unable to allocate SCBs, error = %d %s: unable to map SCBs, error = %d iha: invalid EEPROM, bad signature or checksumtrm%s: target=%d >= %d %s: lun=%d >= %d %s: target %d using 16 bit 8 bit Asynchronous %d.%01d MHz, Offset %d data transfers with Tag Queuing%s: DMA transfer map unable to load, error = %d %s: SCSI OpCode 0x%02x for target %d lun %d timed out %s: reselect - target = %d, lun = %d not found %s: unable to create DMA transfer map %s: unable to allocate SCSI REQUEST BLOCKS, error = %d %s: unable to map SCSI REQUEST BLOCKS, error = %d %s: unable to create SRB DMA maps, error = %d %s: unable to load SRB DMA maps, error = %d ِппΐппппппппппппппппппппппппппِِِЈЌЌЌЌЌЌЌЌp9Ќp9Ќp9Ќp9зp9'p9p (#. PF$]  H` l|*  | *p (#. PF$] 0 H` lp (#. PF$]  H` l    p (#. PF$]  H` lq@@@@@q@@@@@@@q@@@@<@P@d@x@q@@@@@q@@@@@< @P @d @x @ @ @ @ @| @ @ @ @ @ @ @ @ @0 @D @<@@P@@d@@x@@<@P@d@x@@@@@<@P@d@x@@@@@<@P@d@x@<@P@d@x@@@|@@@@@@@@@0@D@<@@P@@Z@Pd@@x@@@P@@@@@P@@@@q@@@P@@@@@P@@@@<@P@d@x@@@@@q@@@@@<@P@ZPd@x@P@@P@@|@@@@@@@@@0@D@q@P@@P@@2@F@Z@n@@@@2@F@Z@n@<@P@d@x@l `q `v `{ ` ` ` ` ` ` ` ` ` ` ` p `l `q `v `{ ` ` p ` ` ` ` ` ` `l `q `v `{ ` ` p ` ` ` ` `l `q `v `{ ` ` ` ` ` ` ` ` ` ` l `q `v `{ ` ` p ` ` ` ` ` ` ` 88888ԘԘ Ԙؘh`h`h`h`h` 88888Ԙ@H@@@OOOOOaOOLOOZZZZ̘Ԙ Иܘ*****``nnnKKKKKHHHHH"""""????? $$$$$PPPPP*****22222ttttt(((((11111 %A%A%A%A%A     HHHHHؘ0 0 0 0 0 `````RRRRRĘ@GG) iP ``YD $H!!(aa,%bb04B8H""<xbb@ccDHLXR##PccT|X\$`d  dJ*Khjl ZpJt,x+| NkRJ^,: :SzIzyF;:9{zy<;=|{}ĚȚ̚<К|Ԛؚܚath_hal_attachk1///r1y1 //// /0#/@ /ar5k_radar_alertar5k_channelar5k_rfregs_opar5k_rfregsar5k_ar5111_rfregsar5k_ar5112_rfregs%s: out of memory %s: unable to init EEPROM 53115311a5311bxxxx51105111211151122112%s: invalid bank %s: device not supported: 0x%04x %s: unable to get device capabilities: 0x%04x %s: unable to read address from EEPROM: 0x%04x %s: Possible radar activity detected at %u MHz (tick %u) %s: channel out of supported range (%u MHz) %s: invalid values at offset %u   $,04DHPL @@XLPTX\`dhl,048H(G 2=k $( ,o048<@cDrH3LPFF>P lAdlAdLL@@`` S S $;;(, 88Ԙ 88ԘHHbOLZ̘ar5k_ar5211_nic_wakeupЏФЖФФФНФФФФФФФНar5k_ar5211_resetЄЄЏЏ%s: invalid radio frequency mode %s: failed to reset the AR5211 + PCI chipset %s: failed to resume the AR5211 (again) %s: failed to warm reset the AR5211 %s: invalid channel: %d  4@DHLPT  $0p8x8x8x8x8x8x8x8x<|<|<|<|<|  $(0,0418<HTX\0*ĀȀ'@̀ЀԀ؀UU܀  ,$,(0,<0,4,80<<@DHLPTX\`dhl:putx| hćȇ ̇ Їԇ؇܇   (}k ,/<@zj L  0($ $4,,04"<2@ D*HL&PT6X\.`hl1p t)x|%5 # ++++++++ě+ț+̛+Л+ԛ+؛+ܛ+++++++0H   $ , 04<@DHLPTX\` h"l#p$t%x(|)*+,012455555555ě5ț5̛5Л5ԛ5؛5ܛ55555550@/////D/////H/////L/////P/////T/////X/////\/////`/////d/////00`ph`8>h@Xh@  @@ 48 Dr%r(rr%rP `dhA@A@A@A@A@$0    $(        HZZiiimmuuuX. ~. ~.M~.M~. ~. ~. ~. ~. ~. ~\^f71^f71^f71^f71^a71^f71^f71^f71^f71^f71l          ''|*'LD       gֈgֈg>Јg>Јg> jA,djA,djA@djA@djA@d@,d@,d`Bd`Bd`Bdar5k_ar5212_nic_wakeupar5k_ar5212_resetaaaaaar5k_ar5212_get_israr5k_ar5212_txpower%s: failed to reset the AR5212 + PCI chipset %s: failed to resume the AR5212 (again) %s: failed to warm reset the AR5212 %s: invalid phy radio: %u %s: 0x%08x %s: invalid tx power: %u AR%s %u.%u phy %u.%u rf%s %u.%u, %s, address %s hardware error; resetting rx FIFO overrun; resetting %s: unsupported mode %dunable to start recv logic 802.11 packet too large: %uno rate table, mode %uath_rx_proc: no buffer! ath_rx_proc: no mbuf! bogus xmit rate 0x%x new association w/ no rates!gpiounable to attach hardware; HAL status %d HAL ABI mismatch detected (0x%x != 0x%x) failed to allocate descriptors: %d unable to setup a beacon xmit queue! %s: WARNING: unable to establish power hook unable to setup a data xmit queue %u! unable to reset hardware; hal status %u unable to initialize the key cache %s: unable to reset hardware; hal status %u %s: unable to start recv logic %s: multi-segment packet; nseg %u%s: ath_hal_setup_tx_desc failed %s: ath_hal_fill_tx_desc failed %s: unable to allocate Tx/Rx buffers %s: unable to create beacon dmamap, error = %d %s: unable to create Rx dmamap, error = %d %s: unable to create Tx dmamap, error = %d ath_rxbuf_init: multi-segment packet; nseg %uath_tx_start: packet not one segment; nseg %uath_chan_set: unable to reset channel %u (%u Mhz) ath_chan_set: unable to restart recv logic unable to allocate channel table unable to collect channel list from hal bad hal channel %u (%u/%x) ignored no valid channels for regdomain %s(%u) no h/w rate set for phy mode %utransition to RUN state w/ no rates!ath_chan2flagsӄׄބath_resetath_beacon_alloc̭ӭڭ64 bytes160 bytes192 bytesstore and forward96 bytes288 bytes544 bytesatwSTOPPEDRUNNING - read descriptorRUNNING - transmittingRUNNING - filling fifoSUSPENDEDRUNNING -- write descriptorRUNNING - fifo fullRUNNING - wait for receptionRUNNING - write descriptorRUNNING - flush fifoRUNNING - fifo drain%s: bad or missing/bad SROM %s: unknown SROM type %d Intersil (not supported)RFMDMarvel (not supported)%s: unknown RF %s: unknown BBP %s: %s RF, %s BBP%s: reset failed to complete %s: BBPCTL still busy %s: tsft offset %s%ull %s: sync TSF with %s %s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) atw_add_rxbuf%s: receive ring overrun %s: transmit process stopped %s: receive process stopped %s: fatal bus error descriptor error%s: receive error: %s PLCP SFD errorPLCP signal errorPLCP CRC16 errortime-outFCS errorWEP ICV error%s: txstat %b %d %s: transmit timeout %s: illegal WDS framebad lastx000 0 0 0" 0 0Ьn<Ј#00#00000atw_tuneatw_newstate/>x hRUNNING -- write last descriptorRUNNING - check this packet, pre-fetch next%s: unable to allocate SROM buffer %s: ADM8211C MAC/RFMD BBP not supported yet. could not get mac address, attach failed %s: unable to allocate or map rx buffer %d, error = %d %s: chan == IEEE80211_CHAN_ANY%s: failed to tune channel %d %s: wrote %d bytes at 0x%x wepctl 0x%08x %s: atw_recv_beacon: bssid mismatch %s %s: my tsft %llx beacon tsft %llx %s: unexpected state IEEE80211_S_INIT%s: transmit underrun; new threshold: %s %s: incoming packet spilled, resetting ATW_TXSTAT_SOFBRATW_TXSTAT_TROATW_TXSTAT_TUFATW_TXSTAT_TRTATW_TXSTAT_TLT%s: unable to allocate Tx mbuf %s: unable to allocate Tx cluster %s: unable to load Tx buffer, error = %d rtw %s: reset failed GRF5101WS9901MAX2820MAX2422HFA3873Intersil SA2400ASA2411RF2189unknown 0x%02xradio %s, amp %s, %s: could not read SROM %s: channel %d out of range%s: unknown rate #%d %s: too many rx segments %s: could not load DMA map%s: phy init failed %s: segment too short RTL8180FRTL8180DRTL8185unknown 0x%08x%s: ver %s, Maxim 2820Philips SA2400GCTRFMD 2948IntersilRealtek RTL8225Realtek RTL8255%s: unknown rfchipid %d %s: could not recall EEPROM in %dus is not understood, limping along with defaults RFMD RF2948B, LNA: RFMD RF2494, SYN: Silicon Labs Si4126 %s: could not get mac address, attach failed %s: rtw_rxsoft_alloc failed, %d buffers, rc %d %s: DMA error/FIFO overflow %08x, rx descriptor %d %s: rtw_rxsoft_alloc(, %d) failed, dropping this packet %s: could not allocate rx buffers %s: failed to turn off PHY (%d) %s: cannot load Tx buffer, rc = %d %s: cannot allocate Tx cluster %s: cannot load Tx buffer, segment too short %s: transmit timeout, priority %d %s: could not allocate beacon %s: could not allocate hw descriptors, error %d %s: could not map hw descriptors, error %d %s: could not create DMA map for hw descriptors, error %d %s: could not load DMA map for hw descriptors, error %d %s: could not load DMA map for hw rx descriptors, error %d %s: attach failed, malformed serial ROM %s: attach failed, could not attach RF %s: could not load DMA map for hw tx descriptors, error %d %s: RTW8180_PHYCFG_MAC_POLL still set. ЩзЛЍІrtw_chan2txpower rtw_tuneбдЧддЬдд !h!h!t!rtw_seg_too_shortrtw_newstateO0^03131Ц0и0 1%1 1%1%1и0%1%1868686A686A6A6A6A6A66С6І66666\6k6<д====p=Ї=p=I=I=3=3=Э=Э= >rtw_bbp_writertw_rf_macbangbitsJJJJJ1J1J1J#J*Jrtw_rf_hostwriteJЀJkJ[JЀJеJеJеJРJРJrtw_rf_macwritePKDKKKDKDK $0H`l    $0H`l!?$,dbEaL 8pP-%!T1;? 8#2!U#4@\ 0HP#+ "#P'()`5689:=`>K #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik*++,,--../-@@A&''(())**++,,-MNO`abcd e f g h ik$%b(&b,'b0(b4)b8*b<+b@,bd"h"l"p"t"x"|""" " ")$+$-$/$3YyYЬYЬYYД````Ю````г`````````!bbbb!bbbb!bbbbbbbbb5i5ii5i5i5i5i5i5ii i5i5i5i5i5i i5i5i5ii5i'i5i5i5i5i5i5i5i5i5i5i5i'i5i5i5i5i5i5i5i5i5i5i5i.i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i.i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i5i.i5i5i5i5i5i5i5i5i5i5i5i.iбijеijjjjjjмiijjjjjijjjijijjjjjjjjjjjijjjjjjjjjjjijjjjjjjjjjjjjjjjjjjjjjjijjjjjjjjjjjjjjjjjjjjjjjijjjjjjjjjjjiМzzz>{{'|}}}}}}}}}}С|Y`gnu|ЊЊЊЊЊЊЊЊЊЊЃ%s: could not create DMA map %s: could not write to BBP %s: could not read from BBP %s: could not write to RF RT2522RT2523RT2524RT2525RT2525eRT2526RT5222%s: timeout waiting for BBP %s: MAC/BBP RT2560 (rev 0x%02x), RF %s %s: could not allocate Tx ring %s: could not allocate ATIM ring %s: could not allocate Prio ring %s: could not allocate Beacon ring %s: could not allocate Rx ring %s: could not create desc DMA map %s: could not allocate DMA memory %s: could not map desc DMA memory %s: could not load desc DMA map %s: could not allocate soft data %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: could not load rx buf DMA map%s: sending data frame failed 0x%08x %s: sending mgt frame failed 0x%08x %s: could not load rx buf DMA map %s: could not map mbuf (error %d) %s: could not allocate RTS frame uhciuhci_allocm%s: host system error %s: host controller halted %s: controller did not reset stop%s: cannot %s uhci_alloc_std_chain: maxp=0 UHCI root hub%s: interrupt while not operating ignored %s: host controller process error uhci_abort_xfer: not in process contextuhci_device_isoc_enter: xfer=%p in frame list uhci_device_isoc_close: %p not found uhci_device_setintr: 0 interval 2Щ222222222222ZЕ2д 2е2%222B222222222222ohci, legacy support version %d.%d%s %s: reset timeout %s: %u scheduling overruns %s: resume detect %s: blocking intrs 0x%x ohci_rem_ed: ED not foundOHCI root hubohci_setintr: 0 interval %s: isoc TD alloc failed %s: unsupported OHCI revision %s: SMM does not respond, resetting %s: unrecoverable error, controller halted ohci_add_done: addr 0x%08lx not foundohci_abort_xfer: not in process contextohci_device_isoc_abort: early return 2]<<<<<Ј<<<<<<<г(Mehciehcidb%s: run timeout %s: config timeout ehci_rem_qh: ED not foundehcidiEHCI root hub%s: port reset timeout ehci_check_intr: sqtdstart=NULL ehci_open: bad device speed %d%s: *** WARNING: opening low/full speed isochronous device, this does not work yet. ehci_abort_xfer: not in process contextPw w 'PFw w w w w qw w w w w w w ~ H~ Мкw  w w w ' w w w w w w w w w w w w ~ L rd%drdattach: device name too long WARNING: no memory for concatenated disks ccdinit: device name too long. %s: error %d on component %d%s ccdbufplccd%dccdbuffer (mirror)ccdiodone: countccdlck/etc/firmware/%sSelftest TimeoutHost Bus Parity ErrorHost Directed FaultSoftware FaultHardware FaultPC Trace Path TestDMA ErrorImage CRC ErrorAdapter Processer ErrorUpgradeDMA UnavailableDMA AvailableLink AvailableLink UnavailableHaltedRing MemberStationPhy PortTrace ReceivedReasonTransmit UnderrunTransmit FailedBlock Check Error (CRC)Frame Status ErrorPDU Length ErrorReceive Data OverrunNo User BufferRing Initialization InitiatedRing Initialization ReceivedRing Beacon InitiatedDuplicate Address FailureDuplicate Token DetectedRing Purger ErrorFCI Strip ErrorTrace InitiatedDirected Beacon ReceivedData Link HeaderUpstream NeighborLEM Error Monitor RejectElasticy Buffer ErrorLink Confidence Test RejectDirectionSASDACSACNACDASV6.2V7.2V7.3ANSI Multi-ModeANSI Single-Mode Type 1ANSI Single-Mode Type 2ANSI SonetLow PowerThin WireShielded Twisted PairUnshielded Twisted PairDEFPA PCIDEFEA EISADEFTA TCDEFAA FuturebusDEFQA Q-bus0123456789abcdef, SMT %s [A]/usr/src/sys/dev/ic/pdq.cPDQ StartChars SetStatus Chars GetCounters GetCounters SetAddr Filter SetAddr Filter Get%s: Unsolicited Event: %s: %s[%d]fpdu != NULLfreecnt == 0state == PDQS_DMA_UNAVAILABLEcnt > 0state == PDQS_DMA_AVAILABLEstate != PDQS_DMA_UNAVAILABLEstate != PDQS_RESETstate != PDQS_HALTEDstate != PDQS_UPGRADEstate != PDQS_RING_MEMBER: halt code = %d (%s) %s: Flushing transmit queue ,30=30S30g30v30Ѕ30И30Т30в3071/30303030304040#403+40440C40J40\40l40Є40З40404040405050750P50b50r50Ђ50C40Л50R1Ь50о505050 60090Ќ90Ш90,90@90М9060606060#60 #4'60,60160ABSM660F60^60v60Ё60Ћ60Е60Ы6090:06060606060 ;70@ {70(70 A70K70\70i70 v7070%s: DEC %s FDDI %s Controller %s: FDDI address %c%c:%c%c:%c%c:%c%c:%c%c:%c%c, FW=%c%c%c%c, HW=%c%s: FDDI Port%s = %c (PMD = %s), FDDI Port[B] = %c (PMD = %s)cbp->pdqcb_command_request != ci->ci_request_completionrspgen->generic_status == PDQR_SUCCESS%s: MAC CRC error (source=%x-%x-%x-%x-%x-%x) dbp->pdqdb_transmits[completion].txd_sop == 1dbp->pdqdb_transmits[(completion + descriptor_count - 1) & PDQ_RING_MASK(dbp->pdqdb_transmits)].txd_eop == 1dp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration  n;AvXaM ְdx ІГ˃rndrdcd9660_inactive: pushing activecd9660_reclaim: pushing activeRRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991ASPqj"Ѐ)ЀЀЀ0ЀЀЀЀЀЀЀ4ЀЀЀЀЀЀЀЀЀЀЀЀЀЀЀ[jcHvOvvvvvvvvvvvvvvvvvvvvvvvvvvvVRRIP with incorrect NM flags? (/Ц~ױЅ5ȒР'Ywwfcd9660_mountroot: can't setup bdevvp'sfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] root_devicecd9660CD001%/@%/C%/Eisoinodefhtovp: bread error %d LYY6ALLcd9660_strategy: spectag VT_ISOFS, isofs vnode |uE#WaТЩ*HRФЭжпИИudftrpludfndpludfdspludfCannot read sector %d of FSD Couldn't find the fsd Cannot read sector %d Invalid root file entry! Can't read sector %d of VDS Invalid file entry! Error from udf_allocv unodeInvalid partition map found *UDF Sparable PartitionInvalid sparing table found udf_mount: enforcing read-only mode FSD does not lie within the partition! Cannot allocate file entry block Unsupported partition map: %s Failed to read Sparing Table at sector %d hash entry is NULL, node->hash_id= %dudf_allocv: failed to allocate new vnode udf_transname(): name too long udf: Unicode translation failed warning: udf_readlblks returned error %d Cannot deal with strategy4096 yet! Unsupported allocation descriptor %d udf: invalid FID fragment udf: invalid FID Invalid FID tag uiomove returned %d tag VT_UDF, hash id %u udf_lookup: Invalid tag Unknown strategy type %d File offset out of bounds ЯЯЯЄЦ#!/dev/fd/%dCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2005 OpenBSD. All rights reserved. http://www.OpenBSD.org swapperfork initcfpendcannot mount rootcannot find root vnodefork pagedaemonfork reaperfork cleanerfork updatefork aiodoned/sbin/init/sbin/oinit/sbin/init.bak/dev/consoleinitexecexec %s: error %d init: not found no initwarning: /dev/console does not exist warning: /dev/console error %d init: couldn't allocate argument spacefileplfdescpldup2: fdallocclosefжИ.WPkqeueplknoteplkqreadkernel mapping failed %d user mapping failed init died (signal %d, exit %d)procppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindprocessor %lupid %d not locked with %d pendinglockmgr: not holding exclusive locklockmgr: upgrade exclusive locklockmgr: locking against myselflockmgr: non-zero exclusive countlockmgr: processor %lu, not exclusive lock holder %lu unlockinglockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: draining against myselflockmgr: unknown locktype request %d lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by Z_].\\[б_h`malloc: allocation too large%d,malloc: out of space in kmem_maprw_enter: locking against myselfrwlockphysbufphysioprocinit: mallocprocplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0plimitpl                    sigaplpauseprocfs debuggingissignal sorry, pid %d was killed: %s %s.corehashinit: bad cntsysctlsysctl_disklock-&B;BB4zpzppppppppppppppppppppppzppppzppppzpzpppzpppppzzzzzzpzppzЍДЛЬ ̠֠Ї&BΤUΤt~  6о~ЅΤΤХЌЖРЪ йZuбк ң4'ΤΤΤzΤeΤΤΤΤΤΤΤЁΤΤХй!(3=DXbВпHǥdenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleeppreempt: cpu_preempt not yet implementedsetrunnable>>> probing for %s>>> %s probe returned %d >>> %s probe won >>> no winning probe %s (root)%s at %sconfig_make_softc%s%dexpandcreat%s detached mapply: no match function for '%s' deviceroot device %s not configured config_make_softc: allocation for device softc failedconfig_make_softc: device name too longconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %sconfig_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structurewrit%s%d%c: %s %sing fsbn %d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 root filesystem has size 0bufq_default_alloc: no memorydisk_attach: can't allocate storage for disklabelrootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %dfilesystem type %d not known.. assuming ffs extentplextntextent_free: region not foundextent_free: start 0x%lx, end 0x%lx klogpool_init: too much uptimephpoolpcgpoolpool_get: %s: page emptypool_put: %s: page header missingkernel %sassertion "%s" failed: file "%s", line %dsplassert: %s: want %d have %d %s: table is full panic: spl assertion failure in %s%llo%lld(null)0123456789ABCDEFbug in kprintf: bad baseЈЈЈЈЈЈЈЈ /Ј&8ЈЩеееееееееЈЈЈЈЈЈЈЈЈЈ ЈЈЈЈЈЈЈЈЈЈЈЈЈЈЈЈЈЈЈЈЈЈЈЈЈЈ $ЈЈЈ$ЈЈЈЅ5Ј\ЈЈЈchangeexitfindhelplinesquitshowtimezoneverbose--- more --- 0%o*FOUND**UNKNOWN*%3d free slot (for add) Unknown devno (max is %d) %3d at disable ??? flags 0x%x %s [] ? Unknown argument change (y/n) ?out of memory. %3d can't change free slot %3d %s changed Error unknown state %3d can't disable free slot %3d can't enable free slot leave UKCUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type Unknown command, try help Argument expected 8|10|16 expected Attr, DevNo or Dev expected timezone = %d, dst = %d autoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... 3<<ЉАЗОХЬгкг#''''''''''''''''''''#*$i$а$%k%'%'''%''''%'&&'&%3d %s count %d (pseudo device) %3d %s can't disable pseudo device %3d %s can't enable pseudo device command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't knowNo more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')pipelkpiperdpipewrpipeclpipepl@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@vRЗRЗRЗRЗRЗRЗRЗRЗRЗRЗRЗRЗRЗRЗRЗRЗRЗRЗRЗRЗRЗRЗRЗRЗRЗRЗRЋR}RВRЄRGSPS3S:SJSPSCSЭkкkкkкkkкkкk{tЈtЕtдttttckoutqload: %d.%02d not a controlling terminal no foreground process group running cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d empty foreground process group putc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersm_copym0: m == NULL and not COPYALLmbplmclplm_copym0: off %d, len %dm_copym0: null mbufm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufm == NULL in m_pulldown()sockplsoclose: NOFDREFsoaccept: !NOFDREFnetconnetclsnetionetlcksbappendaddrsbappendcontrolsemi-panic: sbcompresssbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 3uipc 4piusrrequnp_attachunp_connect2unp_disconnect%HЋМЦбе!+7S7блббЂbremfree: lost tailgetblkgetnewbufbiowaitbiodone alreadyallocbuf: buffer larger than MAXBSIZE requestednchplcluster_read: DONE bpChild Block: %d addr: %x cluster_callback: too little memoryClustered Block: %d addr %x bufsize: %ld Clustered write to wrong blocksvop_generic_revokeallvfs_op_descsvfs_opv_init: bad operationnameioperation %s not listed in %s. vfs_opv_init: operation vector without default routine.lockfpllf_findoverlap: defaultH"Каrelookup: null namerelookup: lookup on dot-dotvnodesvfslock%s_mountroot failed: %d free vnodefree vnode isn'tvgetvrele: cannot lockvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevmissing aliasvgonel: not cleanVNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBAD|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT|VBIOWAIT|VBIOONFREELIST|VBIOONSYNCLIST|VALIASED flags (%s) kinfo: vp changed syncing disks... softdep vwakeup: neg numoutputvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvflushbuf: not dirtyvflushbufvflushbuf: dirtybgetvp: not freebrelvp: NULLtype %s, usecount %u, writecount %u, holdcount %u,unmount of %s failed with error %d WARNING: some file systems would not unmount mounted on: %s sched_sync: fsync failedsyncersyncer vnodemount: lost mountunmount: dangling vnode{{{{{{{{{~~~~~~~ЀЀvn_lockvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_leasevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfiforfifowtag VT_NONfifo_badop called, fifo with %ld readers and %ld writersЍлЊЫЫииЕРиЫspec_read typespec_write typespec_ioctlspec_fsync: not dirtyspec_fsyncspec_close: not specialtag VT_NON, dev %d, %d spec_badop called!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~dos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld msdosfs_reclaim(): pushing activemsdosfs_inactive(): pushing activeextendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath(): .. not a directory? RRaArrAamsdosfs_sync: rofs modU<МР'Р'tеР'msdosfs_write(): bad file typemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?tag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld msdosfs_strategy: spec(LOCKED) dev %d, %d, %s """ bpf: ifpromisc failedbpfbpf_mcopybpfattachbpf_detachd: descriptor not in list&FR^IbbbbнbbbbbbbqbbbbbСbbbbbcbbVbbbЕbbЈbbbjbbbbbbЛbbbbb&xbb-bbbЧbbbbbbbbbbbbbbb.:bb.bbbbbbbbbbbbbb8bbbbbbbbbbbbBbbPbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbЭЭ 5 Ѓ Ѓ too many interfacesif_attachhead: mallocif_attach: mallocegress%s: can't handle af%d d n;0&AvQkkXaM%sTODS %sFRDS %sDSDS %s(%s->%s) type#%d WEP %dM +%d%s: bogus xmit rate %u setup associatedsynchronized%s with %s ssid channel %d start %uMb ieee80211_newstateFгл8йV+OВВe $HHno recent beacons from %s; rescanning APL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKAWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDaeauazbgbhbnbrbybzcacocrczdkdodzegf2figrgthkhnhuiej1j2j3j4j5jmjojpkpkrkwkzlblilvmcmkmomxmyninlnzpkprqarusvtnttuaukuyuzvnyezazw0T0U0S0R0 0F0I0V0E)0/0G40:0B?0E0XJ0P0DU0Y0 _07e0@l05r0Ѐy02060080000900400“0 03ȓ0h͓0@ғ0ד0ݓ00"0 0!00:0010 0H0@0J!0K(0A/050C:0 @0Oc.@Oc.“00fE0gL0`S0aY0b_0ce0dk0eq0i|0j000@@@ @@ !" 1:7 25@608 943 @ A BC D@EFGHIJ K RSTU V X`abcdefgh ij30x13&10 r1G(;[09$0!008M10d0400`0RD1UL0p0T0|0 u15Qd0X2R00 ~1706 37070 0117200706Ĕ07} 0.6 -/0,ǔ0@ʔ0X͔0!TД046\Ӕ05hJ1t֔07xIj0d]1p1l60R`*/7|.7ٔ0Aܔ0Hߔ0C0J0K000@n1IDq00E0E00005Pj0d307J070E3300' 0 0!00.007B07*0"1O2\x-/`N1J0hO07v!0l.7X{0z$01'0{1/Y07h1Bp1706*0,/j1E-0606 000- 0G$30:607H-/Z90E\<0:^1V?0wB0E07H0arp_rtrequest: bad gateway value arpresolve: can't allocate llinfo arp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arplookup: unable to enter address for %s arp_rtrequest: malloc failed arpintrarptfreerevarp}ЅЅЦЅin_controlinvalid argument to in_lifaddr_ioctlin_pcbinit: hashinit failedinpcbplin_pcbinit: hashinit failed for lportIPv6 pcb passed into in_pcbconnectinterneticmp_erroricmp lenAAA> ? AAA@AA??4@AAAx@AAAAAAAAAAAAAAAAAAAAAAA>>>>>>>>>>>>>>>>icmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout %d.%d.%d.%dipqeplip_initaeshmac-sha1deflate_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_F_V_F_F_F_F_F_F_F_F_F_F_F_F_F_F_l_F_F_F_F_F_F_F_F_F_F__aaaaaaaaaaaaaaaaaaaз``!`І```mn7m7m7m7m7mnЫmЫmЫmЫmЫmnnnnnmnnnnnnnnnndmnmxmЉmКmFn@oЈnЈnЈnЈnЈnFnnnnnn@o@o@o@o@on%o%o%o7o7o7o7o7o7o%oгnйnпnnnp=q\qЃqЖrrip_attachrip_detachrip_usrreqy@zYz"{Бz"{'zz"{z9z?{{"{"{+{4{"{m_pulldown malfunctiontcp_pulloutofbandsynpl{ЉЉЉ̘̘Љ̘tcp_outputtcp_output REXMTtcpcbpltcpqepltcp_initЩL6tcp_usrreq FЛ!TmЇйЙбЛЅЅЅЖЖОСаudp_usrreq"-]O\ОЮipip_input: should never reach herefile system fullffs_realloccg: bad bprevffs_realloccg: bad blocknoffs_realloccg: bad optimffs_valloc: dup allocout of inodespos = %d, i = %d, fs = %s ffs_clusteralloc: lost blockffs_blkfree: bad sizebad block %d, ino %u bad blockffs_alloccg: map corruptedbno = %d, fs = %s ffs_alloccg: block not in mapuid %u on %s: %s %s: write failed, file system is full dev = 0x%x, bsize = %d, bprev = %d, fs = %s %s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE dev = 0x%x, optim = %d, fs = %s mode = 0%o, inum = %d, fs = %s free inode %s/%d had %d blocks %s: create/symlink failed, no inodes free ffs_alloccgblk: cyl groups corruptedffs_alloccgblk: can't find blk in cylcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapdev = 0x%x, bsize = %d, size = %ld, fs = %s dev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodestart = %d, len = %d, fs = %s ffs_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizeffs_isblockffs_clrblockffs_setblockffs_isfreeblocksoftdep_flushfiles calledsoftdep_freefile calledsoftdep_setup_remove calledsoftdep_change_linkcnt calledsoftdep_slowdown calledsoftdep_setup_inomapdep calledsoftdep_setup_blkmapdep calledsoftdep_setup_allocdirect calledsoftdep_setup_allocindir_page calledsoftdep_setup_allocindir_meta calledsoftdep_setup_freeblocks calledsoftdep_setup_directory_add calledsoftdep_change_directoryentry_offset calledsoftdep_setup_directory_change calledsoftdep_load_inodeblock calledsoftdep_update_inodeblock called?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@Q܍lbōd~eСfiMi k_k ffs_mountroot: can't setup bdevvp's WARNING: soft updates isn't compiled in WARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffsffs_reload: dirty2ffs_reload: dirty1no UFS2 support ffs_statfsupdate: rofs modffsinoffs_write%s: nonsync dir write%s: typeffs_fsync: not dirtyffs_fsyncffs_inactive: pushing activeufs_reclaim: pushing activemangled entryi_ffs_size too smallbad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2%s: bad dir ino %d at offset %d: %s checkpath: .. not a directory ААА>wwIT_jj:::::4:chown: lost quotaufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_readdir: lost in spaceufs_strategy: specufs_rename: lost from startdirtag VT_UFS, ino %d, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lldext2fs_valloc: dup alloccg = %d, ipref = %d, fs = %s bad block %d, ino %d blkfree: freeing free blockifree: freeing free inodeext2fs_alloccg: map corrupteduid %d on %s: %s mode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ext2fs_mapsearch: block not in mapext2fs_inactive: pushing activeext2fs_indirtrunc: bad buffer sizei_size too smallrec_len % 4 != 0directory entry across blocksinode out of boundsext2fs_dirbadentryext2fs_direnter: newblkext2fs_direnter: frag sizecheckpathrec_len is smaller than minimalreclen is too small for name_lenbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d hoЙvЙ}ЙЄЙЋЙВЦЭдлext2fs_writeM܍fōЯ[@Ў % L ext2fs_mountroot: can't setup bdevvp's%s: file system not clean; please fsck(8) Ext2 fs: unsupported inode size Ext2 fs: unsupported optional feature ext2fsext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsext2fs_rename: lost to startdirext2fs_rename: lost from startdirext2fs_reclaim: pushing activerename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_mkdir: blksizeamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_unadd: offset out of rangeamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: nothing thereamapplamap_wipeout: corrupt amapcownowcownowpageuvm_anon_add: can not allocate %d anons uvm_anon_adduao_set_swslot: uobj = %p uaoeltplaobjpluao_flush: weird flagsuao_getpageuao_getuao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_flush: strange, got an out of range flush (fixed) udv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_noram2flt_noram3flt_pmfail1fltagain2flt_noram4flt_noram5flt_pmfail2uvm_fault_unwire_locked: address not in mapuvm_fault_unwire_locked: unwiring non-wired memoryuvm_fork: uvm_fault_wire failed: %duvm_swapin: uvm_fault_wire failed: %dschedulerschedpwaituvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_alloc1: non-released pagekm_getwait2km_allockm_alloc1wvallocwaitkmthreadkmallocvmmaplk# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsvmmapbsyuvm_mapent_alloc: out of static map entries, check MAX_KMAPENT (currently %d)fork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)%  J 3 Ў ? _ ™  u }    К К    ] ] ] m q І u uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: bad free list %duvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx uvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] uvm_pagealloc_strat: bad strat %duvm_page_init increase VM_PHYSSEG_MAX STRATEGY = BSEARCH number of buckets = %d emergvapager_map\ | | | | | | | | | | | | | | | u | | | | | ` | | | | | | | | | | | | n g pagedaemon: deadlock detected! pgdaemonswapsysswapmapswp vnxswp vndswapdrum_addminirootswapctl: miniroot copy failedswapctl: copystrswap0x%04xdisklabel regionleaving %d pages of swap swap_off: swapdev not in listswstrategy: vnode type 0x%xswapmount: no device swapmount: no device 2 swap_deviceswapmount: copystruvm_swap_init: can't get vnode for swap deviceuvm_swap_init: extent_create failedswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot sw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost sbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attachuvn_termuvn_flushuvn_getpageuvn_getuvn_iosyncuvn_attach: blocked at %p flags 0x%x uvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_cluster: offset out of rangerd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_ifawithscope: output interface is not specified %s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled %s: didn't unlink in6ifaddr from list %s: no ifid available in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6&S!2S!?S!IS!SS!bY!lY!>Z!АY!КY!Чz!z!){!S{!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}!}{!Ч{!{!{!%|!O|!y|!Р|!|!|!icmp6_mtudisc_callback_registerICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d icmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutENOBUFS in icmp6_error %d /usr/src/sys/netinet6/icmp6.c(src=%s dst=%s tgt=%s)ip6_initip6_nexthdr: m == NULLOpenBSD-currentip6_input: packet to an unready address %s->%s cannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s !˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!ۥ!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!ۥ!˥!˥!˥!˥!˥!˥!˥!˥!˥!˥!/!V!]!t!Ћ!Т!צ!й!/!register_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p ip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not splitm!m!m!m!!Ы!Ы!Ы!Ы!Ы!!!!!!m!m!!]!]!m!?!!m!!m!!!!!!!!!!!!!m!!!!!!!!!!!!!!!!!!!В!Ы!!!u!u!u!u!u!u!u!u!u!u!u!! !u!&!A!\!u!u!С!u!w!u!u!u!u!u!u!u!u!u!u!u!u!Ќ!b!b!b!Є!Є!Є!Є!b!.!.!.!.!.!Є!b!b!b!b!Є!Є!b!t!t!Є!0!b!Є!b!Є!b!b!b!b!b!b!b!b!b!b!b!b!Є!b!b!b!b!b!b!b!b!b!b!P!P!P!G!b!b!b!P!Ж!О!У!Ъ!!!!!!!!!!!!в!и!!!!!!!!!!!!!!!!!!!!!!!В!!O!Њ!;!!!@!w!Х!!nd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 uninitialized ndopts in nd6_optionuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored rt_llinfo(%p) is not equal to ln(%p)nd6_lookup: failed to lookup %s (if = %s) nd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) default router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) ndopts == NULL in nd6_optionndopts == NULL in nd6_optionstoo many loop in nd opt ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLdst=0 in nd6_timer(ln=%p)unspecnd6_rtrequest: malloc failed O!O!p!O!O!!B!N!\!А!nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s %s: starting DAD for %s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_output: source can't be determined: dst=%s, error=%d nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_ns_inputnd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_na_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) defrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) K"K"L"+L"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"зM"RL"yL"РL"L"L"M"9M"YM"yM"ЙM"ЊO"ЊP"P"ЭR"]Q"ЭR"GP"Q"ЭR"R"ЁP"R"ЩR"ЭR"ЭR"жR"R"ЭR"rip6_attachrip6_detachrip6_usrreqmainbuswdswfdwtsdmcdraidroot on %s%d%c root device? %s: not a unit number %d: no such unit use one of: %s%d[a-%c] cpu_configure: mainbus not configuredbiomask %x netmask %x ttymask %x invalid geometrydisk label I/O errorno disk labeldisk label corrupteddos partition I/O errorbad sector table I/O errorbad sector table corruptedgdtlckgdt_init: no pagesgdt_growgdt_get_slot: gdt_next != gdt_countgdt_get_slot: out of GDT descriptorscpu0real mem = %u (%uK) startup: no room for tablesavail mem = %lu (%uK) 386SX386DX486SX486DXCyrix486DLC6x86NexGen586386686OverDrive Dual GenuineIntel486DX2486SL486SX2486DX4Pentium (A-step)Pentium (P5)Pentium (P54C)Pentium (P24T)Pentium/MMXPentiumPentium ProPentium IIPentium II/CeleronPentium IIIPentium MPentium III XeonPentium Pro, II or IIIPentium 4AuthenticAMDAm486DX2 W/TAm486DX2 W/BAm5x86 W/T 133/160Am5x86 W/B 133/160Am486 or Am5x86K5K6-2K6-IIIK6-2+/III+K5 or K6Athlon Model 1Athlon Model 2Duron Model 3Athlon Model 4Athlon XP Model 6Duron Model 7Athlon XP Model 8Athlon XP Model 10K7Athlon64Opteron or Athlon64FXAMD64CyrixInsteadMediaGX486 classGXm586 class6x86MX686 classCentaurHaulsIDTWinChip C6WinChip 2WinChip 3WinChipC3 SamuelC3 Samuel 2/EzraC3 Ezra-TC3 NehemiahC3 EstherRiseRiseRisemP6GenuineTMx86TransmetaTMS5x00Geode by NSCNational SemiconductorGeode GX1SiS SiS SiS SiSSiS55xFPUV86PSETSCMSRPAEMCECX8SEPMTRRPGEMCACMOVPATPSE36SERCFLUSHFXSRSSESSE2HTTSBF3DNOWSSE3MWAITESTTM2CNXT-ID%s: TSC disabled RNG AES AES-CTR SHA1 SHA256 RSAPentium II XeonC3 Samuel 2C3 EzraVIA%s %s%s" %s (%s%s%s%s-class) %d.%02d GHz %d GHz %d MHzTMS5800TMS5600 Attempting to power down... rebooting... dumpconf: bad dumpdev=0x%xdump area unavailable succeeded device bad device not ready area improper i/o error aborted from console error %d ioporttoo many boot args/boot too old: upgrade!_bus_dmamem_map: size botchstartup: table size inconsistencyusing %d buffers containing %u bytes (%uK) of memory cpu_startup: cannot allocate VM for bufferscannot get physical memory for buffer cacheAm486DX4 W/T or Am5x86 W/T 150Am486DX4 W/B or Am5x86 W/B 150%s: xchg bug workaround performed %s: F00F bug workaround installed %s: disabling processor serial number identifycpu: strange family value%s (%s%s%s%s-class, %dKB L2 cache)WARNING: CYRIX 486DLC CACHE UNCHANGED. WARNING: not updating battery clock The operating system has halted. Please press any key to reboot. dumping to dev %x, offset %ld cannot reserve /boot args memory WARNING: CAN'T ALLOCATE RAM (%x-%x) FROM IOMEM EXTENT MAP! warning: too little memory available;running in degraded mode press a key to confirm bus_space_map: bad bus space tagbus_space_map: pa 0x%lx, size 0x%lx bus_space_map: can't free region bus_space_alloc: bad bus space tagbus_space_alloc: bad region start/endbus_space_alloc: pa 0x%lx, size 0x%lx bus_space_alloc: can't free region bus_space_unmap: bad bus space tagbus_space_unmap: %s 0x%lx, size 0x%lx bus_space_unmap: can't free region H11H11H11H11 11 11s"1$1A1H1111N1U1[1G 1b1,1i1z1Ї1Ж1Х1б11Х11:u"1й11й11111111 1Фu"! 1! 13v"+ 14 18 1E 111R 1e 1x 1 1Ј 1Ј 1Ј 1 1Ш 1Ћ 1А 1 1 1`u" 1к 1 1 1 1 1 1 1+ 1Іu". 17 1M 1Іu"S 1 1` 1 1h 11r 1v 1s" 1 1 1 1h 1 1 1з 1 1Xr" 1 1 1 1 10Бr" 1 1h 1 1 1 1 1 1" 1h 1, 1, 1 %x kvtop: zero page framevmapbufvunmapbuf IGNOREDdkcsum: %s matches BIOS drive %#x%s wsdisplay is not in cdevsw[]mii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specified%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %smii_activate: DVACT_ACTIVATE phy %d!A  !@@@@mii_phy_setmedia: MASTER on wrong mediamiiautnsphyDP83840 10/100 PHY: %s, rev. %d B"Q"Ћ"U;1nsphyterDP83815 10/100 PHYDP83843 10/100 PHY"S"";1;1qsphyQS6612 10/100 PHY"У"Е"Q`*<1a"~"~"~"m"~"~"~"~"~"~"~"y"~"~"~"f"~"~"~"r"inphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHY_"3""<12<13<1iophyi82553 10/100 PHY"Г""V=15V=1eephyMarvell 88E1000 Gigabit PHYMarvell 88E1111 Gigabit PHYMarvell 88E1000* Gigabit PHYMarvell 88E1011 Gigabit PHYMarvell 88E1000S Gigabit PHY""" =1 =1 =1 =1CP>1CP>1CP=1CP;>1CP=1CP=1CP `?1"Ѝ"Ѝ":"Ѝ"Ѝ""Ѝ"Ѝ"Ѝ"Ѝ"Й"Ѝ"Ѝ"Ѝ"Ѝ""Marvell 88E1111-RCJ Gigabit PHYexphy""-#: 3Com internal media interface %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYrlphyRTL8201L 10/100 PHY: RTL internal phy f#e#"rlphy_service: attempt to isolate phylxtphyLXT970 10/100 PHYLXT971 10/100 PHY####"#@1@1luphyLU6612 10/100 PHY#""` *A1mtdphyMTD972 10/100 PHY#""дgA1icsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYc #7 # #}A1}A1}A1sqphySeeq 80220 10/100 PHYSeeq 80225 10/100 PHYSeeq 84220 10/100 PHY #Ы #"6B1оLB1оbB1tqphy78Q2120 10/100 PHY&##"9B1ukphy%s: no media present #"": Generic IEEE 802.3u media interface %s: OUI 0x%06x, model 0x%04x, rev. %d dcphy: internal PHY #b#М#bmtphyBroadcom 3C905B internal PHYBroadcom 3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHY#Ђ#"C1C16 D1!&D1(9D13QD1dD12zD1brgphyBCM5400 1000baseT PHYBCM5401 10/100/1000baseT PHYBCM5411 10/100/1000baseT PHYBCM5421S 10/100/1000baseT PHYBCM5701 10/100/1000baseT PHYBCM5703 10/100/1000baseT PHYBCM5704 10/100/1000baseT PHYBCM5705 10/100/1000baseT PHYBCM5714 10/100/1000baseT PHYBCM5750 10/100/1000baseT PHYBCM5752 10/100/1000baseT PHYbge=#n#!#3E1IE1fE1E1E1E1E1E14F12F1OF1#з#з##з#з##з##з#з#з#з#з#з#з## 22  ##  *hh   1 @"#Ђ"#"#Н"#"#"#"#"#"#"#"#"#в"#"#"#"#"#"#Ф"#"#в"#Ы"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#"#в"#xmphyJato 1000baseX PHY##t%#"5J1ЃRI1$#$#$#$#$#$#$#$#$#$#$#В$#XaQti Corp. XMAC II Gigabit PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHY'#Ъ(#"n`&J1@`:J1n`LJ1n` ^J1ЕpJ1acphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHY*#Н+#"!K1ЕK1Е1K1rgephyRTL8169S/8110S PHYJ-#y/#d4#LK12K1-#.#.#.#.#.# .#.#.#.#.#.#.#.#.#.#.#ciphy%s: unknown PHY speed %x V5#_7#<8#@M1 @M1!@M1Џ!@M16#6#6#-6#6#6#&6#6#6#6#6#6#6#6#6#6#6#Cicada CS8201 10/100/1000TX PHY%s: unknown CICADA PHY model %x scxsplgetxscannot allocate scsi xs could not get size scsi_scsi_cmdscbusyprobe%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDEFERRED AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s ASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %donly the first 4,294,967,295 sectors will be used. scsi_execute_xs: invalid return codeunknown error category (0x%x) from scsi driver %sCheck Condition (error %#x) on opcode 0x%x %c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) +C#2C#ЦC#ЦC#ІC#OC#2C#ЭC#РC#!D#!D# SCSI%d %d/%s %s%sT1T13&T1/T1 #4@T1IT1 #4ZT1cT1tT1xT1ЁT1 #4T1АT1 #4T1КT1 #4T1ПT1 #4T1ШT1 #4 #4ЭT1 #4T1оT1 #4T1T1 #4T1T1 #4T1T1Еz3U1U1 #4T1 U1 #4U1U1)U1,U15U1FU1,U1KU1\U1,U1aU1rU1wU1 #4ЕU1U1 #4ХU1U1 #4кU1U1 #4U1U1 #4U1U1 #4й3U1 #4U1U1 #4V1W1 #4V1 V1 #4й3V1 #4й3(V1 #47V1 %s: %d-sector PIO, LBA48, %lluMB, %llu sectors LBA, %lluMB, %llu sectors device faultdevice timeout, retrying %s: soft error (corrected) wddump: try againwddump: device timed outwddump: drive faultwddump: DMA errorwddump: %swddump: unknown error typeST506 CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors %s: freeze lock command didn't complete __wdstart: bad return code from wdc_ata_bio()wddump: polled command has been queuedwd_get_params: bad return code from ata_get_params%s: flush cache command didn't complete %s: flush cache command timeout %s: flush cache command: drive fault )##q#j#x#U#Љ $N $5 $< $. $wdc_wdc_ata_bio_start: bad statewdc_ata_bio_intr: bad staterecalpiomode%s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in _wdc_ata_bio_start %s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: not ready, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in wdc_ata_bio_intr %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq wdc_ata_ctrl_intr: state==RECAL$з$$;$t$з$$I$Ђ$б$$address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedno media/write protectedinterface CRC errorerror not notifiedcpupcieisa dev %d function %dpci_io_find: bad requestpci_mem_find: bad requestpci_mem_find: bad 64-bit request.miscellaneousfloppyIPIethernettoken ringFDDIWorldFipPCMIG Multi ComputingXGAvideotelephonyhostMicroChannelNuBusRACEwaySemi-transparent PCIInfiniBandparallelmulti-port serialGPIBsmartcard8237 DMA8254 timerRTCPCI Hot-Plugdigitizermousegame portgenericAlphaPowerPCMIPSCo-processorACCESS.busSSAFiber ChannelIPMISERCOSCANbusIrDAConsumer IRRFbluetoothbroadband802.11a (5 GHz)802.11b (2.4 GHz)standardvoicenetwork/computingentertainmentDPIOTime and Frequencysynchronizationmanagementprehistoricmass storagenetworkmultimediacommunicationssysteminputdockserial buswirelesssatellite commcryptoDASPundefinedOZ6832 CardBusOZ6836/OZ6860 CardBusOZ68[17]2 CardBusOZ6922 CardBusOZ6933 CardBusOZ69[17]2 CardBusOZ711Mx CardBusOZ711M1 CardBusOZ711E0 CardBus3c9853c9963CRDAG675 (Atheros AR5212)3CRPAG175 (Atheros AR5212)V.90 Modem3c9403c3393c3593c4503c555 100Base-TX3c5753CCFE575BT3CCFE575CT3c590 10Mbps3c595 100Base-TX3c595 100Base-T43c595 10Mbps-MII3CRSHPW796 802.11b3CRWE154G72 802.11g3c556 100Base-TX3c556B 100Base-TX3CCFEM6563CCFEM656B56k Modem3CCFEM656C56k Global Modem3cSOHO-TX3crwe777a AirConnectGig3c900 10Base-T3c900 10Mbps-Combo3c900B 10Mbps3c900B 10Mbps-Combo3c900B 10Mbps-TPC3c900B 10Mbps-FL3c905 100Base-TX3c905 100Base-T43c905B 100Base-TX3c905B 100Base-T43c905B 10/100Mbps-Combo3c905B 100Base-FX3c905C 100Base-TX3c9201 100Base-TX3c920B-EMB-WNM3cSOHO 100B-TX3c980 100Base-TX3c980C 100Base-TX3cr9903cr990-TX3cr990-TX-953cr990-TX-973c990b-TX-M3cr990-FX3cr990SVR953cr990SVR973c990BSVRVoodooVoodoo2BansheeVoodoo3Voodoo5300SX500TXDelta500MXOxygen GVX1Permedia 3Escalade IDE RAIDFE2500 10/100PCM200 10/100FE2000VX 10/100FE2500MX 10/100PC4800 WirelessPCI35x WLANPC4500 WirelessMPI-350 WirelessACCM 2188 VL-PCI2051 PCI2051 ISAATP850U/UFATP860ATP860-AATP865-AATP865-RAEC6710AEC6712UWAEC6712UAEC6712SAEC6710DAEC6715UWMPX 5030/5038EN2242EN1217rtl8139AWA-100M1435 VL-PCIM1445 VL-PCIM1449 ISAM1451 PCIM1461 PCIM1489 PCIM1523 PCIM1523 ISAM1531 PCIM1533 ISAM1535 PCIM1543 ISAM1541 PCIM1621 PCIM1647 PCIM3309 MPEGM4803M5219 UDMA IDEM5229 UDMA IDEM5237 USBM5247 AGP/PCI-PCIM5243 AGP/PCI-PCIM5451 AudioM5457 ModemM7101 PowerAL981AN983AN985ADM8211 WLANAIC-7810AHA-2940AU/CNAHA-2930CUAIC-7850AIC-7855AIC-5900 ATMAIC-5905 ATMAPA-1480AIC-7860AHA-2940AUAIC-7870AHA-2940AHA-3940AHA-3985AHA-2944AIC-7880AHA-2940UAHA-3940UAHA-398XUAHA-2944UAHA-2940UWProAIC-6915AIC-7895AHA-2940U2 U2AHA-2930U2 U2AAA-131U2 U2AIC-7890/1 U2AIC-7892 U160AHA-29160 U160AHA-19160B U160AHA-3950U2B U2AHA-3950U2D U2AIC-7896/7 U2AHA-3960D U160AIC-7899BAIC-7899DAIC-7899FAIC-7899 U160AAC-2622ASR-2200SASR-2120SAAC-364AAC-3642Dell PERC 2/QCAIC-7901 U320AHA-29320A U320AHA-29320LP U320AIC-7901A U320AHA-29320 U320AHA-29320B U320AIC-7902 U320AIC-7902B U320AHA-39320 U320AHA-39320B U320AHA-39320A U320AHA-39320D U320AHA-39320DB U3201200A1200BABP-930/40UAABP-940UWASP-3940U2WASP-3940U3WWaikato Dag3.2Endace Dag3.5Endace Dag4.22GEEndace Dag4.23AT22AT24AcenicAcenic CopperAC1000AC1001AC9100AMD64 HyperTransportAMD64 Address MapAMD64 DRAM CfgAMD64 Misc Cfg79c970 PCnet-PCI79c978 PChome-PCI53c974 PCscsi-PCI79C974 PCnet-PCIElanSC520 PCI751 System751 PCI-PCI762 PCI762 PCI-PCI761 PCI761 PCI-PCI755 ISA755 IDE755 Power755 USB756 ISA756 IDE756 Power756 USB Host766 ISA766 IDE766 USB766 Power766 USB OpenHCI768 ISA768 IDE768 Power768 AC97768 Modem768 PCI-PCI768 USB8131 PCIX8131 PCIX IOAPIC8151 Sys Control8151 AGP8132 PCIX8132 PCIX IOAPIC8111 PCI-PCI8111 USBAMD8111 LPC8111 IDE8111 SMBus8111 ACPI8111 AC97MegaRAIDMegaRAID Series 428MegaRAID Series 434ADSP 21535 DSPAD1889 AudioSafeNet ADSP 2141TC9021BanditGCOHareHeathrowPaddingtonUni-N EthUni-NUni-N AGPGMACKeylargoPangeaPangea USBPangea AGPPangea PCIUni-N2 AGPUni-N2 HostPangea FireWireUniNorth FirewireUni-N ATAUniNorth AGPUniNorth PCIIntrepid ATAIntrepidIntrepid USBARS106SARS0303D1000PV2000PV2000MT2000MIAX88140A/88141Radeon Mobility X600Radeon 9600 ProRadeon 9600Radeon 9600 XTMach32Radeon 9600 Pro SecRadeon 9600 XT 2ndRadeon 8500 BBRadeon IGP 320MMobility M6IXP200 AC97SB200 PCI-PCISB200 USB2SB200 USBSB200 PCI-ISASB200 SMBusMach64 CTMach64 CXIXP300 AC97IXP400 AC97IXP400 PCIIXP400 SMBusIXP400 USB2IXP400 USBIXP400 ISAIXP400 SATAIXP200 IDEIXP300 IDEIXP400 IDEMach64 ETRage ProMach64 GDMach64 GIMach64 GLMach64 GMMach64 GNMach64 GOMach64 GPMach64 GQRage XLMach64 GSMach64 GTMach64 GUMach64 GVMach64 GWMach64 GXMach64 GYMach64 GZRadeon 9000Radeon 9000 SecMach64 LBMach64 LDRage128 LEMobility M3Mach64 LGMach64 LIMobility 1Mach64 LNMach64 LPMach64 LQRage P/MMach64 LSRadeon Mobility M7 LWRadeon Mobility M6 LYRadeon Mobility M6 LZRadeon Mobility M9 LfRage 128 Mobility MFRage 128 Mobility MLRadeon 9500/9700Radeon 9800 XTRadeon 9800 ProRadeon Mobility M10 NPRadeon 9500/9700 SecRadeon 9800 Pro SecRage 128 Pro PDRage FuryRage 128 PKAIW RadeonRadeon QERadeon QFRadeon QGRadeon 8500 QLRadeon 9100 QMRadeon 8500 QNRadeon 8500 QORadeon 7500 QWRadeon VE QYRadeon VE QZRadeon 8500 QlRage 128 GLRage MagnumRage 128 RGRage 128 RKRage 128 VRRage 128 SHRage 128 SKRage 128 SLRage 128 SMRage 128Rage 128 Pro TFRage 128 Pro TLRage 128 Pro TRMach64 VTMach64 VUMach64 VVRS300 HostRadeon IGP 9100 HostRadeon Mobility IGP 9100Radeon IGP 9100 AGPRadeon 9200 PRO 2ndRadeon 9200 2ndRS480 HostRadeon XPRESS 200Radeon XPRESS 200MRadeon 9200 PRORadeon 9200Radeon 9200 SE 2ndRS480 PCIERadeon X300Radeon X600FireGL V3100Radeon X300 SecRadeon X600 SecFireGL V3100 SecRadeon Mobility 9200Radeon Mobility 9200 (M9+)Radeon 9200 SERS100 PCIRS200 PCIRS100 AGPRS200 AGPS5933 PCI MatchmakerMyrinet LANaiAR5210AR5211AR5212AR5210 (Early)AR5212 (IBM MiniPCI)AR5210 (no eeprom)AR5212 (no eeprom)AR5211 (no eeprom)AR5212 (emulation board)AR5211RefIDE-2015PLVortex 1Vortex 2Vortex AdvantageAVL2301AVG2302ALG2301ALG2302ALS4000LP-PCI 4 SerialFritz ISDNFritz v2.0 ISDNBRI ISDNPRI T1 ISDNF5D6001F5D6020V3F5D6000VME 617VME 270655015601BCM5752MBCM5702BCM5704CBCM5704S_ALTBCM5702FEBCM5705KBCM5720BCM5721BCM5705MBCM5705M_ALTBCM5714CBCM5780SBCM5705FBCM5751BCM5750MBCM5751MBCM5751FBCM5782BCM5788BCM5789BCM5702XBCM5703XBCM5704SBCM5702_ALTBCM5703_ALTBCM5781BCM5753BCM5753MBCM5753FBCM4401B0BCM5901BCM5901A2BCM4306BCM4322BCM4309BCM4401580158025805582058225823BT848BT849BT878BT879BT878 AudioBT879 AudioBt8474 HDLCMultiMaster NCMultiMasterFlashPointGPPCINitrox XLCinemaster643106554565548655506555465555685546900069030CL-GD7548CL-GD5430CL-GD5434-4CL-GD5434-8CL-GD5436CL-GD5446CL-GD5480CL-GD5462CL-GD5464CL-GD5465CL-PD6729CL-PD6832 CardBusCL-PD6833 CardBusCL-GD7542CL-GD7543CL-GD7541CS4610 SoundFusionCS4615CS4280/46xx CrystalClearCS4281 CrystalClearPCI0640PCI0642PCI0643PCI0646PCI0647PCI0648PCI0649PCI0650AUSB0670USB0673PCI0680SiI3112 SATASiI3114 SATASiI3512 SATAAAR-1210SAGigaCardEX110TXTriflex PCIQVisionQVision 1280/pSmart Array 5300Smart Array 5iSmart Array 532Smart Array 5312Smart Array 641Smart Array 642Smart Array 6400Smart Array 6400 EMSmart Array 6422Smart Array 64xxNetelligent ASMCPCI HotplugUSB OpenHostSMART2P RAIDISAPnPNetelligent IDENetelligent 10 TIntegrated NetFlex 3/PDP Netelligent 10/100TXProLiant Netelligent 10/100TXEmbedded Netelligent 10/100TXNetelligent 10 T/2 PCISmart Array 5300 rev.2Smart Array 5i/532 rev.2NetFlex 3/PBCompexeRL100-ATX 10/100PMAC 9871356k WinmodemSoftK56 PCIHSF 56k HSFiMUSYCC CN8478MUSYCC CN8474MUSYCC CN8472MUSYCC CN847182C599 VLBCY82C693U ISAFEther CB-TXD 10/100FEther II CB-TXD 10/100CG-LAPCIGTC-Bus II-PCISoundBlaster LiveSoundBlaster AudigySoundBlaster Audigy LSPCI Gameport JoystickSoundBlaster Audigy DigitalEctiva 1938Cyclom-Y below 1MCyclom-YCyclom-4Y below 1MCyclom-4YCyclom-8Y below 1MCyclom-8YCyclom-Z below 1MCyclom-ZIQ80310GXm PCIGXm ISACx5530 SouthCx5530 SMI/ACPICx5530 IDECx5530 XpressAUDIOCx5530 VideoDM9100DM9102DM900921050 PCI-PCI2104021030Zephyr NV-RAMKZPSA21140TGA2DEFPA21041DGLPB (OPPO)ZLXP-L2 (Pixelvision)21142/3Farallon PN9000SX21052 PCI-PCI21150 PCI-PCI21150-BC PCI-PCI21152 PCI-PCI21153 PCI-PCI21154 PCI-PCICompaq SMART RAID 42xxSWXCR RAIDPERC 2/SiPERC 3/DiPERC 3/SiPERC 4/Di i960PERC 4/Di VerdePERC 4e/DiViper/PCI550TX530TX+DFE-690TXDDWL-610DGE-550TDGE-528TDGE-560TDGE-560T_2DGE-530TSmartCache/RaidSmartRAID (I2O)SmartRAID 2005SMemory ControlPCI-SCIDMX3194UIS64PH ISDN155P-MF1 ATM (FPGA)155P-MF1 ATM (ASIC)25SS-3010 ATM (ASIC)SpeedStream 1023QuickStep 1000 ISDNLight Pulse FibreChannelLight Pulse 8000Endace Dag3.6DEndace Dag4.23GECB-1410 CardBusAudioPCI97AudioPCICT5880ES366H ModemMaestro IISOLO-1 AudioDriveMaestro 2EES1989ES1989 ModemMaestro 3ES1983 ModemMaestro 3 AudioES366H Fax/ModemES2838/2839 SuperLink ModemES2898 ModemRoadRunner HIPPIRoadRunner Gig-EFreedom GBusWL11000PATM PCA-200ATM PCA-200e801 SoundTMC-18C30 (36C70)GL24110P03GL24110PGL24110P02PR103WinTVPN672TX 10/100Visualize EGVisualize FX6Visualize FX4Visualize FX2Tach TL FibreChannelTach XL2 FibreChannelJ2585AJ2585BDiva Serial MultiportElroy Ropes-PCIVisualize FXeTopTools Communications PortNetRaid-4MNetServer SmartIRQ82557B 10/100 NICPluto MIOzx1 IOCMercury Ropes-PCIQuickSilver Ropes-PCISmart Array V100Smart Array P800Smart Array P600Smart Array E40077516500781179517814/7851/785480658165815479567955/7954CPU - Alta LiteCPU - Alta MPISA w/PnPAuto LANStreamerGXT-150P82G267582351 PCI-PCIServeRAIDMiami/PCIOlympici82557B 10/100FireGL2PCIX-PCIX77201/77211 ATM (NICStAR)WDT 50x Watchdog TimerINIC-850 (A100UW)INIC-1060 (A100U2W)INIC-940INIC-941INIC-950IPN2120IPN22208849EES ISA2114580303 IOP80312 I/O CompanionPCIE-PCIEIOP331 Channel 0IOP331 Channel 141210 PCIE-PCIX82375EB EISA82424ZX Cache/DRAM82378IB ISA82426EX ISA82434LX/NX PCI/Cache/DRAMGDT RAIDi960 RP PCI-PCIi960 RM PCI-PCIi960 RN PCI-PCIPRO/1000 (82542)PRO/1000F (82543GC)PRO/1000T (82543GC)PRO/1000XT (82544EI)PRO/1000XF (82544EI)PRO/1000T (82544GC)PRO/1000XT (82544GC)PRO/1000MT (82540EM)PRO/1000MT (82545EM)PRO/1000MT (82546EB)PRO/1000MF (82545EM)PRO/1000MF (82546EB)PRO/1000MT (82541EI)PRO/1000MT (82540EP)PRO/1000MT Mobile (82541EI)PRO/1000CT (82547EI)PRO/1000CT Mobile (82547EI)PRO/1000MT QP (82546EB)PRO/1000MT (82545GM)PRO/1000MF (82545GM)PRO/1000MB (82545GM)PRO/100PRO/100 VEPRO/100 VM82562EH HomePNAV.92 ModemPRO/Wireless 2100PRO/10GbE LR (82597EX)PRO/100 MPRO/100 VE (82562EZ)PRO/100 VE (82801FBM)PRO/1000CT (82547GI)PRO/1000MT (82541GI)PRO/1000MT Mobile (82541GI)PRO/1000MT (82541ER)PRO/1000MT (82546GB)PRO/1000MF (82546GB)PRO/1000MB (82546GB)PRO/1000GT (82541GI)PRO/1000MT (82573E)PRO/1000MT QP (82546GB)82815 Hub82815 AGP82815 Graphics82806AA APIC82559ER82092AA IDESAA7116EE Pro 10 PCIEE Pro 100EE Pro 100 Smart8255782437FX82371FB ISA82371FB IDE82371 ISA and IDE82437 PCI/Cache/DRAM82441FX82380AB Mobile ISA82380FB Mobile PCI-PCI82439HX82806AA82870P2 PCI-PCI82870P2 IOxAPIC82870P2 Hot Plug80960RP ATU82840 Host82840 AGP82840 PCI82845 Host82845 AGPPRO/10GbE SR (82597EX)82801AA LPC82801AA IDE82801AA USB82801AA SMBus82801AA AC9782801AA Modem82801AA Hub-to-PCI82801AB LPC82801AB IDE82801AB USB82801AB SMBus82801AB AC9782801AB Modem82801AB Hub-to-PCI82801BA LPC82801BA USB82801BA SMBus82801BA AC9782801BA Modem82801BAM Hub-to-PCI8256282801BAM IDE82801BA IDE82801BAM LPC82801BA AGP82801E LAN82801CA LPC82801CA/CAM USB82801CA/CAM SMBus82801CA/CAM AC9782801CA/CAM Modem82801CAM IDE82801CA IDE82801CAM LPC82801DB LPC82801DB USB82801DB SMBus82801DB AC9782801DB Modem82801DBM IDE82801DB IDE82801DBM LPC82801EB/ER LPC82801EB SATA82801EB/ER USB82801EB/ER SMBus82801EB/ER AC9782801EB/ER Modem82801EB/ER IDE82801ER SATA82820 MCH82820 AGP82850 Host82860 Host82850/82860 AGP82860 PCI-PCIE7500 MCH HostE7500 DRAME7500 MCHE7501 MCH HostE7505 MCH HostE7505 MCH AGPE7505 MCH PCI-PCI82845G/GL82845G/GL/GV/GE/PE AGP82845G/GL Video82865G/PE/P CPU-I/0-182865G/PE/P CPU-AGP82865G Video82865G/PE/P CPU-CSA82865G/PE/P CPU-I/0-282875P Host82875P AGP82875P PCI-CSA915G/P/GV Host915G/P/GV PCIE915G/P/GV Video925X MCH Host925X PCIEE7221 MCH HostE7221 PCIEE7221 Video915GM/PM/GMS Host915PM/GM PCIE915GM/GMS Video6300ESB LPC6300ESB IDE6300ESB SATA6300ESB SMBus6300ESB AC976300ESB Modem6300ESB USB5300ESB USB6300ESB WDT6300ESB APIC6300ESB PCIX82801FB LPC82801FBM LPC82801FB SATA82801FR SATA82801FBM IDE82801FB USB82801FB PCIE82801FB HD Audio82801FB SMBus82801FB Modem82801FB AC9782801FB IDE82945GP82945GP PCIE82801GB LPC82801GB SATA82801GB AHCI SATA82801GB USB82801GB PCIE82801GB HD Audio82801GB SMBus82801GB LAN82801GB Modem82801GB AC9782801GB IDERCU32 I2O RAID31244 SATA82855PE Hub82855PE AGP82830MP CPU-I/O-182830MP CPU-AGP82830MP Integrated Video82830MP CPU-I/O-282852GM Hub-PCI82852/82855 AGP82852GM AGP82852GM Memory82852GM ConfigurationE7710 SMCHE7710 MCH ERRE7710 MCH DMAE7710 MCH PCIEE7710 WMCHPRO/Wireless 2200BGPRO/Wireless 2225BGPRO/Wireless 2915ABGi960 RD PCI-PCIPRO 100 Server82371SB ISA82371SB IDE82371SB USB82437VX82439TX System82371AB PIIX4 ISA82371AB IDE82371AB USB82371AB Power8281082810 Graphics82810-DC10082810-DC100 Graphics82810E82810E Graphics82443LX AGP82443BX AGP82443BX82440MX Host82440MX AC9782440MX Modem82440MX ISA82440MX IDE82440MX USB82440MX Power82440BX AGP82443GX82740 AGP82450KX/GX82450KX/GX Memory82451NX Mem & IO82454NX PXB82802AC Firmware Hub 8Mbit82802AB Firmware Hub 4MbitI2O RAID PCI-PCIRCU21 I2O RAIDRCUxx I2O RAIDRCU31 I2O RAIDRCU31L I2O RAIDS21152BB PCI-PCIS21154AE/BE PCI-PCIPowerstorm 4D50TIntense 3DExpert3D5526 FibreChannelPRISM3PRISM2.5Prism IndigoPrism Javelin/XbowPrism GT/DuetteAEONGV-BCTV3AGX016ITT3204 MPEG DecoderIT8212FIT8330GKTIHSSIDS3DS1Appian LiteDual SerialQuad SerialDual ParallelDual Parallel BS3 805Leadtek WinFast TV 2000LXT1001EG1032EG1064PCMPC200PCM200PNICPNIC-II8031K56flex DSVD LTMODEMVenus ModemUSB 2-portUSB QuadraBusFW322 1394LS242 DVD DecoderPMAC 98715PMAC 98727MX86250Smart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 CardbusPresto PCISmart 100/16/4 PCI Ringnode16/4 CardBus Mk2Collage 25 ATMCollage 155 ATMi740 PCILibertas 88W8310SKv2Yukon 8035Yukon 8036Yukon 8052Yukon 8050Yukon 8053Belkin F5D5005MGA PX2085 (Atlas)MGA Millenium 2064W (Storm)MGA 1064SG 220MHzMGA Millennium II 2164WMGA G200 PCIMGA G200 AGPMGA G400/G450 AGPMGA ImpressionMGA G100 PCIMGA G100 AGPMGA 1064SGMGA G400 Twin HeadMGA G550 AGPMGA Millennium G200 SDMGA Produktiva G100 SDMGA Mystique G200 SDMGA Millennium G200 SGMGA Marvel G200 SDMN-120 10/100MN-130 10/100Powerstorm 4D30TGUI AccelMPC105 PCIMPC106 PCISM56Raven PCICP-114C104HCP-104ULC168HDMA4 serialDAC960P V2 RAIDDAC960P V3 RAIDDAC960P V4 RAIDDAC960P V5 RAIDAcceleRAIDeXtremeRAIDMyriNet LANai 9.2MTD800 10/100MTD803 10/100MTD891 10/100/1000MV1000NCP130NCP130 Rev A2DP83810 10/100PC87415 IDE87560 Legacy I/ODP83815 10/100DP83820 10/100/1000SCx200 ISASCx200 SMISCx200 IDESCx200 AUDIOSCx200 VIDEOSCx200 X-BUSSC1100 ISASC1100 SMI/ACPISC1100 X-BusNS87410PowerVR PCX2Versa MaestroVersa Va26D MaestroMagicgraph NM2070Magicgraph 128VMagicgraph 128ZVMagicgraph NM2160Magicgraph NM2200Magicgraph NM2360MagicMedia 256AV+MagicMedia 256XL+MagicMedia 256AVMagicMedia 256ZXMA301GA620GA620T2S1PCMI8338A AudioCMI8338B AudioCMI8738/C3DX AudioCMI8738B AudioHSP56 AMRNSP2KNetVin 5000Universe VME53c81053c82053c82553c81553c810AP53c86053c1510D53c89653c89553c88553c87553c151053c895A53c1010-3353c1010-6653c103053c875JFC909FC909AFC929FC919MegaRAID 320MegaRAID 320-2EMegaRAID SATA 8xPacket Engines G-NICFNW-3603-TX 10/100FNW-3800-TX 10/100NX82C501 PCINDR4600 PCIBS21 10/100E-mobility WirelessImagine-128Imagine-128 IIImagine-128 T2RImagine-128 T2R4NV1DAC64Riva TNTRiva TNT2Riva TNT2 UltraVantaMCP04 LANnForce4 ISAnForce4 SMBusnForce4 IDEnForce4 SATA 1nForce4 SATA 2CK804 LANnForce4 AC97nForce4 USBnForce4 PCI-PCInForce4 PCIEnForce4 DDRnForce2 ISAnForce2 SMBusnForce2 IDEnForce2 LANnForce2 USBnForce2 AC97nForce2 AudionForce2 PCI-PCInForce2 FireWirenForce2 400 ISAnForce2 400 SMBusnForce2 400 IDEnForce3 LANnForce2 400 USBnForce2 400 USB2nForce2 400 AC97nForce2 400 PCI-PCInForce2 400 SATAAladdin TNT2nForce3 ISAnForce3 PCI HostnForce3 PCI-PCInForce3 SMBusnForce3 IDEnForce3 USBnForce3 AC97nForce3 250 ISAnForce3 250 PCI HostnForce3 250 AGPnForce3 250 SATAnForce3 250 SMBusnForce3 250 IDEnForce3 250 USBnForce3 250 USB2nForce3 250 AC97nForce3 250 PCI-PCIGeForce 6600 GT AGPQuadro FX 330GeForce256GeForce256 DDRQuadroGeForce2 MXGeForce2 MX 100GeForce2 GoQuadro2 MXRGeForce 6600 GTGeForce 6600GeForce2 GTSGeForce2 TiGeForce2 UltraQuadro2 ProGeForce4 MX 460GeForce4 MX 440GeForce4 MX 420GeForce4 440 GoGeForce4 420 GoGeForce4 420 Go 32MQuadro4 500XGLGeForce4 440 Go 64MQuadro4 200/400NVSQuadro4 550XGLQuadro4 GoGLGeForce4 MX 440 AGPGeForce4 MX 440SE AGPGeForce 4 MX 420 AGPGeForce4 MX 4000Quadro4 580 XGLQuadro4 NVSQuadro4 380 XGLGeForce2 Crush11nForce PCI HostnForce 220 DDRnForce 420 DDRnForce 220/420nForce APUnForce AC97nForce ISAnForce SMBusnForce AGPnForce PCI-PCInForce IDEnForce USBnForce LANnForce2 PCInForce2 AGPnForce2GeForce4 MX nForce GPUGeForce3GeForce3 Ti 200GeForce3 Ti 500Quadro DCCGeForce4 Ti 4600GeForce4 Ti 4400GeForce4 Ti 4200Quadro4 900 XGLQuadro4 750 XGLQuadro4 700 XGLGeForce4 Ti 4200 GoGeForce FX 5600GeForce FX 5200GeForce FX Go 5200GeForce FX 5500GeForce FX 5700LEGeForce FX Go 5700OTI107OC2183OC2325OC232682C092G82C557 Host82C558 ISA82C568 IDE82D568 IDE82C621 IDE82C70082C70182C82282C861010L100L110L200L210L400L800Lx10H100H200H200HV2400H/800H011HExsys EX-41098PMC/GNIC2RZ1000HSP MicroModem 56PCIHB5I/O BridgePCIHB7CNB20HE HostCNB20LE HostCIOB30CMIC_HE HostCMIC_LE HostCNB20-HECMIC_SL HostCIOBX2CIOB-EROSB4 SouthBridgeCSB5 SouthBridgeCSB6 PCIOSB4 IDECSB5 IDECSB6 IDEOSB4/CSB5 USBCSB6 USBCSB5 PCICSB6 LPCPCI/ISASAA7130PT80C826PT86C521PT86C523PC87550PT86C523_2PCC-ISESES1849I/O 9050I/O 9080DC5030PDC20246PDC20262PDC20263PDC20265PDC20267PDC20268PDC20268RPDC20269PDC20271PDC20275PDC20276PDC20277PDC20318PDC20319PDC20371PDC20375PDC20376PDC20377PDC20378PDC20379PDC20617PDC20618PDC20619PDC20620PDC20621ISP10160ISP1020ISP1022ISP1080ISP12160ISP1240ISP1280ISP2100ISP2200ISP2300ISP2312ISP631285008580RT2460ART2560802981298138816981805C465 CardBus5C466 CardBus5C475 CardBus5C476 CardBus5C477 CardBus5C478 CardBus5C521 Firewire5C551 Firewire5C552 FirewireRS56/SP-PCI11P1 ModemViRGETrio32Trio32/64Aurora64V+Trio64UV+868ViRGE VX86C92886C864-086C864-186C864-286C864-386C964-086C964-186C964-286C964-386C968-086C968-186C968-286C968-3Trio64V2/DXPlatoTrio3D AGPViRGE DX/GXViRGE GX2Trio3 DX2Savage 3DSavage 3DMSavage 4ProSavage PM133ViRGE MXViRGE MXPSavage/MX-MVSavage/MXSavage/IX-MVSavage/IXSuperSavageTwisterTwister-KProSavage DDRSonicVibesSafeXcelMagicLAN SWL-2210P984x GESK-9821 v2.0SK-9D21SK-9SxxSK-9ExxTigonSTG 2000XSTG 1764Kyro-IISTG 1764X64GXDVDmagic-PRO86C201 AGP86C202 VGA648FX AGP86C20585C503 System5595 System85C503 ISA180 SATA181 SATA182 SATA5597/5598 VGA6215300/305/630 VGA85C50185C496SiS596530 PCI540 PCI550 PCI85C601 EIDE620 PCI630 PCI635 PCI640 PCI645 PCI646 PCI648 PCI650 PCI651 PCI652 PCI655 PCI658 PCI661 PCI730 PCI733 PCI735 PCI741 PCI745 PCI746 PCI748 PCI750 PCI752 PCI755 PCI760 PCI900 10/100BaseTX961 PCI962 PCI963 PCI964 PCI965 PCI551155125513 EIDE5571 PCI558155825591 PCI55965597/5598 Host62046205530 VGA650 VGA6326 VGA6330 VGA5597/5598 USB7002 USB7007 FireWire7012 AC977013 Modem7016 10/100BaseTX7018 AudioFDC 37C665FDC 37C92283C170 (EPIC/100)83C175 (EPIC/100)LynxEMLynxEM+Lynx3DMLynxELynxE+Lynx3D910Pirahna 2-portTulip, power, switch extenderFPGA I-Bus Tracer for MBDSZB6120CXD1947A FireWireCXD3222 FireWireMemory Stick SlotVelocity128PCIO Ebus2PCIO Ebus2 (US III)ERI EtherGEMSimba PCI-PCICrypto 5821Crypto 1KPsycho PCImicroSPARC IIep PCIUltraSPARC IIi PCIUltraSPARC IIe PCICassini EtherST201ST1023ST202140XX4018ASurecom NE-344S2PSpectrum24 LA41X382C10182C10382C10582C565 ISATC9021 GigETC9021 GigE (alt ID)DC-290(M)DC-690CDC-3x5UTerratec TV+Terratec TValueTerratec TValue RadioTLAN3DLabs Permedia3DLabs Permedia 2TSB12LV21 FireWireTSB12LV22 FireWirePCI4450 FireWirePCI4410 FireWireTSB12LV23 FireWireTSB12LV26 FireWireTSB43AA22 FireWireTSB43AB22 FireWireTSB43AB23 FireWireTSB43AB21 FireWirePCI4451 FireWirePCI4510 FireWirePCI4520 FireWirePCI7(4-6)10 FireWirePCI7x20 FireWirePCI6515 CardBusACX100AACX100BACX111PCI1130 CardBusPCI1031 PCMCIAPCI1131 CardBusPCI1250 CardBusPCI1220 CardBusPCI1221 CardBusPCI1210 CardBusPCI1450 CardBusPCI1225 CardBusPCI1251 CardBusPCI1211 CardBusPCI1251B CardBusPCI2030 PCI-PCIPCI2031 PCI-PCIPCI2250 PCI-PCIPCI2050 PCI-PCIPCI4450 CardBusPCI4410 CardBusPCI4451 CardBusPCI4510 CardBusPCI4520 CardBusPCI7510 CardBusPCI7610 CardBusPCI7410 CardBusPCI1410 CardBusPCI1420 CardBusPCI1451 CardBusPCI1421 CardBusPCI1620 CardBusPCI1520 CardBusPCI1510 CardBusPCI1530 CardBusPCI1515 CardBusPCI2040 DSPPCI7420 CardBusPCI interface5634PCV SurfRiderR4x00TC35856F ATM (Meteor)R4x00 PCIToPIC95 CardBus-PCIToPIC95B CardBusToPIC97 CardBusToPIC100 CardBusFast Infrared Type OSD ControllerVirtual NorthbridgeMem1Mem24DWAVE DX4DWAVE NXCyberBlade i7CyberBlade i7 AGPCyberBlade i1CyberBlade i1 AGPCyberBlade Ai1CyberBlade Ai1 AGPCyberBlade XP/Ai1TGUI 9320TGUI 9350TGUI 9360TGUI 9388CYBER 9397CYBER 9397DVDTGUI 9420TGUI 9440CYBER 9525TGUI 9660TGUI 9680TGUI 96823DImage 97503DImage 9850Blade 3DCyberBlade XPHPT343/345 IDEHPT36x/37x IDEHPT372A IDEHPT302 IDEHPT371 IDEHPT374 IDEPyramid3D TR25202ET4000w32p rev AET4000w32p rev BET4000w32p rev CET4000w32p rev DET6000/ET6100ET6300UM82C881 486UM82C886 ISAUM8673F EIDEUM8881 HB4 486 PCIUM82C891UM886AUM8886BFUM8710UM8886UM8881F HostUM8886F ISAUM8886AUM8891AUM9017FUM8886NUM8891NUS2013CP5610USR997902V961PBC i960 PCIV292PBC AMD290x0 PCIV960PBC i960 PCIV96DPC i960 PCIK8HTB HostVT8363 HostVT8371 HostVT8501VT82C505VT82C561VT82C571 IDEVT82C576 3VVT82C585 ISAVT82C586 ISAVT82C595 PCIVT82C596A ISAVT82C597 PCIVT82C598 PCIVT8601 PCIVT8605 PCIVT82C686 ISAVT82C691 PCIVT82C693 PCIVT86C926 AmazonVT82C570M PCIVT82C570M ISAVT82C416 IDEVT82C1595 PCIVT83C572 USBVT82C586 PowerRhine/RhineIIVT6306 FireWireVT82C596 PowerVT82C596B PMVT6105M RhineIIIVT82C686 SMBusVT82C686 AC97VT8233 AC97RhineII-2VT82C686 ModemVT8366 ISAVT8633 PCIVT8366 PCIVT8653 PCIVT6202 USBVT6105 RhineIIIS3 Unichrome PRO IGPVT8361 PCIVT8375 PCIPM800 AGPPM800 ErrorsPM800 HostPM800 DRAMPM800 PMCPM800 PCIPM800 Unichrome S3VT612xCLE266VT8623 PCIVT8233 ISAVT8751 PCIVT8237 SATAVT8235 ISAVT8377 PCIVT8378 PCIVT8237 ISAVT8378 VGAVT8231 ISAVT8231 PMGVT8363 AGPVT8371 PCI-PCIVT8501 AGPVT82C597 AGPVT82C598 AGPVT82C601 AGPVT8605 AGPVT8633 AGPVT8366 AGPVT8361 AGPVT8235 AGPK8HTB AGPVT8377 PCI-PCIGDT6000/6020/6050GDT6000B/6010GDT6110/6510GDT6120/6520GDT6530GDT6550GDT6x17GDT6x27GDT6537GDT6557GDT6x15GDT6x25GDT6535GDT6555GDT6x17RPGDT6x27RPGDT6537RPGDT6557RPGDT6x11RPGDT6x21RPGDT6x17RP1GDT6x27RP1GDT6537RP1GDT6557RP1GDT6x11RP1GDT6x21RP1GDT6x18RDGDT6x28RDGDT6x38RDGDT6x58RDGDT6x17RP2GDT6x27RP2GDT6537RP2GDT6557RP2GDT6x11RP2GDT6x21RP2GDT6513RSGDT6523RSGDT6518RSGDT6x28RSGDT6x38RSGDT6x58RSGDT6x33RSGDT6x43RSGDT6x53RSGDT6x63RSGDT7x13RNGDT7x23RNGDT7x18RNGDT7x28RNGDT7x38RNGDT7x58RNGDT7x43RNGDT7x53RNGDT7x63RNGDT4x13RZGDT4x23RZGDT8x13RZGDT8x23RZGDT8x33RZGDT8x43RZGDT8x53RZGDT8x63RZGDT6x19RDGDT6x29RDGDT7x19RNGDT7x29RNGDT8x22RZICP82C592 CPU82C593 ISA82C594 Wildcat82C596/597 Wildcat ISA82C54182C54382C53282C53482C53582C14782C97582C925Virtual SVGAVirtual SVGA IIP9000P9100WD33C193AWD33C196AWD33C197AWD7193WD7197WD33C296AWD34C296WD9610W83769FW89C840F 10/100Linksys EtherPCI IIW83C553F ISAW83C553FW89C940FW6692 ISDNLinksys EtherPCIX3201-3X3201-3 (21143)CBEM56G Modem724734738737740740C724F7447541221PCI-ST32Genie TV/FMMartin-MariettaHauppaugeDynalinkCompaqSymbios LogicATIULSI SystemsVLSIAvance LogicTseng LabsWeitekCirrus LogicWestern DigitalAMITridentAcerDellSiemens Nixdorf AGMatroxChips and TechnologiesToshibaNECFuture DomainSISHewlett-PackardPC TechnologyAsustekDPTOptiElsaSGS ThomsonBusLogicTexas InstrumentsSonyOak TechnologyWinbondMotorolaPromiseNumber 9UMCI. T. T.PicopowerMylexAppleYamahaNexGen MicrosystemsQLogicLeadTek ResearchInterphaseContaq MicrosystemsBit3OlicomIntergraphDiamond MultimediaCMD TechnologyQuantum DesignsBrooktreeSGIACC MicroelectronicsSymphony LabsSTB SystemsPLXMadge Networks3ComAcer LabsMitsubishi ElectronicsSurecomNeomagicMentor ARCAdvansysMolexMacronixEvans & SutherlandNvidiaEmulexIntegrated Micro SolutionsTekram (1st ID)NewbridgeApplied Micro CircuitsRealtekNKKIO Data DeviceInitioCreative LabsHighPointSigma DesignsCogent DataSiemensAcctonVortexEfficent NetworksFORE SystemsPhilipsZiatechCycloneAlliance SemiconductorSchneider & KochMutechXircomServerWorksRicohD-Link SystemsCorrollaryAcardZeinetOmega MicroMarvellLite-OnV3 SemiconductorPinnacle SystemsAT&T/LucentDolphinMesa Ridge (MAGMA)Analog DevicesZoranPijnenburgCompexCycladesEssential CommunicationsO2 Micro3DFX InteractiveATMLC-CubeAVMCoregaASIXNortel NetworksSilicon MotionEnsoniqRockwellDavicomITExpressPlatformLuxSonorTriTech MicroelectronicsAlteonUS RoboticsNVidia/SGS-ThomsonAurealADMtekPacket EnginesForte MediaSIIGDTC TechPCTELCNetLAN MediaNetgearMoxaLevel 1Hifn3wareAbocomSundanceC-Media ElectronicsLavaSunixMicrosoftOxfordTamarackAskeyAvermediaAironetMyricomVScomAvlabInvertexBroadcomPlanexConexantMyson CenturyTopic/SmartLinkENEAralionTerraTecSymbolSybaBluesteelVMwareNational DatacommZoltrixEumitcomNetSecSamsungAtherosGlobal SunSafeNetLinksysNetoctaveAntares MicrosystemsCaviumBelkinHawking TechnologyINPROCOMMLanergyRalinkTekramHint3D LabsAddtronIndustrial Computer SourceNetVinGemtekc't MagazinAdaptecAtronicsNetMosTigerJet NetworkEndaceBelkin ComponentsARC LogicINVALID VENDOR IDunknown "%s %s" (class %s subclass %s, rev 0x%02x) rev 0x%02x,|11z3ʍ1:|1A|1G11k1,|1ЀE|1N|1Y|11z1^|1g|1,|1Ѐ1}|1\1,|1Ѐ|1I3|1,|1Ѐ̲2?z/,|1Ѐ|1160|11U1|11|1|1 |1 ,|1Ѐ51|1|11|1|1,|1ЀY.|1}1}1}1,|1ЀX3 }1*}1V10}1,|1Ѐ:}1,|1Ѐ(1,11B}1H}1 P}10U}1@1b}1m}131q}1K1|1}1}1}1 }1}1}1}1}1}1 }1!,|1Ѐ}11I3}1f.}1}1,|1Ѐ ~1~1#~13~1 ,|1Ѐ>~1 1J~1`1W~11?"3`1_~11>,/13 1j~11y~1 1Ѐ~1 1І~1 1X}1 1Ћ~1 1Ж~1 12n11П~11Ю~11е~1@1к~12h~16h~1rh~1%i~13i 1ri1q+1q;1#rK1з[1зa1зg1'1з1з1з31з51зE1зUP1зWP1зWQ1зWR1зY1зPY1зQY 1зRY1з`-1з`@1зU`T1зV`e1з`ew1зbe1зce1зde1зee1зFv1зpw1зр1зՀ1з1з1з1з1з +1зP<1зQM1зU^1зVp1зX1зZ1з1з1зЁ1з߁1з1з1з1з1з"1з/1з<1зH1зR1з ^1з j1t1{111 1==1==1==1==1==1==1==1== 1== 1ʂ1ʂ1܂1111й1йP(1йE41йH1йD1ЪU1ЪQ f1ЪBXo1Бx1Б1Б1Б1Б 1Б1Б1Б 1Б01Б@Ƀ1БP҃1܃1113@`13@ n13@p1%51йE1йI"1йQ,1йa61й@1й!J1й#T1й1^1й3h1й5r1йC|1йA1й!1йG1й 31йR1йR1й)RĄ1й7Rӄ1йGR݄1йCR1йQT1йWT 1йq1 %1 +11171xD1x!M1`8[1xPf1xUo1Yx1Y1u`1x`1xa1xp1xq1xr1xsʅ1xtӅ1x܅1x1x1x1x1x 1i1x$1-1;1I1V1d1r11P1Q1_11̆1ֆ11111 1d1e1d&151C1S1d1s11S11111·1އ1111 1#1%"1'.12:15I1.BW10Bh1B"dw1B$d|1Ю1Ю1Ю3Ю3;1;1;1"1"1"҈1"1" 1" 1" 1"@ %1"061"pD1"pO1" p[1" pc1"po1"pw1"t1"t1"t1"t1"t1" t1" t1" t1"t̉1"tԉ1"t܉1"t1"t1"@t1"At1"Ct1"Et1"Ft!1"Ht+1"It71"Pt?1"QtI1"TtZ1"Utk1"Xtt1"Yt~1"`t1"dt1"ht1"it1"jt1"ktŊ1"mtϊ1`ي11`15 11D/&1T!81k?1kF1kI1kO1kX1kc1km1k31k s1k!}1k"1k$}1k%1k&1k'1k(1k)1k-1k.1k/1k0ʋ1k1ڋ1k2}1k31k41k51k61k;1k>1k?&18318;131푠D1홠K1R1Y1[`1Cuz1P1o1PA1QA1RA1XA1pA1rAʌ1BB݌16C17C1AC1BC1EC"1GC-1HC-1LC71SCE1TCQ1XC[1aCe1pCq1qC}1rC1sC1tC1uC1wC1yC1zC1ICÍ1iC΍1vCٍ1TE1BG1DG1IG1LG 1MG1NG1OG)1PG31QG=1RGG1SGO1TGY1UGc1VGm1WGw1XG1YG1ZG1fI1nI1BL1DLŎ1ELώ1FLڎ1GL1IL1ML1NL1PL1QL1RL#1SL,1WL61YLL1ZLb1fLx1FM1LM1DN1JNɏ1HN؏1PN1dN1hN1DP(1FP81RPB1DQN1EQY1FQc1GQm1LQw1MQ1NQ1OQ1WQ1YQ1ZQϐ1lQܐ1ER1FR1GR1KR1LR1HS'1KS31LS?1MSK1NSW1FT`1LTp1RT1TV1UV1VV11X13X15XΑ18X1@Y1AY1PY1TY*1UY<1`YO1aY_1bY_1dYk1tY*1uY<1?Z~1AZ*1BZ<1aZ*1bZ<1`[1b[1d[1p[1r[1t[Β1a\ߒ1c\1D]1p1p(121<1PGF1C[1Ќi1Ќp1Ќp1Ќw1Ќ~1Ќ1Ќ1Ќ1Ќȓ1Ќۓ1Ќ1Ќ1 1 111#,1#41@#<1@#D1@@L1P!T1D d1Do1D1D1Й`1Й `1Ѐ즔1Њ1Њ1Ы1ЫVĔ13ɔ1D3E3FҔ1G3Hڔ1I1M1S3T1X1Y 1]1^1h)1j#3k21n;1v3wD1|L1}U1~^1g1o1w11111111•1˕1 ԕ1 ޕ11 C1"C1$C13C]1D1X1X1X1 X1!X1"X$1#X)1ОP.1ОQ41Оn:1Оo@1ОxF1ОyR1Оt^1K@j1K@y1K01tcsg1}1?1,1,1,1,1,Ö1,ɖ1,ϖ1,Ֆ1,0 ۖ181111 11!1+151?1I1S1e1w111`1`1`1`ȗ1Е@ܗ1ЕB1ЕC1ЕF1ЕG1ЕH1ЕI 1ЕP1Еp1Еs%1Е-1Е151Е1B1Е5O1Е@\1qNCg1 p1601x1 x1201301401@x1p@1@1@1@˘1@ܘ1@1@1@ 1@!1F21 p31C1󠎹1T1`1m1)1+z121314151@1Cљ1i1l1m11 101`$1x;101PT1a1 i1z1316111C$1/1x1t1rǚ1q՚1Ѐ1Ѐ1Y1Y1Y)1Ќ41A1S1A1g1@1p~1p1p~1811Λ1כ11111#1<,1x41x<1xD1xQ1xa1xl1x1Ђ1Ђ1Ђ 11111ɜ1 Ϝ1 ՜1ڜ1111 11!#1"11#?1$P1%^1&l1Fz1e1(1(1(1(1(1( 1(1(ɝ1(ٝ1(1(1(1(1(1(1(!1`1 n1В1І1І1І@1І31І@1ІC1ІK 1ІK)1ІL41D=1D1DM1D]1Dm1X|1J1u1111#֞1H1115I1 6%1.BW10Bh1>B41$E1tqU1tP`1tXi1]p1]h}1]i1]x1]1]1]1]ß1]П1](1]8(1]( 11+1<18I1'R1'^1k16u1Ы1Ы1Ы1FP1p1г1<1<Π1<ܠ1< 1<(1<) 1<0#1<1*1<H11<TG1<W1<e1<1<1<1<)1<*1<.ġ1<֡1<21<#21<%21<121У01У51У:1У?1УD1УS1УX1У]1Уb1У g1Ј3ɑ1Ј31Ј31 1q11 11111 1"1.ɢ16Ӣ1>ݢ1W1p111OI" 1P71`I1]1f1o1 !x1 "1I1І1І91І 1І 1І)1І*1І,1І0ã1І2ԣ1І@1ІA1І1І1І1І!1І-1ІG1ІG1І` P1Іb `1Іd p1І1І1І1І1І1І Τ1І 1І 1І 1І!1І61ІK1І`1Іu1Іu1І 1І1І1І1І1ІХ1І1І1І&1І'1І(.1І)C1І0T2І1K1І2K1І3V1І4V1І5a1І6a1І7a1І8V1І9K1І:K1І;V1І<V1І=K1І>V1І@q1ІC|1ІH1ІPK1ІQK1ІY1Іd1ІhĦ1Іuڦ1Іv1Іw1Іx 1Іy51ІzJ1І{_1І|t1І51І1І1І1І1І1Іɧ1І1Іɧ1І 1І!1І01І11І2ɧ1Іaا1І 1І"1І#1І&1І'1І(1І)+1І-11І.91І0E1І4Q1І5c1І7x1І<1ІK1ІP1І`1І`1Іaʨ1Іbڨ1І`1І!1І#1І$ 1І01І1!1ІH+1І$B1І$N1І$Z1І$f1І$t1І$1І$1І $1І!$1І"$1І#$Ʃ1І%$ԩ1І&$1І($1І@$1ІB$1ІC$1ІD$1ІE$(1ІF$51ІH$C1ІI$W1ІJ$]1ІK$j1ІL$v1ІN$1ІY$1І]$1І$1І$1І$1І$1І$Ȫ1І$٪1І$1І$1І$1І$1І$1І$1І$)1І$1І$71І$D1І$1І$R1І$_1І$k1І$1І$x1І$1І$1І$1І$1І$1І$ī1І$1І$ի1І$1І$1І$1І%1І%1І0%1І1%1І2%1І3%+1І4%+1І5%+1І6%+1І@%91ІA%H1ІC%S1ІD%S1ІE%S1ІF%S1ІG%S1ІH%S1ІL%]1ІP%l1ІR%{1ІS%1ІT%1І`%1Іa%1Іb%1Іp%̬1Іq%1Іr%1Іs%1Іv%1Іx%-1Іy%91І{%D1І%S1І%b1І%q1І%1І%1І%1І%1І%1І%1І%ѭ1І%߭1І%1І%1І%1І%1І%"1І%/1І%=1І%I1І%U1І%a1І%=1І%n1І%1І@&{1ІA&1ІQ&1ІR&1ІS&1ІX&1ІY&1ІZ&1І[&1І\&1І`&Ǯ1Іb&Ǯ1Іd&Ǯ1Іf&Ǯ1Іh&Ԯ1Іj&1Іm&1Іn&1Іo&1Іp'1Іq'"1І'߭1І'/1І';1І'H1І';1І'Z1І'Z1І'Z1І'Z1І'Z1І'f1І'f1І'f1І'f1І's1І'1І'1І'1І'1І'1І0ů1І2ԯ1І@3߯1ІA31Іu51Іv5 1Іw51Іx521І5D1І5T1І5d1І5p1І51І51І51І51І51І51І51І51І51І51І5˰1І Bְ1І!B1І#B1І$B1ІR1ІR#1Іp21Іp>1І pJ1І0pV1Іq^1Іqm1Іq1Іq1Іq1І q1І!q1І"q1І#qƱ1І$q۱1І%q1Іq1Іq1Іq1Іq1Іq 1Іq1Іq1Іq,1Іq:1ІqF1ІqR1Іq^1Іql1Іql1Іqx1Іx1ІĄ1Іń1Іʄ1І˄1ІIJ1І߲1І 1І! 1І"1ІA)1І81ІRH1ІTY1Бm1Б~1Б1~1`r81`s81`w81`81`8Գ11 @1a1a1Ѓ1Ѓ01.01v"1v'1v#1v+1/1;1;1;1]1]1 ;1!;1G1G1]1]1]1]1X1S1S1a1}q1}fx1Д17217d1717 1Э1Э1Ыô1@ȴ1Aմ1Bմ1Cմ1Dմ1Eմ1Fմ1Gմ1Hմ1Iմ1Jմ1Kմ1Lմ1Mմ1Nմ1Pմ1Qմ1Rմ1Sմ1Tմ1Uմ1Vմ1Wմ1Xմ1Yմ1Zմ1\մ1մ1ݴ1X31X1X1X1Ї 1z1112*1%51ж=1жU1жq1ж1ж1ж1ж =2ж 1ж ݵ1ж1ж1= 1Ы1Ы1Ы C'1Ы@C2ЫAC2ЫBC2ЫCC2ЫDC2ЫEC2ЫFC2ЫGC2ЫPC,1ЫQC71Ы`CB1ЫaCM1ЫbCX1ЫPc1+r1+1+1+1+=2+ ˶1+!ض1+%1+ 1+1+1++ 1+y!+1+'%>1+K1+b1+y1+1+1`1a11Ʒ1кԷ1к1W1W1WV1WH 1ГA1Г@1ГA!1Г*101i<1iL1i\1i l1iP|1iV1C1111YԸ10۸111 1 1  1 31  1 "+1 ?1 J1 U1 `1 m1 z1 1 1 1 Я135313F13t13}1313313XĹ13<ҹ11111+1=1%O1a1s11ЅA1Ѕ b1Ѕ c1151E1`Qw0111˺1޺11 1JP1 1111111 1!1011121415161P1Q1R1 1 1 1 1 1 1 1! 10 11 12 1@ 1A 1B 1P 1Q 1R 1` 1a 1b 1 111$1+121;1 B1 K1 R1 Y1`1g1o1 w1!1011 1!1"1#1$1%1`ي11û1 ӻ111 1txN1,1l81l0D1] #X1]9#d1]=Is1]HS11 1 1(1)1,1-17Ǽ18Ǽ1PѼ1QѼ1Rݼ1S1T1U1V1W1Y1Z,1[,1\81]H1^U1`a1dm1e{1f1g1h1j1k1l1m1nʽ1۽111 11)1:1K1 1_1p1}11111 1ľ1ľ1о11 1ݾ1111#151 1E1U1f1w11111ǿ1ο1ڿ111@1A1P1Q,1R81SG1pS1qc1rs1t1u1v1x1y1z1{1|1 1131H1Y1i1u111111111111 11'121=1I1U1U1U1U1U1U1]1t1}111P1Q1S1X1Y1[1 11"/1$?1&R1)?1Cb1Ht1N1Ѝ1Ѝ1Ѝ1Л!1EWū1EXŷ1Eh1Eh1E!1E1E1E"1Ea111 1 1!1@11"1'1,1 1181=1B1G1 V1B`1Myxg1fy1f1f1f1f 1f1f1f1f1f1f1f1f1f1f1f1f&1f/1f/1f 81f!F1f%O1f'X1f0a110qi1fq1fz1f1f1f11Ѕ1еv1еw1еP1е1ZS1Z3M1Z8M1Z8 1Z0 1Z0M1ZhM1Zhb1ZiM1Zib1Zu1ZuR#1Zur,1Z351Z3>1Zq3G1Zu3P1Zv3Y1Zw3b1Zs3k1Zr3t1Zf}1Z&f1Z)f1Z f1Z!f1w1w 1w"1w1w1w@1w1w!1w"1w#1w#1wc1И 1И111)%1)*18/191i41910Ѐe>1ЀfL1ЀuZ1Ѐvh1Ѐwv1Ѐx1Ѐ!1ЀQ1ЀR1z 13S1V13S13S13S13S13S13S=13S13S13S13Sˆ'13SÈ013SЈ913SшB13S҈K13SӈT13S]13Sf13So13Sx13S13S13S13S13S13S13S 13S!13S"13S%13S13S13S13S 13S13S#13S.-13S913SA13SK13SY1ЮAd1}m1H@Y|1HC1H C1HD1H1H1Щ 1J1J 1J1JF1d119191919 1919 19+19619?19H19Q19_19 19d19t19{1919019@19P1919 19019319519@19E19F19H19P19Q19R19U19X19a 190193195%19@19A-19E519F=19HE19PM19Q19RU19U]19`e19 m19a ~19b 19c 19d 19e 19U19U19U19qU19U19U19U19U19U19b19b19c19c19%c19&c190c 19p19p$19p-19p;19pE19pP19pb1иm1иx1и1и1o1o1o 1o1o1o 1o 1)1)1)BI1) a1M %1M971MH1Z1Ўf1ЎK/Ўq1Ў1Ў1Ў31Ў+1ЎP1ЎTT1ЎUT1Ў1Ў1Ў1Ў1Ў1 1#1! 1 hq1 hr#1н4)1В71В1b<1ЭN1ЭU1Э\1N1Эec1=!n1=!z1)܏1 i11;'1;41;51L1L=1L=1L1L 1L)1L:1LK1L ^1L!q1L#1L$1L&1L'1L)1L*1L+1L.1L61L8>2L&1L.1Lf61L=1LM1L\1Ll1L|1L1L1L1L1L1L1L1L 1L! 1L#1L(-1L@=1LAM1LB]1LDm1LF}1LG1LH1LI1LJ@>2LK>2LL>2LP1LQ1LR1LS1LT1LU 1LV1LW-1LX=1L`M1LY1Yi1w1/ 1/ 1//1y1y1y1y 1y1y1y1y 1y1y,1y11# 61# @1#J1# X1#j1# x1#1# 1# 1# 1#P1#`1#1#1#1# 1#@ 1#%1#`1#(1#21#P<1#PI1#V1#_1m1|11111В1 21 21 21 21 21 G1`#1`01`=1`J1`]1`f1`:gm1`v1`j}1`1`1`1`1`1`莹1`1`11й116I1а1а1а` 1а`1$1/1;1G1N1aW1q`1vm1y11111111111& 11#1$1q11>1"$180L1@0Y1C0h1D0v1P01Q01S01W01X01Y01e01h01t01010 1111!11,11<11Q11\1Yg1Yq1Y"~1Y21YB1Yr11111"11#11G11H11I11w111$1112 1'212$1B$1an1r"1r$11-1581C1N1]1h1u111111h111111 11!1)11191 A1 I1 Q1 Y1 a1i1s1}11111111111111 1!1"%1#01$;1%F16Q17[18e19o1:y1;1<1=1>1?1f1g1h1i1j1k1m1n1o111#1-171A1K1U1_1i1`s1a}1111111 1 1111111Э 1Э1&1,121<1F11P11W12^1Bh1q1J1Px1P@1P@ 1Pe1P1PZZ1Pf1J1]1]1] 1]1]1s1s 1s 1s1s 1s 1s 1s#1s'1s 1Г+1801а @91W`1 a1=E1pU1u_1h1o1}1111 . 11VT11T111"4 1#1%1(1)1+1,1/1316"1901<41BD1CR1DZ1E^1Hc1Jh1Kt1L}1M1N1P1W1Z1]1`1a1f1i1k1s1t1w1x 1} 1~1Ѐ&1Њ:1Ѝ?1Ў1БF1ВQ1Еd1Иs1О1Щ1Ъ1Э1д1е1ж1з1иP1й1к1н11 111$1-1@1G1N1i1y111111111W 1 1 1111 1'11#18+1<31B;1HR1Yc1]j1fq1y1Ѐ}1І1Ќ1Б1Г1Л1Ы1Э1а1н111111$1/161?1X1a1r1?w1D~1Y1[1]3`_0l1o1t1y" 1z1Ђ1Ѓ1Ѕ1Ї1В1Ю1й11!1(1/1>1J1JO1MX1q^1vc1Ѕm1Гu1Дz1У111111 111=1O1a1й11111 1111$121$B18F1;N1bW1В^1Ыc1Эm1t1а181`1}1Ќ1Ы1Ю1171 1;k3T1}1Й1г1 1111"1Ј3)1==.1@13@61OI>1JY1FP`13S1tcg1ІH1J1.1s1s1{11'1Y11Ѐ111Smart 100/16/4 PCI-HS RingnodeMGA Millennium II 2164WA-B AGPPCI6515 CardBus (Smart Card mode)PCI7610 CardBus (Smart Card mode)PCI7[46]10 CardBus (SD/MMC mode)PCI7[46]10 CardBus (Memory stick mode)%svendor 0x%04x product 0x%04xvendor "%s", unknown product 0x%04xunknown class 0x%02x, subclass 0x%02xclass %s unknown subclass 0x%02xcy82c693_initcy82c693_readcy82c693_writecy82c693_init: bus_space_map failed (%d)>%s: unable to allocate bus-specific data %s: Enabling 39Bit Addressing : couldn't establish interrupt%s: Using left over BIOS settings %s: External SRAM, %s access%s, %dbytes/SCB %s: PCI error Interrupt at seqaddr = 0x%x %s: Data Parity Error Detected during address or write data phase %s: Signal System Error Detected %s: Data Parity Error has been reported via PERR# %s: Latched PCIERR interrupt with no status bits set RAID functionality unsupported adapter at unexpected slot %d unable to map to a channel , parity checking enabledfastslow%s: Received a Master Abort %s: Received a Target Abort %s: Signaled a Target Abort PCI bus mode unknownPCI-X 101-133MhzPCI-X 67-100MhzPCI-X 50-66MhzPCI 33 or 66Mhz%s: unable to map registers Unable to read SEEPROM DFF0DFF1OVLYCMCMSITARG%s: Receive overrun in %s %s: Count not complete in %s %s: PCI error Interrupt %s: Signaled Target Abort %s: warning: can't find PCI-X capability %s: unknown memory type: 0x%x %s: couldn't establish interrupt%s: Primary Auto-Term Sensing failed! Using Defaults. %s: Secondary Auto-Term Sensing failed! Using Defaults. %s: Unable to set termination settings! %s: Received split response in %s. %s: Received split completion error message in %s %s: Split completion data bucket in %s %s: Split completion address error in %s %s: Split completion byte count error in %s %s: Signaled Target-abort to early terminate a split in %s %s: Data Parity Error has been reported via PERR# in %s %s: Target initial wait state error in %s %s: Split completion read data parity error in %s %s: Split completion address attribute parity error in %s %s: Received a Target Abort in %s %s: Received a Master Abort in %s %s: Signal System Error Detected in %s %s: Address or Write Phase Parity Error Detected in %s. %s: PCI Split Interrupt - PCI-X status = 0x%x %s: Unable to attach to unsupported chip revision %d %s: readcfg failed - see dpt(4)  %s: unable to map device registers adv_pci_attach: adv_init failed %s: couldn't establish interrupt %s: couldn't map interrupt AscIsrQDone: Corrupted SG list encounteredAscIsrQDone: Attempting to free more queues than are activeAscIsrQDone: completed scsiq with unknown statusAscExeScsiQueue: Queue with QC_SG_HEAD set but %d segs.AscExeScsiQueue: Queue with too many segs.QUANTUM XP343011071HP TDC 36NEC CD-ROM DRIVE YAMAHACDR400 #$sH6s#6@6 PH#6`OH#6`bF M#asM΁3swO 33i`J`c,c<3 #hM #h##acj3 Nv3 6-3PNPDF##Ɓ#a Jac6-3#hW`愀#愀sKa O#AObHFV#s)Bg#sw2|<LزjNgc-xfjn3|P`P##< #%aOo##$+fj 3cCM #a15l8?#a31 5 9=~-   x33|`B~`)1`C~"X<\"3%|>`> 3B~#:nl8?B~B؃|3/B؃|ă3&8+26##k#c 3|`  k#c-<4830| ` 3 #b cZ3cd# v3 3B##"#"(#"#"B#JaE#3 bG# 3 bC##D#sM3'##&KOO"va F$Hڀ#4#Ja@#AK`#I0I`w#]b#c3-c#Ja#APb#Ac̆_+gcz|#hH##c|#cJa6#Ac37 #c`c#|ocKARaN#Ac3 b#Acg#cc#|gc3@ bcc|+@c|@cC|g@c|#c3*c +3)Ccކ3 bڀc|{c3, .c,|3=gc D|#acrqpcrppqrqppcrppqrqppc##3H#HCڇ#c nCvwc nCvwc#tC@Dt$&$scuZF&JudNsc{cv3>gcc8+8+2 1 c26:>c26:>c8+@2@6@:@>cZ @]cs #ss#f ##bswhA###BT+#%' %s: unknown model: %d %s: adw_init failed@?@DDDDDD?DD%@UUUUUU?UU'$Ш$Й$Ш$Р$Ш$Й$Ш$Р$Р$Й$Р$Й$Й$Й$H( U 8TW > 2 @W<ln>W>"JTX0K 2>$<hjprtvxb ,.LUP(6G& I_CP P(b?(ZfCHlWH=iG&rI߉ MhC? ?rpn%2 \d"  .2a8 nfL:U_K2  oE2b,f{%2 2\"C,w TU Jj5 t7 c'ġ@ JO5@XPPDQQ RS @PP 9:J j*, TU OXDƐ VW RS@ 9: 8N J5*NeH\2*sݸtz"Caa E  h.$ aEa R, $ +vmmp^+35Z|ZtmgD ;'tgm  ! j fXD.c'@YYwT1U {|TUc'X8NyVhW8N# { |yVhW y9h: 5R1SXXYYm  5:U_/  91:w XXm#G  lAz3Dl9: QQ4t vZ z3B < "Z $Z  La;*Ne 2*sݸ""*e, %2H Թ"Cp}"0.ؼ}"0.ֱEBZxI8  DK TK(! @]>( 2Y-o)DK > > 4F> C J 5Y-og Y<*  > \aX P\ b J5 _\GA$pk(!_ABY) 717T<>E4<GKuWQV8 BDHF  @GAX IT* * Q>E4BHLMT!$ x,F v 2p< Gx,FB/-4 B6EH̰=u \o~ElDXt@v'*}0.H V0>#J"3+C+b 2~)+/y9h:w jr8NX&{1|w TU# { |$isX8NUU8NV1W@VV VW8NR1SVV RS jX@T1U,PPV1WDPPR1SPP91:@PP\$[+D0.!D/![n=D  y9h: U4U9: QQ[A[+%20.KK ;D%20.!D0. I`(I4EKE>x=nKE/(?(4^[]P P^+&\\%2D0.!DBXJ DJ /[? ?^+&\\e&r#r%^+lWH0V\lWH=0V\lWHlWH X P ?TH}}}|c' RSVWbJZtBH_`0.0. Y(I#bKd;xxUUb0,Vb d d(b` MNCV`lC"=MiiM`#M߉VX` & &&rI&&&I&rJ`DI;r^'/ Z#CE J5 B  Q EX B Q BI  Qqf`$f,/!qdXfX<0EH̰=u o~@$$  Yv'< J5-o8yhHU4Us  @IDsu BE Q @suNd$:E[Nd6N dH,NE hTizZt$ 4Z$&]$, ]$]$M 3}%e`W2-H U8T W ><2| @W>lntvT>W>zJUFv6kF2@G+ 8W$L[ 'xV4!, ֙ B,= ]M 8(AHIJFTGZCHDLEP + p+Y9X p pX,+=#Z09H" 5i OC JTX7/B+ FfsAX Tk+,O*WCwW'K @&ZHhe,H!" Fx'4K $p(m6{j,gWwWHt F Qdy*p(m6{jǁȃ$'@<;WN- - $31LDLQDHoLTkOy*HGb*2R oLTkHG@20M 6{d $-@\6+B[FYWwW1[  |Sl(1ZS V(Ng'H4H'V&!SJvIp%!%"%X H'&SM%9'"AM 6{d $(\(6A& SPK\ \(bE(Z vCHqWRCnA&S YxKE Evt'4 lt$ .     Bh80     lXPUzB  oE2iml'T4 Bl$K,V `aTZ7" 9 j*H@T[7@bPPDQQ ^_ @PP =>JZ*, `a[bDƐ ?@ ^_@ => . AYR z$ :ITWI}cXXJ:I;cYYWIWcJZf"bD.j*@YYV`)a W`}aj*b.<:?;@.<6!  :?;@:=;>7^)_XXWI}c 7P2  =)>V XXJ!A lA~6DlW=}> QQ5t ve ~6B < "e $e  XhM,N'  4,w$$,' 4< $Ktǁȃ$31ǁȃ'f $31߼NBe|I,  DU TU(# FfD( &d/s+DU D D 4FD CT 7d/s dB. D \hXPP V T7 P.oA$tp(#PABd+ 919HBDE5BGKuW]V8 HDHO FAAX IT. ]DE5BG+" !Y"/A9/Y8):Vif O4JH i~9.8 `: bC %//!"Y"~q$9sW][W]W!WxX" <0 VZr.<"b&)Vv `a!  %nwb.<UU.<?)@@VV ?@.<^)_VV ^_Z"b@`)a,PP?)@DPP^)_PP=)>@PP%r- L31#L2#rCL :=;> U5UW=}> QQrAr- 431UU ML 431#L 31 IQ(S5EUND|CKE2(E(5gr]\ \g- & 4L31#LBXJ LJ2rE Eg- &'&vH !v{g- qWR0V\qWRC0V\qWRqWR X \ ETR}}}|j* ^_W?}@JZ BHPQ 31 31 Y(S!iUkM|0xUUi0mVi d d(i` YzBCVTqC@\CMnznMz̈Q!MVXQ  &  & &vI  & & &I &vJ Q"HIMvg'H'.2 R!K"NT7 H  ] EX H ] HLI L ]ul`$l,/#udXfX<0G> ^WWTb Z>@V\ lnUWXJ@>X D LNJ0 <$<hjprtvx| 2nH:UW[ p08DLW@\M] 2346 Ny< h : @PJNTX YH i \  46BD8DD EHFHhTUY1 K"&`zjh  ` 548W$Le 'xV4!7} J} Q7=  gMx(>"HIJFZG`CNDREV "5_ 5G \ \X"7*5= +Z0G"!, 1i",` ,b aJDVQ5 W 6AX T{57`0WCwW'K @*&fTtFp7HF (&! Wlj*2/*<A )$cBpF7}gWwWHu W  wP@0cBpי؜*)/NJ~WT22)'%LDXPDH4LT{`0NHG| (2C h&4LT{NHGT (C @ ( M B)2: B5B[}FYWwWG e   3  8pT8 XP^/*</&8JIq.!.".J H/8M. G' ($> M B)@f8>r 8$OVhAffpUh H.CHbXWR#?NbI>8E AUUo>8CHbE 8$6qxMbI>-N & A! XW*oo2_u/*< )  . v: 0|JxOG -(Hl ( oE2ScN|/~*< l)A$XXx j"k aTD!, w~G,z0?q@ aeD@ njPPDQQh"i@PPK"L TPj"k eN3  nDē: ƐƓy l"mh"i@: “y K"Ld"4 a$D7N/ H<7 B  B   )A$vv ]  t. v]v A, f r  +k#v##[[[[u^2B5ppt#[}xM!0w}[  +  T $!nG DBW W z0@YY@j;k"jkz0 nd4l~mDUUd4j&l~m $@K~L Dh;iXXYY[ $@ DxO: y C n   K;Ln XX[&>3   lAkBDlKL QQk#1v v#]#p B\ > "p $p  Jv$M7N/ * H<7))))72/> *AX IT^: gGF(E1QG5!, & | HU;bU1t8;:S6,`4bSG*8#:b ,V&! yGsW][W]W&Wω JN3  :3 *X0 xOE'%~'% '% '%i '%G8$1xS64?x81OE@Z#?IHbIqHbV@]EZCH-64@-644- 6Fc(ITHE?@V X@>-N !F$]&!~E!HE!DN&xEP  _II_JPtttIttJt It_! L IM_^'/>C "d& A! ] aD Z@   g  ]EX Z g Z~LI L g\|$(*(|,/+d$XfX$0Xz0z0E+G59u&~#6#4` V<BQ Z>AHEH?  L N@$VR  @0Qa(DV8~HU1U!  AH WID Z  g WN{R:E,N{dN {v$cNEhT#Ig H Z.4 Z.& 6.c 6. 6.B*/ *?3 3 3 3 3 3 G G G ,: y : y  : y <: 3 wf 2wK@K@BusLogic 9xxC SCSIunknown model!: unable to map I/O space : can't map controller i/o space : can't map interrupt : can't establish interrupt: %s %s``(((``  Dell 466v1Dell 466v2Dell 438(Dell 466v3<HP 438<HP T5/T6<HP T7<HP 466#ELSI 5232Intel SRCU42XAMI(Dell<HPLSIIntel: can't map controller pci space ami device dissapeared between match() and attach()AMI 428AMI 434%s %x64b/hlc64b/lhc32b %s/%s %scan't find mapping %s: can't map register window cannot map DPMEM cannot map I/O ports cannot write to DPMEM DEINIT failed (status 0x%x) unsupported protocol %d couldn't establish interruptinitialization error cannot map memory mapped I/O ports cannot access DPMEM at 0x%x (shadowed?) $`$/$$^$0@D.L21@D.V22@D.`23@D.q24@D.Є2@@2Д2H@2Х2P@2Ю2Q@2п2X@2Ҟ2FSMART-2/PSMART-2SLSmart Array 3200Smart Array 3100ESSmart Array 221Integrated ArrayRAID LC2Smart Array 4200Smart Array 4200ESSmart Array 431: %s Compaq %s %s: can't map i/o or memory space @p@`@@x@@@@@F<2<#2<%2<12: wrong BAR type : unfit config space : can't map controller config space w ww@wwww!w"w#w#wc: no mem for sdparam table 0$0$x$x$x$x$x$x$x$x$x$x$x$x$x$0$0$0$a$x$;$M$W$: can't find i/o space : can't find mem space ISR 0x%x SEMA 0x%xRISC2HOST ISR 0x%xcannot malloc xflist arraycannot malloc dma map arraycannot create dma mapsmailbox dma setup failureread towrite from%d byte %s %p in %d segsseg0.[%d]={0x%lx,%lu}seg%d.[%d]={0x%lx,%lu}Request Queue Overflow++PCI Status Command/Status=%x : unable to map device registers : couldn't establish interrupt at %s 0 !"#$%: mpt_pci_lookup failed : unable to map interrupt linking with peer: %s: unable to establish interrupt: unable to allocate DMA memory "##$%!%&&(''          V%%V% %V%V%1%Ё%$@%f%%% %Ё%% %Ё%%\ @@@@@@@x 8 %J %8 %8 % % %l %З %l %l %З %!%Ё% %{ % Y%Ё% %{ %%Ё% %{ %b%Ё% %{ % %Ё% %{ %%Ё%${ %T)%*%Ћ,%-%0%%+% % %)?%\"%\"%#%#%%%HUUDEC DE500DE450ZNYX ZX3XX SMC 9332DST 9334BDT 9332BDT 8432Cogent EM100TX EM100FX EM440TX ACCTON EN1207 EN1207TX EN1203 Asante COMPEX 400TX/PCI %s%d: transmission timeout (invalid EESPROM checksum), couldn't map interrupt Cannot find master device for de%d interruptstulip_txput: different mbuf dequeued!tulip_if_start: txput failed! tulip_if_start_one: txput failed! %s%d: %s%s pass %d.%d%s address %s : not configured; limit of %d reached or exceeded : not configured; 21040 pass 2.0 required (%d.%d found) de%d: not configured; 21140 pass 1.1 required (%d.%d found) : can't read ENET ROM (why=%d) (%s%d: %s%s pass %d.%d address unknown, couldn't establish interrupt%s: warning: couldn't establish shutdown hook YRYQYPY: can't find memory space! : can't map CSRs! : initialization failed fpa: can't find I/O base : can't map I/O space : couldn't create dma map : couldn't load dma map : couldn't allocate memory for card : couldn't map memory for card 16 bytes128 bytes112 bytes248 bytes20 bytesstore-and-forward108 bytesAm79c970Am79c970AAm79c971Am79c972Am79c973Am79c975pcn, %s, rev %d: %s, address %s %s: overflow error framing errorpcn_add_rxbuf20Љ220Г2Ĭ20Љ2Н2Ч20Љ2Н2# 00Љ2а2Ѐ20Љ220¬2̬2~%0$լ2~%!&߬2Н%#&2Н%$&2Н%%&2Н%'&v2/Н%%s: unable to map device registers : unable to wake from power state D3 : waking up from power date D%d%s: unable to establish interrupt%s: device timeout (txfree %d txsfree %d) %s: WARNING: chip failed to enter suspended state %s: packet spilled into next buffer %s: timeout processing init block %2K} }}}%}2> > >>> > > >>%+2>K}  }}}} } > > > >  >> ! >> >: broken match/attach! , using %dK of on-board RAM, can't map on-board RAM  @DHL  @DHL     &(`& 0&0 0 `"0 0  JtT4$   rq! 2r!qq! 0  S1B1SSA1B1B11qw!! RSQQP@064a2O%"O%0%p%q%Йq%$%!$%J$%K$%Њ$%Ћ$%$%$%$%$%$%Т%%У%%а%%o&%S&%Q&%R&%'%'% t|%t|%At|%it|%@%C%F%H%I%Ѐ%1$%5$%@$%1%qu%qu%I1%Г%U%Ѐ%Ё%Ђ%%m%)R@%%%%%%3M%8M%0 %0M%hM%hb%iM%ib%u%uR%ur%3Z%3Z%q3Z%u3Z%v3Z%w3Z%s3Z%r3Z%&&&& &%%%%&e&Ѕ&Ў%&&%S&T%U%= &yC$%zC$%2"@22 2$29@2 p2222f 2Z2`2 ػ22222CC @ @  "2"%Щ%Щ%%%%]G4" w! &&&&&,&,&pciide %s: device disabled %s: couldn't map %s cmd regs %s: couldn't map %s ctl regs unknown interrupt, (unsupported maptype 0x%x)channel 0channel 1%s: %s disabled (no drives) native-PCIcompatibilityconfiguredwired, %s %s to %s: DMA (unsupported), (partial support): no DMA%s: %s ignored (%s) %s: %s ignored (disabled) : ATA33: ATA66: ATA100: ATA133%s: %s %s to %s mode %s: port %d: PHY offline %s: port %d: device present, speed: 1.5Gb/s, speed: 3.0Gb/sport 1port 2port 3: unexpected PCI function %d , %s %s to native-PCI compatibility 630630S633635645645DX651652655658661733735741745746748755760962963: 5597/5598unknown SiS IDE type %d %s:%d: error intr %s:%d: bogus intr %s: no known timing values %s:%d: bogus intr (reg 0x%x) : couldn't map IDE registers : DMA %s: couldn't map native-PCI interrupt %s: using %s for native-PCI interrupt %s: couldn't establish native-PCI interrupt%s: unable to subregion %s ctl regs , unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers)%s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s:%d: unable to load xfer DMA map fordrive %d, error=%d %s:%d:%d: bus-master DMA error: status=0x%x %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x %s: %s cannot allocate memory for command queue%s: no compatibility interrupt for use by %s not responding; disabled or no drives?other hardware responding at addresses%s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers %s:%d:%d: multi-word DMA disabled due to chip revision %s: bus-master DMA support present%s %s: can't allocate memory for command queue: unable to map BA5 register space %s: port %d: device connected, but communication not established %s: port %d: unknown SStatus: 0x%08x : can't subregion offset %lu size %lu%s %s channel: can't allocate memory for command queue%s: couldn't subregion %s cmd base %s: couldn't subregion %s ctl base %s: couldn't subregion %s channel cmd regs , (unable to map ctl registers): cannot allocate memory for command queue %s: unexpected PCI function %d : couldn't establish native-PCI interrupt: couldn't map bus-master DMA registers %s: channel %d: can't allocate memory for command queue %s: couldn't map channel %d ctl regs %s: couldn't map channel %d cmd regs %s channel %d: can't subregion DMA registers ppbpci at %s%s: not configured by system firmware : can't map io space 3@``l)9: failed to enable i/o ports iYC%s: chip is is in D%d power mode -- setting to D0 : neither i/o nor mem enabled vr: failed to enable I/O ports : failed to find i/o space : failed map i/o space %s: can't alloc list %s: rx error (%02x): crc error frame alignment error FIFO overflow received giant packet received runt packet system bus error rx buffer error%s: rx shutdown error! %s: tx shutdown timeout %s: restarting %s: rx packet lost %s: receive error (%04x) no buffers packet lost%s: Using force reset command. : could not establish interrupt%s: initialization failed: no memory for tx buffers C0ae01S0 3@ 245C@P0L:F&WF&kF&sF&|F&`F&ГF&ЩF&%s: failed to send address, status: %x %s: failed to send write command, status: %x %s: adapter check: %x %s: network status: %x %s: got a dummy interrupt %s: bogus interrupt type txpfailed chip init : can't map mem space %d %s: reset hung not waiting for host request 3c990TYPHOONfirmware invalid magic fw wait failed, initial not waiting for boot loaded firmware, fw wait failed comm0 fw not waiting for segment fw truncated section %d %s: error 0x%x can't allocate boot record can't allocate host ring can't allocate high tx ring can't allocate low tx ring can't allocate high rx ring can't allocate low rx ring can't allocate command ring can't allocate response ring fw not running %s: no free cmd descriptors %s: 0x%x command failed %s: response error: id 0x%x %s: hello %s: unknown id(0x%x)   : failed to enable bus mastering : failed to enable memory mapping failed loadfirmware of file 3c990: errno %d fw invalid section address, section %d fw dma malloc failed, section %d fw section %d, bad cksum (expected 0x%x got 0x%x) %s: fw wait failed, section %d can't allocate rx buffer ring [cmd flags 0x%x num %d id %d seq %d par1 0x%x par2 0x%x par3 0x%x] [rsp flags 0x%x num %d id %d seq %d par1 0x%x par2 0x%x par3 0x%x] [data flags 0x%x num %d totlen %d addr 0x%x/0x%x pflags 0x%x][frag flags 0x%x rsvd1 0x%x len %d addr 0x%x/0x%x rsvd2 0x%x][unknown(%x) flags 0x%x num %d id %d seq %d par1 0x%x par2 0x%x par3 0x%x] Fv PQUVXZEUPU`V`%s: chip is in D%d power mode -- setting to D0 )0 I$567129:=PQdh348;<>Y)Y$]$'i82558i82559i82559Si82550i82551xv|w   &'(yz{u?&е&е&Џ&е&е&c&е&е&е&е&Q&е&е&е&е&Q&%s: Invalid mac address , address: %s %s: Unsupported media type %s: Unknown MAC Type : mmba isn't memory: can't find io space %s:CTRL = 0x%x %s:RCTL = 0x%x PS=(0x8402) %s: hw tdh = %d, hw tdt = %d %s: Std mbuf failed = %ld %s: Symbol errors = %lld %s: Sequence errors = %lld %s: Defer count = %lld %s: Missed Packets = %lld %s: Receive errors = %lld %s: Crc errors = %lld %s: Alignment errors = %lld %s: XON Rcvd = %lld %s: XON Xmtd = %lld %s: XOFF Rcvd = %lld %s: XOFF Xmtd = %lld %s: Good Packets Rcvd = %lld %s: Good Packets Xmtd = %lld %s: Allocation of PCI resources failed %s: Unable to allocate tx_desc memory %s: Unable to allocate rx_desc memory %s: Unable to initialize the hardware %s: EEPROM read error while reading mac address %s: watchdog timeout -- resetting %s: Could not setup transmit structures %s: Could not setup receive structures %s: The EEPROM Checksum Is Not Valid %s: EEPROM read error while reading part number %s: Hardware Initialization Failed%s: em_dma_malloc: bus_dmamap_create failed; error %u %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_load failed; error %u %s: Unable to allocate tx_buffer memory %s: Unable to allocate rx_buffer memory %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u %s: Adapter hardware address = %p %s:tx_int_delay = %d, tx_abs_int_delay = %d %s:rx_int_delay = %d, rx_abs_int_delay = %d %s: fifo workaround = %lld, fifo_reset = %lld %s: Num Tx descriptors avail = %d %s: Tx Descriptors not avail1 = %ld %s: Tx Descriptors not avail2 = %ld %s: Std mbuf cluster failed = %ld %s: Driver dropped packets = %ld %s: Excessive collisions = %lld %s: Receive No Buffers = %lld %s: Receive length errors = %lld %s: Carrier extension errors = %lld  (((((((((2222222<<<<<<<<<FFFFFFPPPPPPZZZZZZZZZddddddddddddddnnnnnnnnnnnnnnnnnnxxxxxxxxxx !#%')+ #%(*,/1368: #&),/257:=?BEGJ+/36:=@CGJMPRUXZ9>BFJMQUX[^adgjlINRW[_bfimpruwz|[`eimqtwz}lquy|M&r&&&r&&&&{&{&&&{&{&Є&Ѝ&П&Ѝ&П&б&б&Є&Є&Є&б&&&&&П&Є&&&&&&&&Ж&Ж&Ж&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&к&к&к&Ш&Ш&Ш&к&&&&&&&&&&&&&&Ш&&&&&&&&&&&&&&&Ш& & & && && & &r&r&r&r&&&&&&&&&&&о&&&&&&&&&&&&6&6&6&6&Y&Y&Y&Y&Y&s&s&s&s&&,'H'l','H'l','H''(':'L'^': %s,dc_pci_attach: unknown device: %x:%x $: waking up from power state D%d : unable to wake up from power state D3, reboot required. %s: failed to send read command, status: %x %s: can't load firmware: unknown hardware rev %s: firmware revision mismatch; want %d.%d.%d, got %d.%d.%d %s: no memory for jumbo buffer queue ti_jfree: can't find softc pointer!ti_jfree: asked to free buffer that we don't manage!ti_jfree: buffer already free!%s: board self-diagnostics failed! %s: unsupported chip revision: %x %s: cache line size %d not supported; disabling PCI MWI %s: bios thinks we're in a 64 bit slot, but we aren't%s: chip initialization failed %s: failed to read station address %s: jumbo buffer allocation failed tigon1tigon2%s: invalid command %s: unknown command %s: bad config data %s: unknown event: %d ti_jfree: buffer not in use!%s: can't create recv map overwritten!!!%s: unknown hwrev ti_setmulti: %s address %s %s: couldn't get mbuf%s: initialization failure not enough mbufs for rx ringF'ИF'ИF'ЏF'ИF'9F'FF'ЮF'ЮF'Ѕ b c Xq'ss'ss'Nr'ss'ss'Nr'Nr'ss'ss'ss'еq'ss'Nr'ss'ss'еq')@wOwxwyP@ & 4JPJ.0ne_pci_attach: impossible: can't subregion i/o space : failed to enable I/O ports! %s: can't map list data, size %d %s: receiver babbling: possible chip bug, forcing reset %s: can't alloc list data wbP@ %s: PHY failed to come ready %s: reset never completed DP83815C, DP83815D, DP83816A, srr %x,9 9p  : can't find I/O space ste%s: bad receive status -- packet dropped%s: tx underrun, increasing tx start threshold to %d bytes %s: no memory for list buffers! %s: initialization failed: no memory for RX buffers %s: global reset never completed vendor 0x%04x%s: init failed, error=%d : can't map memory space %s: pre-2.0 USB rev %s: timed out waiting for BIOS cbbcardbuspcmcia?V card, 0x%x %s: no bus space %s: overlapping windows %s: can't map socket base address 0x%x %s: can't map socket base address 0x%lx: io mode %s: BAD voltage request: no 5 V card %s: BAD voltage request: no 3.3 V card %s: bad Vcc request. sock_ctrl 0x%x, sock_status 0x%x pccbb_pcmcia_io_map iot is boguspccbb_pcmcia_io_unmap: window out of rangepccbb_pcmcia_mem_map memt is boguspccbb_pcmcia_mem_unmap: window out of range%s: pccbb_open_win: %s winlist insert failed %s: pccbb_close_win: %s winlist delete failed pccbb_winlist_delete: window 0x%lx size inconsistent: 0x%lx, 0x%lx 'Т'(((@(Ѓ(('((((((зqNCLKK7d CP@CACBCCCDCECFCGCPCQC`CaCbCHCH CHH 22  %s: bad VPD resource id: expected %x got %x %s: failed alloc of %dth mbuf %s: no memory for jumbo buffer queue! sk_jfree: can't find softc pointer!sk_jfree: asked to free buffer that we don't manage!%s chip is in D%d power mode -- setting to D0 sk_vpd_read%s: phy failed to come ready %s: phy write timed out sk_jfree: buffer not in use!%s: unsupported PHY type: %d %s: unknown device type %d sk port %c at %s port %c%s: unknown chip type %s: unknown ram size: %d %s: unknown media type: 0x%x SysKonnect GEnesisMarvell YukonMarvell Yukon LiteMarvell Yukon LPMarvell Yukon-2 XLMarvell Yukon-2 ECMarvell Yukon-2 FEMarvell Yukon (Unknown) rev. %s (0x%x) skcg(Ыg(Ыg(Ыg(8g(6g(зpwg(ЅAg(#g(3@pg(Ѐg(0g(1i(`s8mj(`r8mj(}mj(l0d(bd(: can't map local I/O space : bridge not ready : bridge timeout : failed bridge setup : can't find PLX I/O space : can't map PLX I/O space : can't map TMD I/O space %s: "%s, %s, %s": can't map command I/O space %s: no PCMCIA card detected in bridge card %s: trm_init failedpcscp%s: can't create dma maps %s: dma_intr: DMA aborted. %s: unable to allocate memory for the MDL, error = %d %s: unable to map the MDL memory, error = %d %s: unable to map_create for the MDL, error = %d %s: unable to load for the MDL, error = %d %s: error: DMA error detected; Aborting. pcscp dmaintr: DMA wasn't activedmaintr: discarded %d bytes (tcl=%d, tcm=%d) pcscp_dma_intr: empty esp FIFO of %d dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d %s: unable to load dmamap, error = %d : address: %s nge_jfree: buffer not in use!%s: failed to enable I/O ports! nge_jfree: can't find softc pointer!nge_jfree: asked to free buffer that we don't manage!nge_jfree: buffer already free!;;;DEFGHISnT]^hXYv|w~}jk HDp!3p,3q+73q)B3q)M3q)X3q)c3rr3@}3@3D3D33333 3 3 3 3!30 3030"30-3@83@C3@N3@Y3Ad3Bo3Pz3`3`33@333333 33%s: eeprom read timed out %s: PHY read timed out bge_jumbo_buf = 0x%08X bge_jfree: buffer not in use!BCM5700 A0BCM5700 A1BCM5700 B0BCM5700 B1BCM5700 B2BCM5700 B3BCM5700 AltimaBCM5700 C0BCM5701 A0BCM5701 B0BCM5701 B2BCM5701 B5BCM5703 A0BCM5703 A1BCM5703 A2BCM5703 A3BCM5704 A0BCM5704 A1BCM5704 A2BCM5704 A3BCM5704 B0BCM5705 A0BCM5705 A1BCM5705 A2BCM5705 A3BCM5750 A0BCM5750 A1BCM5750 A3BCM5750 B0BCM5750 B1BCM5750 C0BCM5714 A0BCM5752 A0BCM5752 A1unknown BCM5700unknown BCM5701unknown BCM5703unknown BCM5704unknown BCM5705unknown BCM5750unknown BCM5714unknown BCM5752unknown BCM5780pci_mem_find bus_space_map pci_intr_map pci_intr_string pci_intr_establish unknown ASIC (0x%04x)%s (0x%04x)bge_reset bus_dmamem_alloc bus_dmamem_map bus_dmamem_create bus_dmamem_load bzero bcopy mii setup if_attach ether_ifattach timeout_set bge_jfree: can't find softc pointer!bge_jfree: asked to free buffer that we don't manage!%s: can't alloc txdmamap_pool_entry dmamap NULL in bge_init_tx_ring%s: RX CPU self-diagnostics failed! %s: buffer manager failed to start %s: flow-through queue init failed %s: host coalescing engine failed to idle bge%d: failed to read station address %s: firmware handshake timed out %s: pcistate failed to revert %s: 5705 A0 chip failed to load RX ring %s: block failed to stop: reg 0x%lx, bit 0x%08x vge%s: MII read timed out %s: MII write timed out %s: soft reset timed out%s: EEPROM reload timed out %s: can't alloc TX list %s: can't map TX dma buffers %s: can't load TX dma map %s: can't alloc RX list %s: can't map RX dma buffers %s: can't load RX dma map vge_newbuf: out of memory vge_rxeof: SOF vge_intr: status=%#x DMA_STALL %s: unknown media type: %x 1%s: failed to idle MII autopoll %s: failed to start MII autopoll %s: setting CAM filter failed %s: tried to map a busy RX descriptor vge_intr: RX error, recovering %s: init failed: no memory for RX buffers %s: init failed: no memory for TX buffers stge%s: DMA wait timed out %s: Host interface error %s: receive ring overflow %s: excessive collisions %s: EEPROM read timed out stge_add_rxbuf6)6)#! =!=!!!@T!: unable to wake up from power state D3 %s: Tx packet consumes too many DMA segments, dropping... %s: transmit underrun, new threshold: %d bytes %s: EEPROM failed to come ready bce%s: unable to find mem space %s: transmit fifo underflow %s: receive fifo overflow %s: data error %s: descriptor error %s: general purpose timeout %s: unable to wake up from power state D3 %s: waking up from power state D%d %s: unable to alloc space for ring descriptors, error = %d %s: unable to map DMA buffers, error = %d %s: unable to create ring DMA map, error = %d %s: unable to create tx DMA map, error = %d %s: unable to create rx DMA map, error = %d %s: receive descriptor underflow %s: descriptor protocol error %s: unable to allocate or map rx(%d) mbuf, error = %d %s: timed out writing pkt filter ctl %s: timed out disabling ethernet mac %s: receive dma did not go idle after error %s: timed out resetting ethernet mac %s: while resetting core, reject did not set %s: while resetting core, busy did not clear %s: PHY read timed out reading phy %d, reg %d, val = 0x%08x %s: PHY timed out writing phy %d, reg %d, val = 0x%08x : couldn't enable memory mapping : couldn't enable bus mastering : couldn't make shutdown hook : cannot map register space %s: unable to establish interrupt : waking up from power state D%d %s`3: could not map memory space : could not map interrupt no bios: configuration mode %d (%s)pci_make_tag: bad requestpci_make_tag: mode not configuredpci_decompose_tag: mode not configuredpci_conf_read: mode not configuredpci_conf_write: mode not configuredpci_intr_map: bad interrupt pin %d pci_intr_map: no mapping for pin %c pci_intr_map: bad interrupt line %d pci_intr_map: changed line 2 to line 9 pci_intr_string: bogus handle 0x%xpci_intr_establish: bogus handle 0x%x%s: interrupting at irq %d pchb: bdnum=%x (reserved): Compatibility PB (bus %d): Auxiliary PB (bus %d) : rng active, %dKb/sec@0P0Q0W0: disabled CPU-PCI write postingisa at %sichpcib: PM disabled: failed to map I/O space$ $@$L$$$$$$@&%gscpcibhme%s: DMA buffer map error %d %s: DMA map create error %d %s: hme_stop: reset failed %s: rx allocation failed %s: XXXlink status changed %s: status=%b %s: mii_read timeout %s: mii_write timeout %s: DMA buffer alloc error %d %s: DMA buffer map load error %d %s: cannot accommodate MII device %s at phy %d, instance %d hme_config: can't establish shutdownhook%s: buffer overflow, ri=%d; flags=0x%x RXRCNTACNTCCNTLCNTRFIFOCVCNTSTST TX TFIFO MAXPKT NCNT ECNTLCCNTFCNTDTIMERXHOSTNORXDRXEEXLATERXPRXTEOPMIFTXHOSTTXALLTXETXLTXPTXTSLV SLVPUPCIR: could not map hme registers %s: using %s for interrupt port 0x%x iomem 0x%x drq2 %d%s%d: irq %d already in use >>> probing for %s* >>> probing for %s* finished >>> probing for %s%d >>> probing for %s%d failed pulsednoneedge-triggeredlevel-triggeredisaattach: can't map DMA controller #1isaattach: can't map DMA controller #2isaattach: can't map DMA page registersisaattach: can't map `delay port'>>> probe for %s* clone into %s%d %s: iosize not repaired by driver >>> probing for %s%d succeeded isa_intr_typename: invalid type %disadma%s: bogus drq %d %s: DRQ %d is not free isa_dmacascade%s: drq %d is not free isa_dmamap_create%s: drq %d is already free isa_dmamap_destroy%s: drq %d, nbytes 0x%lx isa_dmastartisa_dmadone: %s: bogus drq %disadmaattach: can not create DMA map%s: drq %d, nbytes 0x%lx, addr %p isa_dmastart: no DMA map for chan %disa_dmaabort: %s: bogus drq %disa_dmacount: %s: bogus drq %disa_dmafinished: %s: bogus drq %d%s: isa_dmadone: channel %d not finished isa_dmamem_alloc: %s: bogus drq %disa_dmamem_free: %s: bogus drq %disa_dmamem_map: %s: bogus drq %disa_dmamem_unmap: %s: bogus drq %disa_dmamem_mmap: %s: bogus drq %disa_drq_isfree: %s: bogus drq %disa_free: freeing unallocated memory isa_mappage: mapping unallocated memory kbc selftest: %x pckbc_attach: couldn't map%s: using irq %d for %s slot %s: unable to establish interrupt for %s slot {)8-(**u+,Щ,Ъ)80x25P 3R8)@)H)Ѕ)У)pcdisplay_init: cannot map memorypcdisplay_attach: display disappearedpcdisplay_free_screen: consolepcdisplay_init: cannot map iopcdisplay%s: can't map i/o space %s: bha_find failed 3.37%s: buggy VLB controller, disabling 32-bit DMA %s: couldn't establish interrupt %s: could not map I/O-ports(aha probe)isapnpahaccb%s: can't malloc ccb 1542C15401540A/1542A/1542B16401542CF1542CP: model AHA-%s, firmware %s ahawait%s: aha_cmd, host not idle(0x%x) %s: aha_cmd, cmd/data port full %s: aha_cmd, cmd/data port empty %d %s: aha_cmd, host not finished(0x%x) ahaattach: aha_find of %s failedshould call debugger here (aha1542.c)aha_find: illegal drq setting %x aha_find: illegal irq setting %x %s: unlocking mailbox interface aha_init: could not allocate mailboxt)б)б)б)б)б)б)б)б)б)б)б)б)б)б)б)})І)Џ)Џ)И)С)ST01 v1.7 (C) Copyright 1987 SeagateSCSI BIOS 2.00 (C) Copyright 1987 SeagateFUTURE DOMAIN CORP. (C) 1986-1989 V5.0C2/14/89FUTURE DOMAIN CORP. (C) 1986-1989 V6.0A7/28/89FUTURE DOMAIN CORP. (C) 1986-1990 V6.0105/31/90FUTURE DOMAIN CORP. (C) 1986-1990 V6.0209/18/90FUTURE DOMAIN CORP. (C) 1986-1990 V7.009/18/90FUTURE DOMAIN CORP. (C) 1992 V8.00.004/02/92%s: polled reselection was not for me: 0x%x %s: expecting IDENTIFY message, got 0x%x %s: target %02x lun %d not disconnected %s: timeout waiting for STAT_REQ %s: after successful arbitrate: no STAT_BSY! %s: !STAT_BSY unit in data transfer! sea: command aborted by target %s: sent message abort to target SEAGATE SCSI BIOS FUTURE DOMAIN TMC-950sea%s: board RAM failure %s: parity error %s: done? %s: resetting %s: can't malloc scb seascb%s: wrong state 0x%x %s: arbitration lost %s: arbitration timeout %s: parity error detected no data address! %s: message_reject received %s: unknown message in: %x sea: unknown phase %s: timeout in data transfer `&3%&3("*3"*3&3- '3.`'3/'3/'3. (3,5*3))))))))в)) )))))G))))б))#)Й)uha_attach: u14_find failed!u14_find: unknown model %x %s: BAD MSCP RETURNED! uha_attach: bus_space_map failed!u14_find: illegal drq setting %x u14_find: illegal irq setting %x u14_find: board timed out during reset %s: uha_start_mbox, board not responding should call debugger here (uha_isa.c)wdswdsscbwdsbuf%s: Is this an error? wds?%s: failed reset!!! %2x : version %x.%02x %s: reset! %s: DMA beyond end of ISA wdsattach: wds_find of %s failed%s: unrecognized interrupt type %02x%s: VENDOR ERROR %02x, scsi %02x %s: waiting for controller to become ready.%s: no request slot available in getvers()! %s: UIO is untested and disabled! %s: wds_scsi_cmd, more than %d dma segs %s: wds_scsi_cmd, I/O too large for bounce buffer %s: bad mbi scb pointer; skipping %s: couldn't map registers %s: can't allocate memory for command queue%s: can't create map for drq %d NE1000NE2000NE2000 (RTL8019)%s: where did the card go?! %s: %s Ethernet %s: can't subregion i/o space %s: couldn't establish interrupt handler %s%d: changing IRQ %d to %d : %s (%s-bit) %s: configuration failed we_write_mbuf: negative lenWD8003SWD8003EWD8003EBWD8003WWD8013EBTWD8013WWD8013EPWD8003EPWD8013WCWD8013EBPWD8013EPCSMC8216/SMC8216CSMC8216TSMC8416C/SMC8416BTSMC8416T    ()2)])P)])])])])])])])])])])])])])])])])])])])])])])])])])])])])])])F)<)W)^)Џ)Н)б)б)Ж)%s: can't wildcard IRQ on a %s %s: can't establish interrupt %s: failed to clear shared memory at offset 0x%x elink_reset: can't allocate state storagePP0 ***********%s: can't map nic i/o space %s: can't map asic i/o space %s: can't map shared memory %s: memory test failed ec_write_mbuf: negative len%s: 3Com 3c503 Ethernet (%s-bit) %s: wildcarded IRQ is not allowed %s: invalid IRQ %d, must be 3, 4, 5, or 9 egstart: no header mbuf: ROM v%d.%02d %dk address %s %s: configure card command failed %s: invalid packet size %d; dropping ep_isa_probe: can't allocate state storageep_isa_probe: can't map Etherlink ID port ep_isa_probe: ignoring model %04x ep_isa_attach: can't map i/o spaceStarLAN 10EN100StarLAN Fiber3C507EtherExpress 16%s: can't find shared memory *3COM*: address %s, type %s R%d %s: receiver not ready ietint: command still busy! %s: send aborted %s: late collision %s: no carrier %s: lost CTS %s: DMA underrun %s: too many collisions iestart: no header mbuf%s: tbuf overflow %s: abort commands timed out %s: TDR command failed %s: transceiver problem %s: configure command failed %s: %s does not have soft configuration %s: msize mismatch; kernel configured %d != board configured %d 3c507 probe: can't map Etherlink ID port %s: can't map 3C507 RAM in high memory %s: irq mismatch; kernel configured %d != board configured %d %s: maddr mismatch; kernel configured %x != board configured %x ieprobe mapped memory size out of range ieprobe mapped memory address out of range %s: receive descriptors out of sync at %d %s: disable commands timed out %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status %x %s: multicast address setup command failed %s: individual address setup command failed ex: invalid IRQ. : address %s, connecter TPE BNC AUI ??? ex: WARING: board's EEPROM is configured for IRQ %d, using %d BICC IsolanNE2100DEPCAPCnet-ISA%s: address not found %s: failed to clear memory %s: couldn't allocate memory for card No-maskable interrupt, may be parity error irq %d level %x mask mismatch: %x vs %x%s: isa_intr_establish: can't malloc handler info %s: isa_intr_establish: bogus irq or type intr_disestablish: bogus irq %dintr_disestablish: handler not registeredisaattach: ISA bus already seen!_isa_bus_dmamap_load_mbuf: not implemented_isa_bus_dmamap_load_uio: not implemented_isa_bus_dmamap_load_raw: not implemented/usr/src/sys/arch/i386/isa/isa_machdep.c; stopped loggingstray interrupt %d%s intr_alloc: bogus type%s:%d -- Already 0! clock_batteryROM_cksumconfig_unitmemory_sizefixed_diskinvalid_timeWARNING: NVRAM century is %d but RTC year is %d WARNING: Setting NVRAM century to %d WARNING: preposterous time in file system WARNING: invalid time in clock chip WARNING: RTC time at or beyond 2038. WARNING: year set back to 2037. WARNING: CHECK AND RESET THE DATE! WARNING: file system time much less than clock time WARNING: clock time much less than file system time WARNING: using file system time RTC BIOS diagnostic error %b clockrtcnpxnpxdna vector not initialized: using exception 16 npxintr from nowhererecursive npx trap; cr0=%x %s: WARNING: Pentium FDIV bug detected! : error reporting broken; not using npxintr: p = %lx, curproc = %lx, npx_type = %d pccomcomattach: io mapping failedcomattach: impossible: unknown uart : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, 16 byte fifo : st16650, no working fifo : st16650, 32 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: console comprm%s: %d silo overflow%s comcninit: mapping failed: xr16850 (rev %d), 128 byte fifo comattach: IRQ but can't have one*Ж*Х*Ь*г*Ѐ*׀**7*7*7*7*7*7*7*7**wsdisplay%s: screen %d added (%s, %s emulation) %s: screen %d deleted wsdisplay at %sdmux mux %d: console (%s, %s emulation), using %swsdisplaytty() on ctl devicewsdisplay_switch3: giving up wsdisplay_switch2: giving up wswaitwsdisplay_common_attach: no memorywsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared vt1006***Ф*Ͷ*в*4*4*4*4*4*4*4*-*A*o*#*#*#*\*ܺ**4*4*4*4*4*4*4*4*4*4*4**о*ʽ*ʽ*з*ʽ*ʽ*ʽ*ʽ*З*З*З*З*ʽ*Ф*Ф*Ф*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*А**ʽ*ʽ*ʽ*ʽ*s*|*ʽ*ʽ*ʽ*ʽ*ʽ*Ќ*Ѕ*ʽ*ʽ*З*ʽ*ʽ*ʽ*ʽ****U*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*^*ʽ*Ž*Ž*Ž*ʽ*ʽ*ʽ*v*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*в*ʼ*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*ʽ*ּ*о*Ц**4*4*4*4*4*4*4*4*4*4**4*4*4*4*4*4*4*4*4*4*4**4*'*4*4***r*վ*վ*վ*վ*վ*վ*վ*վ*վ*վ*վ*վ*վ*վ*Ј*Џ*в**վ*վ*վ*վ*վ*Ǿ*վ*վ*վ*y*վ*Џ*վ*в*վ*վ**վ*վ*Ф*վ*վ*վ*վ*վ*Н*Ж*վ*վ*վ*վ*վ*վ*Ы*й*Б*Б*/*Б*I**Ш*Ш*а*Ш*а*Ш*а*а*а*а*а*а*а*а*а*u*u*u*u*u*u*u*u*u*u*а*И*а*а*Р*Р*wsemul_vt100_output_c0c1: ESC in kernel output ignored [>24;20;0cP2$uP0!u%5\[?62;6c[%d;%dR[?13n[?21n[?27;1n*Я***д*й**о*****************************************M*V*C*C*C*C*C*C*C*C*Т*C*C*C*C*C*C*C*C*C*Ы*д***и*******************(*(*(*/*I*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*`*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Б*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*Ь*wsemul_vt100_handle_dcs: bad type %d  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~OPOQOROSOpOqOrOsOtOuOvOwOxOyOIOMOjOkOlOmOnOo[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOC9*Ы*Ы*Ы*D*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*Ы*O*Z*e*p*{*І*wsevent_readwskbdwskbd at %scannot load keymap: console keyboard%s: attach error=%d wskdet%s: event queue overflow %s: connecting to %s %s: disconnecting from %s wskbd_detach: %s didn't detach *Р*Р*Р*Р*Р*Р*Р*Р*Р*Р*Р*Q*Q*Q*Q*Q*Q*Q*Q*Q*Q*Q*Q*Q*Q*Q*Q*Q*Q*Q*Q*Q*е*й**** * * *(*(*(*Q*Q****** * ***s*$*2*G*s*s*s*s*s*s*s*s*s*s*+*ABCDEFGHIJKLMNOPQRSTUVWXYZ%*?*Z*o*Г*wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux_getmux: no memory for mux %d wsmux: attach out of memory +Ѝ++4+m+Ѓ+q3pckbdprobe: reset response 0x%x pckbd_enable: command error pckbd_disable: command error pckbd 1!2@3#4$5%6^7& 8* 9( 0) -_ =+! qwertyuiop[{]} as d!f"g#h$j%k&l';:('")`~*+\|,z-x.c/v0b1n2m3,<4.>5/?67*89 :;<=>?@ABCD E F G7H8I9J-K4L5M6N+O1P2Q3R0S.W X  / ,-.2"36&7/{ 8([ 9)] 0=} ?\ qQ@z+*'() +#',y2mM3,;4.:5-_V<>| '`+*~)^2"@3#4$6&7/{ 8([ 9)] 0=} +? |'()+'*3,;4.:5-_V<>\ '`|^~ +?\'()V<>| '`|^~ \'()|V<> \`^~&12~"3#'4{(5[-6|7` _8\ 9^ 0@ )] =+}az$q'm(%)+*,w2,?3;.4:/5!V<> 2"35%6&7/ 8( 9) 0= '? ^{[+*}]'@(#)\|+3,;4.:5-_V<> 1!2"34$5%6^7& 8* 9( 0) -_ =+('@)``+#~V\|2"6&7' 8( 9) 0 -= ^~@`[{';+(:*)+]}ps\_y{}\|1!|2"@3#4$~6&7/ 8( 9) 0= '? [+*]'({)\+}3,;4.:5-_V<> !1@-2_/3#;4$:5,6^.7& =8* [9( ]0) ?+' xX%eE{wW}!'(")`~+qQ|-34fF5\9 &1|2@"3#'4(56^7 !8 9{ 0} ) -_az[$*]q'm(%)+`,w2,?3;.4:/5=+~V<>\ `~)<> W  FE7JG7H8I9K4L5M6O1P2Q3R0S.-N, [{ ]}'",<.>pyfgcrl/?=+o e!u"i#d$h%t&n's(-_,;:-q.j/k0x1b3w4v5z:; <=>?@ABCDW X 6^6,7&7.qQwWeErRtTyYuUiIoOpP[{]}aAsS dD!fF"gG#hH$jJ%kK&lL';:('",zZ-xX.cC/vV0bB1nN2mM3,<4.>5/? 6^6,7&7. -_ =+qQwWeErRtTyYuUiIoOpP[{]}aAsS dD!fF"gG#hH$jJ%kK&lL';:('")`~+\|,zZ-xX.cC/vV0bB1nN2mM3,<4.>5/? 1+|2"@3*#46&7/ 8( 9) 0= '? eEz[!]'({) +$},y3,;4.:5-_V<>\ '? ^`~!]['({2"@3#6&7/{ 8([ 9)] 0=} '? <>+*'()\|+3,;4.:5-_V<> 1!2"3#6&7/ 8( 9) 0= '?\ qQ@+*~'({[)|+}]3,;4.:5-_V<> 1!2@3#4$5%6 =+[{'()'"+]}5;:S.V\|s/?2'3^#4+$5%6&7/{ 8([ 9)] 0=} *?\ -_qQ@I~'(i)"+,;345.:V<>| ''+,;`eEoOaAsS&lL,zZ-xX.cC1nN 1'~2"3+^4!5%6/7=` 8( 9) qQ\wW|zZiIQP!fF["gG]$jJ'$()0+qp,yY>-xX#.cC&/vV@0bB{1nN}3,?;4.:5-_*V< 1!~2"3#^4$5%6&7/` 8( 9) 0= '? +*qQ\wW|zZ!fF["gG]%kK&lL'()+,yY/vV@0bB{1nN}2mM3,;4.:5-_V<> 1!2"@3/4$5%6?7& 8* 9( 0) -_ =+oOpP[']';:~({)#|\+<>}2mM3,'4..5V ^^[](``{5 ]3O@_3 _3Z a3F`3`3Ga3Mb34 c3 `3 `3 `3 a3Ce3Kf3g3@# g3g3g3 g3g3H@g3 Jc3 [ e3g3i3Xj3 Pk3 hk3 Pk3Bk3i@d3G l3=l3W@m3 m30 n3 n3o3fp3q3fdcfdcresult: overrun (st0 %b cyl %d) fdcattach: couldn't map I/O portsinvldabnrmlseek_cmpltequ_chckdrive_notrdytop_headctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_damend_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_am (st0 %b st1 %b st2 %b cyl %d head %d sec %d) 1.44MB1.2MB360KB/AT360KB/PC720KB720KB/x360KB/x2.88MB1.2MB/[1024bytes/sector]: %s %d cyl, %d head, %d sec : density unknown soft errorstray interrupthard error@ +G +N +U +\ +c +Ы+J+Ѐ+q+/+Ж+3+++$+^+/+Ћ++/++%s: drive %d: unknown device type 0x%x ahc_isa_irq: illegal irq setting %d ahc_isa_idstring: BIOS biffed it at 0x%lx ahc_isa_match: irq mismatch (kernel %d, card %d) ahc_isa_probe: can't allocate slot markerahc_isa_attach: could not map slot I/O addressesahc_isa_attach: could not read ID stringahc_isa_attach: ahc_isa_irq failed!Adaptec AHA-284x SCSI (BIOS enabled)Adaptec AHA-284x SCSI (BIOS disabled)ahc_isa_attach: Unknown device type %sADP7756ADP7757aic7770 <= Rev C, aic7770 >= Rev E, slot %d%sdevice %s%s: can't map I/O space for slot %d %s slot %d not configured by BIOS? ahb%s: board not responding ADP0000ADP0001ADP0002ADP0400ahbattach: ahb_find failed!Adaptec AHA-1740 SCSIAdaptec AHA-1740A SCSIAdaptec AHA-1742A SCSIAdaptec AHA-1744 SCSI: <%s> %s: BAD ECB RETURNED! %s: unexpected interrupt %x %s: can't malloc ecb ahbecbself test failed, val = 0x%x illegal int setting %x should call debugger here (aha1742.c)ahbattach: could not map I/O addresses%s: couldn't map interrupt (%d) %s: ahb_scsi_cmd, more than %d dma segs k.+k.+.+.+.+.+.+.+.+.+.+.+.+-+.+.+.+.+.+.+.+.+.+.+.+.+.+.+.+.+{.+{.+]1+d1+k1+r1+Ї1+y1+Ѐ1+ahc_eisa_irq: illegal irq setting %d ahc_eisa_attach: could not map I/O addressesahc_eisa_attach: ahc_eisa_irq failed!Adaptec AIC-7770 SCSI (on motherboard)ahc_eisa_attach: Unknown device type %sADP7770ADP7771Adaptec AHA-274x SCSIDPT2402DPTA401DPTA402DPTA410DPTA411DPTA412DPTA420DPTA501DPTA502DPTA701DPTBC01NEC8200ATT2408HBA on invalid IRQ (%d) USC024UltraStor 24f SCSIuha_attach: u24_find failed!uha_attach: could not map I/O addressesu24_find: illegal irq setting %x u24_find: board timed out during reset should call debugger here (uha_eisa.c)D+C+zE+]E+D+܀33Ѐ333Ѐ333Ѐ33 3Ѐ333D.CPQ4001IDACPQ4002IDA-2CPQ4010IEASCPQ4020SMARTCPQ4030SMART-2/E: controller on invalid IRQ : can't map interrupt (%d) %s: Compaq %s TCM5090TCM5091TCM5092TCM5093TCM5094TCM5095TCM5098TCM5920TCM5970TCM5971TCM5972: can't map i/o space3Com 3C509-TP Ethernet3Com 3C509 Ethernet3Com 3C579-TP Ethernet3Com 3C579 Ethernet3Com 3C509-Combo Ethernet3Com 3C509-TPO Ethernet3Com 3C592 Etherlink III3Com 3C597 Fast Etherlink TX3Com 3C597 Fast Etherlink T43Com 3C597 Fast Etherlink MII: couldn't map interrupt (%u) eisa_intr_map: bad IRQ %d eisa_intr_map: changed IRQ 2 to IRQ 9 eisa_intr_string: bogus handle 0x%xeisa_intr_establish: bogus handle 0x%xPNP00A0ahaADP1502aicADP1520aicADP2015aicPNP0500comPNP0500pccomPNP0501comPNP0501pccomPNP0600wdcPNP0E00pcicSCM0469pcicAEI0218pcicPNP80D3nePNP80D4nePNP80D5nePNP80D6nePNP80D8lePNP80F7epPNP80F8epPNP8123wePNP8124wePNP8125wePNP8126wePNP8127wePNP8128wePNP812AwePNP81C3wePNP81C4wePNP81C5wePNP81C6wePNP81C7wePNP81C8wePNP8200lePNP8201lePNP8231lePNP828ClePNP828DlePNPB000sbPNPB001sbPNPB002sbPNPB003sbPNPB006mpuPNPB02FjoyPNPC000comPNPC000pccomPNPC001comPNPC001pccomCSI2203leUMC9008ne@@@1980neSMC8416weTCM5051efAWL4800an@P@0001joy@P@1001joy@P@2001joyAZT3001joyCSC0001joyCSC000FjoyCSC0101joyCTL7002joyESS0001joyESS0005joyOPT0001joyCDC0001joyASB16FDjoyESS1868essESS1869essESS1878essESS1879ess@X@1001mpuAZT2001mpuCSC0003mpuOPT0002mpu@@@2001sb@X@0001sbADS7150sbADS7180sbAZT1008sbCTL0001sbCTL0031sbCTL0041sbCTL0042sbCTL0043sbCTL0044sbCTL0045sbASB1631wssCSC0000wssCSC0100wssCSCA800wssOPT9310wssCDC0000wss@@@1001ymYMH0021ymMFRAD10rtAZT0500wdcCSC0004wdcCTL2011wdcESS0002wdc0123456789ABCDEF%s: Too many pnp cards "%s, %s, %s, %s"mem32(isapnp probe)%s: bus map failed: no cards found : read port 0x%x resource conflict %s: error in region allocation %s: card %d violates PnP spec; byte %d %s: Maximum tag size exceeded, card %d %s: No current device for tag, card %d Too many tag errorsResource timeout%s: %s, card %d : can't allocate memory for command queue efstart: no header mbuf%s: adapter failure (%x) PC/XTPCjrAT/286+PC/XT+PS/2 25/30PC Convertible, BIOS32 rev. %d @ 0x%lxPS/2 386+apmpcibios%s: ROM list: 0x%05x/0x%x%s:%d%s at %s function 0x%x: %s(%02x) BIOS, date %c%c/%c%c/%c%c܃+О+Е+Ќ+Ѓ+z+q+h+C+M+W+a+k+u+interface not connectedpower management disabledinterface not engagedunrecognized device IDparameter out of rangeNo pending eventsNo APM presentunknown error code?apm0: APM %s: %s (%d) get capabilitiesget eventpower management enableset power statesystem defaults faileddisconnect failed%s: disconnected apmlkapmev%s: dev %04x state %04x ioctl get power status32-bit interface not supportedreal mode interface already connected16-bit interface not supported16-bit interface already connectedunable to enter requested state32-bit interface already connectedapm0: APM engage (device %x): %s (%d) : Power Management spec V%d.%dapm0: flags %x dobusy %d doidle %d %s: failed to create kernel thread, disabledY+Ч+*+،+،++Ї+++e++،++: rev %d.%d @ 0x%lx/0x%lx [2][x][1]%s: interrupt fixup failed %s: bad IRQ table checksum %s: bad IRQ table size %s: no memory for $PIR pcibios_get_statuspcibios_get_intr_routingpcibios0service not presentfunction not supportedbad vendor IDdevice not foundbad register numberbuffer too small%s: %s - %s %s: PCI Exclusive IRQs:PIR Entry %d: Bus: %d Device: %d pcibiosprobe: 0x%lx:0x%lx at 0x%lx[0x%lx] %s: config mechanism %s%s, special cycles %s%s, last bus %d %s: Warning, unable to fix up PCI interrupt routing %s: PCI bus #%d is the last bus %s: PCI IRQ Routing Table rev %d.%d @ 0x%lx/%d (%d entries) %s: unsupported IRQ table version %s: PCI IRQ Routing information unavailable. %s: PCI BIOS has %d Interrupt Routing table entries %s: %s - unknown return code 0x%x INT%c: link 0x%02x bitmap 0x%04x 4+Іq+І.+Іp+І$+І@$+ІL$+І$+І$+І$+І$+І'+EXŠ+Ep+fT+fT++++t0+1|+9+" t +"t +й3+йC+pci_intr_route_link: PIRQ 0x%02x: no IRQ, try "option PCIBIOS_IRQS_HINT=0x%04x" pci_intr_route_link: route PIRQ 0x%02x -> IRQ %d%s pci_intr_post_fixup: PCI IRQs:Interrupt not connected; no need to change.pci_intr_header_fixup: no entry for link 0x%02x (%d:%d:%d:%c) %d:%d:%d %04x:%04x pin %c clink 0x%02x irq %d stage %d%s irq %d %s: no compatible PCI ICU found: ICU vendor 0x%04x product 0x%04xpciintr_guess_irq (stage 1): guessing PIRQ 0x%02x to be IRQ %d %s: PCI Interrupt Router at %03d:%02d:%01dpciintr_link_init: no PIR table pciintr_link_init: bus %d device %d link 0x%02x: bad irq bitmap 0x%04x, should be 0x%04x pciintr_link_fixup: PIRQ 0x%02x is already connected to IRQ %d pciintr_link_fixup: PIRQ 0x%02x not connectedpciintr_link_fixup (stage 2): assigning IRQ %d to PIRQ 0x%02x pciintr_link_fixup: piirq 0x%04x pciintr_link_alloc: bus %d device %d: ignoring link 0x%02x pciintr_link_alloc: bus %d device %d link 0x%02x: ignoring PIRQ 0x%02x preserved BIOS setting; ISA IRQs: WARNING: ignored WARNING: missing fixed up WARNING: overriding WARNING: preserving, assigning IRQ %dPCI bridge %d: primary %d, secondary %d, subordinate %d I/O APICLocal APICBIOS PROMPCI I/O memory spacePCI I/O port spaceSystem BIOS SettingPCIBIOS fixup stagemem %02xh %s 0x%08x 0x%08x [%s] Resource conflict. %03d:%02d:%d %04x:%04x 3"3-3[%s]----------------------- device vendor product register space address size -------------------------------------------- --------------------------[%3d devices bogus] WARNING: can't reserve area for %s. Physical memory end: 0x%08x PCI memory mapped I/O space start: 0x%08x WARNING: unknown PCI device header. No available resources. fixup failed fixup failed. (new address=%#x) ٸ++8+С++ *+U+Щ+#++g+К++s+ʿ+++F+s+ʿ+++_+s+ʿ+'+A+І+++ ++#+в+?+ _+y++S++++>+s+ʿ+    cardslot slot %d flags %x pcmciabus at %screate_slot_managercardslot_eventcardslotevno cardbus on %sno 16-bit pcmcia on %scardbus at %s subordinate bus %d%s: unable to create event thread for slot %d cardslot_event_thread: unknown event %d: bus %d device %d%s: failed to map memory no room for cardbus tuplesno room for cardbus_tag " cacheline 0x%x, lattimer 0x%x cardbus_attach_card: failed to read CIS (manufacturer 0x%x, product 0x%x) %s: cannot detach dev %s, function %d +`+`+`+`+`+`+`+`+`+`+`+`+`+U+`+`+`+`+`+`+`+`+`+`+'+++cardbus_io_find: bad requestcardbus_io_find: void region cardbus_mem_find: bad requestio alloccardbus_io_find: expected type i/o, found mem cardbus_mem_find: expected type mem, found i/o cardbus_mem_find: expected mem type %08x, found %08x cardbus_mem_find: void region cardbus_mem_find: 64-bit memory mapping register cardbus_mem_find: reserved mapping register type cardbus_read_exrom%s: bad header signature in ROM image %u: 0x%04x %s: bus_space_subregion failedno memory for rbus instancerbusrbus root3c575-TX Ethernet3c575B-TX Ethernet3c575C-TX Ethernet3c656-TX Ethernet3c656B-TX Ethernet3c656C-TX Ethernetxl_cardbus_attach: impossible: 3Com %s at %d: irq %dWP 3WQ63WRV/3`evB3bevT3deVg3%s: unable to map function status window ]77 : can't map device registers : unknown device %s: awakening from state D%d : can't establish interrupt at %d )fxp_cardbus_attach%s: failed to allocate mem and io space: %s %s89YY@%s: unable to map deviceregisters : couldn't establish interrupt i: couldn't establish interrupt at %s: unable to establish irq %d %s: ath_cardbus_power `%s: unable to establish interrupt at %d : revision %d.%d: irq %d %s: atw_cardbus_power  `3%s: could not establish interrupt at %d : %s (rev. 0x%02x) %s: can't map mem space %s: interrupting at %d Intel 82365SL rev 0Intel 82365SL rev 1Intel 82365SL rev 2Cirrus PD6710Cirrus PD672XVadem VG468Vadem VG469pcics A and B A only B only 0,10,01,01,1%s,%spcic_create_event_threadpcicevpcicssunknown pcic socketpcmcia at %s controller 0 socket 0 controller 0 socket 1 controller 1 socket 0 controller 1 socket 1pcic_chip_io_map iot is bogus%s controller %d: <%s> has socketpcic_create_event_thread: unknown pcic socket%s: unable to create event thread for sock 0x%02x pcic_event_thread: unknown event %dpcic_queue_event: can't allocate eventpcic_attach_card: already attachedpcic_chip_mem_map memt is boguspcic_chip_mem_unmap: window out of rangepcic_chip_io_unmap: window out of range%s: irq %d, %s: no irq, polling enabled : can't map mem space%s: couldnt map interrupt %s: PCI interrupts not supported %s: can't map high i/o space pcmcia_card_attachmanufacturer 0x%x%sproduct 0x%x%s: error %d detaching %s (function %d) pcmcia_function_init: function is enabledpcmcia_function_enable: function not initialized%s: CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: function %d: unspecifiedmulti-functionserial portparallel portfixed diskvideo adapternetwork adapterSCSI bridgeSecurity servicesInstrumentSerial I/O Bus Adapterunknown (%d), ccr addr %lx mask %lx memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx%s%lx; memspace %lx%s%lx%s%lx; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audiopcmcia_parse_cis_tuple;,Њ=,Њ=,Њ=,Њ=,Њ=,Њ=,Њ=,Њ=,Њ=,9,8,8,Њ=,9,5A, %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS portXBBp@m@m@ f(  pt""(4I@@@@1` QFb '               uhubselfsinglemultiple, %s transaction translator%s%s: no ports, hub ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: port %d reset failed <-&-.&-н%-%s: hub depth (%d) exceeded, hub ignored %s: %d port%s with %d removable, %s powered%s: bus powered hub connected to bus powered hub, ignored %s: cannot open interrupt pipe %s: port %d power on failed, %s %s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: strange, connected port %d has no power %s: device problem, disabling port %d hid_start_parseBAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d .)- *-*-B*-L*-Е*-П*-Ч*-Я*-Я*-з*-п*-*-*-*-*- +-M+-Ў+-н+-+-+-+-,-+-+-,-,-uhidev%s: %s, iclass %d/%d %s: unexpected endpoint %s: no report descriptor %s: %d report ids %s: no memory uhid at %s reportid %duhidev_intr: bad repid %d `d.-К.-2-Ѐ2-%s: could not read endpoint descriptor T;-A<-7-Ѐ:- ;-35-5-В7-Y7-ukbd %s: attach failed, %s %s: was console keyboard bad modifier sizetoo many modifier keyskey code size != 8too many key codesmultiple key code arrays This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). key codes not on byte boundaryabcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L!MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.e mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= 2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;7.:8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8 3R3 3]33I3R3J3R37`3 3 3 3 3K 33@#3333 33H@3 N3 _`3 33\@3 3 3 3E@3 3m3K3A3[@330 3 33j33umassCBIBulk-OnlyCBI with CCIRBCUFIATAPIISD-ATA%s: using %s over %s %s: isdata not configured %s: bus attach failed %s: BBB reset failed, %s %s: Unknown state %d%s: CBI reset failed, %s %s: Get Max Lun failed: %s x>->-B-ЍC-F-zF-*H-ВN-8N-tO-@-?-?-?-?-?-H@-V@-O@-A@-]@-jB-rB-rB-jB-zB-cH-I-eI-:J-ІI-:J-L-8M-ЅM-ЪO-KP-Q-Q-R-IR-{R-гR-%s: unable to get Max Lun: %s %s: command protocol=0x%x not supported %s: got polled xfer %p, but %p already pending %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytes%s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s (  v      W 1 Q `  S-@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   S-  L+ L T-L2 D   O  {8T-o  A umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cbAZPZPZPPX- Y-OZ-Z-urio%s: setting config no failed %s: missing endpoint %s: couldn't get ep %d uriorsuriowr%s: getting interface handle failed F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF |9 ,pf-Ъf-вi-|j-aueauemii%s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: abort rx pipe failed: %s %s: close rx pipe failed: %s %s: abort tx pipe failed: %s %s: close tx pipe failed: %s %s: couldn't get endpoint descriptor %d %s: %u usb errors on intr: %s %s: open intr pipe failed: %s %s: abort intr pipe failed: %s %s: close intr pipe failed: %s  B W  1b0{&"=F@n a-4|-|-ҁ--axeaxe%d: read PHY failed axe%d: write PHY failed %s: media change failed axemii%s: usb errors on rx: %s axe%d: usb error on tx: %s axe%d: rx list init failed axe%d: tx list init failed axe%d: watchdog timeout axe%d: getting interface handle failed gpio0 path not done! PHY not enabled axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s axe%d: abort rx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close intr pipe failed: %s cue%s: read MAC address failed %s: cue_send error=%s ---Ж-@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0--и-%-kue%s: loading firmware failed %s: kue_send error=%s %s: warm boot, no firmware download %s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer {%1lȳ-*---cdce%s: no union descriptor %s: no data interface %s: usb error on rx: %s %s: could not find data bulk in %s: could not find data bulk out udav, setting config no failed udavmii, missing endpoint , read MAC address failed , couldn't get endpoint %d %s: udav_send error=%s p-Ъ--c-, failed to get interface, err=%s upl%s: upl_send error=%s x---Y-urlurlmii%s: couldn't get endpoint %d %s: url_send error=%s %s: %s: bad register %04x L-І-л-Љ- P Q@9@WPurl_int_miibus_readregurl_int_miibus_writereg%s: failed to get interface, err=%s :5g hahh! !(3P@3vK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik*++,,--../-@@A&''(())**++,,-MNO`abcd e f g h ik$%b(&b,'b0(b4)b8*b<+b@,bd"h"l"p"t"x"|""" " ")$+$-$/$h T.Ў..:..д.... ". ".!. ". ". ". ". ". ".!.!. ". ". ". ". ".!. ". ". ".!. ".!. ". ". ". ". ". ". ". ". ". ". ".!. ". ". ". ". ". ". ". ". ". ". ".". ". ". ". ". ". ". ". ". ". ". ". ". ". ". ". ". ". ". ". ". ". ". ".". ". ". ". ". ". ". ". ". ". ". ". ". ". ". ". ". ". ". ". ". ". ". ".". ". ". ". ". ". ". ". ". ". ". ".".І".".Њ".".".".".".".Б".П".".".".".".Ц".".".".И".".Э".".".".".".".".".".".".д".".".".".".".".".".".".л".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".".40.b0.Ќ0.0.v1.п1.П2.П2.П2.П2.П2.П2.П2.П2.П2.П2.92.4.4.5. 5.5.5.'5.'5.'5.'5.'5.'5.'5.'5.'5.'5. 5.ural%s: xfer too short %d %s: could not read BBP %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: MAC/BBP RT2570 (rev 0x%02x), RF %s, address %s %s: could not allocate tx buffer %s: could not allocate tx xfer %s: could not allocate rx buffer %s: could not allocate rx xfer %s: could not transmit beacon %s: could not transmit buffer: %s %s: could not read EEPROM: %s %s: could not read MAC register: %s %s: could not write MAC register: %s %s: timeout waiting for BBP/RF to wakeup %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyz OpenBSD3.8RAMDISK_CD#794 @(#)OpenBSD 3.8 (RAMDISK_CD) #794: Sat Sep 10 15:58:32 MDT 2005 OpenBSD 3.8 (RAMDISK_CD) #794: Sat Sep 10 15:58:32 MDT 2005 deraadt@i386.openbsd.org:/usr/src/sys/arch/i386/compile/RAMDISK_CD d'(TfX 04@ Pp@     P  `  @ @@ @ @` K1v.I.@J.I.В~1ym0У3.I.5}1o0I.I.I.J.,M.H3J. J.Ъ3J.m1$J.+J.3J.;J.    pcba`_YQPOBA8MNKIJ?@=><FGDE234vwx'z{!"0#$+),-.(\/y9%&^|]}~:UVRSTmnot u;lqs*WXiR,iR@*4-4@iRXiR@*4-4liRЄiR@*4-4iRаiR@*4-4iRiR@*4-4iRjR@*4-4jR4jR@*4-4HjR`jR@*4-4tjRЌjR@*4-4jRиjR@*4-4jRjR@*4-4jRkR@*4-4$kR-_ { }xYYvw E--   <<cr39AAAAEEEIIIIDOOOOUUUYaoybuiltin@ `P0pJ.K.@K.K.L.ЀL.J.ЀK.@L.OM. $( ,+J]JЖJJПKFK@`Q4Oc.Tc.\c.dc.lc.tc.|c.Єc.Ќc.Дc.Нc.Шc.гc.лc.c.@c. c.`c.Ѐd.Р d.5d. Ed.Yd.dd.B ud. zd. d. d.d. d.d.d. %d.0+d.@2d.P8d.`>d.pDd.x}.{`S4Oc.>.F.N.W.@.s.. .Ѐ.c.@c. c.`c.Ѐd.Р d.5d. Ed.Yd.dd.[.g.t.Ђ.Б.Ц.ж.ǃ..ж.h о ..П.Ь.П.г.к.Ⱥ.к.Ϻ.к.ֺ.к.ݺ.к...........$..+..2..9.@.P.@. ..KТK...)) .4ڥX.X!.}к_к.CCX.e.m.~.Р/l/r/u/Ѓ/|/=/uJ/0IK/PK/XK/_K/hK/qK/xK/K/ІK/ЏK/)+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuw ! ,j/ZK<v/# v/%v/$uR0ny/oЍӰЮH˝пХgмP0(/4&`H@?@@̑//4L1at3H/W/`/i/s//2/THIS is A memory TEST pattern\3Р/Ю//PwU/"f}}}|VГP}}4 %+2>c0 N, 00 08 0R 0i 0Ѐ 0Њ 0Р 0Ц 00 08 0 0к 0Ѐ 0 0 0 0S 0l 0q 0 ,d0     4*0fЦk΍gp̎ǯnsLbxcL]jyLXЀ~М=Qy؞ӟ=iwۥoL @ @   ) 2l-0     ЫЄЙТ;cx}'ЂЪ"'OЗЦУбТШ yЈEЉС @ @   )/0 ВLЋг! & Ђ 0 X Ђ о Ђ+ YЁ+Ђ;cЕгs1@sY Ђ @ @ @   )36 ##$ U Uք!;ІPXАTFÜ ЀPNRRCEΞSTYNMڛCLR0PLR0RE@RRCEΞSTYSLRRCEΞSTYERcCEΞSTY}4 `~4Р~4Р'~4Р' 4`4Р4 4A 4Д`4оР4Р'4Ъ' 4׻`44 4Ъ'`4Р'Р4a4Р' 4Р'`4Р'Р4Ѕ4 4'`4u Р44O 4Щ`4Р4844 ~4 4`4Р' 4c Ud4}4HР4 4A 4ДР44O 4Щ`44 ~4U f4}4<Р4 4A 4ДР44O 4Щ`44 ~4 4c UЀf4!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>}4 Р4Р4r`~44Ц 4#`4* 41`4;4 4иР4q4Ј4 4`4 ~4 4;Ui4@j4 j44j4native|"*@k4@J"Щnative|"*@k4AHJ"cH0nH0zH0JQ `( * Q1wN]^_ON Zf thd   Hr4CHyJs_s f    1apdeJZr8s  $s'|]|k @-DHv^ c >$v&PQx     Z    szorTt z [0xp }  G |E" F   o& I) + jgxTxp&)\^s+tkI tDK T"@wxy[zyRc  Et `|n{o  7mr HA å Q a6vs ir   TMK\L|*UYwxo.$/ ۧ   u u v Yw +6bzb/YP7Z7d7n7,77,,,Ј--l,t4t4t4мt4u4 u4@ 0 ?wu4u4u4u4u4d@B@.4 #43H3 T`v4 2= r0/-Y0>1ИZ0A2?[0Y33i1ПZ0.W3ФZ0Ќ1ЩZ0 10bW3ЮZ01дZ0.W3йZ0Л2оZ0m0Z0BW3Ђ[0 1 #4 #4$;=*AЛAAD*BBDEDvpxgy\;D@4 vpxgy@4) vpxgy@4&vpxgyСb@4uuvpxgydu0`444AU#C[$U#C[$U#C[$53AU#C[$U#C[$U#C[$>|AU#C[$U#C[$U#C[$P9>U#Cc'U#Cb2U#CT*(08@HPX`hpx La!U#C')U#C U#C p!U#CU#CU#C4!U#C*uU#C*uU#C*u/!U#C*uU#C*uU#C*u!U#C*uU#C*uU#C*uS!U#C*uU#C*uU#C*u }!U#C U#C U#C Cs!U#C U#C U#C C#Wy!U#C U#C U#C ClM!U#C U#C U#C Dɚ!U#CWU#CWU#CWc{9!U#CWU#CWU#CW vS!U#CWU#CWU#CWAG!U#CWU#CWU#CWyO!U#C>U#C>U#C>!U#C>U#C>U#Cc'i!U#C>U#C>U#Cc'?\!U#C>U#C>U#Cc'2}=!U#C>U#C>U#Cc'{aU#CU#CU#Cc'^PaU#CU#CU#Cc'oaU#CU#CU#Cc'%<!U#CpU#CpU#Cc' ad$!U#CpU#CpU#Cc' m!U#CpU#CpU#Cc' DyaU#CpU#CpU#C(a<!U#CpU#CpU#C(7aU#CU#CU#C(GbJ!U#CU#CU#C(<aU#CU#CU#C(g!U#CU#CU#C(<ߘaU#C9U#C9U#C(>!U#C9U#C9U#C(aU#C9U#C9U#C(X!U#C9U#C9U#C(aaU#C9U#C9U#C(Z;!U#CtU#CtU#C(#~aU#CtU#CtU#C(<!U#CtU#CtU#C(TvaU#C kU#C kU#C(.!U#C kU#C kU#C(9aU#C kU#C kU#C(y!U#C kU#C kU#C(@aU#C kU#C kU#C( #'إ!U#CU#CU#C( ׌aU#CU#CU#C( 4Uz!U#CU#CU#C( ;aU#C8U#C8U#C( i!U#C8U#C8U#C(  3aU#C8U#C8U#C( !U#C8U#C8U#C( P(aU#C4U#C4U#C( _!U#C4U#C4U#C( A}aU#C4U#C4U#C(A!U#C4U#C4U#C(KaU#CeU#CeU#C(sx!U#CeU#CeU#C(aU#CeU#CeU#C(*!U#CeU#CeU#C( aU#CeU#CeU#C([r\!U#CeU#CeU#C( |ZDaU#CeU#CeU#C(f[q!U#CeU#CeU#C( f aU#CU#CU#C(!U#CU#CU#C( jaU#CU#CU#C(&!U#CU#CU#C( %iaU#C(U#C(U#C(p#!U#C(U#C(U#C( ~aU#C(U#C(U#C(;!U#C(U#C(U#C( _;aU#C/ U#C/ U#C('!U#C/ U#C/ U#C( Q)aU#C/ U#C/ U#C(#[!U#C/ U#C/ U#C( t\aU#CU U#CU U#C( m!U#CU U#CU U#C( LR1aU#CU U#CU U#C( ޽Z!U#CU U#CU U#C( z6aU#C`!U#C`!U#C( p!U#C`!U#C`!U#C( e4aU#C`!U#C`!U#C( czWr!U#C!U#C!U#C( aaU#C!U#C!U#C( !U#C!U#C!U#C( N2aU#C!U#C!U#C(qҶ!U#C"U#C"U#C( aU#C"U#C"U#C(|!U#C"U#C"U#C( aU#C*#U#C*#U#Cc'!U#C*#U#C*#U#Cc'/LCaU#C*#U#C*#U#Cc'ÉJ!U#C*#U#C*#U#Cc'/caU#CF#U#CF#U#Cc'KP!U#CF#U#CF#U#Cc'4aU#CF#U#CF#U#Cc'.0!U#C[$U#C[$U#Cc'5!U#C[$U#C[$U#C(("Bu!U#C[$U#C[$U#C )+[@Bu!U#C[$U#C[$U#C )Bu!U#Cs$U#Cs$U#C ) fBuaU#Cs$U#Cs$U#Cc'G!U#Cs$U#Cs$U#Cc''1aU#Cs$U#Cs$U#Cc'!U#C %U#C %U#Cc'M}aU#C %U#C %U#Cc'*!U#C %U#C %U#Cc'QaU#C%&U#C%&U#Cc'.m!U#C%&U#C%&U#Cc'#/!U#C%&U#C%&U#C%&-Q!U#C%&U#C%&U#C%&-i!U#C6&U#C6&U#C6&-R~P!U#C6&U#C6&U#C6&-n8!U#C6&U#C6&U#C6&-݈t5!U#CV'U#CV'U#CV'u,!U#CV'U#CV'U#CV',mU#C+U#C,U#C,% hmU#C,U#CL-U#CL-:mU#CL-U#Cq/U#Cq/ PxOU#CG0U#C50U#C500 !U#C50U#Cx1U#Cx18 @ H P X ` h p x P'K U#Cb2U#C2U#C2 JA)U#CB3U#CB3U#CB3eU#C%3U#C%3U#C%3 z U#Cs4U#C U#C 2 @U#CWU#CWU#CW/tmp/disktab.shadow]eU#C>U#C>U#C>/tmp/fstab.shadow]U#C>U#C>U#C>/tmp/resolv.conf.shadow[ 2 U#CU#CU#C/tmp/hostsN\U#CU#CGU#CU ՔU#C9U#C kU#C k6 pPx7U#C kU#C8U#C8 _U#C8U#CeU#CU EU#CeU#CU#CU |ֳ>qU#CU#CU U#CU 9VU#C[$U#C%&U#C%& ቨrxU#C%&U#CQ*U#CQ*    ( 0 8 @ H _5=N}^~1P%(qn )gpBg0'oW3媖`# M"3;7q [Ӿ<1ʭ'ŝhwY z >V66 _JDшdy\ ղLV^nD ZBFh n&*9;idG~ #E'쮼c&bD{`<jL ng68c<"*{fuaVa!]7%ʽ2? XBG+7_"Nl./~tYv%ƞu:->*c kJ,liG.#[Ҷl5ġB^h(uD3ʟ6Wf?LPb;и1s315ҁ<7`(~㊁aA$r6:jC@ h|ͱ%߰`n Gz4k> tJE`"yyF\K)xw*?U i _k\>.i zMF$B7W,}v4?)[fc꘾h/@Yg'x )s7PE; 6]8%D![mOٸ.NJvi!J~ʠ=!9~og|Y 7eM) R|ix z%(us iRo1FrQu 7@L[Cz@RϪM5rWzTYMhrxbS3W9ؼ˭ bC\.[[PAb=؀5uc=3+\WŐ3~P72*>^b5D _+2wx*҇e5xmOYH+ne"o'<5ScA/}b-GťڮtHGkt.άH~̀ X8+w›!nm՝I­D#HS kV . .. catchmod# cp dd df edhostnamer ksh sh ln lsmkdir# mv pax tarcpio# rmstty#chgrp#Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxU . .. pppfirmware ڐgroup=ڑspwd.dbdisktab.shadow protocols#ڔservices#ږ disktab fstab$И resolv.conf4 hosts$ ... . .. kue3c990= ... ... . .. bin dev etc mnt mnt2K/ sbinK/ tmp usrvarinstbin.profile#ڜ install.mdڝupgradeinstall install.subdtx,0JVZ &.4HRd $*2808<DBH    $ ( 2 F J P T Z ` |       $ , 2 < F L P T Z ^ f l r x ~ |  $ @ D H N L R h l p v $ ( 0 6 < @ J P X V \ ` d     " 0 ~ ,>LP^d ... . .. binmdecK/sbinK/share/ . .. ftpgrep#egrep#fgrep#gzip#gunzipgzcat#less#more#\sed . .. installbootbiosboot#ڎ mbrboot2= . .. . ..miscK/keymaps . ..termcap ... . .. tmp db runempty/ ... ... ... ...*) dodisk raid $U 19 54 $U 0;; ccd*) dodisk ccd $U 16 18 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" list="$RMlist" for mode in $modes; do list="$list;${mklist[$mode]}" done for group in $groups; do list="$list;${grplist[$group]}" done list="$list;$MKlist" if [ "$eo" = "echo" ]; then $eo "$list" else echo "$list" | sh fi #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 RMlist="$RMlist $1$2? r$1$2?" [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 M r$1$2$d c $4 $(($n+$count)) 640 let count=count+1 done MKlist="$MKlist;chown root:operator $1$2? r$1$2?" } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist="rm -f" MKlist=":" mkl() { [ "${mklist[$1]}" ] && { mklist[$1]="${mklist[$1]};mknod -m $1 $2 $3 $4 $5" } || { mklist[$1]="mknod -m $1 $2 $3 $4 $5" modes="$modes $1" } } M() { RMlist="$RMlist $1" mkl ${5-666} $1 $2 $3 $4 mklist="$mklist $1" G=${6:-wheel} [ "$7" ] && { MKlist="$MKlist;chown $7:$G $1" } || { case $G in wheel)g=0;;kmem)g=2;;operator)g=5;;tty)g=4;;dialer)g=117;;_lkm)g=61;; esac [ "${grplist[$g]}" ] && { grplist[$g]="${grplist[$g]} $1" } || { groups="$groups $g" grplist[$g]="chgrp $G $1" } } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 fd0 wd0 sd0 tty00 tty01 rd0 R st0 cd0 ttyC0 random wskbd0 wskbd1 wskbd2 apm ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 22 0 M stdout c 22 1 M stderr c 22 2 M ksyms c 50 0 640 kmem M drum c 4 0 640 kmem M klog c 7 0 600 M xf86 c 2 4 600 ;; ttyc*) M ttyc$U c 38 $U 660 dialer uucp M cuac$U c 38 $(($U+128)) 660 dialer uucp ;; xfs*) M xfs$U c 51 $U 600 ;; wdt0) M wdt$U c 55 $U 440 operator ;; uk*) M uk$U c 20 $U 640 operator ;; tuner*) M tuner$U c 49 $(($(($U*2))+16)) 644 ;; tun*) M tun$U c 40 $U 600 ;; systrace) M systrace c 78 0 644 ;; ss*) M ss$U c 19 $(($U*16)) 640 operator M nss$U c 19 $(($(($U*16))+1)) 640 operator M enss$U c 19 $(($(($U*16))+3)) 640 operator RMlist="$RMlist scan$U" MKlist="$MKlist;umask 77;ln -s ss$U scan$U" ;; speaker) M speaker c 27 0 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 45 $n 644 n=$(($n+1)) done ;; rmidi*) M rmidi$U c 52 $U 666 ;; radio*) M radio$U c 76 $U MKlist="$MKlist;[ -e radio ] || ln -s radio$U radio" ;; pf*) M pf c 73 0 600 ;; pctr) M pctr c 46 0 644 ;; pci) M pci c 72 0 600 ;; nvram) M nvram c 84 0 440 kmem ;; music*) M music$U c 53 $U M sequencer$U c 53 $(($U+128)) MKlist="$MKlist;[ -e music ] || ln -s music$U music" MKlist="$MKlist;[ -e sequencer ] || ln -s sequencer$U sequencer" ;; lkm) M lkm c 28 0 640 _lkm ;; joy*) M joy$U c 26 $U 666 ;; iop*) M iop$U c 75 $U 660 ;; hotplug) M hotplug c 82 $U 400 ;; gpr*) M gpr$U c 80 $U ;; gpio*) M gpio$U c 83 $U 600 ;; fd) RMlist="mkdir -p fd;$RMlist" n=0 while [ $n -lt 64 ];do M fd/$n c 22 $n;n=$(($n+1));done MKlist="$MKlist;chmod 555 fd" ;; crypto) M crypto c 70 0 ;; bpf*) M bpf$U c 23 $U 600 ;; bktr*) M bktr$U c 49 $U 644 ;; bio) M bio c 79 0 600 ;; audio*) M sound$U c 42 $U M mixer$U c 42 $(($U+16)) M audio$U c 42 $(($U+128)) M audioctl$U c 42 $(($U+192)) MKlist="$MKlist;[ -e audio ] || ln -s audio$U audio" MKlist="$MKlist;[ -e mixer ] || ln -s mixer$U mixer" MKlist="$MKlist;[ -e sound ] || ln -s sound$U sound" MKlist="$MKlist;[ -e audioctl ] || ln -s audioctl$U audioctl" ;; acpi*) M acpi c 85 0 644 ;; apm*) M apm c 21 0 644 M apmctl c 21 8 644 ;; uscanner*) M uscanner$U c 77 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 61 $U 660 ;; urio*) M urio$U c 65 $U 660 ;; ulpt*) M ulpt$U c 64 $U 660 ;; uhid*) M uhid$U c 62 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 63 $(($n+10#$j)) 660 done ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 66 $o 660 dialer uucp M cuaU$U c 66 $(($o+128)) 660 dialer uucp ;; uall) R ttyU0 ttyU1 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 R uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 ;; lpt*|lpa*) case $i in lpt*) n=lpt f=0;; lpa*) n=lpa f=128;; esac M $n$U c 16 $(($U+$f)) 600 ;; wsmouse*) M wsmouse$U c 68 $U 600 ;; wsmux|wsmouse|wskbd) M wsmouse c 69 0 600 M wskbd c 69 1 600 ;; wskbd*) M wskbd$U c 67 $U 600 ;; tty[C-F]*) U=${i##tty[C-F]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; esac case $U in [0-9a-f]) M tty$n$U c 12 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 12 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 5 $(($off+$n)) M pty$nam c 6 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 81 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 8 $o 660 dialer uucp M cua$U c 8 $(($o+128)) 660 dialer uucp ;; wt*) name=wt n=$(($U*8)) m=$(($n+4)) M $name$U b 3 $n 640 operator M r$name$U c 10 $n 640 operator M n$name$U b 3 $m 640 operator M nr$name$U c 10 $m 640 operator ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 5 $n 660 operator M ${pre}rst$U c 14 $n 660 operator n=$(($n+1)) done ;; ch*) M ch$U c 17 $U 660 operator ;; vnd*) dodisk vnd $U 14 41 $U 0 dodisk svnd $U 14 41 $U 2048 ;; rd*) dodisk2 rd $U 17 47 $U 0 ;; mcd*) dodisk2 mcd $U 7 39 $U 0 ;; fd*) typnam=$U${i#fd[01]*} case $typnam in 0|1) typnum=0;; # no type specified, assume A *A) typnum=0; typnam=0;; *B) typnum=1;; *C) typnum=2;; *D) typnum=3;; *E) typnum=4;; *F) typnum=5;; *G) typnum=6;; *H) typnum=7;; *) echo bad type $typnam for $i; exit 1;; esac case $U in 0|1) blk=2; chr=9;; *) echo bad unit $U for $i; exit 1;; esac nam=fd${typnam} n=$(($(($U*128))+$(($typnum*16)))) M ${nam}a b $blk $n 640 operator M ${nam}b b $blk $(($n+1)) 640 operator M ${nam}c b $blk $(($n+2)) 640 operator M r${nam}a c $chr $n 640 operator M r${nam}b c $chr $(($n+1)) 640 operator M r${nam}c c $chr $(($n+2)) 640 operator ;; cd*) dodisk2 cd $U 6 15 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R nvram gpio0 gpio1 gpio2 bktr0 ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 R vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 cd0 cd1 rd0 tun0 tun1 tun2 R tun3 bio bpf0 bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 R pty0 fd1 fd1B fd1C fd1D fd1E fd1F fd1G fd1H fd0 fd0B fd0C R fd0D fd0E fd0F fd0G fd0H xfs0 ss0 ss1 ch0 hotplug ptm gpr0 R local wscons pci iop0 iop1 uall rmidi0 rmidi1 rmidi2 rmidi3 R rmidi4 rmidi5 rmidi6 rmidi7 tuner0 radio0 music0 speaker R audio0 wdt0 wt0 uk0 random joy0 joy1 lpa0 lpa1 lpa2 lpt0 R lpt1 lpt2 lkm tty00 tty01 tty02 tty03 ttyc0 ttyc1 ttyc2 R ttyc3 ttyc4 ttyc5 ttyc6 ttyc7 acpi apm crypto pf pctr R systrace wd0 wd1 wd2 wd3 raid0 raid1 raid2 raid3 std st0 st1 R fd mcd0 ;; wd*|sd*|raid*|ccd*) case $i in wd*) dodisk wd $U 0 3 $U 0;; sd*) dodisk sd $U 4 13 $U 0;; raid . ..MAKEDEVconsoleklogQ$xf86Q$bpf0Q$ttyC0$wskbd0 wskbd1!wskbd2" tty#nullQ$$zeroQ$%stdin$&stdout'stderr( mem)kmemQ$*ksyms$+drumQ$,fd0aQ$-fd0bQ$.fd0cQ$/rfd0a$0rfd0b$1rfd0c$2wd0aQ$3rwd0a$4wd0bQ$5rwd0b$6wd0cQ$7rwd0c$8wd0dQ$9rwd0d$:wd0eQ$;rwd0e$<wd0fQ$=rwd0f$>wd0gQ$?rwd0g$@wd0hQ$Arwd0h$Bwd0iQ$Crwd0i$Dwd0jQ$Erwd0j$Fwd0kQ$Grwd0k$Hwd0lQ$Irwd0l$Jwd0mQ$Krwd0m$Lwd0nQ$Mrwd0n$Nwd0oQ$Orwd0o$Pwd0pQ$Qrwd0p$Rsd0aQ$Srsd0a$Tsd0bQ$Ursd0b$Vsd0cQ$Wrsd0c$Xsd0dQ$Yrsd0d$Zsd0eQ$[rsd0e$\sd0fQ$]rsd0f$^sd0gQ$_rsd0g$`sd0hQ$arsd0h$bsd0iQ$crsd0i$dsd0jQ$ersd0j$fsd0kQ$grsd0k$hsd0lQ$irsd0l$jsd0mQ$krsd0m$lsd0nQ$mrsd0n$nsd0oQ$orsd0o$psd0pQ$qrsd0p$rrd0aQ$srrd0a$trd0cQ$urrd0c$vcd0aQ$wrcd0a$xcd0cQ$yrcd0c$ztty00${cua00$|tty01$}cua01$~ st0rst0Q$Ѐnst0Q$Ёnrst0$Ђest0Q$Ѓerst0$Єenst0$Ѕenrst0ІrandomЇsrandomurandomprandomarandom apmapmctlELF4@4 (LFtMQQfh @]ff`Rf1fѱfRf1ұAf[Xֈ1۸faf@ ðRBrù fP(fffXfffsftS1C[5!Loading ERR ? U.symtab.strtab.shstrtab.text.data.bss!',X0 k [)09ELQYbfs_bsize_sforce_chsnblocksfs_bsize_p_startinodeblk__bss_start_edata_endfsbtodbinodedblp_offsetip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ELF 4$4 (   МfXf= tfZffgf/ ff"fM؎ЎR k,1ȯ,UWVS$E/!h5hyj(h)hhh)h uJ$hh`h0}1 $(,V =Ĝu*h0h hhh0(=Ĝth(Zth0hĜ((j?EԍEPh0 1yyFu E1hSh06|S5$hQ(},U@,Jt h"(X,,5 EPe[^_ÐU05,hh` u 07UWVSpj5$$ 4^Xy.$tQtLP%$h0h%r'1EPWAY}[uEt?h0hD'WC45$%$h0h3' |`0jVWa4 ~F< t-`=vم|u`t)@,N> th0h;&XZ~ tW3؍e[^_UQQ1Ƀ=0E4`< `t< u A< t< t<#4Q 8EPEEXEZu4E$xu t E@xu tE}t+QEPXEZuE0hN%1fEE0Eɣ8t54Bw'Q 84Xt4Bv١480PUWVSPu V}\E1ۀ>Xt C<3u 8tS0VjM u8uEe[^_UWVS u}E E~gEJ4E1Eu J9} LtLu/jhWNxj E}e[^_LLt,7F t_ t& tS.tt"9vjKE9^w9vjoEKY뵉ڋE)H9s CjSEjLEXZCe)[^_UEtB t t@t1 t u8t"@ t u @ t t8u1US];t3h `#X;ZuE ]DUh`<#hYXUhj #h1US;4}48hC"X;4Z|j FD1]U=4VSujjE[^PjD$?5<EYu5<hs"U=4u jPE^ZP5<hh" . @B1< wk AtЊB< vVSNEY[e[1^UPNH=4EuEP> $"X1UWVSp<]SuP$ ZYy5$? $h0hJE%=@tSh0^_h0u [y5$$h0hi!p=00tC;u/C?}Wh0 ZYy"5$$h0h! WS _XSVL ZYyV Xe[^1_US] C% P6BC tr-PBCtw-PBC@tπuҀЀuӀPAC tr-PACtw-PACtπuҀЀuӀPvACtr-P^A Ctw-PCACtՀuҀրuӀPAus8ssh؀]U=Ȝt Ȝ1U=4~*<8-t u0PIjYZ1҅u6/jZ1҅u&h0h hhh0UU:t 8:t @8u8:uhRh0r Rh hhh0[0Uh!1ÐU=4t5,hf|XZjj5<Q, 1UShhJX=@@Zt3h.S Y;Xu1]U=4th hYXj5<h q 1U=4th0hXZh5<h0q 1U=4t5(hYXjj5<`( 1U=4St jw?$O5<?Yu 5<hs45<hƁ#SD t 5<h߁ hhXZ1]U=4u^= tLj-=> Xtja,>X!tjc>X tjs >X @tjd=Xj =jX1UVSR]549 }s 89-uPA9t\U҃ctat dtst @ EPhA9uQh C9| 1e[^U=4VSu&tPhXZh)Xto8tf5<C=‰XtC;=u)9}Ѐ PtC; u;tCR5<VC u CFuۉt ;uuh4Y=4u@P5<)h0PVe[1^ÐUWV} Sw VB4ËEsWuC PLCe[^_UWVSۋU t {[u9slj:ۋut)S9s"RSVULs[ t S2+E9re[^_ÐUs21UWVS=4th h` <>/uF>/tA %=@1t#/t@=F>t/uPu Q Èvu _X\A %=7yV58=[ ~ BPVP ? ;(}W4PRquv0?&YPju  E PPv0NdPjM qRu^WPT> /t Džu lÅXZu >1ۃtq0%^_t&h p%h%e[^_UVSEX@tZ1tCp0~%XZF~܃tCp0\%Y^h sM%hSB%e[1^UWVSEuxE EEtW_W9ӋGrwF9sBEPEPu Eu(E9ƉvSuu<1W] )u}tE0Ee[^_UUUVSEM ]ptt &t^ ^F)ȋVډVV[^UEPB M AB|AABRQP3CVU3CXu0Oy j-UXO0j$Oϋ0j j0UjxU[^O0jVu* j%UYtjlUZVUXe[^_UWVS}E u]1@CɉuKPXE9we[^_U=ĝu&ƒQR@Ej>ZYÐU=uE PuhUhVf4frdPdp01É`0î0000000000000000011000000000000011111#1'1+1/13171;1?1C1G1K1O1S1W1[1_1c1g1k1o1s1w1{111111111111111111111-  'x0jj\jjVjjPjj JjjDjj >jj 8jj2jj ,j (jj"jjjjjjjjjj|jxjtjpjljhjdj`j\j Xj Tj Pj Lj HjDj@j20 ؎ f"f0@Ȏ؎1gfH/ggfgfg矆gfq1@gf/ f"f~2؎Ў`0D$,L$(T$$|$8X%P -5=aϐX^Z1 ؎ f"f1@Ȏ؎1gfH/1f|`PPPPD$<D$< aϐ؎@D$0D$,D$(D$$D$ D$D$D$D$tSXC~e[^UEE EUE EE GUS]{DuA{uEh$sLsH CuCD=$tC@CLK@Ћ]UVSuVVVuVjuF@eÉ[^UWVSu1V<;ȝYt&tF@t FFT1~CvVVǃXZu 1t F@VCXvt%VVYXKt V@ZutVYt@utV{Zt@ut1VCeXv1~DD@F@e[^_UVS] SuƃXZt_u[jX ÉYtXjXjPj@hmjS&u*h CLZu S4X sHSt jXS [XVae[^UVSuw?kt(S:4hsL jXS ue[^ $ e[^UWVSQE EE<W@tu1J G@EGEGrTGËG9vÅtS7w$_)_)_ Gt&Pwuh GD=$u)GG)EE1GW GW}uGDEuCDu=h$wLu GuGD=$GLjW&G@^HZuwG+EPuwPM>GPGWEY;GPt G@EWBWY@[uG_wWU#_G wGjjj=GP@uDu G+EPuwP=GPE+Ge[^_UWVS}UE Uv$ kuRW44~Tt0RWu vFjt t%J5<FVV9F[|9sQjjjWu V1^LjXjVj@hmjV" ^L~HV[V9F 9)Ëօ|qvl|vDžDžPWf ;u-;u%+|w$[ $e[^_UEWVk11Sw u $ CuC tSPZuCtSP Xt5$ 1t =$e[^_ÐUEWVkSU M}w u $ )t5tuSKSK$[CS WQRC SPe[^_ÐUWVSE>tE}~$E @EPuVFF E u~t|Ut:u E$F Eh;@E}9$EVuZYtǃttEEE;@|ӅuVFP X$e[^_ÐUWVSPEk}w u$ iut?NVu SKW RjsCP$u3E1CSU#VWu S}C P$u+Ue[^_ÐUVuStM] CA8t IC)Nu1[^ÐUWVS11hhjPSVt jSwY[RVhsp KCǃFXZ{e[^_UWVSWEu19hdhjP=SW tjS[^{~΄PPhyC PSth1FY3C$t | EE1FK K1F CSǃuG9e[^_UWVSS1SCYt~1ۅt CuCS E1ۅZt 1ҋM<󥋀C u؋UhjjCiuSj[e[^_U؝V@SBhhjPbh3CK CCCHCPCLdCTCXdjhC(P+fC$ jhC8PC C\dfCh,fCjCxǃǃC WEVǃWEVP}fǃǃdƃǃǃdƃfǃǃe[^UUt9t u1UVSh^tZփCtc1Ұhxfsss ssCtQRVPhN(ue[^UuYZu1UWVSh1ۉYtp;yaCu[VjuSjtK@hVs+C 9t":yBu B9Cu9uދue[^_ÐUWV1=НSН]t9r tL9sωƃzJuFu6ԝwKD= ԝv SRh"N Be[^B_UUНBНÐUU131҄tUWVS uV} 3ـ?E]MWO_ }X@B7WGttujv`yQFv;5 uAAU3Eu f=UuE ‰WGGuG1e[^_UWVS(E U EU؋M At%E}}EE؋Mf1f19u]]v!u<}EYtuuPr EE xUEΊM fE܃f5ffufft5}BtCU31҄t1;]}E] K [1ҋEEЉ1E̋E+Eԍ9ˉr)1}EMMU UMЉeu MfA31҄tu1uu uE9E[tu1 uZM}toU9Ut}uuuR e[^_UWVS}t u j?yrPjjWjtP(}f}Utp11UzurF@u(~1MyuqF@u 1hPjVWjju u S e[^_UWVSPP} E@{:t{:t cCEEU;,}+PV7 u3hj;:XtPC;:Xuj UB< vh.WCŠpЍB<vhʏ XƒaE;tE}wU$@  vPË@M%  ʁCXt!C PS^_YuCCEX1ҍe[^_UMt9tBut9uBUM1t)PPt9tt9uBUWVSP]uE MEU}tWSRQut ‰Ee[^_aUE@1U1ÐZX)ĉqqqP␐UWVE MS}1ۉ;XD}"uWV…XYu1wC;X|uwЍe[^_UEU tcBdB0BJyhf0dAQaBUE tZ t! t5^ tGuTjmj fXZj]Xܝt@Hܝ8j DXܝ@ܝuP,ܝ PܝXUS u  u tSP؋]U Af1 ‰RA@Phxjh$N$UWVSSuEEX;]Y@%k8~%k8~%V^k8%VkV1[^_UWVSEPhR[^EPh:ZYEkdUEMEEEimE}5wK~/ud؉љu؉љuFKщUkk<Mk<$e[^_US ]9|1[ÐU=`S`t'SSX~t;P~ ;uًtSS]UWV=`Su`t҈Ut-t'Ht!8UuAC҈Utt Ht8Ut)‰Z[ÐUWVu~l19wQ>WEVu WEVt u2,+fw V,Zt:e} 19ve^_ÐUU19s f3 9rUUJES] t JAu[ÐUUVSM] It CBu[^ÐUVS ] 1E1ɋP9tFAvE؅u51ɋD؋PAv1ɋ;PtFD؉Av [^UWVSWhh1^E@ PAMS 5„ҋ u=PAMSuE~uFu1}t2% H@DLP51҄u7% `TX\dh҉u~1V[uwv \hTX`duhnnTY@"=Pį@~V Fw=/w=v Ph F PhXZVw,= w%1FV 9ڋ w r9sȉ Vw=vFV  į~Q:u8tRhWe[^_UWVu1Su@~tFCS  P)3siPh {u CS  ǃ{u5į5hWhe[^_UWVS =P@iWEGUEW EU+M]D|w:E EԋEU+EԋUU؅ |=w)PGPW3E;U7|;Ew0E 9U#|9Es)M]UM_WO EM9ʉEԉU6|]9s-E 9U$|9EwUM)UM؋]؋MԉO_ E9UE܉Uf|9Es_U ;MӉN|;UsG)PWGPg)]EuU)E܋MU_O]U܋Mw_ WO e[^1_UWVS=PE@+Ex 0xHX E9׉EU"|9wE 9ډEU9E9EU7|9s1E 9׉EU#|9wEU)uӉVN^ E9ډEU1|9w+E 9ӉEU|9s)u}UMuVN [E 9@|9s:ԯ+EPEuPEMQE +E Aq EEx Uzu4}uMAEQU)U E AQ e[^1_U=P@t xuh@-,Pj脴ÐUWVSPP1۸S5 Ȅۉu =MPt1҅҉1S5S5ÈۉEĞU ȞОuk ؞U)Ӊʁ)U)Ё}̞ ܞԞwUe]ԞS51t h_h4Shj jee[^_U=t'ОԞ%PREZYÐUM Vu9SUsэ2Jt#IKJuJt ACJu[^ÐUEtP$u B@@@@ @ @80BlBPBLBB BB B(B,B0B8B<1UEWVSM ]tP$t r<<1 vH!ÉZ8z<1[^_UVSE]u Ut 81u@t ۸{(C uC(5C0{,uC,5h0%js0S(ƒ ҸtPS$y B @BFvRs0S,C$r$B4]e[^Ge[^Uuu juUE@L@@T @P@@XUWVSEX${4u)jK$PUr0R( C4{(uK$C(C0C,E ƋU+rC(9rPB+C(Ps4=C0=+{09vWUB)PC0C4P )tVUB)Ps4s0C( C0S(9ЉC0uC0C,9sC,1ҍe[^_UWVS4} Ep$ x 8u x > u URUMIM]]E@EV8U~0FlFLFT FTRP^lSUv`FpPj EtMA ~FlFPFXuȍFXPSvdF`DFpPj ENTHVL#EUċ9v"}MMEEtiud]ԋ]H#EU‹Eċ׉9v"}VMMEE몋Em)ωm)τۉF@u è t  t@FH^Ht=9s$}MMEE9r܈ٸH#EF@m)NXH^P#E]9v"}|MMEEud]ԋ]H#EU‹E׉9v"}MMEE몋Em)m)Ϩ@tUB ~^DFH^Ht=9s$}MMEE9r܈ٸH#EFDm)ߋEF,+E9FD5}e]+]FD9v")؉ËF09ËN@V4v)ËF()9v U)‹^@;]v])])^@MBAKMu~@y}F@]C]MS~w&}UMBEUvڋ])]؋E؋M1AQ]^tES)PvTFUB8 EU%‹E%‹EMM;Vt]C ~E1EE UEPMH]UPM~(N8~wV];XtNuuZYt=UEPMH]UPMN8~<][)]܋E@)E؋ME1AQ E1AQ]^~ttSA)PvFUB8 ~F u耋MA4}u}t} u }uEEЍe[^_US]tC$tS,u!@4tPs0XZs$s0S,C$1]UWVuS}t^$t {t; t; u$jjj5Wu P+;Ct\vV8Y^t @C(9ljvPE )Ps4C(C,Wu C4)P{, C 1e[^_UEU t @$t@u P B01UWVSu1ۋ}9s<w7E v=uBt1 )ЉC9svɉ[^_UWVSW}t Ex$u Myu<w ?tOG<)g81҃GE@*EUƁUta}t$E!;EtE]M E܉MEMUMKtut B!1uE]E}1[^_ÐUVSte11)C ƃ v1ۉعt1IyC~ u[^áUtoUWVu 1S}]tA1F31F31F31F31F31F31F313Fdt13FOu[^_UU 1ҋMtt3uUWVS}u 14VCXZ~e[^_UWVSEU ‹}Dž @~VtSwSVpVtSZYZt WS%XZ ‰tGSVZYt WVY[ ‰j3} e[^_ÐUWVSPPu 1]UMy ۃ޿yڃٍEPQRVS"t ]U]EUe[^_ÐUWVStMU EE]u u.1ҋ }EEMq9wr9s}tEp11dEԉuEEĉEE]fEEfEEMfEEfEUEUfE؋EMҍ}fEfUfEfMEM}u|EX1GfEG 1fEW ։1G 1}t E@UE ‰U`EUfziEM)Mfu Mftuփx EfpNy+EUBUEMYw:Ev}~'EuEPWEuHPEPEEf@fEUfRfUMfOf;EftOTOMu E! 1MȉӉE 9v'EMwMM 9wًu1ۅ~.E 0EpEO))ډN؅fOҋUW)؉fWt:uM1ۅ~'M1GUU rUNfGًMfOEUMf BU@9ЉE}tg}t3u9~$wM+MTw fwN;ufwUE ‰UUE ‰UEUMQUE ‰UUE ‰UEUe[^_UWVS} 19u}#^M+MD^ f^C9|^Mf^[^_ÐUWVu} S]tItBCtIuutBu[)^B_/bsd/obsd/bsd.oldBOOT>> OpenBSD/i386 %s %s/etc/boot.conf%s:%sboot> booting %s: failed(%d). will try %s Turning timeout off. `ek#echoenvhelpmachinerebootsetsttytimeopen(%s): %s %s: %s %s: line too long %s: syntax error commands:machine:%s not a console device %s speed is %d /.stat(%s): %s opendir(%s): %s -fc-d-b---l-s-w-sSx-tT %u,%u %lu %s Rebooting...   "R<3   ]  non-secure %s, will not proceed addrhowtodeviceimagetimeout%s switching console to %s %s console not present howto: bad option: %c boot: illegal argument %s empty %s=%s  C  R  2.10probingdiskBIOSĂ͂TdiskinfomemoryBooting from %s [%x,%d] [%x] Invalid device! bad language bad OP machine boot {fd,hd}<0123>[abcd] Where [0123] is the disk number, and [abcd] is the partition. pciSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%s %s %d %d:%d:%d %d entry point at 0x%x %s:open %sread headerELF=0x%lx lseek phdrread program headers+%s%lulseek textread text+%lulseek section headersread section headers [%s%ldlseek symbolsread symbols]))#*#**)#**#*#*#*#*#*#*#*#*#*#*#*#*#**#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#*#**#*#*#*#*#*#*#*#**#*#*#*#*#*))))))bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleExec format errorInput/output errorInvalid argumentUnknown error: code %dInappropriate file type or format+=,r,,,,,,,,+,,,,,,M,,,,,,0123456789abcdef|/-\exitPTX\`dhlpt{~x@DHLPTX\`dhlptx|؉$;I\w@ӊeaxecxedxebxespebpesiedieipeflagscsssdsesfsinvalid opcode faultbreakpoint traparithmetic trapasynchronous system trapprotection faulttrace trappage faultalignment faultinteger divide faultnon-maskable interruptoverflow trapbounds check faultdevice not available faultdouble faultinvalid tss faultsegment not present faultstack faultmachine check ([P]Pro)reserved fault base trap: %u(%x): %s cn_tab=%p %s %x%cCode dumpMemory dumpStack trace%s [%p]:%sfp coprocessor operand fetch fault (![P]Pro)1.2.3 fd%u hd%u%s cd0ATAPI CD-ROMfictitious*none*Disk BIOS# Type Cyls Heads Secs Flags Checksum %cd%d 0x%x %s %d %d %d 0x%x 0x%x heap full (0x%lx+%u)aJpJwJpJaJpJgJpJpJpJpJpJpJpJpJpJpJaJinvalid function/parameteraddress mark not foundwrite-protectedsector not foundreset faileddisk changeddrive parameter activity failedDMA overrun data boundary error bad sector detected bad track detected invalid mediacontrol data address mark detectedDMA arbitration level out of rangeuncorrectable CRC or ECC error on read controller failure1no media in drive2incorrect drive type in CMOS@seek failedoperation timed outdrive not readyvolume not locked in drivevolume locked in drivevolume not removablevolume in uselock count exceededvalid eject request failedundefined errorwrite faultstatus register errorsense operation failed  ] ]  _ `12failed to read disklabelbad MBR signature no BSD partition Unknown device: Bad unit number Bad partition id wdfdwtsdstcdmcd (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( scdhdcncompc %s%d pc%d com%d com%d: %d baud com%d: changing speed to %d baud in 5 seconds, change your terminal to match! ;Zx0Nmno disk labeldisk label corruptedUUUU mem[ No Extended memory detected.%uM %uK ff!a20=o%s] Total free memory: %uKB Region %ld: type %u at 0x%x for %uKB Low ram: %dKB High ram: %dKB apm: connect error apm`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     `qkqkqkqkqkqkqkqka9b`bjbcncc7deghhi jvjjqk_khkkqk inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@ t"<*3pR[PU@Az   !bKZIKKhNNNNNO%OP`ȯ%.shstrtab.text.rodata.data.bss   -~``N 0  $ELFX4P 4 ( FF <<,|,|@@<@uhpt2L @tA<9ӡ<||9sx5<5<5)뺍v h sPh]X t0EuTP#X tFè9|1e[^_ËEU\u# u % à V. e[^_1Љˋ} у < Wb t u Vh J< t< t{Wuhr1 't ;s%hpy ]Ív Ft9 PPt' h`<^ vvP؍e[^1US]3%E ]]j USQjj]j3W +CC]US jum Ã1t h i t@]à SD 1UWVS< 0<D<)1ɉE9щZ<5Z Z .UWVS t< $ h$&Cp<jh'-} G hj jhISuMQ}WE E; hyK< hKKy119~Vj ) vPUt\hJ^ue hvvVu juVu+!PjuuP t h < E܉CE؉PVu uS%u(= s)ЋM]K뢃uuN;G+;EvJ+9tPh` XZhVB,9G,2B09G0&B49G4B89G8B<9G<EpVhjS <Sh<| Y[0jG< << < 1҅yPh`<wx ZY0j묐U=<t,5u SEtsRP$HF@ E<h`<[EPVh|+x8<<<<t<뢡<<ȣ<ș 8<<<{UWVS $<1ҋ}E <|p,<9Ӌ (<|Z9vTh@tltlP+ jjCFP+%  ȃ jjCNPX+ jjƍCVPF+%  ȃ 0jjCfP+ jjC^P*@SWSn)1҃RP %=tEPȃ1)ȃLJ Ƈ }e[^_TP t Wx*P1)ȃRPMye[^_ÍvjnSwU|1U<jUWVSjj} PPu(jhjFP% RC(jhjNP1P(jhjVP0% R'jhj^Pd'djnhRGdGP*dn)ƒ1҃RP t}tx ts Px, )1RPPhp% PS=H<upT VjXh<9 Y^0jsXZ\\ST STP,(SP1L\Sw5\ TQ0\S\`TR0ҍvTS P ĐPSh9ljs?uvC9s;t9U}MEuUM EM܋@EME؋E܅QN<u8E< u t#uPx E! uܿN<u<jP5 +vju։ƿ<8Ed3tuEIjP\T hu1Ґj,V蝧 tj=V膧 tx j tHC0X@1Hw!ơ@u뀐DWh Che[_à jv tS@1ы, hC jB C?EtE8u.C 5T  v 1C HC v iC 3@ $8 ڍvUWVS d Ph<j5X Ph<$P5X'XXtWXXu<<  PD u h<5<lPURj|P5<Džl& hPQdPjDžd URSP jhQj˽ <_9<S Vέ $$^  8$ hD u>u4tuE܋C xuEFu }[t uS Y}uhjh<]SuE Shi|5|<Džt h Y[e[^_UVSuFxtk^ ~ hY<i SFPN Ph_$h_ XZ1}jh<]S Shi T5|Puh="M 8+hŦ<E e[^_e[^_UWVS] 1CuCƍJt5 vUWVSEEE Ep@Ex@^ <<    WSV ɉUVSܪU P 1҅tMWPQV$' [uS e[^_à u< 1PEPVTRvUtzuU1}эQMA9aPRuPG FJvU0jEjEEPEPjEPEEE)Eu.  E ÉU0EjEE PEPEPjEPEEE)E'.  E UWVSPjj t ~փ tE; H H CW 9|jvhIH< h@C<h`C< P}w Ph<haH;] r1Ʌu CU; Ѹ??d <Džt_QjPP3! XZffffPR4N<ڍڽ<<<<<ݝ@E@Du <5<@D<݅@E%<5< hD<+ h;<Cwu$<@< hK<XZVCPE; PƄ(htBv1t <Dtсw <DPCux1 xS6 PjWWPS*6 PVS6 XZShS7 X Vh~NPjdPS hhPVj赑 1҅t hPQ ‰ЋU; 6.&S#YF 51?t VjXZF~=D<~ h@O.u~F<.ttM9sFB<.tt9r1=@<@.t1DžhrPh7^< } Eu?u-ĭ<!?uVW9ZY|e[^_UWVS] Su}uvZYu EE*Su YZYuShM <Xt= < jjh_{CU1e[^_Uu uh< yE EgJjg hNGEǃ1р;yt"~WuS uCF;uEe[^_Uh_t`Ѓ#t%uH;uv8Ft>8Ft<<%t <#u1<uEj@P4Eu_>XtoЃ#t%uW;uv8FtM8FtK<%t <#u@<uEe[^_UWVSP]  Z U0@ tRtME)H9|:EEju|uSPB2 S 1э| Ge[^_UWVSWh<]E^tp8tkSYt^1}ˉj| WVPuhC`Xu1e[^_UWVSEU = <EUEtPGz[hU`<#EY1ǃʋ}щM؋})M؋EҍTUjR4EEX}1ۃZty}WU<%uN|suGE܃}uuuu] 1}uuuD 1}эt C M F1}CI9ruPu/ ^_t]e[^_6ye[^_UVSpuÍEPS1 xE%=@uSӁ e[^UWVSpuP1_Zt)1߃jyWWSP, Wh9Yu 9u @tCi?WV>E[Xl B[@jj@ZYu#jj?Y[u EZ}Yu[=<t(u#u=l <u=<u 4 <*=l <u蓼N7= <t= <twM =( <t 0 <}t <u0 <=}u }t <Ee[^_#UWVSEEEEE]u }%E9}t  < t tCuEƉ׃&l <us tCuƉWV艻ZYEtEEu}DuuuuMt  <tR t蘽RPS t== <u =< <~ET <,j[U;}p ;ueuEUe[^_UVu S]ut)VS}ZYuN-tD t u<5<t t u<5S 9C|29s.S;UCu ;E ue[^_UWVS E0} u{E8-YuEC0< v.t WtEPh)b<}"XZjI{XB1< wk CLЊB< vEt}tىȍe[^_ÐU= <S } tx<%VtP,EEFnt=dt&FsuA;t7PCE;Xu"7EYw7*EXZ>uEe[^_USqujQsX t t t tSX]UWVS <1ۃ=<}u t= <t菀  u*x&; <}CSpYu u x; <|u u趃]UEBW6VU $Z<= < <Rs_=< <0 <5<3ƿN<^8h <1=h <tqBud@_H} <}R1BYu@tE|<5v5.R1 _t$ς|vRPS_Y t%观 5<^1e^_UVSUB6E b$[ :1}PEPjS5< 1҃1tE]Ѝe[^_á Hjj5jj, UW= 3h <놐DžL<)N<uH 1 D_RXPDždU*TLPj@bhPjjV%4$ hSjjjjhPXP|T u LtRLSXP!Pu(U1;  h<U1  <;  1߹D hsE܉MKU‰C S؍e[^à h<1 hx<jjRUWVSu6} FX6ÉFt~ 1e[^_ÉFt!tS{@ 1ЋFP FuFtF F 뭍vUVSu ]S 1ɋR QR,$@3 ؙ<4ڶr=0 <tt=<u } ` <=T <=H <tj= <~)u%  <; <}=$ <ut h]<^$ <=  < <` <~Vj:u < j-u ` Q1ɉ;K_}#1;w <DP9A;K|݋C31ɋCDAv9}>;)9T= <t!9w <|PC)ȉDAS9|e[^1_UWVS } EEEEEE1ы]ACǃǃ ǃǃU |$uAEǃ CM 9^uEKǃ= <t&1=l <@ S)ʃSZ{ }~Ou EƸ<u0u u؋Eԍt0<uEԃCǃC@Pu uNjKC1;K_ 1t <Du?1t <Du#<_t<,t<^t<$t<=t <-t<:t )T= <t!w <LPC)DFS9|ƒt s3XZ1e[^_UWVSPEE@@@ MQ9Uˋu u 1t})ׅt t 9UREpE PU2 @2M9Q]{yq  t7] u T11t <DE |_u1ҋ^ 9ӋENu9t6EpE 1t <DU <_uV9Ӌp9fE] 1t <Du u <1_5EH] T1t <Du |1_Es}UE r+BP2 @"M+A]S{s j t4 ] T1t <Du |1_u1ҋ^ 9ӋENu9t2EpE 1t <DU <_twuV9Ӌ|k9veE] 1t <Du u <1_u8EH] T1t <Du |1_qEP9)ЋM D]+|9u1uE vP6 @-E8HFƋ]Cs E t7uE T1t <DU |_u1ҋ^ 9ӋENu9t2EpE 1t <DU <_txuV9Ӌ|l9vfE] 1t <Du u <1_u9EH] T1t <Du u |1_u E)EP:;EtM ]|E)9Ee[^_Uu Zu hD:>L:غљF9ƉE|Y[^_UWVS1=t <}] uh h <<]h"u7 u PÃt}u e[^_É V 1щˋ} Ӎ< WXu VhWqKEZuWh<E5URhFu t E=<t WhWKEYuWh藥j EPW& E}K 8"t}xEЀ8tWhʩ<0}u>WKEZyWh<ԍP, EYuh<:Et&>WKZMEȉuSPB' 1҅y0F0u~xu萟jEPPwj EPu \ 8"tE8u te[^_Uh<5@PHv19}<u @9|Qhq<藤ÍHTv19}π<u @9|뾍vUWVSU11۹׈I wWE ffDž؉IfWIQPR0Y[PuOe[^_Ãhx0tC1WIE QPVIU f e[^_ÍvF0tx1I wX} Ce U *PVZXZPufDž#fDže[^_Ãh` hL<誑+9Dž|*Vu [ye[^_ÐsFDh[<ۛXZCPhc<˛ F PF PF PFPFPFPh<蠛CPh~<莛[XF Ph<}VRFP)Ph Shi uj @t)U; <Etuh Shi u @t*U1; e[^_;0<| uhhy SuWg9tuh3s(G <o@Ph&<}V P{ t7jjEPWjSڙ x EEhu8-t 3 @PtuغE U]tu׍vUMV1 dF <1҅Su] ttdʹ )v!I <ffffI <SI 1 <B% u1}ȹr}йuEĴ&E <t HpQVhE F <t HpWVhF ve[^_;F}u E>e[^_顩;F| uVR茩;F| [VRoOv< rC< dUVSuu <9= <,VE 0连ZY= <tzҍNta< <1Gtڋ\ۈtw DSAu= <t QX=p <t Q_19ju =v <uPhV<5ȕ <5ȕ Ru6h7 h7 ZYu= <&u  <u  <UWVSU <E]  `?Y^uhCSPƅ-$<ǹ 8tƅ+= <t,5ȕ <觺5ȕ 6[Z}h<7U BEYE ph< 6[Zue}H5ȕ )P4:P1Cу ;] Q}vPhtF;t>u;t DŽd= < O < O < <WDž`[t,$&\FF F$uyF1҃tС<TtZF<0uU:t<BC:u/ <)dT)č};t BC;uDž`,]\uFu$uhF1҃tС<TtIF<0uU:tBBC:u5 <)dt!T)č};tBC;ut FC<,t<]k>Dž`N`Ft9Ɗ<]t>\u~tFF<]u>,i]tqN^F1҃tС<TtIF<0uU:t=BC:u0 <)dtT)č};tBC;u CF>= O <u5ȕ jE p{։ÃXZutVSE ph<5ȕ ufuh <Ft>uFuh`t"j/VZYt @1= <t(VSWh@<5ȕ < =( <t jjYX@<ۉDžt;tDž@v tht;u7PjDž <DžSY= <[$t :uDž=v <t%uJ^} tM 9-tQh<5ȕ <%| }tuh<5ȕ < | =| <tuu u) v <9v ^_x|%=t@u h<5ȕ <}y`PjhdPjhpPI < <tS`PjJhdPj lXljMjj e\v < MI=DžL=0 <4 BXv <|TE܃t EPj )TXZEPja 4 <^ɋ0 <_E؅|vj]B[=`p <cE= Uju9LZ@Y<j;PLTPPE PY @ LPd$|$E Ph<5ȕ <)dDH 3X˽]Uj7le[^_UVSPP <@EufEjjV }h< ? w7j h<5ȕ <"?Ne[^_U5@<5@<5@<5@j]UWVS $Vh65ȕ hě V5ȕ ?1҃hh<ЍѸ)PوЍэ Q щȺ<әRPh(<4 <ۋ 0 <|-v&s <9 < |9v h6<~FhC<1҃ЍѸ)PوЍэ QI 2+x<|Y[c Z1эy;}}4ȕ uAv,h<VhxC$_u h`-<}7,ǹ@@P^us$hF.ts.t .tu1҃tӡ<T1tYF1tӡ<Du-t 1_u0_uuuh2<4XZ؉xe[^_UWVSW]1;G5<C.t1Ƀt L0u߄҉t uC; tEPSHY^t1e[^_UEWV=S <] v PhSEP?%ZYt'=th3<*1S1;YX jS#XZS ]UWVSST <@Hu }VW$-ZIYf$l< PVSV^_mDŽ]SVZYKDŽ;SVv^_)DŽSVTZYDŽjPV T <PVl;PV1@󫍃PV& PV;^V@: PVHjjV:V 2he<]1Vn9[XVWU#;ZYth|<=1VN9^_e[^_UWVSSSuV}W] #YYwhEV}W"ZYjjUuP;EE;EnVW1#ƒ:XYuVW"ƒ:XYt]]u3VW"U1эA_;MEX~h<߉"h@3< h3<h3uh<'u(/u}W=ZYu1}уQIÅXu h`5<'$_U1UQRCP tE uURY}[t ,q;th<"[]CHEsPaZYulS zu*fBMfAXBAAB}JtExDu0h H_u hP<<"YjsVMqD hExDuPhF<"XZu uuMhq,Pue[^_U <UWVSRRh =hFu19rC) vKGFue[^_UWS0uhh Cjj:CPCPVt VW*;ZYth<V#^_e[^_UVSSuVEP] =ZYth*<PW}N<}tOt t t"EE߉} Ee[^_uU߉} Ue[^_4tt C t)<VWiYXt hp+<uopVHWE@ /t h><VW%ÁXZt h ?<u+pVWE =th+t~у?F?~11ۍ}> I>yF ~Ӎv <E hD<냍v1tfjP@tcF>t;~1 ЋUF~kōvF~몃 hD<6닐UVS <ۋuu.11ɸ3F<萔t->F<GFl$UV 4 E.1/PS/$EMɸT <9QCT <UWVS11CtBT <: L <tp T <1ۍJAnt\Plt;CtBT <: ( 밃 T <ʍI낃px@ <<L <T <1҃tС<TE8!T <1ۍJAntj^ltICtBT <: [U:u h<$$5QhRh<:Ճ T <ʍI먃pu hG<L <%T <1ۍJAnt=1ltCtBT <: c T <ʍIՃpuσ5p v54 <54 < T <1ۍJAnt@4ltCtBT <: PJ T <ʍI҃pũ54 <54 <_ T <1ۍJAnt<0ltCtBT <: a끃 T <ʍIփpuЃL <gT <1JAntITltBFtBT <: =@ X <$ <t5<t<<σ S#;=H <̓W3蕻z(x)Efv  tDtEt4 t" jPjVu#~ )H u+v;]Qv؋M@ <CG;]|2 jɃ j<뮐UD<@<9VS <<|'d@<@PQ薞trD<RE << D*ddB:gM dfz8;}  rpdY)ppƉѿ<8pdB$p )9/$I막vh(<ډRvQvvh(<|h(.tƅ.\\)Љ¸)PVQ0X<\ - <ܶ <Ķ <ж < jjxjhLt6VWW 9t"=Ķ <x Sh<|^_Dž~h@WR uQyM=Ķ <x/Io8t?o0Y ZM CuCDsjsVc YZC)PWP@8P@{S;P@t MbS;CZt4boL@jjS t CD0VjjjP@1u{Du {C)PWP@P@E+Ce[^_UÐUWVSSSM}u u,vˁ}w:M}tMF˃}uv։1}m[FFFFFFFFF F F F F FF˃Jwȿ1щ1}I}}mFFFFFFFFF F F F F FF˃}pM}tMF˃}u1щ1Ӊ ʉZY[^_UWVSVVjhuu}ϋu E1%m8]+]vxvvve[ ^_U Et?}G Z<E@ ZPjEPV谿x3>uEԀ8u]9RVh " VR2EE뻍v FdP;EFF F <@4FV  <@4 Fh <[5 <te } $؃Kޡ tuJ  < <<E11;Q,}01;} sshVL= < hsVhDhu hk<>럍v j f hMm<#$Nhu΃ hlR jdf%@fc!vUWVSl  p@ < hhn!<B;Au'A$P Phln<UEE A$+B$ÐU5 <5$ n<[vUWVS EExp~"vjVtEOFEe[^_É\ <)tȋ <ۉtv9st;ux()\ <  <뀍FӉ@C < S <\R뢍vFbU50 <5, љy8x+)ÍD2@ЋX80ٍX닍, >ɉxXU t6*ɉx") X8~Aى8A룉A:W4GGO41G GPVPho<DžU ,QfdGP>PPLh{<댍vDžTDžBxPDž DžU PǀPB뫋= ɉo])AF;u|ӉMؙPAЋ!AQ Rh <]{U tU tVhiۉ)Èٸ\ <Mɉxt‹ExU tWɉxB) F;u| Ee[^_á te~t_j,\1 E C >1эyW.C6hxc VSZYu-sh  u0E@t`u#%=@]PSh@h= 1e[^_ÍvA1;y}H ɉxi¡ <xU tNɉx<)F <;s8|V5 <C KdPV\A@`뱍A@Xp@TC@`vA`Q htJjjEPR.EuPVhS5XPSh#u~nu <rhw1=@9 j@Puh u E[PEPjVE@PuVhx<<-]~SFt-~u tƒ뽉UWVS}EEE18wE仃s̃h0dt2$?tauEȍe[^_Étux<밿D<멡<4u[EuUǃWuVv Vt֋uh-1vWh(эA;E~EЃ <~]UjDPMQhjh0%EPVHtkE}UuPЅxE؋E؋U4uZZ0b PVh<uPc뫃Vh<؃uVt덊V<u"1҃tС<TjFVEttjV8tVh<<e[^_á<@@L wX1t @?t SuؾщЋU; u EoPEPjVETPuVhxӋE(<@Pju̡(t4ft&?u֍e[^_ÃvuE뾉E볡<4tP}tm S|NjuEu0j[SpZYPWٯuUwGPhMtFE;tE:Ct;u1e[^_ÉSVhuuSBvˉыS<럐UWVSEu] }$w$8j4tPjuWE)uWdtPjuW)uWdFuWsd;uW_djjPW詏ujjPu臏tލCw|$̻<99999w9cvxPW1ۃPuu09ExPW^1ۃPu?9x 9|{vPu1ۃ]xPWW09E8CUvUWVSu V}WuCܐUWVS|0 #t[19ڿ} <2 tFB9|;U }#щJx2< tIJ1y#E8[^_I1#2݉G뷺119}t$2<#t12A< B9|E1뷊2ލvUWVS,EEtY j o$ cUԅYE tEP+~Eԃu e[^_Ð<PuTލvu uv ~}@U19U ;uo~U |/t O~|/u<]PCPE1E܉E؃D;uE}vM;MsdU FE;u|M;MsEU܉)ӡ<VPPR  E܉M؉]븋U܉)P<PPR议  E܉M؉]`jU P9F;u|jE 0ǃUWVSU1Ru Ɗ111ۃt <\31CH!B2u3<Pj(<10p$(<#=th'V7Qt8uWS1ۃ뫃hP7 yՋU܉)ӡ<QPPR~E؍E؉]LPUVSu FP]CPPuC+Fe[^ÐUWVS<u't"t`t=t :tN͐~|>\t9}A;<u1't,"t'`t"=t:t\CtǍv9}@Ety~t7*D7e[^_À}tvEЉPhO$vUSQEt9Ex ^D t PMH j ,붍vUWVS E 8^]t(PS覄)ڃH e[^_Ép1RIQVSńPɐUX Vt jKu` <;T ~BE L < t&< t"<"t<'tGt%< t < t <"t<'u鐄t< t`< t\<"tX<'tTʍAJx <t'< t#< t<"t<'tGt< t < t<"t<'u RGt< t< t<"t<'t듍vG.< t< t<"t<'t j.UEU#vUELvUECvUWVS T <5X <9x E hDžLhFxFDždbxu͋E h뚋E%  uDžPEyTkDžTEUE hh5E@0x{t h@htE(PE P|PEPl||19H!d։l=pdtDžt);uu hJ^XZjl@$lE҉+E@~WPVEPƃCFuDždDžPDžpDžpljlS8@lE$EPlSEP t5Et`tDžP\A\\Eff+EfAEfAEЉApfQ Et Ml%t9#tMDžPeMDžpFk=t?uƒeM뵋E@uM(Me럡<Pjgl@\PBjl7l8jSl7KlhME@>#E1҈E1:< Y ]ԋMԅu}EMԉE*@j[Vl Et@<*<@Eԃ= V;UB$>M]ԃ<@u\}yjU8tP+tGv=<t E8 EPW jjuY_jj WNjEtRjjPVYu5j2V XZWj=WdEf@ EXe[^_ÐFmF`F UBHu@j0jj jrPt Ef@ 늃Vh1҄tv<Gtu҉tA9؉EtU+M)ډM؉UЀ?tG9؉ue[^_G{},GuՃuЉ+EHEԡ<PEEEЉE@PU EuuP`MM؃ MuuQ_EEԃ EuSP_U܋MXuEEPuRuG }9NbPF$EupM;Ys#UCPM)MuQQTQP<)PPRLUUBЋMQ뚁eMEUME Ue[^_>G<{t"<}t<,-$NFUWVS\EE11҅t-E t2E u+Ef8t"E VjPEPRe[^_É j>T<2 Ef8 E E E@ Ef8Ef8E@ tEX .Ew!$|vEQPh<j UB4a=#<tAUBD<+u C S PShd<0@U P e[^ÁāUWVSu] ZYj/Eu݉Pjuu>- hB<$=tuC 8/tu ύvhE0UB 9F 뱋UB 9F 룋MA 9F 땋MA 9F 뇋N uG uWYZPW#EEV t@ EO N tG uWYZPWEEF u MQ tEk몋V ЋMy UF My UFE@ V 3UF R )#E@ V !E@ V 1E@ V 1~ EuG j WƋE܃uO %u: WE܃tG j WEE܃uPh4Dt:PjjDǃ&X4VWa jʋDt뇃j=@P``<P3#Ƌ`+0@4+\t!Tu Pt hs뮃 5 <te[^UU JS11ۃMtw$<9tvJAu[ø9uC1ܸոθǍvUWVS Y[h`QhCPE ^01t4{P < <ۉt9St t 9PutBQȋ]Ãh < <19H!‰ < <19H!‰ < <] <9tPu h +x@~QPWxPBǃGXGGGGXG$G{GWxP& (<NJ<\5 <B:#t^%tY V(h h;tthDždQpP)hʉ V(h h;tth Džd QpP)hG: (<Gt<\t +x@~RPWxP>ǃ?G\GGB2\t`+&h hG;tthDždPpR&hʃ\ (<t+<\t'5 [9GP|)WP (<5<\- <`B;`<`&tl1>@>GtJ `GG G|=<`|u@G1<H能`>kGu (<t2<\t. [`C0?`T'th h;pthd  <RpQhɍv"h h;pthdQpPhϐ}h h;pthdG}PQpP<hːhAw $D<("tm'tShP h;pth dPpRhϋhB <똋h@뉃)t\{hAihJ[h@M"t\?hB-h@HhA 'hA  <`t~\C (<t^<\tZ X(hG@@Dždh hS:`ghB\'t+"tfh Džd h h;tt$hDžd <RpQch (<t#<\t  <0؍BMąt tE9u!+E@~RPVUR+ƃGF닄u  S (<tj<\tf u'= <uu蔜Ft<Àt*t%u" 5< W#% &;|t%)uEt M1}u밋utM끋MvU1܉Ph69s*1C;u sF<t#19t e[^_Ív9r1;u C=e_?FD*tvC19t9tNWSu V[u1F;E r낍v[=uPjWS1ɅEUN{]PjWu\EE 9}EtuE 9Ew*EEuuuVu EE 9EvߋEEE9Eu1Wuu utWPu VvVtRS뛍v1Ʌp==~-PjWSa1ɅE0N{]PjWu7;u Euw'EuuuVu!EE 9EvߋEEE9EuvWuu u}u;utWCPu uatWPu VEtJPjWS1ɅEUN;u ua]PjWuZEPuuV u+EEE9EuWPu uEE 9EvUWVSMME19u A<txt59t 9uӀy]u1;}QH!ƒ[^_Ðy-uŀyt(At 19׊Ayty]u1[P#UAh<` T(JA9!0EA#vUWVS ]u 19s v;tC9r1e[^_C<)t5<|tyPh<4tGNjUtڅu֍C뾉OuUE UE UWVS U +UU] Eljփ;u9v\37Ut>~4;utˋUMΉM뵃밍v;utmMuUE +U)9|SuGu PEE Quuu}vM16UumM%e[^_ÐU2vUE@@U P @@ÍvUWVSu Vҋ}^Dul1҅t-Ft-t!F t+tFe[^_ÊXtAF-FFVB?Fj:a;X,O#FPuEp1)@<:tr<;tn<,t_<#tEf\Nt%<tFFFËt<tB͋FD‹MTUNM<t뤋U t@<;trM9:tW uF J^tPE)PjV"t-)PSVu];}rEE+E녍v}΍vUWVS 1Puu u]y3u/ s8#u%s u re[^_ÍvUSjj]Sqx1Ҩu Ћ]ÍvRPjSqUWVS ]ۋ} t]WV蝅ۉt e[^_Ét&<QP1QV蝇ǃʡ<PV硐<PhƃUWVSEEEEpE U  hSr (xk/ptPSVƃ1tU; /t9w됀;.1IvCy'dF$F9FRSWP蛌^^FcV$hC tHC C@CЋ]É S@tC uӸ܍vRPh Y[jhE=5Au݃ jXfxơ(<@Ft8G9>uEfx@PuUfB1߹щMME1P#L@UNjGGG uGSPBVMfI>e[^_ÍvMA4PSGPtϋEP(jRFMfAvUEÉUU BMBAÐUMHxQBAtu Hy1ÍvUEE EUWVS<}PGPJ1fƋW~$vt  tAG9|)WhȦ SVie[^_U1҃1ɉ < << <4=<t.4]Ív ju<\<ʃ Pd뼍vUWVS U<t`8 C@Ctt?Ct,t = <tvJCt Ce[^ÃQjRS8 퐺랐he[^UWVS ]} 1vC wS$<Cue[^_ÐCFCuCtNƅuFS9t uu뿉PCPh@Cu#WS 1uӍe[^_ÍvWs0̍vWs 0뱍vWs0떐UWVS 뛐ww *dUSP]t0<t#vCt <uE t[t؋]à SltUUS:tЋ$ÐB<t uB<uE tuŀz[u1ۍv9uA<[t <]uKu랉CUS ]u Sy1҃9t 8uЋ]ÍvUS ]jSJ1҃9t8tЋ]Ðx=uvUWVS4<PhE܉E؍Eࡐ<@Et@vEԋ@EЋExOxEЋ0Et  tOyEԋ@LEuËM;Ms-P<QjFPWEc Eu u EU ]uE hjh=EE}t}u< 8QVhedAS,6xZ S<w<1:H!E QhtPEPh/ hR<~D< <ɉEuJEEGt' EP覓"薓"@<D=<]t' EPC@"0߂" ؃cE<~<1҉E1=<EUtT EP m1҅upt u4^_juOxjj<y h<$z=<, Mq詟U2 <uuMA 8urEs<j/uftP@UE؋EEEEܤs<<ÐUjjujJÐUjuÉUWVS ]PSjjfHu|~‰Ћ]Ív#Et䐐U u uh<νc=̀rcìrUEt ؉EHDɸÐWc:̀rGc)̀rU,EEEPEPjEEEZ x EtEUÐUWVSh0jjj PuDžd jfff=tl@fff=tMfff= t.fff=te[^_Ët狅fff= Wfff=_fff=  0ff%=ff%=  D 1mfff= ?fff=tWfff= (ff%=ff= D VSjPuDž3b RVSujjPj^ @Dž] t.8t)CCfCC t8uׅ0v0 VSuna 9uE)~ TuR ut N貔܉Gu] t8t‰9_t:_t^Pu.GCGCfGfCGC@ 18u'B띃 Dž{MX? VSu` ; Džd 16  = fff= tntsff%=tMt7ff= t%Z ΋Ή 떉 = i  W ' /  = fff= titiff%=tHt7ff%= t%K ҍ׉ 렉 = s  UU1=ELFt =OLFtËB%=ufzuzuِUWVSAjjj4] u΍v BF P ЃrStEt/uFfFFrF P Fv B=ttFF=uFF붉F뮃 $Fv1PRPujjjU$ $pSWV蠌T DDTD WDžEƃ 1REPWVuaX 97 V UWVS }u 1ۃVW<uCve[^_ÐUVSPjjuƃxu VÉ4$@ ؍e[^ÐUS̀rUE Phwt@u; EÐU E PE PE PEPhYpO7̀rN8̀rN ̀rUWVSLEU tE1v<CPV9t`SV(tE } vɃ}ue[^_Ë̀rUWVSh؃m3[<E??=̀r/=̀r=ùrUUBPBPBPBPBPPhyuE G^~e[^_1Uh ,뙉RPj2EPu ƒ끐U`E vvst u뻋'49̀r4̀rUVSuv't3VNue[^ÐUWVS ,-]QSEPjE<*$貊$E觊 jSjU*$@Eǃ1tg0E؉}܊1҃tС<TRjEPVǔËE8ut W "1e[^_;}rj`Wt!E܉ǃ uShj=WE WoEÃglBau M FݐF+-=\EeEEX $@t e[^1UWS]۸tJ h.<),<tN1.<9M r"WQh.+F:ty ts tn jcdhfu$J{} t?j{SMtEPWVS0uًEe[^_ÃWV@f~}uf~uUWVSM] 9ˍtff9ufDžffUf[f{tf}Qffu׋f>9w'f;ǃ[,Stv9vڋEe[^1_Ët f,St9ًsff9rNfffuuPmUK낃{t$}SqtSY߃ff]tftff]t fuW#fSuPsUff]tftff]t fu^fUUWVS ]f;~t ؍e[^_ËE@ tU E|B9ss,fCft#f/tA9sfftf/uE 8u^ h5`<tHU 9s2tvffA9su9sfffufE :0$ƒ҉J떃 u ߐUWVSu hPuDžU ۍt.v?*fuՍfSu EPRuU ;tAU B t 1e[^_h\ j+PBBP芑ȋR uuPSu ui렍vU J 9t f*5f*([f؃!fuf[!j]FPJ tf[!t]fff-t؃]uU J f]^]tf-Ãfff!뙃fHE H f?BUE E EE郘vUEf8u1Éuuu PEPRPRމUWVSuDžp}fff/t8ffA;EDžtw\ffftf/u͋puHf;/ωtf뜍W;UDžtwffff/tqte[^_Ãu$u uSuVuWu utʍvDžpJfSu xSuMDžtuE @ tf/tE%=@t?=tE @Ru$PuQu Sutu׋E%=@uȍG;EDžtf/fUWVSLEU E}U uE$ e[^_;]tWuSVuf1ɃfuƉ=[uEf>1Ƀftf1f!tff]tff-t.f9tf]u19EPYEڍvf9wf;{w Eff1Ƀf뿍vUWVS }Wt5KG4tvu&Ku w6Ge[^_à P̉UVS u 1e[^É jbÃ۸t߃ V^t8SáD9mv`J<B@Juh1Ƀt }L8tC։ t;E tE1e[^_C})uE@1ۃE  EՃ PtQu VP$} Dʃhu1ҍe[^_) CSU tJRSVPMU Dă W+Uu7h<딃ht0Pt!?tPhtPh^K9se<]'<-v9sL]t+F9s-tWuYU2JЀ~]u-9s FU>]tjuS uF]UB@t=XKx,ˋGt1t <DKyԋG EtOuFXKx(W!Ј(_KyUB@tG B o w u^Wu; Ht(Wu Ph0ue[^_ÃWu Y[PuXZWu уWu  Ј_`Wu  S9ȋGWWV eFuGB-G-E0HDUFGB-G-E0HFuGB]G]ݍFEPjhuEPjhuuUWVS ] S19ы} s-1Ƀ[:9= S'ƋS9s8-tHU:E,u9vˋG_C9~퐍e[^_Ãj SčH9sx]t x-t SE뗃E-댍vF9Љs|-tc]t^WSK S9s/A9s9=tjShy]uAXjS S9s븃jS뒃jSqF9Љsn-tU]tPWS S9s!A9s9:t jcy]uljSc S9sƃjSJ렃jS:낍F9)N!E ]e[^_ UWVS EEE EE0XN9s+A1҃tС<Tt EύIщ`<)`<`t.1ېPVuu эLyquՍe[^_ÐQSV7u <] uSUVSj=u]  SCe[^ÉUVS] S9swA9s9[tvAЍe[^Ívy.uAj.SZK9ʉs B9s:.tjSM뱀z]uBjS) S9smUWVS uE‹} ^B9s|9sB9t эRv:]uϡ<+}19X}A9ى| VSPTPU‰ЋU; :tSh#<4<1>:D:u X<놃w:^jWGM  < juuVu UC <-uA:t2 :tSh($<1?<:u<뷐xuB U9U 2G1Qhc$<.Ác$< wDGɍ4Ct(w1tѡ<Du Phn$fC>kfS:fJv PFkf~8fF>ftft8FP$O@р|/t /SF(@PFDAPQ7e[^_IPjVW. fF:fHtfF>G$uPjjhn!<F xfN<\FfF:vG$u wuvuVWJrO$ 1f pPUjf~8WF$f~8u>G$t1~f)fV: wutԁO$ 7두F<tDG$u v uu v WD#[ v @D[멐th1Ív3YUWVS ] ۋ}t 7XG% fF:f 1fHufC: EЉCUBCCUtEX]EB]]fC: ƋEątEt*F<t#tvG$tCCfC: 럍CDvG$u?CDCVjSWfC:MăɉmBfv fZMRCCPC(@PCDPu[~몃 SYd^u0[umUfB:O$ U?1e[^_ÉWUU܃DPWu+G9EtEG$tE܉EWE)‰Uh2Uۋ0t Sc uXumEf@:O$ T0d~ F%=. ulEG$tU;WtEԅuMEE̅t} tEԅuUfz8uvG$tIEԅt*O t}ERuuWE} Ef@: wntUfB:O$ whlQG벐UWVS u];^} TVt @uv jSvJV:KtBKAt Ae[^_ÍC(FPvL`tF닋FuFF뾃 P_vUWVS uEH@$u uƻ V^Ã1tQtftUBCEC(fC>B$u DIC@WuCDu Po؍e[^_ÉUSP]ۉt [P_ۉu]ÉUSP]E S9s6CuC'P?]Ív P^ӉCPs^tC1ˋCu C붃 Pn^UESPҋXt vBDJ9t +JBZRuU fz8x*BDJ9t +JBBZuBfx8y[UWVSE1ۅt(1׹эQ9vӃEE8uۍC[^_ÍvUWVSE}@$u t 1e[^_ÐxPS>`Džtu+x9F0u |9F,t=NDžtN0xN0t뉃 S7 ShtPjju Ã۸YCUWVSE9EEYE+]S9Ut'9U[}Ԁ? NF=C͐Eԋ};GtMԋU;Jy G=ew=`v==UB9Et9EMԊ< te1҃t]T_Eԋ};GwH1҃t]T_FuBtvUB9EMQ9Us ]Ԁ{ td9E }Ԋ_1ɃtȋEL_9U]Ԋ 1҃e}T8RFuBvMQ뺍vE}EċV]M%=u%UF9UG] C@]ԄUWVSE EU;BxEMeuhuuuE0nEEE MU;Jk9E9EQ1ۃ E/ t)~'uuuuuU2K ۉEف}t.1tѡ<Du7_t2t*1tС<D_t,1tѡ<D_E-v]EMu.E9Et&uWEPuuU2EEEMAMm1EtE@e[^_ÃuuuuuU2E |v}t6W1tС<D6_-E!EE@>1}EZ0 MBuE@EZ,MBuUU4UWVSE@0U EUM;QzEMeuhuuuE0yEEv MU;JD91ۃ E t)~'uuuuuE0K ۉEف}t.1tѡ<Du7_t2t*1tС<D _t,1tѡ<D_E-vQEMtEEU9Ut,M9Mt$RWEPuuE0EEEe[^_ÃuuuuuU2E 닉}t6g1tС<DF_=E1EUBN1}EZ00EBuUBEZ,EBu\UWVSu Ee;uta}}E %=PD=(=tovh=t?= ^tve;]uE[^_ËE-^wۋE#E E΁}t }^uE#E E^^9Eu뿉=8tUw;=0^u%UB}^hM@tz=@t^=H?vE냍v}^'G=xtwG=`tw,=X^E#E EE#E3=ht^=p댐=t=tH=^E#E E}1%=^E#E}}^eE %=tʍ2} %=uE#E=t=^^}a^}RE#E} E}E#E E^})ȍpEeUWVSlEP BUH$M@H]!EEBEU UM HMU9UMI<ɉMt/E9‰sUM8 C;]r;]]]EU M]UMEEE]UB P=ɉE̸ BEMЋUBEEBAEEkBEEQrjPZ uuuuMQ" Eu]{H, uuuuEP uEڃ}pU9E;XDw8vD D  D CE;XDwUЋMIHu EUBL~Uą~ EąbPjjuuVu]S| uSvU9 uuFPRUR6 PjjuuVuEP) tEt"UEM))։ÉYqA }vF;]sE9EEYE+]S9Ut'9U[}Ԁ? NF=C͐Eԋ};GtMԋU;Jy G=ew=`v==UB9Et9EMԊ< te1҃t]T_Eԋ};GwH1҃t]T_FuBtvUB9EMQ9Us ]Ԁ{ td9E }Ԋ_1ɃtȋEL_9U]Ԋ 1҃e}T8RFuBvMQ뺍vE}EċV]M%=u%UF9UG] C@]ԄUWVSEP,X(U@0U EUE;PRUUQpjSLE_ZShSuPU2UËpSu@EEEUE;BUEE؋H9ɉދ}uUU11} B}} }t"~ SWSuuE0N9 t0}1}tU<Du:}_t4}t+1}tU<D8}_.}t+1}tU<D}_{E<uTU9UtLUVpSun?U puSZ?ZYSuuuuE01E dUE܉BU<t E@e[^_1SWSuuU2à _t8};1}tU<D}_E@)1U؍r0 UBuUBEؿp,E@uEyEUWVSEP4X(U@0U EUE;PRUUVpjS_IEZYShSuPU2E }UE;PuE1 EM#}  }t&~$SuSuuU2N3 ށ}t.1tС<Du<_t7}t.1}tU<D:}_0vt,1tС<D_E-v}E<tUU܋UHM9ɉދ}tLE9EtDPuSuP<U puS<<^_SuuuuE0EeE܍e[^_ÃSuSuuU2à a}t8}>1}tU<D}_EEUB"1}Er0EBuUBEr,EBuEE&UWVS u ;utUEP %=P/=(=tlvA=t?= _tF;]uE [^_ËE-_w݋M]D_ˁ}t _}u]UD_9EuUMD덐=8tiwC=0_u%UB}_XM@vd=@t=H_+MDLUd}_!=xUwW=`tEw,=X_ET1M=ht=p_뇋]=t=tT=_v]]E\]S9%=_A1UM0EE_E %=t MM9 %=uU2MU =t=__}_}]T1]D)ʉM  ȄɈ_VN+Ep?vUWVSE8e} u]MP u:Et [^_ÉB(uz wMU[^_>M]u} U[^_61̀rUWVSuEPEPEu:u^FPuO^e[^ÐUWV}Su Cv B8tu)C[^_ÐU`<ÐU E EEPhvtu-Ð{Òrk̀r[$̀rUVS]ۋut%>M t vB:uAtBKu[^ÐUW,U1эAE܍E؉EEPh;}w1Ҹu9vU:t1ҍve[^_ÉutJ19sSuFU]9EsuU:tU뻃 E 0U Ut u늅t V@ÃE ۉtPVjS nhpc8dGX3Phhn! Stt tI1P1e[^_à u "뎉x @%=.S‹Pu6 t^tl9u 9\dd/)LVLPu$E; hDžX!E}1ULaUWVSjj}7%]t e[^_ÉwW8GYw @<$8$XZjS\벐UUVS] PuPiu)e[^ÍvUjuÉUVSxjuuÃ1t9EPScuE%=@t S 1e[^ÉRjjS@tu j tbt PFF t& E VFFF"F놃 VXSuo UVS ju6Ã۸t4 Tt u뻋a[< )PRSu~! x u 4u4VU1U ڊD;@C ȋu܃?2~EE@}?~EEmȀ}~EU`4<-6P+v1Dž0/ӥ00v1߉эLIwD< <(WPSjMQF}у.`Avȃ ÍXW2 $ujURW1^ ;0s&PSuWd jMQWFT ;0rڍ8fDž61$P6PjURF$$v1vQjSWFa ?v1}T LF  TvÀ.@p<$Ap<2t.Bp</Ph8<Ɔ@p<$Fj@pҹqP.@X@D@TB@T@D@n!HPDP9붋<;H}/@9<~ <@D<HPDP붃V tX<;H}/@9<~ <@D<oHPDPj붃@tX<;H}/@9<~ <@D<BHPDP 붋<;H}/@9<~ <@D<HPDP붋<;H}/@9<~ <@D< HPDP]붃tX<;H}/@9<~ <@D<5HPDP붋<;H}/@9<~ <@D< HPDP붃@E%MA t)ƒUЋEЅt +EЉEЃ}mEEEƋ}܅~uu E~VuE])E̅EEE~uuEEMMEuuvY[u0uEcXZuux  VBuuu Eu-u]u EEMԈU@9UЉEt[Pjj uM9MEt-Vjj u jj uEEEWjj QEEjuZYuPEn~DMU:9tEEv|9Mt ME89t؋|E1uEuMM90tAM?}9tE@UM9AM뀅~+juZYuPE~Eԃ}:tŊEuEt}9t~EԊUԋM낉Puǃ; qEEH}ƍ  ^_juREvuu]E 0EԈẼ9ESjj u(EЉE뽃}E̅ jjuPuE4uuQjj uMU҉Eu MĉMPjj uE}9EUUU%NMEu"EuEtEFEESu7ECuU)‰UE+]]]1Ut 3E|E6M)Mj}ptU4<48M<݅pݝpp}拕tfE ENR@ )j)ƍPSDžv<Dž$Eg*87t W<$ j3jVP7A )87tWjw w)‰)QjPjDž<DžDVmt/%%B%FBF`uTh<]sYuTh<,6<;.EPSú{ut &V<&V<<,<;JE1ɋX19U P=A9|19}s}PuA9|19}OU P}\u E)DLP؅uA9|EU؉LǂPǂTE؉`ǂdMAMhBUMQ Et }DA Ex wGPu]LuS|}U\u 1ҍe[^_ËE@VPuSPۋLECPSaútC<,uURS?t8uMAAE؉LǁP}G}TE؉Ήˉ`ǁdǁhEEuEPuuuURuuv 9~s>CC1Eu'dEיuEיu@U<)EE}g2>C닋E-ECj>S]8>]+MCM}}EGGE؉LLJPLJTE@EM9QM8>+}C}US ]ShT uEt {t[u uRsPEPVu`@tEFȃ u VuWVuUEu1҉à u fU BuݐUWVSU B PuÃ1tRC M CRqjP[M ASACSC BA qCuP؍e[^_U ju uÍvUWVS ] 1ۋut Vtt e[^_ÉV S]x=twfЋMuFt t1떋FfPuXF qUWVS,}1u] }SVtGtt@uEe[^_ÐUWVSlEE}1Uȋ] EUj uEtBUhsE$X<< u<<<ʐE^뀊Wp u<{uhuS/ ÃuEԋUBuEEG  cPujVo w7ۈs;usF+E e[^_ËMt M]tEN뾐GuG뎍N;MsA뚉UVSu ]9s#Stu#9s Bu9w)[^ÍvuBUMw51tѡ<Dtw <DHÉUWVS EU9ЉEsVEEUU2Gt(%tK=u,? Ƌ} 7Gu؋U:tEE9Ere[^_ËE+E vNx5U<.t<\tG PE$ G9uNy̋E0@Eu?t.x놉BUUVS]CҸ.t?v C.t+.t .tu1BvBv B1 wvɉЉuľ[^ÐBvBv܍BЃ v1-t؍vUE8*t EhP.t uÃUVSM1t3At!vB߃]w@u8.t\t&Au1ۃ.t v[^ÉM[^Ӑ11UUBt!1Ƀ]w BuÐUEf@ UMQ Q Q ÉUUЋM fQÉUMȋU BBJÐUUw <DPUjÐUWVS,h@< t:< t< t<,t tFՉtC1<:2USjEP]x tE‰Ћ]ÐE񐐐Ujjuuu u_(ÐUWVSM uӊ\UfJ ZPrTURЉT)֋UR0XUB<)֍vXT֋Uz8B)1)։\Uz< 9d 9`19dq|9`sg`)ڋ\)׋]{Xt1؃@9t R运S0XXEfH ߋUfJ N]CLHЙdj!֋`V!SEpl!Ѓ@UBB0BXt.E@9t R)UR0XXUfb ߋ`) RG]C9);CEP8)׉\1)TujjjUrl!Ѓ@EfH EPfH T@0XxPUBPkpEtU`dW]fK 2 u)zE u-]fK ؋pT[PtMURЙ)֋UR0t UB<)֋E@\ptE`tUtʋR)Љ\ċUR\jjjUrl!Ѓ@ֺEfH LmCUE uRPuIÐUWVSuFU t/ BMUUҋMt~9‰tAuFu1ۃ[^_ÐUWVS}]t(I@w}tMt }~ve[^_ËEUMQS(ƒҸuˡt I@w}t }~e[^_ËE UM$EvURScƒҸu V~u <tvtJAG?u)אUWVSXj uu+ jdtf~E$CUC CCFCFCF C jEP胍EjE jEčC0PsLUVUEE EPV( uECu*t Stt Wt1e[^_à E01Oĉ VCPPCHCP@u2h} h{ SuuVH G<_똃 VЃQjjj#UYZjP UxRjVPrNx C< VefFEe[^Ð<Chu'U9tuhjH@t1H 4>H@uσ >/8USPE UuUҸtZ4u1]PjjSu S-t ҍvǃ0w/ݍvUWVS}4u 1ҍe[^_ÃaGj hv< G@YXSW$jhSVO t1=uIv8u C~{ jj_P8W h tM.O.,+USPEXEM Uu]UME ]F.ǃ,]UVSUEҋu MXtuDt1@MuE ][^-ǃ,[^-ǃ,USPE}Xw7tju jS9]-ǃ,g-ǃ,UWVS,UREp MU܋ jj RQPM1PuEtt}}OE@EЉEEE9UU}0MfYfg)9utiEEE9E|҃} w} s]ce[^_uuuuGau Ma1ӋUbōvEԋ}9u؉NjMu} rD} t2} PuuuZrE`뒋}gXE@EЋUfDPfv!EЋ]}UzTz)ЉC볃 juRuu/ RuuuZuuuuuG`hMaff uuuuuN Eu]EEEPu2ftLjuPuEt%PUЉU MEE]s }g\]]vjuUPulEt%HMЉM]EE}w ]c,HUWVS UEҋXtt $1ɋ 5H(f|Qu@jPQPS Hǃ(fyuf9uǃ $tf9tf(f|q qBU fqvjDq)ЋU B DqBUTqq)ЋUBf;9v&$ǃ ǃ(1ҍe[^_lj(C 떃 juu PS tƍv$S(9v9։$ǃ$jjVSut Hf9uFS(9ǃ(v맋S(뢐ǃ$ǃ(ǃ ,H(ǃ,UWVS uF(@EF(#F0EN};|aV9|,QSPPtu^jvztPF( @PB‹F 9~ DDDDV F,9Ev F0 EF,SuuV We[^_ÐUWVSuV} C5t1PWE0SO) VjPR^E05Ee[^_ÍvUS u]u #C,;C(~#C0]ÍvUWVS]js} otOjKPPEt319}#Ku B9|1e[^_N& 0S>&0ڐUS]M CCACAACACACACAC AC A C A CA CA CA C AC ACACACACACACACACACACACACACACACACAC#A C"A!C!A"C A#C'A$C&A%C%A&C$A'C+A(C*A)C)A*C(A+C/A,C.A-C-A.C,A/C3A0C2A1C1A2C0A3C7A4C6A5C5A6C4A7C;A8C:A9C9A:C8A;C?AA=C=A>CEA?A@EEA@EAAEABEAC1ҍ]uDDECDDCDECDFEDGfQfEFQEQB~L[^UWVSEU zM@EEEURUffDGU@ЋE9~fEfDGfMf)VSfEu8PI)]]7EFfwFf7M6f)ȃfDWUfTGfwY[u uWE U ҸdE7u|fDwfU9~;EfUfTwfMf)SSu8PfUIIE])]fwfDwfUf)TGMfLGvE HxffDGUfDGuvU9~;EfUfDGfUf)SSfEu8PH]7MFf wF6f)ȃf7fDWUfTG)]u4fwE HffDGU`1e[^_Éfwu udVE M ɸtЋM y뤉EU;B.fM%EM;AlfDwUWVS u ^1EfSBfwEfffDCNjVPutWu]Mɋ^tfCfufҋM fDSY~fCfCFAfUUfB f+EfDKMfA fDSE Ht VQp\t9tWuY\UJ81e[^_ËE @녉ff|CIUWVS E @EUMUM]UufC f rf);U Ef|pt9;Uu%M]KƉ9}8‹Mte[^_uƉ9ۋ}8¹uju ])]MUDQPuE tX]EufKfF f);UOEfxz9$8v<%</< <l<|<p<< ]C E1ҋ5HtC;u+]tK9s1ҍe[^_;X9r ;XpE {R9vC;/tKxPVR1҅/uE%=@t u뀋E Shh VlU Q78A 1҄5Zu;t$aC1҃tС<Tu%zt1;tAaAYaQMt#hVg]xPVKt1҃8|vEK4%1BA~BGK9e;Xt[F ș0gfff鉕\\XK)9;XuUWVSjjLWXR fGHfGEf|GMfA fEf9UfEfw;]wM)MDw8EwTw)ЉEftwPQSufu蔦;E MfyvEETQ9uu'EtcPMPQ]SUR3EHfEff9UsEf|G1f9U}tuu 1ҍe[^_Ív]PSEPQ딋]f{vEETS9vAuuoEtH]PSEPMQ{UJCPEPURSf+U Gff]f)É؃fDWfUfTGjuQuEĺ)MUxfA fEEtuQ ]fC UĉUfEVPu Ep Puuu U܉U]ۺ]؋MIۉM]UCUċM1҅ɉEvMċy]MffC EvUWVSUEMEUM} wEfffNfffwfu%ffC fFfC fF1ҍe[^_Á{tEt8[ ~ڍ}ٍvEGGBGBEBIuffEEEFX9UfNfEBNEDNA9~i;E9OLE @P衶|@M CEEx/)EM E Ѝe[^_ÃE}WEu jPu1҅uɋuECDD~FuUMD@DD1HQ D@눉Pj1h{ ..., where is one of: J<5_'_g_'_m_$OpenBSD: restore.c,v 1.14 2005/06/14 19:46:05 millert Exp $ h)hjhi9i jguiii5jQj5j j5jQj$OpenBSD: dirs.c,v 1.30 2005/04/28 16:15:45 millert Exp $$OpenBSD: symtab.c,v 1.15 2005/06/14 19:46:05 millert Exp $$OpenBSD: tape.c,v 1.31 2005/06/14 19:46:05 millert Exp $¯֯kkMhv/J\q~$OpenBSD: utilities.c,v 1.15 2005/06/14 19:46:05 millert Exp $$OpenBSD: dumprmt.c,v 1.23 2004/11/04 20:10:06 deraadt Exp $TMPDIR/tmp/b:cdf:himNRrs:tvxyillegal blocksize -- %sillegal dump number -- %s./restoresymtableCalculate node updates. Begin incremental restore Calculate extraction list. Begin level 0 restore /dev/rst0 directory is used (useful with ``ls'') files to be extracted cd arg - change directory ls [arg] - list directory Available commands are: Debugdebugging mode off debugging mode on %s: not a directory %s: not on extraction list extract/ runcmdshellsetmodesverboseverbose mode off verbose mode on whatgetcmd%s > %s/%s%s: %s: unknown error! no filename match. glob() aborted. missing %c ./%s%s: name exceeds %d char printlistdirectory reopen failed ls: out of memory %*d restore interrupted, continuedir %10d %s addfile%s: not on the tape ./%u%s: REMOVE Mark entries to be removed. [%s] %s: %s [%s] %s: %s|LINK [%s] %s: Extraneous name [%s] %s: impossible state [%s] %s: inconsistent state cannot KEEP and change modescorrupted symbol table |NIL|MODECHG|NAMEFND|INOFND|ONTAPE%s: remove unreferenced name unreferenced with flagsFind unreferenced names. cannot remove, non-emptyunexpected file on tapeunknown file on tape %s: not found on tape %d: bad first Extract new leaves. Extract requested files createlinksAdd links incomplete operationsCheck the symbol table. missing inumber %d type should be LEAFWarning: missing name %s %s/rstdir%d-XXXXXXXXXXextractdirsopendirfile%s/rstmode%dcannot create modefile %streescanpathsearchputdirreclen not multiple of 4 Mangled directory: error reading directory set owner/mode for '.'fopencannot open mode file %s modefile not defined genliteraldir%s: cannot create fileno memory directory table addino: out of range %d duplicate inumdeleteino: out of range %d deleteino: %d not found lookupname%s is not a directory %s: pathname too long duplicate entry link to non-existent name bad name to addentry %s not marked REMOVEDlink not foundlookupino failedfreeing non-empty directoryfreeing referenced directorycannot move ROOTno space for string table bad name fwriteCheck pointing the restore highIncremental tape too %sno memory for entry table Initialize symbol table. /dev/tty/dev/nullno header after volume mark! no memory for file dump list Cannot find file dump listmaxino = %d Cannot find file removal listbad block size %ldcannot stat .Tape is not a dump tapeWrong dump date got: %s wanted: %sMount tape volume %ld Cannot open %s getvol towards the first. with the last volume and work%s%s%s%s%sSpecify next volume #: You have read volumes%s%ldactive file into volume 1 Wrong volume (%d) tape is not dump tape Warning: %s %s ioctl MTFSFDump date: %sthe epoch Dumped from: %sLevel %d dump of %s on %s:%s Label: %s %s: unknown file mode 0%o %s: cannot create fifoextract fifo %s extract file %s unextracted directory %s extract special file %s skipped socket %s not at beginning of a file getfileran off end of tape hole in map End-of-tape encountered Tape read error while trying to set up tape restoring %s trying to resynchronize skipping over inode %d mid-media short read error. continuation failedTape block size is %ld tape read errorgetheadNote: Doing Quad swappingNote: Doing Byte swapping Dumped inodes map headerFile header, ino %dEnd of tape headerUsed inodes map headeroldbegins with record %dfindinodeunknown tape header type %d unexpected tape header mktempnameRSTTMP%s%ld%dnot on ino listrename %s to %s cannot rename %s to %snewnode: not a nodeMake node %s removenode: not a nodeRemove node %s removeleaf: not a leafRemove leaf %s linkit: unknown type %d symbolicCreate %s link %s->%s bad entry: %s parent name %s entry type: %s inode number: %d flags: %s next hashchain name: %s next link name: %s next entry name: %s sibling name: %s |EXISTED|KEEP|NEW|EXTRACT|TMPNAME|REMOVED%s is not on the tape %s? [yn] abortdump core/etc/rmtwho are you?shell/tcp: unknown serviceinvalid user name: %sO%s %d rmtopenC closeR%d rmtreadW%d rmtwritermtwrite0L%d %d rmtseekI%d %d rmtioctlrmtreply(rmtgets got "%s"). block size must be greater than 0dump number must be greater than 0%c and %c options are mutually exclusiveVerify the directory structure none of i, R, r, t or x options specifiedusage: %s -i [-chmvy] [-b blocksize] [-f file] [-s fileno] %s -R [-cvy] [-b blocksize] [-f file] [-s fileno] %s -r [-cvy] [-b blocksize] [-f file] [-s fileno] %s -t [-chvy] [-b blocksize] [-f file] [-s fileno] [file ...] %s -x [-chmvy] [-b blocksize] [-f file] [-s fileno] [file ...] option requires an argument -- %c%s: unknown command; type ? for help If no `arg' is supplied, the current help or `?' - print this list verbose - toggle verbose flag what - list dump header information quit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%scommand lines cannot be continued Warning: undefined file type %d %s: (inode %d) not found on tape deleted hard link %s to directory %s NODE and LEAF links to same inodename/inode conflict, mktempname %s Remove old nodes (directories). expected next file %d, got %d Continue extraction of new leaves Root directory is not on tape cannot create directory temporary %sExtract directories from tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s reclen less than DIRSIZ (%u < %u) bad seek pointer to rst_seekdir %ld corrupted directory: bad inum %d corrupted directory: bad reclen %d cannot find directory inode %d error setting directory modes directory mode, owner, and times not set Set directory mode, owner, and times. write error extracting inode %d, name %s write error extracting inode %d, name %sCannot find directory inode %d named %s no memory to extend symbol table cannot find entry in parent listoutput error to file %s writing symbol table cannot create save file %s for symbol table initsymtable called from command %c cannot read symbol table file %s cannot allocate space for symbol table cannot stat symbol table file %s cannot open symbol table file %s Cannot allocate space for tape bufferno memory for active inode map header read failed at %ld blocks Tape is not volume 1 of the dumpConverting to new file system format. Verify tape and initialize maps Changing volumes on pipe input? Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. Volume numbers are positive numerics Skipping %ld duplicate record%s. read %ld recs, tape starts with %d End-of-input encountered while extractingCannot have multiple dumps on pipe input%s: cannot create special file%s: zero length symbolic link (ignored) Missing address (header) block for %s at %ld blocks write error extracting inode %d, name %s writeseek error extracting inode %d, name %s lseeksymbolic link name: %s->%s%s; too long %luunallocated block in symbolic link %spartial block read: %d should be %d partial block read: %ld should be %ld Tape block size (%ld) is not a multiple of dump block size (%d)gethead: unknown inode type %d ; predicted %ld blocks, got %ld blocksFile continuation header, ino %dVolume header (%s inode format) resync restore, skipped %ld blocks Checksum error %o, inode %d file %s mktempname: called with TMPNAMEremovenode: non-empty directorycannot create hard link %s->%scannot create symbolic link %s->%sLost connection to remote host.Protocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. |G<G< <L<G<I< <<G<H<r< G<9< << G< *<I< I<G<G<:H<H<H<H<H<H<H<H<H<H<H< H< H<#H<3H<#H<3H<2H<3H<3H<#H<@H<@H<@H<@H<H<H<H<I<I< I<I<I<I<I<I<!I< I<)I<(I<0I< /I< 8I<@7I<@?I<>I<FI<EI<MI<LI<TI<SI<ZI<YI<`I<_I<gI<fI<oI<nI<vI<uI<I< ~I< I<I<I<I<I<I<I<I<I<I<I<I<I<I<I<I<I<I<I<I<I<@I<@I<@I<@I< I< I< I< I<I<J<J< J< J<J<@J<@J<J<$J< #J< ,Jundefillegal gfmt1 option -- %sillegal gfmt1 optionispeed=%d:ospeed=%d %s=%x:oflagospeediflagispeedcflagcbreakcolumnscookeddeceverythinglcaseostartrowssaneillegal option -- -%s%d %d TIOCSETDTIOCSTARTTIOCSTOPcs5cs6cs7cs8-cstopb-cread-parenb-parodd-parity-evenp-oddp-pass8-hupcl-hup-clocal-crtscts-mdmbuf-ignbrk-brkint-ignpar-parmrk-inpck-istrip-inlcr-igncr-icrnl-iuclc-ixon-flow-ixoff-tandem-ixany-decctlq-imaxbel-echo-echoe-crterase-crtbs-echok-echoke-crtkill-altwerase-iexten-echonl-echoctl-ctlecho-echoprt-prterase-isig-icanon-noflsh-tostop-flusho-pendin-crt-newcrt-nokerninfo-kerninfo-xcase-opost-litout-ocrnl-olcuc-onlcr-onlret-onocr-tabs-oxtabs-onoeot#%d disc; lflags-extprociflagsoflagscflags%-8scchars%s = %s; %d rows; %d columns;speed %d baud;tablet disc; strip disc; ppp disc; slip disc; -aefgaef:gTIOCSWINSZtcsetattrgfmt1illegal option -- %sTIOCGWINSZTIOCGETDnot a terminaloption requires a numeric argument -- %smaximum option value is %d -- %soption requires an argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:ispeed %d baud; ospeed %d baud;usage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.12 2005/04/15 00:51:57 uwe Exp $LpppppppppppppppppppppppppppppppXpdpppppdppppxFfhnslinkitusage: %s [-fhns] file1 file2 %s [-fs] file ... directory @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.95 2005/04/30 07:09:37 deraadt Exp $$3>Iit0mohHlxh)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)h)f h)h)h)h) h)h)h)h)h)h)h)h) h)h)h)h)h)h)h)h)h)h)!h)h)h)h)h)h)h)h)!"K##9$h)z$f h)h)h)h)$_%h)%%M't'h)'h)(&h)y)w<o?{\5e͠ۼSm^e-y]ivZdEz~3dO]vo˯:k3s__g%'l&;eYc0uκL?uV7H'D_'цTʪ6-j䟘]M%_g-Ƴ}}5H^3v@jEK5>//&[!9SWZЯ/5>(1<;A9`I;?~8 PMhumn;^^mMy۶4>dN>`6bh,{sQ'2;~Apm3( 䫶ߪU;||ب^La5þP<9!@Ut ,s;.|<`u].X抷v4ܲ1`0- fjO/i޺-XYZ šR7C<듣pH^U[ApH1UvUl+0SLDU5lV.w?%|K;3.LÞQuE_2g,0ru$ t٪~X#rMƒ~S^T p x|4 K /K [X)Uo5z8U0^[fJAeч+x&0ڇ;__|mE@SAݙTF#R=;3 kc7RvMD0ZAoٰDޚAKFBÔ*KB)0)Ǟk0|8cjz0*CΊ "u#B%N<;Wpkr#\5! ]CQֆM)V3튠I74=ix\  xӅoc9^,Ni(nI "2vgsΙ%|Ξ:'C@O]gr}eCܑ3$E QaiJ#d"T{jZgPI0Z5' rV}1|blNP(_(D2)=b.ȃ8Fys)n}@Z'>ňo2J`'>IG@/=dۂ7ԈL@CSkk .y!2,ף1-&!)j5- h[(PU`}p+˵foAjbk.円)=C^A8.uUl)meu~x8VHQlRh#>Dw6uټnv 0 ᙜzCQ%dA=O!޴G/qG·G@bGi&Ix -V#؈m)ˤz;${X+'•4FѺ VW^Xw1oED/U.N|\~01b+1w۱!/- ;`[ͺ]xW֋U X&Y;ejʡvAie~SKG!7{r#ݺ gWoF`⿌A&PGx `3oBO.i6 8'neL̙c j8+@57w~/>=au :F6,HC8 s'?-sA?h9U_!6)wjb^9C$ ϟ?aA zKS5sǸiA΍;8Yѵ6$svl9"lzВ=*Lqļ^;$Zp챾Nn,-!UFO5\yt2p9蒱K NrY8 ]<?f)5&u%W)>9(I%]@P{yaT_PRp 8ߡ0GY$J뎬 up ϧ}OO|F(r/۲m_krlXvڐsSHvuvq]^gW$(ˑ ^{AX>L'zǒa&[e0߀>XOVX |uz#Qؾ$650E!bV2d26IQ-4z.\NA'- U\w =}~ 4Z%'UK)P^)ECb`;_CpIUpIǤuISADדu؜&^U"?7dO\'ejF+d/aGsܵqP+Ƥ ;~L[]E T%#Ԥo t&*iF1;Q1P 7! nڱ.w}wUsȜIc8Q/- k^lg|6$߀݅f;VxtHfbD_uJd;c6FUlguٞfqTcVPH.u1\Fc4UƂPq(' if@gL/5vaD`| ;@X{} w}&&x[ pElP0Ǵ&台;}= jH? KVh'y8,iZs޹4&)C^s'S'iq'5㕩\T} %֨H%G߭~@C"YRhP,ǂ!qI5ŝ=q{cSZ$cҩcB7O,n*EݮV3qQŃđwL(S 'gLFȤPYp,§c钎*uBhdUށj]EqYҸ͢Fk>\k"7Cgԝ_gh&Vz؂@iAKrc.tr`zMI>4 iKiVpm *4 TQݵI=й.p {gZR6]m )|;YZe{f|"W(MzzuM-KТ\}ьܬsf8(7on.=.C.)q7S9R]z,)]a\:u_&܊ CU) XetGHjMsV rL4zZCB4?(gD ؠjHO(6HFocHj^ZI9 $9ɊLG- _@6X)ҝ"c{PxmH?:Cevص9/' P|R|ԮJ)35GM!;3<Ħc7qBMC QەE~W'=ɹVqO"ky(}"2H/xT Tdȹ};T! b%:/بYlpuWtߙf3yz-=1ns8RL $s0o:ُz`-Ope_Ln|ʡkJګ8= :9Sp|J J3 `c֝W0rK1kS;kqA=EI4ݤI~}{]|}7AS=O|:VJc'O&4|3KqnK]}^o3l|C gBXOZ|Ѯ D[*mthwgiD>G77_ :&ޚl{L0 _3K !7-Ÿ7Ƀ 8}=yWVƼޣY>1hݍf挒;6(]7{ MO,jrso\2=n?X$o)I>ڒ }Gnsd60YmT-7k5؋&z:5Gk b֋ Qt@澌 ejڱ5.L"ޡy4 ҪŔuNCsPqGt< /ch8]!OHx`\@,;>8jPF< ;4FiS{FGr7;,UxX<`T:wJySHvW'*Rk1s_ΒÄީ`?{b]c ߍdI3ۇk[:A:Km/!Џ0̶(W8`? O}eķ$<ɑ)ؐucQVRgyh++`Q*w`nOqA3"(I!\:<  ؄(! q}璣 v0U|ֺܿtS꺌Îʘa*5U)%: bsB, tZKXB+X#t0fQK=C ϰ xx@Z@1dH_,2\WĬ#N}=P7GAJ[9MIVOPul?>1108%G% A$CۜX~9X~cV\KI«Ȁ"٣2qFаؾ %C8Uf;RW".W-(]칢V:%.ˑa=;n[q3^9{D?='awa9X&YD&XvL1MHN ^~Wu >;Kpl߶QM.e.Ai؍Euvt[nƪ1tRQ;zkc$Az_*y@L<[c-W?_ԶEI7۳qYA| rf⹄%d| 7Rbs[叾>vԌPbSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDFadosBEf:NRWb:cdenp:rs:tvwbckmgioctl DIOCWLABEL/usr/mdec/unknown disk type: %swritelabelioctl DIOCSDINFOioctl DIOCWDINFOcan't read master boot recordno disklabel found. scanning.no disk labeldisk label corruptedfound at 0x%lxioctl DIOCGPDINFOioctl DIOCGDINFOioctl DIOCRLDINFONONE%sboot%s%s%sboot\ :se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%hu:%sil#%hu:p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:t%c=unknown%d:d%d#%u%sts#%u:%shs#%u:%scs#%hu:%ssk#%hu:%.*s| %c: %13u %13u %7.7s%19.19s# %s# Cyl %5u-%6u %5u %5u %4hu %5u %5u %4.4s %7d %c: %12.*f%c %12.*f%c device: %s disk: %.*s label: %.*s bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u free sectors: %u rpm: %hu %hu partitions: interleave: %hu trackskew: %hu cylinderskew: %hu drivedata: free bytes: %.*f%c total bytes: %.*f%c badsect ecc removable# %s: # Notes: re-edit the label? [y]: editNo changes.EDITOR-cfailed to start editor/usr/bin/vi/bin/sh # IDEline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsbytes/sectorsectors/cylindertotal sectorsrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: too few fieldsgetasciilabelline %d: unknown field: %sline %d: bad %s: %sline %d: bad # of partitionsline %d: syntax errorsuper block size %dboot block size %dcylinders/unit %dtracks/cylinder %dsectors/track %dsector size %dmarked as FS_BOOTcannot install boot programcmplabel [-b boot1] [-s boot2]usage: /etc/disktabfdisk(8), installboot(8) PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sEnteringExiting%s expert mode Write new label?unable to write labelNo label changes.Recalculated free space.FilenameLast change undone.Nothing to undo!editor_addpartition to nameCommand aborted partition to modifypartition to deletenew sizeInvalid entry partition to change size%s: [%s] %s: [%u] getuinthas_overlapValid types are: "%s"label namenumber of cylindersedit_parmssdrzFLOPPYxdhdCCDVNDsvnd0123456789Possible values are:"IDE", Disk typeSize ('*' for entire disk)Available commands: p [unit] - print label./dev/mpsave%s%c %s %s rw 1 %d Size of the partition.cpgFS typeFS type (decimal)Can't get bios geometrysysctl(machdep.chr2blk)Can't stat deviceBIOS geometry not defined. DANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.writing label to block %lld (0x%qx) Erase the previous contents of the disk? [n]: %s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Labeled partition or 'a' partition must start at beginning of disk%s: Open partition would move or shrinkwarning, DOS partition table with no valid OpenBSD partition# Inside MBR partition %d: type %02X start %u size %u reading label from block %lld, offset %lld bootstraps: xxboot = %s, bootxx = %sBootstrap doesn't leave room for disk labelAutomatically generated label:\ :dt=# %13.13s %13.13s fstype [fsize bsize cpg] headswitch: %u # microseconds track-to-track seek: %u # microseconds # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) line %d: warning, unknown disk type: %sline %d: warning, unknown filesystem type: %sline %d: bad partition offset: %sline %d: bad partition size: %sline %d: bad partition name: %swarning, unused partition %c: size %d offset %dpartition %c: block size < fragment sizepartition %c: partition extends past end of unitpartition %c: offset past end of unitwarning, partition %c: size 0, but offset %dwarning, number of partitions (%d) > MAXPARTITIONS (%d)warning, super block size %% sector-size != 0warning, boot block size %% sector-size != 0warning, revolutions/minute %dboot overlaps used partition %cwarning, boot overlaps partition %c, %s disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) disklabel -B [-nv]%s disk [disktype] (boot) disklabel -Bw [-nv]%s disk disktype [packid] (write) disklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. `packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s You need to specify a type for this disk.No 'c' partition found, adding one that spans the disk. Initial label editor (enter '?' for help at any prompt)unable to get default partition tableThis option is not valid when run without the -f flag. Write the modified label to disk?In no change mode, not writing label.Name of the file to save label into.Unknown option: %c ('?' for help) can't run when there is partition overlap.Partition must be between 'a' and '%c' (excluding 'c'). Please re-enter an offset and size for partition %c. Partition '%c' exists. Delete it first. The letter of the new partition, a - p.Partition must be between 'a' and '%c'. Partition '%c' already exists. No space left, you need to shrink a partition You cannot name a filesystem of type %s. Partition '%c' is not in use. The letter of the partition to name, a - p. Please re-enter an offset and sizeWarning, need %u sectors but there are only %u free. Setting size to %u. The letter of the partition to modify, a - p.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. The letter of the partition to delete, a - p, or '*'.Partition %c is currently %u sectors in size (%u free). Size of the partition. You may also say +/- amount for a relative change.Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk The letter of the partition to change size, a - p.Rounding to nearest cylinder: %u Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE)."%s" is not a valid disk type. 15 char string that describes this label, usually the disk name.The Numer of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).The total number of cylinders on the disk.The total number of sectors on the disk.Not enough free space to shrink by %u sectors (only %u sectors left) The rotational speed of the disk in revolutions per minute.The physical sector interleave, set when formatting. Almost always 1.You may want to increase the size of the 'c' partition.failed to sort partition tableWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.The start of the OpenBSD portion of the disk.The size of the OpenBSD portion of the disk ('*' for the entire disk). Treating sectors %u-%u as the OpenBSD portion of the disk. You can use the 'b' command to change this. The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [b|d|u] - use [b]ios, [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. q - quit and save changes. r - recalculate free space. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. Starting sector for this partition.The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Sorry, there are only %u sectors left Size may not be larger than %u sectors Size of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be at least as big as fragment size. Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as page size (%d). Number of filesystem cylinders per group. Usually 16 or 8.Filesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Where to mount this filesystem (ie: / /var /usr)Mount points must start with '/' You must enter either 'd', 'b', or 'u'. Note: user geometry is the same as disk geometry. Enter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.[d]isk, [b]ios, or [u]ser geometry:50?$OpenBSD: ar_io.c,v 1.37 2005/08/04 10:02:44 mpf Exp $[[0__`\]]\]$OpenBSD: ar_subs.c,v 1.28 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: buf_subs.c,v 1.20 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $$OpenBSD: cpio.c,v 1.17 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: file_subs.c,v 1.29 2005/04/25 19:39:52 otto Exp $4`|$OpenBSD: ftree.c,v 1.26 2005/04/21 21:47:18 beck Exp $@@@@!@@..@@$OpenBSD: gen_subs.c,v 1.18 2005/04/28 06:58:07 otto Exp $$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: options.c,v 1.63 2005/06/02 19:11:06 jaredy Exp $HHHHHHHHHHHHHHHHH+HH&RHHHgHH|HHHHHHHHHHH#UgHyHHHHHHccc-cccccccWc~YYHTcr$3=L[jy$5&5DO^wXXXXXXXXXX X"WXWXXHXXWXXXXXXXXXXXXXXXXXXXXX 9HXXXb%$OpenBSD: pat_rep.c,v 1.30 2005/08/05 08:30:10 djm Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.28 2005/08/04 10:02:44 mpf Exp $$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $0 0  0  0  0 e 0 7 0 ! $OpenBSD: tables.c,v 1.23 2005/04/21 21:47:18 beck Exp $$OpenBSD: tar.c,v 1.39 2005/06/13 19:20:05 otto Exp $0#"%%0#%%%%%0#x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)p(p(((7)L(x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)x)))/, / ////////$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $Cannot write an archive on top of a directory %sFailed open to read/write on %s%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. %s: unknown format, %qu bytes skipped. %s: Waiting for tape drive close to complete...Unable to truncate archive fileCannot append, device record size %d does not support %s specCannot append to an archive obtained from a pipe.End of archive volume %d reachedFailed read on archive volume %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDFailed write to archive volume: %dUnable to append, trailer re-write failed. Quitting.Write failed, archive is write protected.Attempting to recover from an archive read failure.Unable to recover from an archive read failure.Cannot allow updates to an archive with flaws.Forward positioning operation on archive failedUnable to seek archive backwardsReverse position on previous volume.Unable to obtain current archive byte offsetReverse positioning on pipes is not supported.Unable to backspace tape %d blocks.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace over tape filemark.Unable to locate tape filemark.Cannot determine archive tape blocksize.Unable to backspace over last tape block. ATTENTION! %s archive volume change required. %s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Switching to a different archive Input archive name or "." to quit %s. File name too long, try again Illegal file name: .. try again %s ready for archive tape volume: %d Load the NEXT TAPE on the tape driveCan't fchdir to starting directoryCannot mix current archive format %s with %s%s: Reading archive to position at the end...Destination is not a directory %sDestination pathname too long %sCannot access destination directory %sArchive I/O error. Trying to recover.Archive I/O error, cannot continuePremature end of file on archive readInvalid header, starting valid header search.Unable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d larger than POSIX max %d, archive may not be portableWrite block size of %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size %d too large, maximium is: %dUnable to rewrite archive trailer, cannot append.Cannot append to an archive that may have flaws.Archive read error limit (%d) reachedUnable to append when there are archive read errors.File changed size during read %sFile %s was modified during copy to archiveActual crc does not match expected crc %sUnable to obtain block size for file %sFile %s changed size during copy to %sFile %s was modified during copy to %sFailed write during copy of %s to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache tableCpio file name in header is corruptedCpio file name length %d is out of rangeCpio link name length is invalid: %quCpio header field is too small to store file %sUnable to write cpio link name for %sUnable to write cpio header for %sFile is too large for cpio format %sSv4cpio header field is too small for file %sCould not write sv4cpio link name for %sCould not write sv4cpio header for %sFile is too large for sv4cpio format %sBcpio header field is too small for file %sCould not write bcpio link name for %sCould not write bcpio header for %sFile is too large for bcpio format %sUnable to close file descriptor on %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfUnable to link file %s to itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingAccess/modification time set failed on: %sUnable to obtain file stats %sUnable to set file uid/gid of %sCould not set permissions on %sWARNING! Major Internal Error! GNU hack Failing!File %s was modified during readUnable to allocate memory for file name bufferUnable to allocate memory for filenameWARNING! These file names were not selected:Ignoring too-long pathname: %sIgnoring unterminated pathname at EOFab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Write limit is not a %d byte multipleError count value must be positiveDestination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578Unable to allocate space for option listUnable to open file '%s' for readabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6%s: Invalid combination of options:These format options are not supportedusage: pax [-0cdOnvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [pattern ...] pax -r [-0cDdikOnuvzYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T [from_date][,to_date]] [-U user] [pattern ...] pax -w [-0adHiLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [-x format] [file ...] pax -r -w [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [file ...] directory usage: tar {crtux}[014578befHhLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list Invalid replacement string option %s%s while compiling regular expression %sUnable to allocate memory for replacement stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Removing leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Processing continues, name changed to: %s Processing continues, name unchanged. Try again, file name too long Try again, illegal file name: .. Replacement name too long %s >> %sCannot allocate memory for temp file name.Can't open current working directory.Cpu time limit reached, cleaning up.Unable to set up signal handlerUser selection table out of memoryUnable to find uid for user: %sUnable to allocate memory for user selection tableGroup selection table out of memoryCannot determine gid for group name: %sUnable to allocate memory fo group selection tableUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Bad option %c with time range %sUnable to allocate memory for time rangeImproperly specified time range: %sCannot allocate memory for hard link tableUnable to create temporary file: %sCannot allocate memory for file time tableFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may failInteractive rename table out of memoryCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesUnable to store mode and times for created directory: %s%s=%s is only supported when writing.Unknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optionTar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sFile name too long for ustar %sLink name too long for ustar %sUstar cannot archive a socket %sFailed stat on %sFailed chdir to %sFailed open to read on %sFailed open to write on %s%qu blocks done. ar_drainget_physar_nextArchive name > Cannot save archive name.Cannot open %s, try again Empty file name, try again Quitting %s! Cannot re-open %s, try again Ready for archive volume: %d Unable to restore signal maskUnable to set signal maskcould not exec-dccould not forkcould not pipeCannot chdir to %sUnable to open %s to readarchivedirectory name is too long %sRead fault on %sFailed stat of %sTRAILER!!!cpio_endwrCpio link name is corruptCpio link name read error070707070701070702vcpio_wrbcpio_wrUnable to create %sUnable to link to %s from %sCould not link to %s from %sUnable to remove %sCould not create: %snode_creatCould not access %s (stat)Could not unlink %sUnable to remove directory %sFailed write to file %sOut of memoryFile seek on %sFailed seek on file %sset_crcFile rewind failed on: %sFile changed size %sInvalid file name argumentCan't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sls_list%b %e %Y%b %e %H:%M%s%2u %-*.*s %-*.*s %4lu,%4lu => == %9qu %s%s %s ls_tty%s: %c argument missing %s: unknown option %c bcpiosv4cpiosv4crcustarInvalid write limit %sInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8Problem with file '%s'-C-Iwrite_opt=nodirUnknown -H format: %scpio: Known -H formats are:Problem while reading stdin -%c %s = %s Invalid option nameInvalid options formatEmpty replacement stringrep_addInvalid replacement string %sEmpty pattern stringPattern list inconsistentPattern select out of memoryInput > tty_renameSkipping file. File name %s/%s, too longrep_name%s >> %s >> %s Replacement name error %scan not gzip while appendingSignal caught, cleaning up.LC_TIMEEmpty time range stringIllegal upper time range %sIllegal lower time range %sHard link table out of memorypaxXXXXXXXXXXchk_ftimeFailed ftime table readFailed ftime table seekCannot update rename tablewrite_optFile name too long for tar %sFile is too large for tar %sTar cannot archive a fifo %sLink name too long for tar %sustar_wrFile is too long for ustar %sFatal error, cannot open %s@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.72 2005/09/01 17:59:13 otto Exp $5L8L8L8L8T5L8L855L8L8L8L8L8H5T55L8L8L8L8L8L8L8L8L8L8L8L8L8L846L86L8L8P67L87L8h7L8t77777L8V8e8PRR QR*RRRRRRR%S_SkSwSSSS!Q@QJQTQ^QQQQQQQQQQQRDI:LRS:c:dfi:jl:np:qrs:T:t:vw:number of packets to transmit is %s: %s%s: only root may use interval < 1sCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)record route not valid to multicast destinations-R option and -D or -T, or -t to unicast destinations are incompatible-f and -i options are incompatibleping: wrote %s %d chars, ret=%d packet too short (%d bytes) from %s wrong data byte #%d should be 0x%x but was 0x%x-- somebody's duplicating packets!round-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms Destination Protocol Unreachablefrag needed and DF set (MTU %d) Dest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDesination Host Unreachable for TOSRoute administratively prohibitedDest Unreachable, Unknown Code: %d Redirect Type of Service and HostRedirect Type of Service and NetworkRouter Discovery Advertisement(%d entries, lifetime %d seconds) Time exceeded, Unknown Code: %d Parameter problem: pointer = 0x%02x Parameter problem, required option absent: pointer = 0x%02x Address Mask Reply (Mask 0x%08x) Vr HL TOS Len ID Flg off TTL Pro cks Src Dst DataUDP: from port %u, to port %u (decimal) TCP: from port %u, to port %u (decimal) %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xpatterns must be specified as hex digitsusage: ping [-DdfjLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host bad interface address: %stos value is %s: %sbad timing interval: %spreload value is %s: %spacket size is %s: %sttl value is %s: %smaxwait value is %s: %sPING %s: %d data bytes ping: recvfromPING %s (%s): %d data bytes setsockoptgetsockoptsetsockopt IP_MULTICAST_IFsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_LOOPping: record routeunknown host: %spingerping: sendto unknown option %x LSRR: 0.0.0.0 (truncated route) RR: (same route) NOP%d bytes from %s: icmp_seq=%u ttl=%d (DUP!) time=%d.%03d ms%d bytes from %s: %ld packets transmitted, %ld packets received, %.1f%% packet loss--- %s ping statistics --- Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Port Unreachablefrag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedHost Precedence ViolationPrecedence CutoffSource QuenchRedirect, Unknown Code: %d(New addr: %s) Redirect NetworkRedirect HostUnknown ICMP type: %d Echo RequestRouter Discovery SolicitationFrag reassembly time exceededTime to live exceededTimestampTimestamp ReplyInformation RequestAddress Mask Request %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x%s (%s)PATTERN: 0xA{Gz?WXXWXXXXXXXXXXXXX8XHXdXxXbenstuv%6d usage: %s [-benstuv] [-] [file ...] 4<Fko<FkM<kL<kW<FkV<Fk\<Fk[<Fk<jb<jEw<jj<ni<op<7jx<m<onc<Ts<s<s<t<t<Mv<Mv<v<v=<iw<Ij<j< #<l<l4<l<l<#l<9l<m<h<Fk<Fk< Fk<Fk<@Fk<FkB<<<ʂe< < <  <<[j<[ji.k$<Ó?i i@<`<)<=i ix<<_____________________________________________ < <@<@<`<<<<<B <<<#<#<#<#<$<$<$<$<%<%<%<%<&<&$<'*<'4<(:<(D<)J<)T<*Z<*d<+j<+u<,|<,<,<-<-2o<-<.<. powersave on (%dms sleep) (auto) %ddBm %sieee80211_statusSIOCG80211ALLNODES noneieee80211_listnodeslladdr %s %udB powersave %uMSGIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAinvalid media mode: %smedia instance %s: %sEthernetetherTokenRingtokenFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTP10STP10baseFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA1DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1-amie1-g.704e1-amie1-ami-g.704t3t3-m13e3-g.751e3-g.832e1-g.704-crc411a11b11gfhfull-duplexfdxhalf-duplexhdxflag0flag1flag2hw-loopbackEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %smedia mode %smediaopt instance %dphys_statusno carrierno ringinsertedno networkbackup metric %lu mtu %lu lladdr %s description: %s %s: no media types?SIOCGIFMEDIA media: status: supported media: inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime in6_alias%s: bad valueprefix %s: %s%s=%o%s=%xgetifgroupsSIOCGIFGROUP groups: malformed link-level addressSIOCSIFLLADDRunable to allocate cloner name bufferNote: trailers are no longer sent, but always receivedinterface index is already filledcould not determine link local addresssetifgroup: group names may not end in a digitsetifgroup: group name too longunsetifgroup: group names may not end in a digitunsetifgroup: group name too longESSIBSSPOLLABLEPOLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SHORT_SLOTTIME RSNDSSSOFDMCACHEBSSAUTHASSOCCOLLECTonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance' physical address inet%s %s --> %s UPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTusage: ifconfig [interface] [address_family] [address [dest_address]] [[-]alias] [[-]arp] [broadcast addr] [[-]debug] [delete] [up] [down] [ipdst addr] [tunnel src_address dest_address] [deletetunnel] [description value] [[-]group group-name] [[-]link0] [[-]link1] [[-]link2] [lladdr etheraddr] [media type] [[-]mediaopt opts] [mode mode] [instance minst] [mtu value] [metric nhops] [netmask mask] [prefixlen n] [nwid id] [nwkey key] [nwkey persist[:key]] [-nwkey] [bssid bssid] [-bssid] [chan n] [-chan] [txpower dBm] [-txpower] [[-]powersave] [powersavesleep duration] [[-]anycast] [eui64] [pltime n] [vltime n] [[-]tentative] [vlan vlan_tag vlandev parent_iface] [-vlandev] [vhid n] [trunkproto proto] [[-]trunkport child-iface] [advbase n] [advskew n] [maxupd n] [pass passphrase] [state init | backup | master] [syncdev iface] [-syncdev] [syncpeer peer_address] [-syncpeer] [phase n] [range netrange] [timeslot timeslot_range] [802.2] [802.2tr] [802.3] [snap] [EtherII] [pppoeac access-concentrator] [-pppoeac] [pppoesvc service] [-pppoesvc] ifconfig [-AaCMm] [interface] [address_family] ifconfig interface create ifconfig interface destroy ĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ̞Ġ؞ĠĠĠĠĠĠĠĠĠĠĠĠ)8GĠĠĠĠĠĠĠĠĠĠĠĠVĠ^wĠlĠӟ-P_n}ĠĠΠ1ACFLRSTacdfghiklmnopqrstuxCOLUMNS %s: %s: directory causes a cyclefts_readdisplay%qutotal %lu %s %*u %-*s %-*s %*s%*qd printlong%3d, %3d %-*s %*u -> printlink ls: %s: %s %*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtuWx] [file ...] main||||||||||||||||||L|X||||||||||||||||||||||||||@||d|p||||||ifconfigmake_packetrtsol_check_timerL^rtsol_timer_update8sockopensendpacketrtsol_inputinterface_upinterface_statuslladdropt_fillget_llflagprobe_initdefrouter_probesendprobeadDFselect: %sfailed to initialize %sfailed to open a socketadDfFm1memory allocation failedNew timer is %ld:%08ldthere is no timerset timer for %s to %d:%dstop timer for %susage: rtsol [-dDF] -a usage: rtsold [-dDfFm1] -a warnmsg<%s> %sprobing %sreallocmultiple interfaces foundff02::2setsockopt(ICMP6_FILTER): %sIPV6_HOPLIMIT: %sIPV6_PKTINFO: %ssocket: %sinet_pton failed for %smalloc for send msghdr failedsendmsg on %s: %ssendpacketrtsol_inputpacket size(%d) is too shortrecvmsg: %schecking if %s is ready...interface_up%s is duplicated%s is tentative%s is readyioctl(SIOCSIFFLAGS): %sioctl(SIOCGIFFLAGS): %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS) on %s: %sunsupported link type(%d)get_llflagioctl(SIOCGIFAFLAG_IN6): %sgetifaddrs: %ssocket(SOCK_DGRAM): %sshutdown: %smalloc failedlo0defrouter_probeioctl(SIOCGDRLST_IN6): %sprobe a router %s on %ssendprobefailed to setup for probing routersfailed to initialize interfaceskernel is configured as a router, not a hostkernel is configured not to accept RAsinterface %s was already configuredfailed to get link layer information for %smemory allocation failed for %slink-layer address option has null length on %s. Treat as not included.%s status is changed from %d to %dNo answer after sending %d RSstimer expiration on %s, state = %dillegal interface state(%d) on %susage: rtsol [-dDF] interfaces... usage: rtsold [-adDfFm1] interfaces... malloc for receive msghdr failedsend RS on %s, whose state is %dfailed to get receiving interfaceinvalid icmp type(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on %s, state is %dreceived RA from %s on an unexpeced IF(%s)invalid icmp code(%d) from %s on %sfailed to get receiving hop limitget_llflag() failed, anyway I'll trydefault router list contains a non-link-local address(%s)sPPPPPPPPPPpPPPPPPPPPDPPPP PP<PZi5a@aaaKaaaaVaaaaaahaaaaaaaaaaaaa"a@aaaKaaaaVaaaaaah  W p                                                                                                                              * 4 > H R \ f p z     & 0 : G Tan{%Rza:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW-R is not supported in this configurationillegal number of packets -- %sMust be superuser to flood pingtoo small interval, raised to 0.01datalen value too large, maximum is %dnew path MTU (%d) is notified you need -b to increase socket buffer sizeUDP setsockopt(IPV6_PKTOPTIONS)can't add an intermediate nodebad addr family of an intermediate addr-f and -i incompatible optionsgateway resolves to multiple addressesgetaddrinfo for the gateway %s: %sping6: wrote %s %d chars, ret=%d failed to get receiving packet informationround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms Destination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d %1x %02x %05x %04x %02x %02x usage: ping6 [-dfHmnNqtvwW] [-a [aAclsg]] [-b sockbufsiz] [-c count] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-h hoplimit] [-g gateway] [hops...] host invalid source address: %sinvalid socket buffer sizeillegal hoplimit -- %sillegal hoplimit %sillegal timing interval %sillegal preload value -- %sMust be superuser to preloadillegal datalen value -- %sPING6(%lu=40+8+%lu bytes) %s --> recvmsgpollsetsockopt(IPV6_HOPLIMIT)setsockopt(IPV6_PKTINFO)setsockopt(SO_RCVBUF)setsockopt(SO_SNDBUF)getsocknameUDP connectUDP socketcan't set the last flagcan't initialize rthdr%s: invalid interface namecan't allocate enough memorysetsockopt(IPV6_RTHDR)setsockopt(ICMP6_FILTER)setsockopt(IPV6_USE_MIN_MTU)IPV6_MULTICAST_HOPSUnable to allocate packetsetsockopt(IPV6_DSTOPTS)setsockopt(IPV6_HOPOPTS)setsockopt(IPV6_NEXTHOP)getaddrinfo failedtoo many intermediate hopssendmsg\%03odnsdecodepr_packinvalid peernameunknown code 0x%x, type 0x%xunknown, type 0x%xTTL=%d03 draftinvalid namelen:%d/%luno nameTTL=%d:invalidTTL=%d:meaninglessunknown qtype???NodeInfo NOOPrefused, type 0x%x%d bytes from %s, icmp_seq=%u hlim=%d time=%g ms dst=%s HbH Options: Routing: Dst Options: -%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap %s(TTL=%u)pr_nodeaddr(TTL=infty) no address truncated --- %s ping6 statistics --- %.1lf%% packet loss+%ld duplicates, IPv6 addressDNS labelIPv4 addressRefusedNo Route to Destinationpr_icmphPacket too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Bad code(%d) pointer = 0x%02x Unrecognized Option Erroneous Header Unknown Nextheader Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dNode Information Query, invalid, subject=%s(%s), oldfqdn, subject=%s(invalid), no subjectSupported qtypesDNS nameIPv4 nodeaddrNode Information Reply, %sVr TC Flow Plen Nxt Hlim%s->pr_iphHBH RTHDR FRAG ESPICMP6: type = %d, code = %d Unknown Header(%d) DSTOPT IP6ff02::2:0000:0000nigroupzDusage: %s -l or %s [-q] name tables available for %s keyboard: encoding Unknown encoding or variant. kbd(8) needs to be rebuilt.%s: unsupported encoding %s on %s kbd: keyboard mapping set to %s pc-xt/pc-atusbadblk201sunsun5hilgscdkfrukjpsvnoruualaplcfnodeaddeclklk401swapctrlcapsdvorakmetaesciopenermachdepapple/dev/wskbd%dWSKBDIO_GTYPEkbd_listunknown encoding %sunknown variant %sWSKBDIO_SETENCODING: %skbd_set!!!!!!!!!-"-"-"-"-"-"-"-"-"-"-"-"-"-"-"-"-"-"-"-"-"-"-"-"-"-"-"-"-"-""L@R@p?v??|?t@^@@1@X@d@x@x@x@x@x@x@j@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@x@t@BCCCCBCCCCBCCCCCCCCCCCCCCCCCCC^CpCCCCCCCCCCC>CCEEEEDCEEEEEEEEDEEEEEECEEEEEEEEEEEEEEEEEEEEEEEECDDEEEEDEE EEEEEEEEEEEEEEEEEEE EEEEEEEEEDEEEEEEEEEEEEEEEEEEEEED3KJMNIQSpRQHMJJLNMoM$RO"PMSPN`MQpR{NvKKNpRIgJRRpRQO LRSO O\O{OQSS[L:NhQpRpRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSHӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖӖĖӖӖӖӖӖӖӖӖӖӖӖӖ˖qߛߛߛߛߛߛߛߛߛߛ?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for datah1ޯޯ hu           %   Բ             ְ x           ݲyóóóóóóóóóóóóóóóóóyóyóóóóóóóyóóóyLESSSECURE-E-G-L-mMORELESS--Cannot allocate memoryraw_modeLESS_TERMCAP_ltget_envLINESlikrklkukdkPkNkh@7kDTERMhcxndapcticmsovb|^srget_termNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorch_ungetchar overrunseek error to 0ESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off (P)less %sungetcc overflowPattern not found(N-th) No %snext fileNo %sprevious fileNo such filegoto mark: Command not availableBrackets: [Press 'h' for instructions.]editcharLESSMETAESCAPELESSMETACHARS; *? '"()<>|&^`#\%c%s%cHOMEbin_file%s %s %sLESSOPENLESSCLOSE...skipping... Cannot find help fileCannot seek to end of fileCannot seek to line number %nDetermining length of fileDon't know length of fileLESSANSIENDCHARSplinenum~ Calculating line numbers (press RETURN)Invalid mark letterMark not setMark not in current fileless Tab stops and then every %d spacesopt_xquotes %sUse "h" for helpThere is no %s optionCannot change the %s optionCannot query the %s optionValue is required after %sNumber is required after %sfakeSearch skips displayed screenRepaint by clearing each lineAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileOpen only regular filesOpen even non-regular filesBackwards scroll limit: Allow help commandDon't allow help commandIgnore case in searchesTarget line: Don't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersprompt: Never ring the bellDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesBackspaces cause overstrikePrint backspace as ^HTab stops: 0123456789,Don't use init/deinit stringsForward scroll limit: Scroll window size: quotes: Show tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeBe less helpful in promptsBe helpful in promptspostoalinenumtoainttoaiprint_intiprint_linenumap_posap_linenumap_intInvalid patternNothing to searchLine numbers turned offWARNING: terminal is not fully functional [Press space to continue, 'q' to quit.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailable"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)Cannot seek to beginning of fileCannot seek to that file positionLine number is required after -l Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less -" must be followed by 1 or 2 charsThere is no %s option ("less --help" for help)Cannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionSearch includes displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenQuit immediately at end-of-fileDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit is %d linesCase is significant in searchesIgnore case in searches and in patternsPosition target at screen line %dConstantly display line numbersRing the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay underlined text in underline modeDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementSend init/deinit strings to terminalForward scroll limit is %d linesScroll window size is %d linesDon't show tildes after end of fileNo previous regular expressionPlease re-enter search pattern,8Et <Ė 32MB HPFS/QNX/AUXAIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech Thinkpad Rec Willowsoft $NEC DOS 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootBSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT Z[s8~eWjbO6p;x7NĞݳ5!8H.Aq~&9ڗU"@ї|u}}>*}{{%nuFr7U2~o|>]x7;?[yȋb/֞~ıyE(2RqZTy =8n>{~wIvJy|zXx{^x‹^𢅧^ ߓo&nkCkv-icU檃+  8w@4h$rD3RpGl۷=+.eXBioio^0#ڦGFxee)TBFF7$ ĪȶqKa+)(* =,'l1q*G-nng0XG⻬JwX;[?: TZAkI.F[8-Q~+9= 1x V1#W^_SFN닠8,:XUĊ)+\ӵ kupNG<XNZiU 76^z$VY_||{!Uv&t.∾\&#;~4= cɇ`c߀~R0iu:2, '3< !q0u9~;W-rt9Rԉe9pti2B&lRX cp4&㛷G0q.s-ܭ9simU& CPz(W-J\J*}n~j'ٴWϴfo.,_= , /&c e,{S&7hU`F,'IQ3sL*NLܠv]ׂD[? Sa \(:ғ¦HC(SN% v6~!مRtQZE t}࿷6OזLNe_N&(œErxK #d[2;7;paɆCx[z'k;%q dLO »[xٙ: X"DoLP3lͿ@릗nţL*XS$"U0pd-Q/-xSV a7ì(ybV=3P,"KiTP;*I,%״Q%wlV@URsQ,ik%%vzh}\*JC)YaKq1KXs]?N4tp 2l]LW8:-B[hxw{umoD ջp}wqzq`xl2tTHЧH }ke!C29.Z sQ7ih^Sog>-9ﮩd/%σzNչQ(M+qXd&6UJ w0;L$KI{Mx^j󱀒a]fmOyցJxl2ja%!'C2Js0h8ǒ ?$klbxCN=\~,=Й^h0Ce-$h`}Yu$hEg)g]މ@uYSVi0yp8Mټo6?BZ"zgiPXΆ(1<} A/^--ae877!V^c١ה_0PKt&Doyz tpǖMfÙ?$c :ڞZ>La`6-2$>jXi(@!_sἁ!ũ@d@g2R9`ȭ8P3;zfxBᾩ8-.|iʆ_|[7ߨoL|0FEgf+q Ӫnv5,o+g2/?lZwi[dʲ ;THo>+ 8`Ume (oqr)ee'.X>iʊ57?Զ& l)v/tP$`$ijؙ KV~JRkiU$NUrl ~ZiK]n3 lf4 "sUlRSS+ydž IA%C[Bx,Ȣ~!Rl,| ADf\]3-&N36[[;&$+qJ F0 .#[>-[nA(U*Xo".͞jwxOܥJݾL] ikOH:&Ȅº{⊞ۍ:褻u3`[ڱY*L6P42N{?jK,‚=(mz#^k (աש6j\ coU+Gt!b챀wNxڨ)7goloߑ\8AD{"=d~Bj6 Ѵ`W`ZU %"ua9b\ v bDwNB- jq :꒵1vOw.ÐWFִu\z7 ~. +9n`Y$MCK2 頝ZTd&f5$πHݚ4!Y*C:R*ݴO̖sog]oL[9bsj:uRqu HڅV}Tn aUP 5 ]t uVaVUI{64֜ABT|WE&͔ $a KjXF0kGFZ&3 qvS٬֧Xёب$g}Lb oV߰*͔sLgmz',#G%;sϩy쩒Zgtk#MjFGPA;%hk$~ţ,FwMōc ^ͫJm@;R %ՋnmcfB3.KPN/w'Q%{݁ +9-~{6c5o\C#V }J>&$Zo1.e|:x^pzړ5ĂTA(ZnԒ$Ȩ{ﯽG!Mm[zs#{UJdy8927O6PMa3ļTww _ZRBh;9Fp@3m4ٝnNG+wl6`]{H8— `WՕ`~0䮙YɼH0j3'q!}L$sd.}JPbC} ,usage: %s [-ieu] [-c cylinders -h heads -s sectors] [-f mbrfile] device -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry `disk' may be of the forms: sd0 or /dev/rsd0c. Cylinder argument out of range [1..262144].Head argument out of range [1..256].Sector argument out of range [1..63].Can't get disk geometry, please use [-chs] to specify.Please specify a full geometry with [-chs].Show entire OpenBSD man page for fdiskRe-initialize loaded MBR (to defaults)Set the identifier of a given table entryFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRPrint loaded MBR partition tableExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesAbort program without saving current changes ----------------------------------------------------- ------ ATTENTION - UPDATING MASTER BOOT RECORD ------ ----------------------------------------------------- Do you wish to write new MBR? Do you wish to write new MBR and partition table?Aborting changes to current MBR.Invalid command '%s'. Try 'help'. %s is not a character device or a regular fileChoose from the following Partition id values:Warning CHS values out of bounds only saving LBA values%c%1d: %.2X %4u %3u %2u - %4u %3u %2u [%12u:%12.0f%s] %s Starting Ending LBA Info: #: id C H S - C H S [ start: size ]------------------------------------------------------------------------Start of partition #%d after end!In memory copy is initialized to:Invalid argument: %s %d same partition as %d, doing nothing. Invalid argument: %s Partition id ('0' to disable) Do you wish to edit in CHS mode?Loop to offset 0! Not selected.Selected extended partition %d Partition %d is not an extended partition. Partition %d flag value set to 0x%x. Invalid argument: %s [value] /usr/mdec/mbrieuf:c:h:s:using builtin MBRCommand help listsetpidEdit current drive statsEdit given table entrySwap two partition entriesWrite loaded MBR to diskUSER_initMBR is unchangedEnter 'help' for informationfdisk:%c%d> USER_modifyWriting current MBR to disk.Offset: %d USER_print_diskBytesKilobytesMegabytesGigabytesask_cmd%s [%d - %d]: [%d] (? for help) '%d' is out of range. ask_num'%s' is not a valid number. %s [%X - %X]: [%X] %s [n] DISK_getlabelmetricssysctl(machdep.bios.diskinfo)Disk: %s geometry: %d/%d/%d [%.0f %s] geometry: Signature: 0x%X MBR_pcopy%02X %s %02X %s %02X %s %02X %s Use 'write' to update disk.XreinitChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsSwap with what paritition?Invalid partition number %d. Invalid partition number.Partition %d is disabled. BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorNew MBR at offset %d. Writing MBR at offset %d. Xwrite %s %s Machine code updated.Partition %d marked active. DS 7MB^x -<UMd s (standard input)(fd %d)invalid file typebinary-filesmmapline-bufferedafter-contextbefore-contextdevicesextended-regexpfixed-stringsbasic-regexpbinarybyte-offsetno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsets\(%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u Unknown binary-files optionBinary file %s matches [[:<:]][[:>:]]usage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxy < < < < < < < < < < < < < < < < < < < < < < < < < <  < < < <  <  < < < < < < < < < < <  < C aFfh:t:vumountfsBad MNT RPCCannot MNT PRC%s: unmount from %s %s: not currently mountedusage: %s %s %s: not a directory or special deviceumount -a[fv] [-h host] [-t fstypelist]umount [-fv] [-t fstypelist] special | node<<<ː<B < < <<-< <<<|||||||||||||||||||||||||||||||||||||||||||||||| |6|||P|\||Gsl9xu:g:m:o:not an MSDOS filesystemunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-o options] [-u user] [-g group] [-m mask] bdev dir <<<ː<B < < <<-< <<usage: %s special node $OpenBSD: fsck.c,v 1.19 2005/02/03 05:03:50 jaredy Exp $!!!!!!!!!!!!!!!!!!!!!u !!!!!!!!!!!!!!!l ! !!!!! ! ! !!! ! !! $OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $$OpenBSD: preen.c,v 1.14 2003/06/26 08:01:54 tedu Exp $dvpfnyl:t:T:start %s %swait %scheckfs%s/fsck_%sexec %sInvalid option string/r%s is not a character device Can't stat %s Can't stat rootrealloc failedstrdup failedBAD DISK NAME %s pass %d, name %s Unknown pid %lddone %s: %s (%s) = %x UNEXPECTED INCONSISTENCY:%s: %s (%s)%s/etc/fstabCan't open checklist file: %sdisk %s: %s in fstab more than once!%s: unknown special file or file system.Can't get resource limit to max data sizeCan't get resource limit for data sizeusage: %s [-dfnpvy] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s 5u5u5u5u5u5u5u5u5u5>5J5u5u5u5u5u5u5_5u5u5u5u5u5u5u5u5u5u5u5u5u55u5u5)555u5u5u5u5u5u5u5u5u5u5u5u5u5V5i5565626/etc/ccd.confCCDF_SWAPCCDF_UNIFORMCCDF_MIRRORCCDF_OLDcCf:gM:N:uUvinvalid ccd name: %s%s unconfigured %s: bad line: %dinvalid interleave factor: %sinvalid flags argument: %sno memory to configure ccdccd%d: %d components , %d blocks interleaved at %d blocks concatenatedfopen: %sno memory to configure ccdsdo_all/dev/%s%c/dev/%sCCDIOCCLRCCDIOCSETioctl (%s): %s0x0no memory to parse flagsdev [...] %s -u [-v] ccd [...] [ccd [...]]usage: %s [-cv] ccd ileave [flags] %s %s -C [-v] [-f config_file] %s -U [-v] [-f config_file] %s -g [-M core] [-N system] %s mkfifoinvalid file mode.non-numeric major number.non-numeric minor number.node must be type 'b' or 'c'.usage: %s [-m mode] name p major or minor number too largeusage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] fifoname ... @(#) Copyright (c) 1997, 1998, 1999 Bill Paul. All rights reserved.@(#) $OpenBSD: wicontrol.c,v 1.58 2005/05/25 07:40:49 reyk Exp $ԯ<<<<,<A<V<k<<< @< < < < <<ΰ<ΰ<ΰ<ΰ<<<<<<<<<!<"<#<$<&/<OOPP:PEPOPPPPPP QPQLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB)SIOCGWAVELAN (0x%x)wi_getvalwi_setvalSIOCSWAVELAN[ %s ]string too longmust specify stringbadly formatted addressmust specify address[ 0xUnknown PRISM chipUnknown Lucent chip[ %s, Firmware %d.%d.%d ][ On ][ Off ][ Unknown ][ Software WEP ][ Firmware WEP ]AP Informationap[%d]: netname (SSID): [ %s ] Channel: [ %d ] Beacon Interval: [ %d ] DataRate [Mbps]: [ %2.1f ] AvailableRates [Mbps]: [ %d.%d Capinfo: [ PRIV IBSS ESS [dBm]: [ %d / %d / %d ] NIC serial number: Station name: SSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Process 802.11b Frame: MAC address: TX rate (selection): TX rate (actual speed): Maximum data length: Create IBSS: Microwave oven robustness: Access point density: Power Management: Max sleep time: Enhanced Security mode: Intersil Prism2-based card: Card info: Encryption: Encryption algorithm: TX encryption key: Encryption keys: Transmitted fragments: %u Single transmit retries: %u Transmit discards: %u Received unicast frames: %u Received fragments: %u Received unicast octets: %u Receive FCS errors: %u Can't decrypt WEP frame: %u %d station%s: AUTHASSOCPERM, flags, caps1M2M5.5M11M, rateswi_dumpstations, sig=%d/%dSIOCHOSTAP_GETALLwi0get_if_flagsset_if_flagsad-hocunknown port type %sPRISM2 HWB3163(EVB2) SST-flashonly 4 encryption keys availableencryption key must be no more than 13 characters longencryption key must be no more than 26 hex digits longno WEP option available on this card[ %s, Firmware %d.%02d variant %d ] BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] Port type (1=BSS, 3=ad-hoc, 6=Host AP): RTS/CTS handshake threshold: Antenna diversity (0=auto,1=pri,2=aux): Roaming mode(1=firm,3=disable): Authentication type (1=OpenSys, 2=Shared Key): Transmitted unicast frames: %u Transmitted multicast frames: %u Transmitted unicast octets: %u Transmitted multicast octets: %u Multiple transmit retries: %u Transmit retry limit exceeded: %u Transmit discards due to wrong SA: %u Received multicast frames: %u Received multicast octets: %u Receive discards due to no buffer: %u Received message fragments: %u Received message bad fragments: %u %02x:%02x:%02x:%02x:%02x:%02x asid=%04xusage: %s [interface] [-olL] [-t tx rate] [-n network name] [-s station name] [-e 0|1] [-k key [-v 1|2|3|4]] [-T 1|2|3|4] [-x 0|1] [-F 0|1] [-c 0|1] [-q SSID] [-p port type] [-a access point density] [-m MAC address] [-d max data length] [-r RTS threshold] [-f frequency] [-M 0|1] [-P 0|1] [-S max sleep duration] [-A 1|2|3] [-D 0|1|2] [-R 1|3] [-E 0|1|2|3] a:c:d:e:f:hi:k:lm:n:op:q:r:s:t:v:x:A:D:E:F:LM:S:P:R:T:0A@@_fs_bsize_p_fs_bsize_s_fsbtodb_p_offset_inodeblk_inodedbl_nblocksvnboot: %s proto: %s disklabel: %sbad disklabel magic=%0x8xdisklabel type unknownproto %s bad size=%ldproto bootblocks too big%s: not a character devicebroken MBRno OpenBSD partitionwrite bootstrap%s: can't read header%s: read failed%s: entry point %#x proto bootblock size %ld %s: devread: lseek%s: devread: readstatfs: %s%s: not on an FFS filesystemfsync: %sfstat: %scross-device installBad inopb=%d in superblockNo blocks to load%s is %d blocks x %d bytes %s: no such symbol%s already set%s not set%s: symbol %s not found%s: %s: wrong type (%x)%s: symbol out of range (%u)%s: bad symbol size %dusage: %s [-nv] boot biosboot device using MBR partition %ld: type %d (0x%02x) offset %d (0x%x) %s: bad magic: 0x%02x%02x%02x%02x%s: %u ELF load sections (only support 1)Bad magic number in superblockfs block shift %u; part offset %u; inode block %u, offset %u fffffffffffffffffffghgghgghgggggg^gggggggggggggggggggggggggggggggggkkkkkkkkkkkkkkkkkkkkkk,kkkkkkkkkkkkkkkkoonoozooo{qooooo{qoop(p>pWppp|ppUopppop{qpp qq$qAqMq{qYq{q{qbq{qo{qqqw\twwwwwwwwwwwwwwwwwwwwwwwwwwwwwwxBwBwvBwBwBwBwBwBwBwBwBwBwBwBwBwBww/wBwBwBwBwNwtxUGHRBD M@dmCXLS1@2 3cJݏ ʑKVd0123456789abcdefblackholecloningexpirehopcountifaceinterfaceipxllinfolockrestmpathnojumbonostaticproto1proto2recvpiperejectrttrttvarsendpipeshowssthreshxresolvebotched keyword: %sdnqtv%-20.20s donewrite to routing socketgot only %d for rlen (address family %s) route-sysctl-estimateentry in usenot in tablerouting table overflow: gateway %snetmask missingassuming route to if old usage of trailing 0old usage of trailing digit, assuming route via gatewayinet6_makenetandmask%s: bad address%s: not a network%d: bad address familygot message of size %d on %sread from routing socketwriting to routing socketso_labelso_ifaso_ifpso_genmaskso_maskso_gateso_dstRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_GET: Report Metricsprint_rtmsg%s: len %d, metric %d, flags:if# %d, name %s, what: departurearrivalif# %d, link: %s, flags:name: %s, route to: %s destination: %s mask: %s interface: %.*s if address: %s flags: label: %s %8lu%c %8ld%c gateway: %s RTM_GET: %s (errno %d) locks: inits: sockaddrs: sodump%s: inet %s; %s: inet6 %s; %s: ipx %s; %s: link %s; label too longRouting tablessysctl of routing tableInterfaceMtuUseRefsFlagsGatewayProtoPortSourceAddress%-6.6s %6d %8ld %6ld %.16sp_rtentry%6s Internet Protocol Family %d: AppleTalkIPXInternet6Encapp_flagsroutename(%d) %s%u.%u.%u.%u/%dnetname6%s/%dillegal prefixlenaf %d: %s*.**.0x%XH%XH.%s%s.%XH%02X%02X%02X%02X%02X%02XHlink#%dusage: %s [-dnqtv] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show Examining routing table from sysctlactual retrieval of routing tablemust be root to alter routing tableking bula sez: set_metric with invalid key%s: resolved to multiple valuesprefixlen is not supported with af %dactual retrieval of interface tableRTM_CHANGE: Change Metrics or flagsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departurerouting message version %d not understoodpid: %ld, seq %d, errno %d, flags: recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expiremessage length mismatch, in packet %d, returned %d%-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s SA(Address/Proto/Type/Direction)%-18s %-5s %-18s %-5s %-5s %-22s +%-+%-%-%-%-%-%-%-%-%-%-+%-%-%-%-%-%-%-%-%-%-%-%-%-%-,%-%-%-%-%--%-%-%-%-%-%-%-%-%-%-,%-%- ,*-%-2,%-A,%-%-%-P,_,n,,%-,%--%- - KMGTPasciiimageebcdictenexusage: %s [ | %s: unknown mode. TYPE %s %sTYPE %slocal-fileremote-fileSTOUSTORAPPElocal-filesusage: %s local-files mputContinue with%s: not foundr+wlocal: %sRETRgetitremote-filesusage: %s remote-files mgetand logged inConnected %sto %s. Not connected. No proxy connection. (none)Passive mode: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Use of PORT/LPRT cmds: %s. Macros: usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracing%s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeGlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryusage: %s remote-directory XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdusage: %s remote-file DELE %smdeletefrom-nameto-nameusage: %s from-name to-name RNFR %sRNTO %sNLSTLISToutput to local-file:Try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. XPWDLocal directory %s getcwdlpwddirectory-nameusage: %s directory-name XMKD %sXRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1usage: %s mode file-name SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPXCUPrestart: invalid offset. SYSTmacro nameusage: %s macro_name usage: %s filename %s %lld %s %sSTAT %sSTATaccountbyecdupdisconnectepsv4formhashidlemacdefmlsmodtimemsendnewernmapntranspagepassivepreservequoterecvregetrestartrhelprmdirrstatusruniquesendportsitestructsunique'%s' macro not found. domacrohttp://ftp://url_get: Invalid URL '%s'Malformed proxy URL: %sCan't open file %sCan't open %sReading from file(unknown)Trying %s... r+Requesting %s (via %s) User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s GET /%s HTTP/1.0 Host: Can't allocate memory.[%s]:%sWriting HTTP requestreceived '%s' 301302Error retrieving file: %sContent-Length: Location: Redirected to %s Reading from socketRead short file. Successfully retrieved file. Receiving HTTP replyWriting %sImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyInvalid URL: %s*?[]{}Retrieving %s/%s auto_fetch:/ftpgatehttp%s: bad port number `%s'connect to address %ssetsockopt TOS (ignored)fdopen failed.Connected to %s. hookup---> PASS PASS XXXXACCT ACCT XXXX%c%c%cgetreplylocal: %s %s: not a plain file. REST %ldnetoutsendrequestnetin%s: short writesetsockopt (ignored)EPSVPASVLPSVPassive mode refused. %u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dinitconnacceptdataconnNo primary connection. PORT %slocal: %s remote: %s %cABOR abort_remoteFTPSERVERPORTFTPMODEgate-ftpFTPSERVERdumbemacssu-r requires numeric argument46Aadegimno:pP:r:tvVRetrying... ftp> sorry, input line too long. Proxy c?Ambiguous help command %s ?Invalid help command %s %-*s %s passwordpasswdmachine%s/.netrc: %s%s/.netrcanonymous4K macro buffer exceeded. Unknown .netrc keyword %sruserpassstringlistusage: %s host-name [port] PASSERVE %snon-printstreamRemote system type is %s. 215 UNIX Type: L8215 TOPS20%s@Name (%s:%s): Name (%s): Password:Login failed.$initftp_loginsorry, arguments too long. (%s) ftpXXXXXXXXXXremglob%s %s? Interactive mode: off. confirmSIZE %sMDTM %s%*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. %3d%% |%.*s%*s| %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeter ETA: %02d:%02d:%02d ptransferUsing %s mode to transfer files. internal error: unknown type %d.We only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. usage: %s local-file [ remote-file ] usage: %s remote-file [ local-file ] Connected for proxy commands to %s. Gate ftp: %s, server %s, port %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Hash mark printing: %s; Mark count: %d; Progress bar: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. usage: %s [ on | off | bytecount ] usage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. usage: %s [ on | off | debuglevel ] CWD command not recognized, trying XCWD. usage: %s remote-directory local-file usage: %s remote-files local-file usage: %s username [password] [account] PWD command not recognized, trying XPWD. MKD command not recognized, trying XMKD. RMD command not recognized, trying XRMD. CDUP command not recognized, trying XCUP. restart: offset not specified. Restarting at %lld. Execute get, put or append to initiate transfer Limit of 16 macros have already been defined. Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. Local file "%s" is newer than remote file "%s". Can't allocate memory for $PAGERExtra `@' characters in usernames and passwords should be encoded as %%40Can't allocate memory to parse URLInvalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.host %s, port %s, path %s, save as %s. Too many redirections requestedCan't allocate memory for transfer bufferAuto-login using ftp URLs isn't supported when using $ftp_proxyCan't allocate memory for auto-fetch.user %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'Can't allocate memory for URL decodingNo control connection for command.421 Service not available, remote server has closed connection. send aborted waiting for remote to finish abort. receive aborted waiting for remote to finish abort. WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomewrong server: return code must be 229 disabling epsv4 for this connection wrong server: return code must be 227 wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode AF mismatch. Shouldn't happen! setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)LPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dproxy server does not support third party transfers. runique: can't find unique file name. Lost control connection for abort.unknown FTPMODE: %s. Using defaultsNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftp%sommands may be abbreviated. Commands are: usage: %s [-46AadegimnptVv] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] Missing macdef name argument. Error: .netrc file is readable by others.Remove account or make file unreadable by others.Macro definition missing null line terminator. Remove password or make file unreadable by others.Already connected to %s, use close first. gateserver not defined (shouldn't happen)Connected via pass-through server %s Remember to set tenex mode when transferring binary files from this machine. unable to create temporary file: %sunable to create temporary file %scan't find list of remote files, oops. can't find list of remote files, oops.Prompting off for duration of %s. n, y, p, a, are the only acceptable commands! Y2K warning! Fixed incorrect time-val received from server. *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************%lld byte%s %s in %.2f seconds (%.2f %sB/s) WWWWWWWWWWWWWXdlnpqshutdown~/etc/rc(can't restart init): SIGTERM processes/dev/consolesetsidrevokeSIGTSTP inithalted (with powerdown) by %shalted by %srebooted by %susage: %s [-dn%sq] WARNING: some process(es) wouldn't die<<<ː<B < < <<-< <<Q <@R <<tG< < <filesystem must be mounted read-only; you may need to run fsckusage: mount_ffs [-o options] special node ________________________________bbbbbbbbbbbbbbbbbbb{={=========Z{{Z={{{{{{{{{{{={{{{{{{{{{{Z=={=={{={{{{{={{{{{{{{{rrrrrrrrrrrrr\rrrrrrrrrrrrrrrrrrrrrrrrrrՕFTrrrrrrrr%r`'r/7rrrGirrjfCq|Xn3n3#F]ٲ^̵T 1ͽ5n X!!]!-i!!&<client callocifi->client->config callocInterface name too long/var/db/dhclient.leases%s.%sasprintf%s: no link ... giving up got link cannot open %s: %m_dhcpno such user: nobodycan't open and lock %s: %mPREINITAF_ROUTE/var/empty/chrootchdir("/")can't drop privileges: %musage: %s [-dqu] ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.BOUNDRENEWREBOOTREBINDold_new_BOOTREPLY from %s rejected.DHCPOFFERDHCPNACK%s from %s rejected.DHCPACKBOOTREPLYARPSEND%s isn't satisfactory.%s already seen.Bogus server name %sDHCPNAK from %sTrying medium "%s" %dMEDIUMNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.EXPIREsend_requestcan't create %s: %mlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; } mediumreasonip_addressnetwork_numberbroadcast_addressserver_nameprepend optionappend optionno space to %s %sexpirypriv_script_write_paramsunexpected msg type %ureceived corrupted messagefork: %mwait: %mexecve (%s, ...): %m%s%s=%soption_as_string: bad code %ddhcp option too largecannot fork%s [priv]poll errorexpecting a statement.semicolon expected.string constant too long.expecting semicolon.%s: unexpected option name.%s: too many options.expecting left brace.no memory for lease.expecting lease declaration.no option named %sexpecting number.expecting identifier.expecting boolean.expecting string.option data buffer %soption data buffer overflowparse_option_declExpecting media options.no memory for reject list!parse_reject_statementexpecting IP address.getifaddrs failedno space to remember ifppoll: %mgot_oneioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %mCan't create socketinterface_link_status/dev/bpf%dCan't find free bpf: %mif_register_bpfCan't get BPF version: %mCannot lock bpfsend_packet: %msend_packetcSclarger than bufferoption %s (%d) %s.rejecting bogus offer.%s: %d extra bytesUnexpected format code %cpretty_print_optiondo_packeteof in string constantlways-reply-rfc1048llowbandoneduthoritativeackoff-cutoffootingoot-unknown-clientslient-hostnameenyynamic-bootp-lease-cutoff-lease-lengthixed-addressddiet-lease-hostnamesardwarenitial-intervalax-lease-timeediext-serverne-lease-per-clientrependequireenewebindtartsubnethared-networkelect-timeoutcriptupersedeoken-ring-host-decl-names-lease-addr-for-default-routeendor-classexiting.exiting. %s line %d: %s%s^subnet_numberbroadcast_addraddr_eqpiaddrpadsubnet-masktime-offsetrouterstime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endfilename must be a stringno memory for string %s.Expecting numeric lease timenumeric aggregate too short.Bogus number: %s.Unexpected integer size: %dnumeric day of week expected.numeric year expected.numeric month expected.numeric hour expected.numeric minute expected.buf_open: %mbuf_add: %mbuf_close (short write): %mbuf_close: %mbuf_read (short read): %mbuf_read: %mcorrupted message receiveddispatch_imsgno such user: _dhcp, falling back to "nobody"[-c conffile] [-l leasefile] interface bound to %s -- renewal in %d seconds.dhcpoffer: no memory to record lease.dhcpoffer: no memory for server name.dhcpoffer: no memory for filename.dhcpoffer: no memory for option %dInvalid lease option - ignoring offerDHCPNAK with no active lease. DHCPDISCOVER on %s to %s port %d interval %dNo working leases in persistent database - sleeping. DHCPREQUEST on %s to %s port %dDHCPDECLINE on %s to %s port %doptions do not fit in DHCPDISCOVER packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDECLINE packet. renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; script_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbinscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'Invalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xwarning: hostname %s contains an underscore which violates RFC 952Corrupt lease file - possible data loss!expecting string or hexadecimal dataexpecting hexadecimal constant.hexadecimal constant too long.expecting interface name (in quotes).unterminated interface declaration.unterminated lease declaration.wrong interface name. Expecting '%s'.expecting identifier after option keyword.Bad format %c in parse_option_param.out of memory allocating option data.no memory for string list entry.Can't allocate poll structures.No live interfaces to poll on - exiting.receive_packet failed on %s: %sInterface %s no longer appears valid.Can't allocate timeout structure!can't allocate protocol struct for %sCan't attach interface %s to bpf device %s: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mMany bogus options seen in offers. Taking this offer in spite of bogus options - hope for the best!Can't allocate storage for option %s.Can't expand storage for option %s.pretty_print_option: bad code %d%s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes at end of arrayDiscarding packet with invalid hlen.string constant larger than internal buffernumeric token larger than internal buffertoken larger than internal buffer%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetsstreettalk-directory-assistance-serverexpecting a network hardware typeno space for numeric aggregateBogus number: %s: digit %d not in base %dvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.expected slash separating year from month.expected slash separating month from day.numeric day of month expected.expected colon separating hour from minute.buf_close (connection closed): %mbuf_read (connection closed): %mreceived unknown message, code %d06=K\jx R R R R R R R R R R R R R R R R R R R R R R  R R R  # R  R R R  #              R # R R R  R R R R R R R R R R R R R R R R R R R R R R R R R R R R R R   U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U" U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U"U" U"U"U"U"U"U"U"_U"U"U"U"U"U"U"U"fU"U"U"U" U"U"U"U"U"U"U"U"U"@ U" 8`pU"f6 !U"b"cannot read temp filecannot seek temp filecannot write temp fileline too longinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad binary digit in keybad hex digit in keydes_setkeydes_ciphercbc_decodecannot read fileinvalid pattern delimiter& no previous commandunexpected end-of-filecannot close input filecannot open input filenewline appended newline inserted cannot read input filecannot close output filecannot open output filecannot write filecannot read stdin \abfnrtv\\ p:sx ? interruptscript, line %d: %s warning: file modifiedinvalid filenamenumber out of rangeinvalid command suffixunexpected addressno current filenameunexpected command suffixinvalid redirectioninvalid destinationdestination expectedno previous substitutioncannot nest global commandsunknown commandno matchfilename too longshell access restrictedinvalid mark character/ed.hupno previous patterntrailing backslash (\)unbalanced brackets ([])infinite substitution loopnothing to undodecryption failed (block corrupted)decryption failed (incomplete block)@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. usage: %s [-] [-sx] [-p string] [name] QpRpRpRQpRpRpRRpRRpRpRpRpRpRpRpRpRpRpRpRpRpRpRpRpRpRpRpR!RpRpR:RpRpRpRpRpRpR^RpRzRHLPRfiproverwrite %s? copy_linksymlink: %sunlink: %sreadlink: %smkfifo: %smknod: %slchown: %sthe -H, -L, and -P options may not be specified with the -r option.the -R and -r options may not be specified together.%s%s: name too long (not copied)%s is a directory (not copied).cannot overwrite directory %s with non-directory %s%s and %s are identical (not copied).usage: %s [-fip] [-R [-H | -L | -P]] source_file target_file %s [-fip] [-R [-H | -L | -P]] source_file ... target_directory X n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     ]1ЅڅJ܇[ڎ؏J inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@Z~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@lost+founddirscanwrong type to dirscan %d DIRECTORY CORRUPTEDNAME=%s fileerror%s=%s LINK COUNT %s COUNT %d SHOULD BE %dADJUST (ADJUSTED)LINK COUNT INCREASINGUNREFmkentryUNREF %s (RECONNECTED)lost+found IS NOT A DIRECTORYREALLOCATElinkupDIR I=%u CONNECTED. PARENT WAS I=%u NO lost+found DIRECTORY (CREATED)RECONNECTmakeentryexpanddirNO SPACE LEFT IN %s (EXPANDED)EXPANDADJUST LENGTHiblockblk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d;cannot find inode %d CLEAR (CLEARED) I=%u OWNER=MODE=%o SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%uBAD STATE %d TO BLKERR CG %d: BAD MAGIC NUMBER dfpnNyYb:c:l:m:conversion levelbad mode to -m: %o -%c flag requires a %s checkfilesysCAN'T CHECK FILE SYSTEM.INTERNAL ERROR: dups with -p%d files, %d used, %d free ***** REBOOT NOW ***** %u, %d,%d blocks missing %d files missing ** Phase 5 - Check Cyl groups** Phase 2 - Check Pathnames** Last Mounted on %s ** Root file systemstarting phase 1, inode %d/%dcheckinodeUNKNOWN FILE TYPE I=%ubad size %llu: (CORRECTED)LINK COUNT TABLE OVERFLOWCONTINUEbad indirect addr: %d bad direct addr: %d cannot read symlink bad size %llu ndb %d:HOLD BAD BLOCKDUP TABLE OVERFLOW.EXCESSIVE DUP BLKS I=%u (SKIPPING)EXCESSIVE BAD BLKS I=%uphase 1b, inode %d/%dphase 2, directory %d/%dROOT INODE UNALLOCATEDpass2MISSING '..'FIXBAD INODE NUMBER FOR '..'DIRECTORY TOO SHORTCANNOT ALLOCATE ROOT INODE BAD STATE %d FOR ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYMISSING '.'pass2checkREMOVEBAD TYPE VALUE%s %s %s (REMOVED)ZERO LENGTH DIRECTORYDUP/BADI OUT OF RANGEEXTRA '..' ENTRYEXTRA '.' ENTRYBAD TYPE VALUE FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'BAD STATE %d FOR INODE I=%d phase 3, directory %d/%ldphase 4, inode %d/%dBAD/DUPZERO LENGTHphase 5, cg %d/%dCREATCANNOT %s CLUSTER MAPS pass5SUMMARY INFORMATION BADBLK(S) MISSING IN BIT MAPSBAD STATE %d FOR INODE I=%ld CREATE CLUSTER MAPS%sING CLUSTER MAPS DELETING CLUSTERING MAPS DELETE CLUSTERING MAPS%s is not a character device (NO WRITE)setupINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEFAILED. YOU MUST USE THE%s %s %s %s %s %s (FIXED)SET TO DEFAULTBAD SUMMARY INFORMATIONCONVERT TO NEW INODE FORMAT** Fclean = %d NO WRITE ACCESS** %sCan't open %s: %s Can't stat %s: %s MAGIC NUMBER WRONGNCYL LESS THAN NCG*CPGsuperblock mismatchesSIZE PREPOSTEROUSLY LARGECPG OUT OF RANGENCG OUT OF RANGEBAD SUPER BLOCK: %s ioctl (GCINFO): %s %s: can't read disk label bad file type 0%o %s? yes %s? no cannot allocate buffer pool deadlocked buffer pool PARTIALLY CANNOT %s: BLK %dProgram terminated MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANUPDATE STANDARD SUPERBLOCKPanic: lost %d buffers READ %ld (%ld), %ld,SEEKWRITEcatchquitSALVAGE (SALVAGED)UNKNOWN INODESC FIX MODE %d catchinfoffs_isblockffs_clrblockffs_setblockffs_isfreeblockSORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYSORRY. CANNOT CREATE lost+found DIRECTORYDIRECTORY %s: CONTAINS EMPTY BLOCKSYOU MUST RERUN FSCK AFTERWARDSPARTIALLY TRUNCATED INODE I=%u blk + cnt %d > sblock.fs_fpg %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot increase directory listcannot allocate memory for inode cache Alternate super block location: %d ** lost+found creation mode %o usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... ** Phase 1b - Rescan For More DUPS(%d frags, %d blocks, %d.%d%% fragmentation) ***** PLEASE RERUN FSCK ***** ***** FILE SYSTEM WAS MODIFIED *****The following zero link count inodes remain:The following duplicate blocks remain:** Phase 4 - Check Reference Counts** Phase 3 - Check Connectivity** Phase 1 - Check Blocks and SizesPARTIALLY ALLOCATED INODE I=%uINCORRECT BLOCK COUNT I=%u (%d should be %d)convert symlink %d(%s) of size %llu phase 2, parent directory %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %dIS AN EXTRANEOUS HARD LINK TO DIRECTORYCANNOT FIX, INSUFFICIENT SPACE TO ADD '..' CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s FREE BLK COUNT(S) WRONG IN SUPERBLKALLOCATED FRAG %ld MARKED FREE ALLOCATED INODE %ld MARKED FREE UNKNOWN ROTATIONAL TABLE FORMAT %d cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO FSCK_FFS TO SPECIFY THESEARCH FOR ALTERNATE SUPER-BLOCKUSING ALTERNATE SUPERBLOCK AT %d IMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKcannot alloc %lu bytes for inphead cannot alloc %lu bytes for lncntp cannot alloc %u bytes for typemap cannot alloc %u bytes for statemap cannot alloc %u bytes for blockmap cannot alloc %u bytes for cylinder group summary area CONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATCONVERTING TO NEW INODE FORMAT INCORRECT QFMASK=%lx IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCK** File system is already clean %sile system is clean; not checking VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEoffset %d, original %ld, alternate %ld %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION INTERNAL ERROR: GOT TO reply()WRITING %sZERO'ED BLOCK %d TO DISK cache missed %ld of %ld (%d%%) THE FOLLOWING DISK SECTORS COULD NOT BE READ:THE FOLLOWING SECTORS COULD NOT BE WRITTEN:returning to single-user after filesystem check    init: %s init: already running initial setsid() failed: %msetlogin() failed: %munrecognized flag '-%c'ignoring excess argumentsfatal signal: %scan't open %s: %msingle user shell terminated.single_userautobootcan't exec %s for %s: %mcan't fork for %s on %s: %msession database close: %ssession database open: %sinsert %d: %sdelete %d: %scan't parse getty for port %scan't allocate windowsetsid failed (window) %mcan't exec %s for %s %s: %mcannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't get %s for controlling terminal: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated, restartingwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modecan't parse window for port %scan't fork for window system on port %s: %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %dsome processes would not die; ps axl advised= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. super-block backups (for fsck -b #) at:%s: %d sectors in %d %s of %d tracks, %d sectors %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) Warning: %d sector(s) in last cylinder unallocated filesystem must have at least %d sectorsinode blocks/cyl group (%ld) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. file systems must have at least one cylinder (not %d)Block size and bytes per inode restrictcylinder groups must have at least %ld cylinderspanic (fs_cpg * fs_spc) %% NSPF != 0%s to be changed from %d to %d %s to be changed from %d to %d Minimum bytes per inode is %ld fragment size %d is too small, minimum with block size %d is %dblock size (%d) cannot be smaller than fragment size (%d)block size %d is too large, maximum is %dblock size %d is too small, minimum is %dfragment size %d is too small, minimum is %dfragment size must be a power of 2, not %dblock size must be a power of 2, not %dillegal expected number of files per directory %dillegal expected average file size %dpreposterous size %u, max is %uinternal error: can't find block in cyl 0first cylinder group ran out of spacefsinit: inode value %d out of rangecg 0: bad magic number (0x%06x != 0x%06x)/dev/apmctl/var/run/apmdev                    ެ             Ҭ             '3ԯSԯusage: %s [-adempqs] [-f devfile] [-S sockfile] [-t timo] can't disable driver messages, error: %mbattery status: %s. external power status: %s. estimated battery life %d%% (%u minutes)battery status: %s. external power status: %s. estimated battery life %d%%cannot set socket mode/owner/group to 660/0/0cannot set close-on-exec for the socketcannot set close-on-exec for `%s'do_etc_file(): cannot access file %scannot fetch power status: %mbind_socketcannot connect to APM socketcannot create local socketclient size botchhandle_clientclient reply botchclient accept failure: %m/etc/apm/suspend/etc/apm/standbyadsepmf:t:S:apmevent %04x index %d/etc/apm/resumesystem resumed from APM sleep/etc/apm/powerup/etc/apm/powerdownno! sleep! till brooklyn!kevent loopkeventkqueuecannot open device file `%s'%s exited with status %d%s exited abnormally.failed to fork(): %mCRITICALinvalid battery stateabsentunknown (absent?)chargingbackup power sourceinvalid AC statusгسггггггггггггггггггггггггггггس(dѴ dfiPRr%s: is a directoryrm_overwrite%s: mallocoverride %s%s%s/%s for %s? remove %s? usage: %s [-dfiPRr] file ... %s (inode %u): not overwritten due to multiple links"." and ".." may not be removedm:pusage: %s [-p] [-m mode] dirname ... /@pv  l@Lle)VhovX $OpenBSD: compile.c,v 1.21 2005/04/11 07:11:44 deraadt Exp $extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashextra text at the end of a transform commandcommand %c expects up to %d address(es), found %dnewline can not be used as a string delimiter\ can not be used as a string delimiterunterminated substitute in regular expressionunescaped newline inside substitute patternnumber in substitute flags out of rangemore than one number or 'g' in substitute flagsbad flag in substitute command: '%c'transform strings are not the same lengthunterminated transform target stringunterminated transform source stringtransform pattern can not be delimited by newline or backslashunterminated regular expression$OpenBSD: main.c,v 1.9 2003/06/10 22:20:50 deraadt Exp $usage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] $OpenBSD: misc.c,v 1.6 2004/07/20 03:50:26 deraadt Exp $$OpenBSD: process.c,v 1.12 2003/11/07 02:58:23 tedu Exp $0123456789/\$invalid command code %cunexpected }branchempty labelread commandw commandfilename expectedcommand expectedunexpected EOF (pending }'s)compile_reRE error: %s\%c not defined in the REcompile_flagsno wfile specifiedcompile_trcompile_textexpected context addresswhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'ae:f:nstdout: %s ..."sed: %lu: %s: \%d not defined in the REflush_appends\ \abfnrtvfirst RE may not be emptye,,,,,,,,,,,,,,,,,,V,,,,,,,,,,,,,,,,,,r,,,,,,,,x,~,,||(2<F<< -eq-ne-gt-ge-lt -le!-ef"-nt#-ot$....A/X/j////0L0|00001+1U1e11122&2M2y222222223d34233%393M3<=<< <<@<tR<f_<cp<d}<s<l<m<n<pg'<\j<po<o<oz<T<V<0U<0W<4a<a<]<\J<o<^<4gZ<X]<TS+<S8<(eD<mP<o\<oi<d&<es<e|<\f<Z<a<W<a<0[<W<|\<8]<d^<ho<]<t<t[(<\A<^[<mj<g{<Hg<c<hn [<0n<e/<o<o<v<v<v<s<Lt<hb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD}+4H +&}s4O:I؇$$$$$$$$ŀ$$$$$$$$$$$$$$$$ŀ$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$lRɞ YYߠ|ӣ33ӣl#4E\t:-Y-YY::YHF,< <<++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():dp|!5CFWiyN^N^n|FWiy4( D+5<CJ+K } ${PS3=#? } ${PS4=+ }< <<<<J J J J J J J J J HN HL HL AL HL AL HN HN AL N N N N N N N o    6 C C y      B B  o z   Ե    z ׶       ! R     V i   V                   V    κ                 G F                 F  ̽ ̽     Ͻ ٽ    [ K K k  ; ;  J ` x  </< U<<<<<t< < s< < <<<<<<<   s                            5 p L L L   L L L L L L L  ;  U w      ( D Z p      (   p ( - = p p ( ( ( ( ( ( p M p @(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QB  j  7 P P P V                           W   f  $          ,        m   8        A       m   ,  |                / N       N           8 [      D   $       O O       ,     Z   '  f   < O       | | | | | | | | | | | | | | | | | | | | | | |  | | |   | | | | | | P | | | H | | | | | | | | | | P | | | | | |  | |  ? | | | | | | | | | | | | | ? | | 7 | | | | | | a | | | H | |  ? |  | | |  | | | | | | | ? | | U | | | |  unable to allocate memoryrestricted shell - can't cdCDPATH%s: bad directory%s - %sno OLDPWDdon't know current directorytoo many argumentsRnprsu,-p: %s-u: %s: %spvpvV is a reserved word special is a%s shell builtin is a undefined (autoload from %s) tracedn exported%s is *GOK*exported is an %salias for alias %s= is a tracked %salias for L#R#UZ#fi#lprtuxfunction %s %T %s() %T %s: not identifier%s[%d]typeset -U -u -l -Z -R%d -L%d -t -r -x -i -tadprtUxalias %s alias not found adtno argumentslpnzjob control not enabled%*d %*s %s%*d %*d %sls:bad signal `%s'%s: is not an identifierOPTARGc_getopts: no argvmissing name argumentmissing options argumentlm+alias+cd+command*=export+fc+getopts+jobs+killlet*=readonly+unaliaswhence+bg+fgnothing to shift%s: bad numberc_umaskaugo=+-rwxugoXsbad maskrwx%#3.3o %s is read onlytrap -- bad signal %s%s: can only %s %d level(s)%s: cannot %sfv%s%*ld.%02ld%s%s%*ldm%ld.%02lds%ssys system user real time: -%s unknown option*=.*=:*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unsetmissing ]internal error: unknown opunexpected operator/operandmissing closing parenmissing argumentmissing expression operatormissing second argumentexpression expected-atime(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)ulimit: %cunlimited%-20s unlimited bad limit: %sexceeds allowable limitinvalid limit: %sx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}*&;#|<>"'`beginning-of-historycomplete-commandcomplete-filedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-fileprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcommentx_search_hist I-search: nothing to yank yank something first%s = %s: no such functioncannot bind, not a ttyPOSIXsubstitute%s: bad substitutionparameter null or not setexpand(NULL)%s: parameter not set%s: cannot open $() input%Rfunny $() command: %s*+?@! coprocess already existsPS4%s: cannot execute - %sCFUNC %d%s: restrictedcommand -p: restrictedbuiltin: %s: not a builtinEXECSHELL%s: %s: %sshcomexec: %scannot %s %s: %s%s%s herein: yylexerror writing %s: %shere document missing-rPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)%s: unexpected `%s'end of expression%s: bad number `%s'%s: %s requires lvaluemissing )missing :zero divisore:glnrs0,1,2,3,4,5,6,7,8,9,-%c%scan't use -l, -n with -e%.*s cannot open temp file %s${FCEDIT:-/bin/ed} $_-16substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILEhist_shrinkinternal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againillegal file descriptor namefd not open for readingfd not open for writingbad file descriptorno coprocess%s/shXXXXXXXX/tmpno such jobambiguousj_init: setpgid() failed: %sj_init: getpgrp() failed: %sjw:last procchildexchild: execute() returnedcannot fork - try againwaitlast: not startedjw:waitlastwaitlast: no last jobjw:waitforjw:resumecannot continue job %s: %sjob not job-controlledrunning and stoppedYou have %s%s%s jobs notifyzombiej_async: bad nzombie (%d)j_async: job not startedcheckjob (core dumped)%-20s %s%s%sj_print%s%5d %-20s %s%s%s%s %5d [%d] %c RunningDone (%d) no closing quote here document `%s' unclosed PS2PS1dopprompt\%c%r%l:%M:%S%a %b %d~/%smissing ] MAILyou have mail in $_KSH_VERSION-xPPIDOPTIND=1hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUmailmakewhoENV$ /etc/suid_profile/etc/profile$HOME/.profile-c requires an argumentUSERinclude: %dUse `exit' to leave ksh shell: %dalloc: %s |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEFallexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivemarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextrace%-*s %sCurrent option settings -o %sgetoptionsparse_args: `%c'%s: bad optionA:o;sgmatch%s%s-`%c' requires argument%s%s-%c: unknown option'\'%-*s%*sdo_phys_pathshf_reopen: bad shf/buf/bsizeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: bsize %dshf_read: flags %xshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: no fdshf_putchar: flags %xshf_write: nbytes %dshf_write: flags %xshf_vfprintf0123456789abcdef(null %s)too many <<'s too many redirections %s: bad identifier %s: invalid function name thenelseeliffiesacwhileuntil{[[&&||((|&unmatchedsyntax error: unexpected EOF syntax error: `%s' %s ?%dunexpectedEXITERRError handlerSIGtimed out waiting for input%S #no-args# #no-vars# ( %T) %T| %T%;%T%s %T ]] %Sdo%N%T%;done in for %s select %s case %S in%N(%S%c%;%T%N;;%Nesac %;doelif %Telse%;%T%;fi then%N%T{%;%T%;} %T& function %s %T%s() %Ttime %T%T|& >| <> <<- << >> <&>&OPTINDPOSIXLY_CORRECTHISTSIZEVISUALMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENO%s: subscript out of range%s: is read only%0*s%.*s%*s%.*sy$%s %dgrabhist: bad history arrayM-no home directory (HOME not set)can't get current directory - %sonly -t, -u and -x options may be used with -falias: -r flag can only be used with -t and without arguments Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %s: arguments must be jobs or process IDsarguments changed since last calltime: -%s requires an argument%s: can't find function definition file - %s%s: can't find function definition file%s: function not defined by %s%s: can't open function definition file %s - %scould not finish (dup) redirection %s: %scan't %s temporary file %s: %s%s: expression recurses on parameter `%s'%s: %s applied to read only variablehistory functions not availablecan't use -e, -l, -n, -r with -s (-e -)error reading temp file %s - %serror writing temporary file - %scannot create temp file %s - %sargument must be %job or process idwarning: won't have full job controlj_init: tcsetpgrp() failed: %sj_init: tcgetpgrp() failed: %sexchild: XPIPEI and no last_job - pid %dfg: 2nd tcsetpgrp(%d, %d) failed: %s1st tcsetpgrp(%d, %d) failed: %sj_waitj: tcsetpgrp(%d, %d) failed: %scheck_job: job started (flags 0x%x)remove_job: job not found (%s)typeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"Cannot determine current working directoryshf_fdopen: missing read/writeshf_reopen: missing read/writeshf_snprintf: buf %lx, bsize %dsetexecsig: unset signal %d(%s)wdscan: unknown char 0x%x (carrying on)j_ttyinit: can't set close-on-exec flag: %sj_ttyinit: dup of tty fd failed: %sNo controlling tty (open /dev/tty: %s)Can't find tty file descriptor0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzsetstr: %s=%s: assigning to selffc -e ${VISUAL:-${EDITOR:-vi}} --do_movecan't remove %scannot resolve %scannot rename a mount point%s: remove%s: set times%s: set flags%s: set mode%s: set owner/group/bin/cp/bin/rm%s: waitpid-rf-PRp%s: destination pathname too long%s: set owner/group; not setting setuid/setgid%s: terminated with %d (non-zero) status%s: did not terminate normallyusage: %s [-fi] source target %s [-fi] source ... directory "  #  #  #  #  #  #  #  #  #  #  #  #  # " "  #  #  # "  #  #  #  #  # " "  #  #  #  #  #  #  #  # "  #  #  # *# usage: %s [-v] [-z | -S] [-slbam] [-f socket] usage: %s [-z | -S] [-f socket] cannot open connection to APM daemonSystem will enter standby mode momentarily.System will enter suspend mode momentarily.Battery remaining: %d percent cannot get reply from APM daemoninvalid send to APM daemoninvalid reply from APM daemonSuspending system...open_socket/var/run/apmdevlmbvasSzf:Power management enabledA/C adapter state: %s Battery life estimate: %d minutes Battery state: %s /dev/apm_msgbufpM:N:sysctl: KERN_MSGBUFSIZEsysctl: KERN_MSGBUFcouldn't allocate space for buffer datausage: %s [-M core] [-N system] sethostnamegethostnameusage: %s [-s] [name-of-host] /var/run/utmplogoutreadlabelfs%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in label%s%s%s%c/etc/fbtab%s: bad entry: %s(null)/*login_protect%s: chown(%s): %m%s: chmod(%s): %m%s: %s: %m%s: opendir(%s): %m%lld%c%lld.%1lld%c0B/var/log/wtmplogwtmp\\#TERMPATHtgetent/usr/share/misc/termcapTERMCAP.termcap /usr/share/misc/termcapB C C C C C KC C C QC C C C C D C C C C C C C C C C TD C C C gD C D C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C D C C C C D C C C C 3C C C C D OOPS\G F `G G hH H lI I SJ J K CL L M 4N N UO O P FQ Q dR S  T T AU U ~V W W X X $Y Y Z Z 3[ [ U\ \ y] ] ^ \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G F `G G hH H lI I SJ J K CL L M 4N N UO O P FQ Q dR S  T T AU U ~V W W X X $Y Y Z Z 3[ [ U\ \ y] ] ^ acosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error ynynfyn: DOMAIN error lgammalgammaflgamma: SING error logflog: SING error log: DOMAIN error log10log10flog10: SING error log10: DOMAIN error powpowfpow(0,0): DOMAIN error pow(0,neg): DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanhatanhfatanh: DOMAIN error atanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfneg**non-integral: DOMAIN error rf yf f f f f f f f f f f f jf unknown/invalid errorno errorresolved protocol is unknowninvalid value for hintsmemory allocation failureai_socktype not supportedai_family not supportedname or service is not knowninvalid value for ai_flagsaddress family for name not supportedservice not supported for ai_socktypeno address associated with namenon-recoverable failure in name resolutiontemporary failure in name resolutiong Lh Lh Lh Lh Lh Lh h h 'h g 0h 9h Bh Lh Lh Lh Lh Lh Lh Lh Lh Lh Lh Lh Lh Lh Lh Lh Lh Lh Lh h xxswfstabscanfstab: RSHrcmd_afconnect to address %s: rcmd: %s: %s rcmd: accept: %s rcmd: socket: %s iruserok%s/.rhosts.rhosts lstat failed.rhosts not regular fileiruserok_sa.rhosts fstat failedbad .rhosts owner/etc/hosts.equiv__ivaliduser__ivaliduser_sa__icheckhost__gethostloopsocket: protocol failure in circuit setup. rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: write (setting up stderr): %s rcmd: socket: All ports in use .rhosts writable by other than ownerrcmd: address %s not listed for host %sgetnameinfoip6_parsenumeric/usr/bin/rshlocalhostrcmdsh: dup2 failedrcmdsh: execvp %s failed: %s rcmdshrcmdsh: setuid(%u): %s rcmdsh: fork failedrcmdsh: socketpairrcmdsh: unknown user: %s rcmdsh: fork to lose parent failed<g<<<`<Resolver Error 0 (no error)Host name lookup failureUnknown server errorResolver internal errorUnknown resolver errorNo address associated with namerresvport_af__elf_fdnlist%u.%u.%u.%u%u.%u.%u.%uinet_ntop4inet_ntop6%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%u<<<<<<<<<<<<<<<,^<<4<<<<<<<<<< <?@[\]^_`{|}~ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~authunix_createauthunix_create_defaultauthunix_create: out of memory auth_none.c - Fatal marshalling problem= 0 && n <= 9n >= 0 && n <= 15/usr/src/lib/libc/net/inet_net_pton.cassertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" z 2{ >z 2{ 2{ 2{ 2{ y 2{ 2{ y 2{ 2{ 2{ 2{ 2{ 2{ 2{ 2{ S{ 2{ 2{ z 2{ 2{ 2{ 2{ 2{ 2{ 2{ 0z q >z >z >z Hz Tz 2{ 2{ rz 2{ z y z { 2{ { 2{ { 2{ 2{ S{ 8r r  t t w v u v u u Ju w w w w w w w -w -w u u u u u u u Lw Lw Lw Lw Lw Lw u u u u u u u u u u u u u u u u u Uw u u u u u u u u Lw Lw Lw Lw Lw Lw u u u u u u u u u u u u u u u u u Uw Ly x Ly hy x w w w w w w w w w w x x x x x x x x x x x y x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x y b0b1hsbxfxtxsimulated                                                   tc%s.dbcgetnext|:X X  X X X X X  X X X X S X X X X X X   X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X   execlexecleexeclpexecvpexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpath                                     g                               5        \   h                     <          ) o l          w     8  8 8           8 8 8 8 8 8 8       8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8  8 8 8 8 8 8 8 8       8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8       j j j j j j j j j j                                             __svfscanfgethostby*.getanswer: asked for "%s", got "%s"-_/getanswergethostbyaddr%x.%x.ip6.arpa/etc/hostshosts.byaddr_yp_gethtbyaddrhosts.bynamegethostby*.getanswer: asked for "%s %s %s", got type "%s":2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$%s%.*s$md5cryptMD5PadR S S  S R -S -S R 5S R R R R W t t W t t t t t t W ,Y t 8Y KY t ([ 7[ 7[ 7[ 7[ 7[ 7[ 7[ 7[ 7[ t t t t t t t t t t [ p t p t t t t m t t m t t t t t m t t n t t t t t t t t t t o [ p p p r [ t t r t r !m s s t  t t m t t t t u Vv   Vv       ov Vv  Vv nw  Vv x x x x x x x x x           x ||  ||     z   {      {   C           Hz x || || || 1} x   9}  P} {  H}   8 {   C  ȁ | | | | | | | | | |   |  s | | | | | | | __sbprintfbug in vfprintf: bad baseInfNaN__find_argumentsexponent?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZError %d[%ld]%h %e %T connectlog_r/dev/log\S<`S  þ JanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %YAMPM%a %b %e %H:%M:%S %Z %Y_fmt%Y-%m-%d%2d%03d%I:%M:%S %p%e-%b-%Y%04d_conv-0GMTmnabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page/usr/share/zoneinfotzload/etc/localtimeposixrules,M4.1.0,M10.5.0TZvsnprintf m      I Y l          # 6 I \ o                clntudp_create: out of memory clntudp_call$W<8W< W<4W<|< <|< <|< <\ c U \ c gethostby*.getanswer: asked for "%s", got "%s"   w   explore_numeric# _gethtentipnodes.bynameres_querydomainN      res_query%.*s.%.*sres_querydomainHOSTALIASES__hostalias $( )  ( (+ ?' (+ ) + (+ ?' __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conf;#lookupnameserversortlist_res_initRES_OPTIONSLOCALDOMAINndots:insecure1insecure2edns0=H H H DH pH 01234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~3\<0`<6`<9`<@`<T> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)<<Eb<a< < kUu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUa<<<<6< <ϕ<`<5<֕<W<a<d<i<w<A<B<C<D<E<F<GǛ<U [<V<aΛ<b:<c<e2E<fڛ<h<i<L<l<n%<q+<q2<r<<sH<vU<wa<xm<u@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.16 2003/07/29 18:38:36 deraadt Exp $$OpenBSD: mount_msdos.c,v 1.19 2005/04/08 20:09:37 jaredy Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $b <^ <L<Z<d<q<}<@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.13 2003/06/02 20:06:15 millert Exp $ +<A<S<R<c<<$OpenBSD: mkfs.c,v 1.48 2005/08/08 20:27:22 otto Exp $......@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.19 2005/08/30 21:00:05 jmc Exp $@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.17 2004/07/01 18:25:47 otto Exp $ <{}abcdDgGhHilnNpPqrs tw xy !:#=@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. < < <<< / P< <<<<<<5`<<<<<<< < << <<)<9: <  E < L < U< h Z44 nwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: dialer:*:117: nogroup:*:32766: nobody:*:32767: dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs # emacs-style command line editing rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi a  ln}of!NI u p + & d _afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3dLGhc" ? : X " X _ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin3V_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmspfa#A< r m & ! P K  _ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"ID { v   P _ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/ksh3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin1_hostapdproxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T vq ~ > 9 j e !  _ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin"vm,%KB k f  u p / * Q L   _hostapd*VVHostAP Daemon/var/empty/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root\Vpk-( Z U    z + & Q nobody*Unprivileged user/nonexistent/sbin/nologin2$_tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplg&!72 N I  _rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd qp120at|Quantum Peripherals 120MB IDE:\ :dt=ESDI:ty=winchester:se#512:nt#9:ns#32:nc#813:sf: \ :pa#13824:oa#0:ta=4.2BSD:ba#4096:fa#512: \ :pb#13824:ob#13824:tb=swap: \ :pc#234144:oc#0: \ :ph#206496:oh#27648:th=4.2BSD:bh#4096:fh#512: pan60|Panasonic Laptop's 60MB IDE:\ :dt=ST506:ty=winchester:se#512:nt#13:ns#17:nc#565:\ :pa#13260:oa#0:ta=4.2BSD:ba#4096:fa#512:\ :pb#13260:ob#13260:tb=swap: \ :pc#124865:oc#0: \ :ph#97682:oh#26520:th=4.2BSD:bh#4096:fh#512: mk156|toshiba156|Toshiba MK156 156Mb:\ :dt=SCSI:ty=winchester:se#512:nt#10:ns#35:nc#825:\ :pa#15748:oa#0:ba#4096:fa#512:ta=4.2BSD:\ :pb#15748:ob#15748:tb=swap:\ :pc#288750:oc#0:\ :ph#257250:oh#31500:bh#4096:fh#512:th=4.2BSD: cp3100|Conner Peripherals 100MB IDE:\ :dt=ST506:ty=winchester:se#512:nt#8:ns#33:nc#766: \ :pa#12144:oa#0:ta=4.2BSD:ba#4096:fa#512: \ :pb#12144:ob#12144:tb=swap: \ :pc#202224:oc#0: \ :ph#177936:oh#24288:th=4.2BSD:bh#4096:fh#512: cp3100new|Conner Peripherals 100MB IDE, with a different configuration:\ :dt=ST506:ty=winchester:se#512:nt#8:ns#33:nc#766: \ :pa#15840:oa#0:ta=4.2BSD:ba#4096:fa#512: \ :pb#24288:ob#15840:tb=swap: \ :pc#202224:oc#0: \ :pe#15840:oe#40128:te=4.2BSD:be#4096:fe#512: \ :pg#15840:og#55968:tg=4.2BSD:bg#4096:fg#512: \ :ph#130416:oh#71808:th=4.2BSD:bh#4096:fh#512: floppy288|3in|3.5in High Density Floppy, 2.88MB:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#36:nc#80:\ :pa#5760:oa#0:ba#4096:fa#512:ta=4.2BSD: \ :pb#5760:ob#0:\ :pc#5760:oc#0: floppy|floppy3|3in|3.5in High Density Floppy:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#18:nc#80:\ :pa#2880:oa#0:ba#4096:fa#512:ta=4.2BSD: \ :pb#2880:ob#0:\ :pc#2880:oc#0: floppy5|5in|5.25in High Density Floppy:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#15:nc#80:\ :pa#2400:oa#0:ba#4096:fa#512:ta=4.2BSD: \ :pb#2400:ob#0:bb#4096:fb#512:\ :pc#2400:oc#0:bc#4096:fc#512: maxtor4380|Maxtor XT4380E ESDI :\ :dt=ESDI:ty=winchester:se#512:nt#15:ns#36:nc#1222:sf: \ :pa#21600:oa#0:ta=4.2BSD:ba#4096:\ :pb#21600:ob#21600:tb=swap: \ :pc#659880:oc#0: \ :pe#216000:oe#53200:te=4.2BSD:be#4096:fe#512: \ :ph#398520:oh#269200:th=4.2BSD:bh#4096:fh#512: miniscribe9380|compaq38|Miniscribe 9380 ESDI :\ :ty=winchester:dt=ESDI:se#512:nt#15:ns#35:nc#1223:rm#3600:sf: \ :pa#21000:oa#0:ba#8192:fa#1024:ta=4.2BSD: \ :pb#42000:ob#21000:tb=swap: \ :pc#642075:oc#0: \ :pe#21000:oe#63000:be#8192:fe#1024:te=4.2BSD: \ :ph#556500:oh#84000:bh#8192:fh#1024:th=4.2BSD: ida4|compaq88|Compaq IDA (4 drives) :\ :ty=winchester:dt=IDA:se#512:nt#16:ns#63:nc#1644:rm#3600:\ :pa#20160:oa#0:ba#8192:fa#1024:ta=4.2BSD: \ :pb#80640:ob#20160:tb=swap: \ :pc#1659168:oc#0: \ :pe#201600:oe#100800:be#8192:fe#1024:te=4.2BSD: \ :pf#20160:of#1310400:bf#8192:ff#1024:tf=4.2BSD: \ :ph#1008000:oh#302400:bh#8192:fh#1024:th=4.2BSD: \ :pg#302400:og#1330560:bg#4096:fg#512:tg=4.2BSD: fuji513|Fujitsu M22XXXX: \ :ty=winchester:dt=ESDI:se#512:nt#16:ns#63:nc#954:rm#3600:\ :pa#20160:oa#82656:ba#4096:fa#512:ta=4.2BSD: \ :pb#40320:ob#102816:tb=swap: \ :pc#961632:oc#0: \ :ph#656208:oh#143136:bh#4096:fh#512:th=4.2BSD: rdroot|ramdiskroot|RAM-disk root FS image:\ :ty=ramdisk:se#512:nt#2:ns#128:nc#16:\ :pa#3800:oa#0:ta=4.2BSD:ba#4096:fa#512:\ :pb#0:ob#0:tb=swap:\ :pc#3800:oc#0: ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet alias $alias_ip_address netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } if [ -n "$new_network_number" ]; then echo "New Network Number: $new_network_number" fi if [ -n "$new_broadcast_address" ]; then echo "New Broadcast Address: $new_broadcast_address" fi case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || \ [ "$reason" = REBOOT ] || \ [ -z "$old_ip_address" ] || \ [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet -alias $new_ip_address $medium delete_old_routes exit 1 ;; esac exit 0 MDFSTYPE=msdos MDFSOPTS=-s MDXAPERTURE=2 MDSERIAL="pccom com tty0" ARCH=i386 md_installboot() { echo Installing boot block... cat /usr/mdec/boot >/mnt/boot /usr/mdec/installboot -v /mnt/boot /usr/mdec/biosboot ${1} echo "done." } md_checkfordisklabel() { local rval=0 disklabel -r $1 >/dev/null 2>/tmp/checkfordisklabel if grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 fi >/dev/null 2>&1 rm -f /tmp/checkfordisklabel return $rval } md_prep_fdisk() { local _disk=$1 ask_yn "Do you want to use *all* of $_disk for OpenBSD?" if [[ $resp == y ]]; then echo -n "Putting all of $_disk into an active OpenBSD MBR partition (type 'A6')..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return fi cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. The 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} cat <<__EOT Here is the partition information you chose: $(fdisk ${_disk}) __EOT } md_prep_disklabel() { local _disk=$1 md_prep_fdisk $_disk cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT md_checkfordisklabel $_disk case $? in 2) echo "WARNING: Label on disk $_disk is corrupted. You will be repairing it.\n" ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -f /tmp/fstab.$_disk -E $_disk } md_congrats() { } #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV >/dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $( is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b #!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while :; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat <<__EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp ( cd /tmp; rm -f host* my* resolv.* dhclient.* ) cat >/tmp/hosts <<__EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up . ..chmod#chown#dhclientr disklabelrdmesg#fdisk#fsck#fsck_ffsrifconfigrinit# kbdmknod#mount# mount_cd9660( mount_ext2fs( mount_ffsr mount_msdosnewfs#ping#reboothalt#restoreroute#umountښdhclient-script wicontrolr ccdconfigrping6#rtsol# apm zzzapmd# mount_udfr . install.md set_term() { local _tables [[ -n $TERM ]] && return ask "Terminal type?" ${MDTERM:-vt220} TERM=$resp export TERM [[ -x /sbin/kbd ]] || return _tables=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "kbd(8) mapping? ('?' for list)" "none" case $resp in none) return ;; "?") echo "Major tables: $_tables" ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done } welcome() { local _q cat <<__EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD in a simple and rational way. At any prompt except password prompts you can run a shell command by typing '!foo', or escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C and then RETURN, but quitting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat <<__EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat <<__EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat <<__EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat <<__EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat <<__EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it." } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } get_ifdevs() { ifconfig -a \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_serialdev() { local _d _bd _td [[ -n $MDSERIAL ]] || exit set -- $MDSERIAL _d=$1 _bd=$2 _td=$3 set -- $(scan_dmesg "/^${_d}\([0-9]\) .*/s//\1/p") echo "$_bd$1 $_td$1" } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } get_partition() { local _drive=$1 _fstypes=$2 _part _fst disklabel $_drive 2>/dev/null \ | grep '^ [a-p]: ' \ | egrep -v "swap|unused" \ | sed -e 's/^ \(.\): *[^ ]* *[^ ]* *\([^ ]*\) .*/\1 \2/' \ >/tmp/parts.$_drive disklabel $_drive 2>/dev/null | grep '^ .:' ask_which "$_drive partition" "has the $MODE sets" \ "$(sed -e 's/^\(.\).*/\1/' /tmp/parts.$_drive)" [[ $resp == done ]] && return 1 _part=$resp _fst=$(sed -ne "/^$_part /s///p" /tmp/parts.$_drive) ask_which "filesystem type" "should be used to mount $_drive$_part" "$_fst $_fstypes ffs" case $resp in done) return 1 ;; $_fst) resp="$_part" ;; *) resp="$_part $resp" ;; esac return 0 } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file >/tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >>/tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" <<__EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null } addhostent() { local _addr=$1 _name=$2 _delim="." [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].* $_name\$/d" /tmp/hosts >/tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[x]'. __EOT while :; do _action= _next= echo for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "Set name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while :; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat <<__EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat <<__EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" v6_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" >$_hn fi ;; esac } v6_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up rtsol -F $_ifs addhostent "::1" "$_name" echo "up\nrtsol $media" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp $media" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "!route -qn add -host -inet6 default $resp" >>$_hn } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _netfile for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} ifconfig $if >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= ifconfig $if $name $mask $bcaddr $ext1 $ext2 down cmd="dhclient $if" ;; "rtsol") ifconfig $if $name $mask $bcaddr $ext1 $ext2 up rtsif="$rtsif $if" cmd= ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $(/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat <<__EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" "${_get_server_list:-yes}" _get_server_list=$resp if [[ $_get_server_list == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while :; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp _passwd=root@`hostname` if [[ $_ftp_server_login != anonymous ]]; then resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { local _drive _part=c _fstype get_drive "CD-ROM" "$CDDEVS" || return _drive=$resp set -- $(disklabel $_drive 2>&1 | grep '^ c: ') case $4 in ISO9660) _fstype=cd9660 ;; UDF) _fstype=udf ;; *) get_partition $_drive "cd9660" || return set -- $resp _part=$1 [[ -n $2 ]] && _fstype=$2 ;; esac mount -t $_fstype -o ro /dev/$_drive$_part /mnt2 || return install_mounted_fs } install_disk() { local _drive _dev _fstype _fsopts ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" "$DKDEVS" || return _drive=$resp get_partition $_drive "$MDFSTYPE" || return set -- $resp _dev=/dev/$_drive$1 [[ -n $2 ]] && _fstype="-t $2" [[ $_fstype == $MDFSTYPE ]] && _fsopts=$MDFSOPTS if [[ -z $(mount | grep "^$_dev") ]]; then mount $_fstype -o ro,$_fsopts $_dev /mnt2 || return fi fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" "$MTDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while :; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d=disk _locs="disk ftp http" [[ -n $CDDEVS ]] && { _locs="cd $_locs" ; _d=cd ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" echo "\nLet's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -z $DEFAULTSETS ]] && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin "cd" $_locs && install_cdrom ;; d*|D*) install_disk ;; f*|F*) isin "ftp" $_locs && install_url ftp ;; h*|H*) isin "http" $_locs && install_url http ;; n*|N*) isin "nfs" $_locs && install_nfs ;; t*|T*) isin "tape" $_locs && install_tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _bd _td ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi ask_yn "Start ntpd(8) by default?" no if [[ $resp == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" yes if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi fi [[ -z $SERIALDEV ]] && return set -- $SERIALDEV _bd=$1 _td=$2 ask_yn "Change the default console to $_bd?" [[ $resp == n ]] && return ask_which "speed" "should $_bd use" "9600 19200 38400 57600 115200" [[ $resp == done ]] && return echo "stty $_bd $resp\nset tty $_bd" >>/mnt/etc/boot.conf sed -e "/^${_td}/s/std.9600/std.${resp}/" \ -e "/^${_td}/s/unknown/vt220 /" \ -e "/${_td}/s/off/on secure/" /mnt/etc/ttys >/tmp/ttys } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DKDEVS $CDDEVS $MTDEVS; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=38 VNAME="$(( $VERSION / 10 )).$(( $VERSION % 10 ))" SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" OBSD="OpenBSD/$ARCH $VNAME" SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot DKDEVS=$(scan_dmesg "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") CDDEVS=$(scan_dmesg "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cmsw]t[0-9][0-9]* /s/ .*//p}") IFDEVS=$(get_ifdevs) SERIALDEV=$(get_serialdev) THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="bsd base${VERSION}.tgz etc${VERSION}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat <<__EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configuredϼWg($g"  Yg$ϒWW WVp  W@Y@ b WRVWV `YYW Wx,VH 7hW b' pDP g H ' H7 `!7>#W?g0L0 H Qϟhϟ7 pPgpߟWWz nb'4' 6W W w W w w /B w zBz'P4w y'P4w y`0PP0zBzW. \'^ϟLiW3'ز'Ҵg`' 'ߗ rbdd$'r'd$ WbpWd d02 dbWdp r'xb'r@ 0d QWj j'j'Rljl`ϟh b r'rϗ ',wW" '' Ag0 0  @YIJg P |wwLdwww w~dPTp\p\`0    Sxd Ȃ ςd‰0`xω Sy‰0zߗ f h f h d02  b7Wh=$ dgw*f0 w f'w f  'wfD'F`'bhW  h lPgl dbWbpߗ  $ dg zfwW P'RW W wX'Zwp'rw' wd'fw@\'^w76'W WP'RT'V 4wW''.W ߗ nb'n'Rpnph?3WR      X T  D'''tD' | LH'Vr W IC `J |gQ Ibuߧ$"  ,  f$("` 4 >   ( ( ' W* 7* Ҳ < W* '  ''\'AgP gZ' ^ `ZAQϟ  Y' |Y  IZ` HAPYYW&~\AgZ' ^\ `ZAQ W~ @'' ' "AgZ^'\\ `ZPY`X I JX@D' }D@A7PW'vA@D't vA؟D'(g$Wz "g>. > T'R  @ x ''|  ~) } 'jjl'nnp'x'b'd t vr @zQ  v zQWR W 2g&  W#@@W @ @ ߟϟ w w  "g"w g"g"w " W Wz w   f  gw dWșgL  7 AHdwA`qWC!C!C!d$.,>DHP\`flpvtz~ $"*06<NRX\ &l *.4:DNZ^jr08<@HFT^TYPHOON @l92- / P!П!|П!tП!lП{!`П``` \\ TT !</ <87?|40ޭި$ @4)m!@V$`L%k(8I7kF`(8 I@#Ak) 1AckiFc9A`bG((IkFacpG(pGpGpG!/!/!/!/@!/!/P!/!// /ဵOd(d 8c C8cIxccG K"kd/ h hIpGkOkB@h cAhKCA`Hk1c x*L !kd) ҹnI!lkB92R!dGxj9kFHb8k8 #rI l dIme x** Hm#@ J!(cdpGHh{` /`* `pG   Q    pG")O{/0;/I   B  pGljG@z8 8 ; 8 8G#h@'* Ji3a hhhW iC`8Gx*#h@'*JhR  Jj3bhh#:Ch. 8Gx*#h@$*Jh  Ji3ahh#:Ch(HF Gx*8ihA8hSC 9hyi@ihB *h C &C GkӸjk@ylC H #iCak1c#3iCaAj1Ab Gx*kA 90{(8S H@#iCak1c#iCaj1b Gx*k ,*90{(%Ѹj9l@#0Ch- L8( ШB KBЀ#iCa`k0`c#[iCaj0b Gx*kal j 2ЂXP0B`j#0ChF?C 8mkl@aj#1C hF 1B Ңj /C 8P)iiz lbl   C    A 8/C G").ЃG%Y1M@@k- $  ;,ѹ@@  B   B  pG 'IBSh##Ch X B 0(Hj Ho B8pG (@@ JFHX? HX HX LX##Ch!B BB pGUUUU: IXF;` XFZ` X2KXBJXKX#;Ch? B Hh1` pGKXF` P  @_-HzV`Ȑ@T,   P!    p      @T g   p_^  @0   $ $< </᠂ @ $ p$ ((,  , ??P/ /  B(  L @  B(  LL@/!00 /! /ဵ8(8v G8 (8h Gh:x$*"2B`D`:{{{C*#[BhCB`"``:{{{C*#AhCA`h1, C .:KB$%BhCE`{{CKB 3D˛@[B 3@C.9}{}C)!)CA`h1`!!`pGBh?hhY9x??/ 2``#CB`xa yKyC C Baz*#BhC* #BhC 3*@#BhC2*р#BhCB`zFvpG xF`KxC`xC`x C`pGHh &Ӹjh@#0Ch #Bxj9kFHb8k8m IFrIJlJdImeG x**Ѐ#ChC h #@C C  @CpG#Ch#@C  @CC#k@")F979{3)2)?kFJe-4-5"XFP2*ӂjFJcjFbz93Z@jFHbH'Bh*h*Bi* a`j) 0q  h*a`iFQea8GI"h+40bhjFbi{K7e7cc3Z3ri+a#ahIj 1Ac0:0B```88j08b8 G @1j-2#2Cjh yyC C 8 &%M4:4* #C+# 2Ch0Ch C0J0xk( #3C1:1` 8( #[C !8h#T0ChF`0G 4kj 53HjKYIB Ch #0Ch8)@ G(%jk@ql2+2:2jQi@3 ^X11Na0(jQi@1 "CR0()J "R`kC !k"R`kC jkJ  IFHb G)T𵍰 J5hb IF`j-4Hj7:79hKYI@#1C h0ChF #@ N(Y(khJ!i  (kyi@1 K33[iFP0( 1V#3ChP0( IBZZBЎH1h(8#Cq8@#CmG0(( ѸhA`(8#C8#C8xh0x`b (_ @ s#0Ch 1C h@ 8 !kK#3ChP1)! hJkF  #3ChnFP1)iF!JZZBXH1hA`(8 #C8#C81)) hJ`)9#C 9#C9)k#8ChF v#0Ch 5H*kFb)O!6Z61r ) I1C h  9#0Ch 1C h@ hJ`)Ѷ#1C h  `jF `  ~3(2(!LF`` (kjFb ( 0r3)2) q8(P G) @x*%HAh1A`$O1$jhFa"hF`"hFa2Z2zJ+ . 63#+@C#+@3ChFڃJkhFځ kFbb93JkFZ#hC`jh#T0ChF`Gx*,1j#E1C h '1J13+ыp2+ыp<8G p琴23'4J4jFp1A1lFOa9##Ch 1d#C h40v0ChCc h  CcpG2-52 7J7jFp4:4hF`a0``i#8ChCc h  Cc0 b0`b (vG7j#4#Ch#3#@k?;C `40##@7A7+< ##6imna3+#vjmb3+3Q3x3+#5+ChFK# 5+Ch{iFK# 5+Ch}i]#63Ch ;#Kˀc I#4#ChF # 4#Ch #0Ch 8j#@ C#@#CC`xj#@ C#@;CCakFckFdPlFHdlFdlFdlFe# GJ32#jF`#a #aQkFQk92Q#hC`Gx*L j( 78qh0)Bj*% ( j(=qh(8y(аG@j()`i(Hh`h(P #h@%((G#Hh@$(8j /88~h8jh9jF`8jF`HAh)h) Ai)9jF`A` 9jF`A`9jhF`9jF`  Lgh/8( `hhF``8 G I60x@-KBV-L8!*#@M)HjX!iC@#Ch %M(0x1z:h {!20x 0y9h@1 "CR0(!J "RxhC 9h"RxhC 9h IJ  1Hq!2QbG @)T @𵃰!XH2Qb!VJF`1Iy)SHhNHGhI4"xPMIjX#XC #1C h5+Ch#+@ EM+$1z:hBJ { x 0y9hA SnnFP0(2iF CZFR0(>+< :!SnnFP1)!xI :hjF!MV[F^S1)"Ij#I5+CnFh#3Chk@Mhs@ej#M1C hjF2ChQ@iQ@Ae xA!p( 8( JPhhFP`88rG) @ @𵂰iKjX#ZCI3x#4#ChCh#63ChCB#C `&6.@#[Btk + 3yFK{Lˀ$ 6#3Chvsa4,$6#3Chvb4,#Kˀ@#C `#kJ 3y3 {#54#ChFc#14#ChF d!#=4#ChFKd#94#ChFd#E4#ChFd#A4#ChF e; hi94,# (#  3zFK{FȀ  4##Ch{a0( 4##Chb0(G); mKF`RmFa`iFahFh HiFi ȀpGJ C`Ɉ Ca񵈰"jhI ''+ТIjX#cC#X9C h  )#CA) #C#C+ДIjX#cC#X9C h  )C)#C#C91K $$ -hFɈ}3rFsF:"qh[[x 3YG[ 5+rF+s.U-+*Ê;F1qdKjX#sC5#+Ch+[11#[@B;$ Fh;{@5+p+x3$ 2kЃ 3r]#+ChF3s+xF+sxxC+- --+CU-+FYr{.Fks3Fs+xY%=@4; 3q[[xY12; 7-CU-; 3q KjSX#sC5#+Ch+[11#[@B;$ Fh;{@4#p2FـQI3pa*IS2* G)pGHh1`8hFxhFhF HAhhFA`8Oh@ #ChFhF Gx*hFAhKC/hFl GjhF`@hFP`@2HhFhFЀHiFhFP~FsiFpGIh(pGhF `I hF``pG"O;3;w#48byb#rL%hk #h $h # OFb O KF``X``28d2@@GO8hGNGM#[(j0bDIF`CHAi)i1 {)#mC hFaiBl1d:8h(7HAi)i1 {)#mC hFaiBl1d8h(/ѻ#pz( pr00z(xh#@&@jBh0`(H{) 0A0@x(Ѹh| `b `8h( y4k #kCc8h08`( 8`G @ @,P,HI#B‰OB{* B{* NJBJFS`2BWGB"BljDBBsCsB‰FJFpGh@kF) gXFWP0(! YO=-Q)0( cXFSP0( p r`rr s`s)7iFx  9 -'-=(  x) "9rT0 xBx8?BhF 2!_ЋXFP1  BG KЁTXF|P0BؐpGx#'*p@xFp*Hz1r****pG8 @H#AiC Aa`!"Ra JF`#@i(OGHA1A @pG𵅰Ihy7( Ѹ(o@gHF` LbjHkcj#`bi B @IF`;X8 "Bxs:z3#i+s"/#`ih Kh 6vM;*#B٨r#1C hF 1  I 1  jJFiHCjFjF2i h#ChB0 B B (bh(`i0a iF`8cNIFy`ibk#kBjFybyj 1b!aI x1!9`9hF`AN`(0Fp` 0jB#kBq!bjFb!kp8kAhFy`hF`iF9a@iFxa8#8qBѹj82j@Ѐ0!k bkBjFaz(!ri8a8k]Hj( i LjBG @ IF`h(r @@*UUUU(@xj@!1@Hсl1dyjII Al1Ad HAj1Abxj9kFHb8k8 IFrG* @"a1 xjF@ @ 8T+Hk x@ CZ'Ne#[Bиi9kFah9kF`88`30(H # i)$}cI $-#k)-6R-#k81~(4@-#k(*8Gh i9kFah9kF`xj@ @ 8h@8888D G!k@jF`pG91   ja2 ) ݇=#+ChFQ0 B۰pG𵠰#!1C hF S1C h92Y:I# jC4i  "ihF94dd 4$$V.JF&hB2 BRU"$B"*ёC hF9`C hFy`1C hF` hFQ1C hF8cyb1C hFa1C hF`1C hF0ChF8h@8`8 8X G(UUUU90A8JBBBF :ʻj2JF2N0j2LmA8k3 rjm0jB e# mk'KFP&MkA@@c "JH){)i{)JFkK1 k0c( c 9kFexj9kFHb3#Ah)9kFA`9khFe9kF`G( D @hN%5OF5`8i88a|h, mFx` ! Hj GHy1q@ @ IF`pG8h Hj9b 0y( #0ChL!jB!C h  )" b jiB!C h Q!"jjB kbk8`G yjF`h#1C h   0Ѐ0IJk kBjpGhHh(Gh O8x( I (  8pJFHBhKh Gxi,5(D @ @IF`O!=0R#h( #ph( #HrG 7H#h5M)!)b2HlnB $(jBB*,JRk (jB 9B$>0%I(=#H,I:/b nMkkBKCjQ*k Hk1c (bGI$?"R:C.bMj nQ *kP J"Cj*k GHFf (-D @6 @HnJ0`#kCcpG < @𵄰 IF`'N3#(j(LhF!hF3(IHi0Ha I`{0`sy0qHhk(j7Bػ#z)!rG @ @ @O#"h+#;`3#{imF|ahF\`DhF`hFahFXaehB`(iFeaapG J3#i#h+;`imFapG!` JhK`@2)Бi!eapGhJhK`@2)Qi!ePapGh!JjK+лBX#cCI<##Ch+ pG1) )=Ji@j@_@@w@@iF@%iF,]2N&Ci@3SjFjFX@B>ъ@@c[#63Ch+,#Q63Ch@#I63ChB#M63ChB#Ch 2+* 3+*7B'5B C G)'Mhi(&Hh1G#L&h#O((j( 8q`((j( 8qh(8y(hh( `(hh(((j( 8q`((j( 8qh(8y(й) pGpGpG@ IF`#Ah@ a J!9jFyeAjFyglld!dk;mc9eBj 2QqymzomF`  I@#Ak9AcxoG*@ IF`[@h#@p IDjF`exjF`goci(8!2+ G*Kooch#iМ.YF>Qi3B;GFHi1aQ1e m@ 6Ҹm{C{C!Is Cs mFs3 Csm@ `h `h2KC`` 7%}``=d}d w8@#C8}b)HFb8D h#8ChFxd`h xn& 1B:dA#@ @`aah  B9dch @0a h c`;8~  h%xbb8< 9dGx*8lk !hA i* قV#3ChFPi0Bxnk #@ @`a h#8Chxlxd`h hB9dch @0a h c`;8V x ^Ghxb b8 9𵄰HAi1Aa ah@  hh{h;8*& x .`h@ ``0}N #h(%-#h(Ъ-#h 9"5-#h(kch}lC (Vk:n hzn 0`  C xahh"@ C"@CC8a #@aCF pph`(n0.8i0)Ix=x`h 9nA  zn  C6 hB `   C FA(1xi  C F(yi1CyaFP8i"@ C"@CC09izh9ah) iCFi `mAӀ `h8  C!hF `h 8  C!hFGx* 񵄰nM(i"@C(aCiIDkFh(&&eHAi1AaO(i0C(ahehBlB@bj&`b`b H#C  8_ `f` h8h ; 9*8hFxh0Cx`1!np anq   C   C FA ` `i  C F0ai1CaaFH`nF i"@ C"@CCq`!iI!ahI`ѱiCi8an8h 1`h8L xmAӀ xh8  C9hFȁ xh 8  C9hFHG<,*x* h&1@9J) ! " C@J)G2Z+:+pG&lFd kFLkg!hFahFhFIBmI!YIY='!I ++**&!)CC  aI. JFHmBm R&@( @F `F``F`84FDcFc /) JFHmBm % G(S 8h#8Ch8ChFx9h8`88 3G ! Ҋ!AGo@m2QqmF`:nF` HFAckIIc 8mG#CI h $^+hF9`A AhFy`hF`hF`07jB(1>) G!aI h*`JhFaH`pG<,Ih(iF `pG<,!gIh*ш`hFg`pG<,Ih(ЂoF`pG<, IF`(#Ah@ Q KK+;G++NHm1e* @ IF`( #C#C .GHm1e @"HF"HA3Amml h##ChB BYA ) (xjjF`jjFH`JFjHBm 9j8#C88@#C88UG8@#C8UUUU((@ ,IF`@h#@h@&ID #C A4@@ ll@d dk"mc ejF`e#xh@x`ah61)8#Cx`8 #Cx` a9hxh ; `8G8M(I@#Ak9Ac*'L k:c*jFcj7 /83#Aj) @IF`G Hh1`Ih(y0*:*ˆ* #oCgIF `!!!pG @ #i0sIy2ԉ`ЁU BSsЁP#:mChFaiBlIF`GxaHilCHa! `8i(иiiAxmA8i axmBa #!3B'!7n8-M(I0z#Cr)JF)HmBm + G i0 a#I0jQ1`j1b kamB#":C ~#" Can n"R Can  n+#"2Cann +w k amB@ c8D @(   IF` II0z'*r9II0z*r/G,P, IF`h0`H4!k 1hzhQd!k0hxhk#xhX@x` k0 c0@y(8G 9Hh(иjh  xo 1qGl/IF`j8!Ygb(  m h  zmB؉bhJl*JlJdjb8hjBkB!Adj9hIk@bhk@bhIl)ѹjkB:lB#X@`kFbh(8`8i(88a  "HjFah IkF `bhF`QxF HF 7j 3 FKFBӸB!h) FHq [(k0c 'h`aJFHmBmK >8\B {Hh(d8x@@(`08x#@Xj Bh(Ih(9".bh( и(Iht(нIhmzhFrahFa0I hb(0IIh[7jB 'hhKCh` a#hC`i(Ҩ a7jBl؜(h#hh@H@JxB 1ӂ /ӝHF Fx FP`hF`xhFb FdFcI@FPcPh60(8 a7jB(Xz ӅHF#"@K FP`hF`xhFb FdFcuI@FPc3* FHqPxC 7jB Pkk @ !:{Fd Fe#[hhCh` a 7jB q8x@@(i*(*8!yh 0IIIhAI (k0c FHq'h`a:JF9HmBm9K    ( FHq(hF& " 8 x B ( B0B @ @h#@ HF( ())  *#CChyH(D @*1X_!@۱  **)))!F :6h#@ @H"CHmBm  #@ @HCF :67jB hhk F B\ Bz_^x"RCh#@ #[C+ +))! (#C :x7(Шh#@ @WH"CSHmBm z jB  0 Bhh0C h`j{('h hh*Pk !:Fd Fcj1]hh0Ch`iB ah#@ /JF;*HmBm '# mChFaiB"i*A`mA ?i@aamB$@a!B i( `aHAil CBailCa! `iFa mChFaiB ( @0haG(R @ -IF`iDjoI 1Hqyh j$I@$Kh9`6m h"nF` Ny5#kCcjmF`j"nF`ai)ik1ic)hc k@@cxh #h) 9C88J  G 0y)!q8Vh( иhPl(иjAx 1RkB8BG8*xhkFb簵oF$M #@i(iFR #Ri8( 4@ #@i((8G LI" " h7" h 7K{-[{+#[C([CJh 9#G#C< @(h!aIJh*H`hFa`pGIHh(iFJ`pG#hX@`h:` i: aBkSkFb hYIlSlQdpGhRkB=0 hRRlh`#hX@`h2` i2@ a@kFbpG9 ) 1Hq`` aJFHmBmK fG(D @I h`#[BI y2 qpGP- @I h`#[BI y2 qpGP- @0I h`#[BI y2 qpGP- @HAy1AqpG @KXЉ ihL X@hBсBh$B فBhx0B Bx0B pG0JXЈ009izhB 9hF9ahzhB9hF`8i8aG! @  "@OX )0*00hzhB9hF`h`Hi( @  I0y"+ I0y+qyG<,,P,+I x)Ah)KCA`hI !  !  8Ch Ch[1@h#@L#hP0y(`h( q8#Ak9AcG8#k]c-3cbk1c!@"hC!`k)!cNph(6$hH`2h`1 {(Ӵ`(#k/!jKQ1bj k?c+b/'@;C7h;@3`Ck;Cc7 xh(G$'/K/J-j0bRi*iSaaAi1Aai*a)D`GinaaUi5Uai.a-T` O:ohy1-m[ Ӌ+;o+@gMF+`#` C8P`i2BJ Q a:g* $ @( IF`L%gi/hA`i?h(`hi/gaHm1ee` h("G @ pG#h@!+ K@$Chhh:` €`Bh#2CB`pGhS 4K@&Chh?h;` À`Ch#;CC`kcˀh`8?hF`Ch$ ##C;`@h Cx`n0fHn0Hf pGj#2Ch7;ChF`#;ChF`# Ch bkF b#iCakFaj1bkFb91J:JIk@2Q9hkF` pGGGGG G(G0G8G0@- H$H L@dQP P@0 PU PUU PP0@/0 16U0 T 0PG- h&h% @P@pČP0 P U PU U p  0 `p `F VpFČ`PPG/ U(( @h dXT/?@-OPT !P@ SY YYYEJK  0R<00/PU @ /  // / T@/ D/ H/L/P/ !@P@/?@^a/T/ /$/(/,/0/4/8</8</d 00S 0 0 0S<00/<Q</P-L*E==+ @#J[Ch[`[G                                                                                                                                /P- @0P R x tt @`0P R P LL @,0P R ( /|40ޭ@74D?@8HxGxG9xGcxGxG(am TuTT9U)De OPx!@#x!@9x!@Qx!@]x!@kx!@x!@x!@uy!@y!@y!@y!@y!@z!@z!@z!@5{!@!@q!@!@M!@Y!@!@!@I!@m!@!@Ղ!@!@-!@U!@e!@!@!@A!@!@!@!@!@u!@ͅ!@ !@m!@!@!@!@!@!@9!@C!@M!@W!@!@͇!@A!@K!@U!@_!@i!@s!@}!@!@!@!@!@!@!@È!@!@!@Q!@[!@e!@o!@y!@w!@!@!@5!@!@!@w!@݊!@!@!@=!@e!@q!@u!@y!@!@!@!@}!@!@w!@w!@!@!@w!@w!@w!@!@!@5!@M!@?{!@~!@~!@\@X@$ @$ @l@h@$ @$ @|@x@@@$ @$ @ $ @ @ @$ @!@m!@s!@!@g!@!@9/ !@---03:11:1107/23/0100001569Copyright (c) 2001 3Com Corporation @ S'}@d,P,=IOy$=;;LS?s!@Qu!@Q?!@)$R S0 @`tln!@ !@!@!@!!@!@!@ŗ!@1!@!@!@!@E!@!@Y!@!@ ) (Hx)!pHpG n!@$ @IB IFppG$ @n!@ J #-#Ha`c2``abHF`H`G 𵄰 #hI #8h(@"``zh"@:a A Q Ҁ `H hI 9iI h(p#TJ#C` y5$!OMh"@9ЊRNK\BKK[xB,IKxjBFbSh[#B ѕh^0hg(&,sX" A`JI'(!p`#Cb"(ӱhH` )  p"(!G#oCgNF0` p(J!H#oCg1` hC `p`!pQ!b# hC ` NFp`U#C py|!@  IFpH"!Gy|!@0Hhz#C#C#C#CB! `%Lh(##C!B  !9@HЀ#oC#oCg`Hjx  0C#3C CB IFbh)y #3@(G@ @  HAx)!Ap'H  8[瀼GiFiXHhFHjFhF! G@@iF8IJzXhF!~ GưLjiF3$cB x@#Cp ؀hF!H8 I( XpFFhFK FG$<ưiF8xx%(CB x@#Cp ؀3,hFhF 3!xx( @@0 (H xxB H v I08hF XphF!(FG$<𵄰'戢hGIy(..'.&%AH.f][D ##Ã#Ń#3y3#[B"m#[ #3C#C3B 0C*#C !C. (`#C* #C. (#3C*#C#C  !I / iF +x@#Cp ؀hF!3^(G Q!b pGOh(7#!C m#[!IC K #[ȃ##CA! C 8 G Oh(7##C m#[#[C  #[0#A#C !IC  G IjiF XhF! G@@#@Ij#[@CIFb pG@@@ Ij//?/'iFq_hF! G @ˆ @!#[B"#B"bbpGiF8F\ OmFhF!|mIFb G*IFHa pGiFHhXhF!W G@IF` pGiFh /x I@#x@#Cp XhF!+ G h */ iFx@#Cp ؀hF!3  GLjiFH 9Z( 9XE pI hF! G$<LjiFhHtJ 9q( K 9"jE p I(`hF! G$!@{!@<G pGˆK!I*k#C*k#CHa*hh ;@C a0 ( @7;C a0 ( pG@ˆh C HF`Oe#[ "C B`ڃ   C  `3# pG@ I h CJh Ch   C $ iF_( ChF! G@@h C IF` C a  C Ha pG@Kh   Ci :C[i ;C? #$;\p@Xـ8ChF! G@@ Ij!!;Yp@XڀhF G@IFb pG I j!!;Yp@XڀhF G@IFb pGI GuiF-HkXhF!e G 3G.G)G Oq#[qH @!I` 1p J#h @!+h h JF`GJFd !@@@ G( iF8HXhF! GiFqX H ‰C ChF! G)GGGGGGGGGG}GxGsGTiF XpiF GZGiF89H$)sDsh AhFh hF!sAsHXhF![ Gh'G"GGGGiF8$C#BKBHXhF!   Ch!YpFڀhF3 GiF8#CB KB HXhF! hF` G[8'_p ؀ HhFAhFhFiFiF8Ghhy G pGhFP!v\hF!GhFQ!d_hF!G pG pG'I hJk#@$*' : 'C 9 'CiF,_hF!f G@@iFHmXhF!O G*GpG pG pG pG Oq#[HqH @!I` 1pJ#h @!+h h JF`GJFd !@@@ pG pG pG XpIh') (hF FX!8G iF8 Xp$ Ih) JBKBѹh'B'8vhF! G $/4BِG K2 ! $K* @! * KB! K" D! " KF! K: H! : KJ! G{!@'?8bybbb H@kF( G@𵊰$iIhFhJh" @!fN*dJh h `aJFdaIh  )T!F`[IX*sЀ WHAXC$'%(8C QKC #CKIXC/Fp`(F`Fq`\y? /a $ ,17JQX)H!C!!1OyX) 8XF&#CI(# 1 ) C1)  C#C1yX) JhI h h F`JFd G@@@@@0n!@C n!@ Hh)@(hFj(Ѩ O( xkF( G#"! #C((8jyjjj| @ #[B &CMB=! AHAKBЀ%/=>JQiFiF#3C9KFYa#3C6KFa"`3Ji"a1J#3iCa"a!/4(HB0!**C 3]"H"IJhR !1 JF`( 8HBdvI8B(HAiCAaiCa"`iFaiCaa GP @ @ @ #[B }&@MB=! >H>KBЀ%/=;JQiFiF#C7KFYa#C4KFa"`1Ji"a/J#iCaa!! /3*C 3%H%IJhR !$JF`( 8HB 1*HBvdI8B(HAiCAaiCa"`iFaiCaa GP @ @ @pGI " p01h(pG @"B@2BpGB@BpG')' JCXc KYWXCPOhFW`hF` iFaKiFSahF`pG0(8Ы @Ű !!@_'y[JQXI 0y?/(L"@#!  XEB20(*OE+>рX@ "#!j!I *h FBh@ " #!0RH WH "#!0@I ) ?X@ " #!0*   CyJFPP0p` E+ ` !!@ )(0a(!00 1C@pa P!!@P)(`8HG Ы @#")ه\{@2BCpGư(A EAJQXK  Cv#[@C:J)a! ihE0!h 1ah@BѦh &!( 1' 7"1;9CH@ hB%-C" #!`h iF 9 C#C !#CC #!`h EJFPPCa```!aaaFGЫ @LB) 'C(!MC@** *i )iB)hB `hpGh iB8Ы @𵄰 !B,IX#C(@FTh!iB/<٠hh@! 1ahFhh@! 1! 1BF 0*h`]F0*;h`'/GЫ @𵃰 !B0IX$C(P  QTh`iB"i/E%Nhh@! 1ah@hh@! 1X#[CP" 2B*hu`!iB a00*;h`!iB a'/GЫ @ð 'C(A HEXk CGb "@h #!0, , ,, ?8Ы @I " T0`(pGЫ @W p ~G𵂰#3@@C  * S F(0ZnT (0aR (0    / p4?'G𵂰@C2S ( ( ( } z0wt(q/ x4k? b0_\(YSGpGOF`x8qG IFG Hh)"o CgIF `#oCg `"0`J`!pG II2 'P0(EL P0 (BJ P0 (ӧaaOee>MF/`o``a`/aoa I4K33L4c#cc#c0Kac0()H1(LFbak#bbQkFb!d%IF!e%I iFceM3e%fhFcfhFfKFf'gggK&gfaai3s#dKFeiFSeQ3e+fKiFSfiFfIFfgVgKgVaai0spG P,,< @\0(T|8T|!J#r#3#aY`r'sa#cKQ'b;`Dic<|`$Dc LF`jFbDi K`jFCbjFacQddefpG @"I#p #XrH'4e#7?/e#3#``a@ `aad f HF` Hkc He#[hFBhFʃhF pG < @< @@@@ IFs3:3aapJFePffpXp#rpG /I/JFa#Pa-HFbSb#cSc)J*O44?;a|a&OF9`ayab;c{dde"O6"My4aQ&7aiFta/gM 'u4|`=`LF! 2C@! 2B! 2 C/JD! JF! CJH! JJ! C(0C CC bFbbFb! HF`8/Ш/!`/!`G9!@n!@~(H/ hC `hI h h  H@j"2CIFJbHbGh#C`@@pGL!hHB #!m2B `t gr8'r HF`/'}1u0 G @JI1 x +# pxC pP0GppGI"h@ * h  h pG@ L8!M8#B ! Gg!@yzvH#vL)]ѢFBtz*zl*ЊBQFAxlkNFjX#ylYC@("2 "B#")i_Lj^KX#kC6#3ChXI2FB0TNFX hC!8eMK5-- B%2B܁≑Bz)/ylII yd*≑B'1F#xlC:NFcjylKYI@Y98KjylJRR9  `8Ja1  a≑Bc!*>$Lj#K]k[[6#3Ch N1Fp#0CIFȀh@@!8 qJRRjIȈy K5-- ]B%]1  B1 CG*)g!@#3@$0O 0J1M91+/QBN.Kj]k]msh66.Ή6΁@3!NvjFPS3SNjR`8FI(#O!."٫Bӫ+S3SX#>sCjh+ˉ3ˁ`8FH(/ pGʉ2ʁx*)!A`IJh*h*2y*Ji* шaHaGJi*шaHaiFP`a*H@i(L"h @''K1*"%LF a$LFLb$LFb#LFb#LF cOc"!LF a LFLb LFbLFbLF cLFLc@$̂OO!* ٌmj}@44eb1B)Ҋ22Wb1)I"G @(@#EgܺvT2 @gE#ͫ2Tv66660 @M1L#J 11# J )#J 9# J ! H2Qq!00AbG @u(@7JPi#0Ch 3K)Ih2KB>G#YUivG pG𵂰09(;8~F&(-05 i((x( hh`h@@ "hh `!i(( p6B 8vG8y1JkFc1 `"`JFJaa!0AppG!@ 60x4jEm!81x@  h* *xJ@*p0   h5Bhh@@axB 8y0k1` 0x00pG2x   jy3cx[j1 `xjF`KFKax~2BHHFa pG!@U!@!@ %~)0N~B ay0k1` U'-8( Gx?B&-807#V) Bh*hh`h( h((@BhB hB !hz`( p6B( Gy2AiFc~1 `2`JFJaJFa!0ppGY!@!@8hKB G!8y4( 8-1kF` 8z(xz( z( `khB 8i(KB 8~( snip@8*%0Ep4ahF( y0cc ``HF`aHFa(Gu!@;!@𵂰 y54jFa`bhkBa`*kB4fhFksjq&h*kB2hF* (jjjA3(aha`"hB ai8ѡi8ah*kBөkjcGiF8 22H!C4`3sy1hF bhFObhFbWhFbhFJcjj c{* **.2Rx* kF`%M"(i) zKjjMkB*Пђ kB`S XhFhF! G< @ ʀ8MhFh(X!~ G82hFh( X!e G8('# hC ``hC #hC` iC a hC ``hC``8G G$%'N !2x@? 45-8G9!@$ Ih)  J:! ?  GC B$   9!@':Kh+"$*#JSh +Ch *C CQ@1(C" K:! 8G  @@{!@"€JF`J2` J\F p01( " p1 K\Fp01( p1 J\F p01( ppG@ !EMy0Assd"B}!!A?H"&C=L97B0y0q8H"!B0y0qh/(/H}"!-M(,H,H+Nq#[*O y((8(8(0`y(#(8(8(I"h@ * h  h IF`IFdHH ]" @!!Y~!@ ,@@e!@HW IF`JHd!H"h @!*h h HF`GHFd%U(@@$O! 8h@ "M"L)9h 9h ` d #Ck1! 8h@ )9h 9h ` di! 8h@ )9h 9h ` dG@@!HJX\<`$F ) Iq#[qPq#[bIFHbHG!@ 1!@H|4G!@HVGHk)сkBk L#`iC`aiCa`iF8aJId JFK )2Hh)#`iC`a` #pG@ T!@d0D @@@!HFAb@!AbpGHAiKCAaiCa"`iFapG KJKHh KMKKB3B (!#aa(@DK `CNFa #CCB!A>NF1ai #;NFa;3b@BӸ#CCBA4KFف@8Xa 0B.Ni3a@B+I ci*KQgi0B$IFbX `C ", X#CCj0 `Bb̉`@ , C[j0 `ˉBOb i+هKjFQ i0BIj8(apG!@@  @) @ H#AiC Aa`!"Ra#Aa Y`pG  H#Za#BiCBaiC#a`iFa @apG I"_3#Zb0 (H"!3G =HGa"K!I(aYiSCAaiCa`iFapG_i#[CGa` a  L3#]jBjBћjB0 ( 3#[j+ 3#bbc_b0 ( ( CpG " O*3#[iB3#SjFSajFajFakFb"0 (K*ZhB!Y`pG C h ( I#[iC"aa@3#jFcSiCaa pG Ji!OiB  BِpG @aCB0ӄFR) xp@Iу:Ӱɸ:Ұ 2 p Cp p p xpI@R`FpG CCXPpGR\TpG pG0123456789abcdefPR)!UQ!;R!ڟ!PRYgк!NPR,~ШNgPRC"}H"ЊG"+N"3O"PR:W!}H"ЊG"+N"3O"дR!}!͊!PR<F!PR+!PR,%H!PR)}H"+N"3O"PR}H"+N"3O"PRg!}H"+N"3O"PRC"}H"+N"3O"C"b0`NRPR$xt=$xu=$xv7>$xU>$x>$xU>$x>$x>$xU>$xU>$x>$xU>$?$?$!?$?$?$?$?$M?$M?$bM?$ b@$ M?$bM?$M?$M?$xx?$xx?$xx?$xx?$P)@$P)@$Q)@$Q)@$S)@$ y@$ y@$y@$xP<$xU<$`8M=$x`M=$xp=$xU>$?$M?$x?$P)@$y@$x@$x@$+$*,$`Q$DQ$DQ$B R$C R$@ R$@ R$(h R$@ R$A R$ R$A R$ R$Q$Q$ R$|C2|C2|C2|C2БC2ТC2вC2C2АB$B$D2 D2D2D2D2 D2Т1D2D2Oc.D2D2F2@F2"D2=D2ЀF2F2G2@G2ЀG2G2H2@H2ЀH2H2I2@I2pS$ДS$DT$бT$$!$p$[$t $Ǽ$T#X$и$X$$h$b$~$Д$d$С$'$Ђ$Ѝ$r$$3$$$4'$И$$r$$3$$$4'$И$$r$$3$$$4'$Ђ$Ѝ$r$$3$$$'$Ђ$Ѝ$r$$3$$$$Ђ$Ѝ$r$$3$$$$$<$$^R%оR% 3\W%yW%X%X%2[%Ф[%^%^%2pP%o% WD2?2?%P%ЖJJПKFK   XD31  %Q%ЖJJПKFKЪSB1 B 1 11111NeN3NQ"NQ!NQNQ&3NQ&!NQ&1NQ1NM1NI1Nm1NE1NE^ & b .,f,b,b܂bܚbܑb܎b܍bmb܁ e T C B ꂀ"T"B"TB BBBB    eB" %ފ%2H+/22201@5#3Pe2 10Q200U23Z25^2@1Eb2Ff2H1P@3Ql2Rp2Ut2Xx2a|20kV13252@1A2E2F2H2P3QH1R3U2`2b 2c 20`&З&n2P&m&& &$0&Ї&d&Ё&2 R&мR&Ws0 W&0Z&2&б& Ї&&2.1.7&&1    [129 0'62'F8'c8'R^'л^'2w'Яw' .'K'T2'<'2 ','2 ''K'%'''Ф<d'Џ''D2'a' (І(ж([( (j (Ї ( (Й(б((Z (Ќ ( ((Ѕ(( ((Ѕ(Ѐ (Й (О (а (LLL LLLL L LLPLQL LRuvwxefyy yyp_,(3(:28.(.(0\.d(Dd(dm(Цm(n(n(Pp(>p(2Цlr(r(s((s(Xs(#w(x(y(z(( (1/$EL(i(lF1(Є(13)н)+ 3 7)Ы7) 3xV)V)EX)xX)Y) t[)\)8(^)L^)D_) @-q"Ѝ"У" "И"l"""4"<"ܘ""Xd)d)B30`j)j)O38hk)Љk)3Hl)8l)L3T3)Ɖ)ԋ)){1 HDXT0h))3\x)Ш)0)Н)8)Ы)!3="3pȥ)ж)p)T))߸)(`)Ǫ)(j)Ǫ)1\)ЦlD)Ў)K*3@T)) ))P))f.3@)))е),)o),)o) .*p*1\*L*0*H*1 *Љ#*83Ў83Д83Т83Ш83v2/ 0$*Й+*֔0  D*E*!1C2П>3Ы>3в>3и>3Р>??  ` ~ ^ "' AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy*H**>*З*@*Љ*\3+А+`t3$lP@ u3TP` u3 #P(u3 *P(v3 *PPv3 #PPv3 *P(v3$HTP$v35tM+v3 + +1 +F+* +0%+к%+{1 2+1+8)+z*+dz3;6+6+/;+w;+~3ж~3о~3~3~3~3~3~3~3~3~333@<+=+,B+hB+E+F+"Ѝ"У" "И"l"""4"<"ܘ""ФXZ+Z+ #3@HPX`bdhjlnprtuv<g+h+p$i+.i+i+Вi+j+j+1pTk+^k+D+N+0+3+p3T3d++++ @L_؛++{1X3H+g+P++3lP+r+2 ++ + +++ +5+t+<+++<$+A++++й+++F+D,,Д,D,Э,o,@,+,Ж ,DRД ,C , ,Фv2/Ω333 33&323>3 !"#$%()*+,-012345 @  0!,<#,,,,Й,,,,,>(,о(,(,, ,4%,$%,,,,Й,,,,,>(,о(,(,, ,   @00  2p+,3+,c0' c'c055$s ?/ 5R@R5R R=R@R=R R(RR(`RRВP@RRВU@RRВ@RR3Ь3Dz3 RРR_,з`, c,Yc,b5= V@t@8xd,?e,i,Wj,@n,Іn,//W93C3p,Mq,r,p,l y,vy,},}, 3-3333 D233ARCP~,~,К,,((Wl 4p,Н,,В,t٦,,6,Ц,2TX,l,к,,,,,,,г,ԤRC2v3z3~3Б14,,h3<-&-.&-н%-  % 3u Du u <u 8u 2u 0&'u 1&u 0&u  X333*444# #  4 440w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-4{{44E..t.Ђ.?.. .Ћ...D..и.44).symtab.strtab.shstrtab.text.rodata.data.bss  H!I.ID )@$4@$$ /@R@Bp @B4B N D I.@$4@RK_4$л11(AxNLP(W)d VqН|+Уd-')& i"m"~У 2*r(2(` 0 .~D_&ЕYؘ4n$ЊuE+ |4@cA-,Ѐ'K^)$HhpP~*r)yfR å ]%v -4.:A#)NxLa"n6Gz~TЮ:yh7Н+Їj ЕRD4$u49 I#N&AV;MMRX؀R_Tib-Ѓ|,ws؆R\$4T4,?R.EsM%/"S`4BALT .!u+ЌT-Л|h'-P1 ^wih0%760R, @,}T۝!\dd7t2< (u.i+Zz"tоZAr4VR(,iR1:D_)%I #5V2пol*My#О=B}, 7W#Ї1Is*)kyR,"-% qp)+$O\&Ы6a;&Fw&!SWнgVwtAH t@s?K-ЪA+I\hRV'RdH.Ku(\'"!Bq~Jt,^4$oyЗz@b/Р!ОÍ4-.?.b,A+?ЇeVZv- ԍ rР! )+, Юx< $4E ܄RM T,_ 3Юs [2!8 4 A d: o%4 *2  (f ױ !#* HШ Q<W ," x1 R? %^'J пa A-Gp {'  F!k 4% fE   lR \ $+ 6+ d'+ D4 "i% %. "=; `4ИD T4T М^ &Ig Аw U #f U  3 `V [5V V V E 0a4  * [. E#3 y*o! Ww8 GбH \L ,fX {Ad "o Rz d; ,L4 gh ( j@#m 4 *Л 9 " R A. t(# E9 J#K "Y nRc Uq m  % R"N й s ] .3 D    X ]L+z/a*@X{ЍO$(X+i'ЀsR%Й1` 4(2hV1W5 @L_{&),V6[LhW$ e4|O Э(,]Ѓm;+'#J! a21iН<Ɇ+K*Xą4m wEKw.s%4xU+gc(>UR0$W4@VЀ}%/R$7!.IEH U_Ujnb4uRi.YUa>&]x4 4)[n"RdE6 /E ( U$((<flGY#ЭW`L.(n-Vp <,Њ7Fwi+U -><.QEБ0^B,i/O<.ZLdkdm(By+4lR9e+vo *.~# #G'8` 1f%$!oЌ8КLkU UDh  yYMФR.+R0_Ш#\4-^$o=#s4B,N1Đ"AMc"N94[% m4Q|@44,-Р,T!6Xx*$wy; ` VА S6,в#V!П.7`,RH5)MXZ4^?nRx0 ,@-Йq=#kt4[%YzR(%+(Np*,9?*)Q%ЀcМnn'yr i(%8Vj$DS-Bf<.&{*h1&1y 9E$+,~8UW?O+w[(гr";pRhR+'TR-!34$R(DP ЎIp,-B7@U%}4+T,)9$MBr]i1h8TRa I)Ѓj!NVЧkR@1LB?* OO,>d fm]t,-+0`U Ѝؾ$ 4$X_4 f6"ch$h(24E&7E` WPr] sft)a.|x гX}кI*4$7W"R8>KD5*c cP >(lmЗ/o>?k&L)c^X,ha$t0yU R )(2 f4XP&̝x,&,y@WА& ++5?lHLGhT;7^.^p28z!IN@\ z-pг7-04[Q4>"-Э' )1M#=P R+J]}m4W4tƗX4Рx-И?, =c-BB-Х-(@uR@ \4Z&127NrB-P-Ёa,s,Ȏ+f$2а9*0к`)m>+ U P+-* &Є6 s+WG )U aN ^ t"r `4М J`O ~ , nШ C-? ![ U U  -b !ڥ!\W%#!$#5!+SC!ФM!TqX!@b4b!Xx4n!dOv!U!!vЄ!)!6)'!0!.p!L!FЩ"nR"`V""<(." 4"/0?"&ЂS"["1!#Ng" (x"U"^~"-b""Д"@N_"&"-"j4L#-п #*#" ,#>#NP# ^#lRg#Ă4}# #)bМ#}'U#R8# *#d, #4k-z#v'# $Ь$$H*7<$S$Dn$@z$wR$_+$]"*$U$&c$LU$Tt$X4$C+_$x[4%8U %';%*Т %f"Ж1% д=%.N%b%4|%jЄ%8М%]|B%R%F'=%aA%(7W%4%%u$&@>&hR&U4&R%&&7&za8A&b4N&å(ЈW&y#,d&["1n&L}4&j"o&4&g2&/)д&+,J&` V&VP&+Л&#д&\а '`U'{4 ',.m*'+o4'SRD'hRN'@4`'`z'h4'З' 'W4'R'"f'PU'D+ж'9#Ъ'nZ(`Љ (w !(cЛ&(6R2(4@(I(DЦU(`_(Px(7М(Б(w(v"( u4(_(^(V((r)D)`&$$)f%) H1)!{#з>)G$V)'#d)V p)*"})` WЀ )t&)h )U)"Ё)p )@'P) )>,)=FM*`-`*,(*%>*F+[L*0W.V*<`* *l*Ї*$=*V0*U*)* *L-:*4*3&M*-^Ѝ+R+ +&S+,+#6<+yMH+3Y+YG$iv++Ѕ+]*5+А f+U++- +`Z4<+-/.Л+:,+'+,y' ,#6,4#,}+, 8,lT-rJ,I$S\,#Вp,6,4hR,z\,R, +3,p\3 ,[*.,EX)(,`jR,( -$/y-AH,!-_/-G(0=-Y|I-p_4b-#*r-h(|-В-b4-*e-BЙ-Vk(-a'|-DTR-AS- )И-L'^.3.(Ш7.0 #!B.R.Rd.qm.o,i.hz(-.1h H...}.R.I#.#A.H /pR/U(#/+!-/*H-=/&L/c/Іo/4/Й/Z]F/)/3-Љ/l,// ,B/+Ќ/@V 0{{+0%. 0`330Ј<0w7G0^0qЁm0&50f0M\"0иv0,N0*В0'0V1ToR 1S10И$1[$E31(M1Ї[1*вh1#*Їo1'({1#u1У1%1yL1W41*D1 U1-И1$v$172i)21:2ݪ-K2l,[2@k4P b2\x22SM+$2.Ж2 *%2/z@2s(2%[343r+І34$.3,6B3Ͷ*V3)$b3O z3uЗ3.=3@a3+M3x3&,w3%Ї3io3׿ 46&41Ip,4=;4+AJ4L:'Ў\4W"$h4Az4թ-z4pй4+,e4Ѕ4x{E4&4" 4\4MA`4pg5@5!5y/5˨cJ5a"#U5:{-,e5Tu5 5O5b&5U'5@V5X45L'5'5@2X5hR5U$6\=X6&46!(6-C;6/$1R6 c60q6q}6,6636 V6d6о6*6*6(7x=7eO$7*.7t67HhR?7tBH7 mX7O p7x>|7]47"7F-O7U77&#7QR7E) O7R7e-Z7r)7V 8 "Џ#8\28hR<8|(ЇJ8.GZ8$#m8,7W{848׻*8t8R8&(8L.(8Qd*98Ѕ8Г8,9$!(9~0U89 ЭH9V9'(p9*9R9kj9A+q9R9&49 #В9R9R9d(P9C1"  :Xv:%:B77:#ЌM:m"S:&1^:A q:>:- :4W(:m:u4:j:ݨY:Dz+W:-m:F~(:S];9z ; !%;D.82;+G=;VP;صZ;:+Wg;(nRq;1(};'MІ;h"F;#;D4; ';ƁN;#*;)U<̙L <Js<W>)<0*u><c P<a<%|r<^#]<V<+ x<lA.<(,6<30< !&Ђ<nR<-b-#= (Q=І(=\#==]4E=F*W="Kg=9Ќw=c>=$_={.=` Y=w=P4=EH=+=U=PR=>!n>QR1>Q:>!k*B>"S>|pb>(Ѝw>5>B.>sЌ>9('><> Л>T>f*K>cJ Q>,' ?*,*?ԋR-?Թ'8?H#5@?)W?J)g?Xx?4?V-?!?t4?Q+~?T ? ?\б? @(h @S*IӰЙ=IJ.(KI@pR_I(#QlI #ІyI+ I #Io.еIDоI9|ILI- Iv!I4Ij-'Ig Jg+!ЏJ$&J]0J$"L7Jp|4DJ%.MUJhЇ`JWRhJzJgJ2-rJ#J[-]J=.JIJz]JH3 JЗJp+9J:. Kј(*K$,K+>=K^ 0LKRc_hK,vKs.fK*СK4K ЈKa4K)iK$4K-ЉKf`-gKԤRK#ЂLp:WL$4/LG;L6CL$DWPL R[LJ+lLr(-{Ls&SL.LЃL RLgs&-L1<LL,ML|}LnPЁL%w M8G.MF+e(M'Ћ3M(П>M <GMPM W]MjueM-NsM3MMuMG"M4M@"MMtUMzE+wM ^4 Ms*NM-H%NY,NR8N}XIN<,ZgN`VАqN,(NVNY"N@a4(N6N*4Nj)MN!7)2N0dkN[zMNHdNU O R(OYs$OWЎ.Oк>O$MO(v4^O)vkO%{OW!]OFЍOۧ O,uOd{'НO< Ќ OЄOUЎOaPq(PЪ$PJVЮ8PRAPW KP~d^P зgP*4qPUxP-:P*P}H"ЮPO PǀЂPmRPD'eP"uP5xЅPn,ЇQ`*,QR) Qp'Э/QZ9Q՘2CQo6PQF$ccQ yQa}(TQ,5QPb-BQ*Q84QU Q]Q&gQ"/Q"MRJ#RЌ*R85RRBR,!OR,]RLCeRe%еoRX4wRF+R]4Rf* RQR,R7R`V4R4_RERХSS&"/SP$4>SWMS![S eSSB1 S#4ЄSеSLSn S"S,,@S иSd-rT 3,T3&K,T!$G7T*XGT׭ TT!]dT\EtT$| TF4КT~RT +?TVT@U(Ty);TJ#ТTVT$*UI-У U%fU*)U{B;U9P#^MU-uЋUU0kdU!mmUt4U2vU1TUDWUW*ЀU/LU +JUz4МUfU?V VXwR+V@#4E0V1KVǶ"^V'МnV2VPkRV+Vu"V|iVP*ZVv4VЏV*VVy W&ЫWqml2Wi':W&uIWt:WYWP'?aWx$СhWh|<sW$4}Wx;1 WPVWbQWl-зW֞+ Wsx4WP$lW4W"ЁX#)Є XXQRXA(7XVGXmRVX94 )cX' iXnrX)ЅzXHXRXb4X X}*-XV"7X8NRXe"ЀXJ1 YYYЂ&YpP&а.YxY;Y,JYdU_Y .(qY-аY+?Y)YG(Ys YѬDYhЀY*AY' Y%ЎY$4Z`ЩZ -/Z#6Z +MAZxoMZB-#[ZW3gZ4$vZ'+ZZGtZ4Z"4ZСZ`6WZ=Z]4Z )вZ`]1x[9#4 [-[*[#>0>[jЂT[ f[-q[4}[1/[y,)[Z% [dnR[#g[{U[eR+j[(s(0[Н[6) \W(A \P2/\9C(>\jRH\hkR\[\t4j\Q*Лu\4D\LhR\)( \|3 \!*Ю\'\;c*"\(0\1a\'П\Q":] Е]{ ] R'])Х5](.H]~P]TLa]~s'p]6Љ]M-m]i)5]ޭi];(q](]X ]]n-*]$Р]p^/О^~&>%^J?1^%G^# U^s0]^-Шg^s&V^H^н^hR^J+E^_^T^,Л^^3^*,$v _&_m-Ќ _P<"2_#bF_#GV_-a_,#4k_XA{_,Ќ__&)_--_&О_@_A .Ј_ &'_~_SR`q*&K`V` #`1Ѐ-`':`RG`J1!S`n7``j`#-K~`d-<`O``=`4'`U`}`R `_`:.`Rat@1  aLa ,a 9ahдUa~R[a_kga`(JpawaO-fa%3)ЊaH&a%ca%ao,+6a8ab4b br^#b U*b:3-x6b+жLb1+Wbb#Шdb[oЩlb]+И{bx4bЀb`U@b'bRb["b ,]bt'b}8rbS7)b %H c[cW,c<BcЍ4NcvГScn~^cdUfc;ocncj)]c"0c+bc,acRc'Ќc"%cUdPdn($ d,$.dFW9d4CCd WdY<`dЊnd%}duЗd{`d)<d}HdSd,Ѝd.&-АdlS4d+)пdmj(e А$e4;e!)IIe~4aeX2pej,We,eO'|ee* e>b&ese; e*e-"Г fR f@44#f23fXjGfNf &.WfoLgfX:tfɀnf)бf- frВfD$4fX=Vf-ИfPH#VfE'f ge"g0*2g 4;ggyFg"Vg+!hg?{g,Hg?g;7g#gx4g$|g2g!h(h4*h3h?hކ#_Gh|UOhM\Uh"4%ahMb8vhPhe-ЛhfhU-лhthB&Bh %XhG!Ьh i.i(#i *iK$@i&.OiU[igi|Н rii%XiY#1iDu<i@4i-Љi!Ўi!i}4j-\гj-1jmP&j$Xd5j-FjD3ZjJ)^djH#8ljHD}jk$jJVj$Rjө"Зj`4ЀjijgR`j9k,бk0hRk-,.+k0m,rm~4mٗ,miРm  n nЃ(n-\8n:W @n! KnIK_nЛqn})$ nRn-оnߦ!NnЛn!,ШnV$nYn&An1ІnmR o)HФoj4$o3Ѓ0oXiRr*#Lr-ЄZr'crfОqra&Mrwj-Iw0XQw(к^w.smwmdJzw VwC+%wp&wqw@Rw6)>wإ'w:Ww]x:mxQ"xh44x91FAxx%Xx"лcxաspx]x]()x@20x1<xxЬxЗx̎'x(cx-ey\*y- y<*Ѕ2y&UBybIy+`ya'кiy;4&LxyЧy yޗ,y`u"&y# y_,"yk5&rylШzu%ЌzS3Џ-z>z3&JLzC `zЈjz;GxzzE.:z+Nzĕ4 z78zȹ-zΡ,z,z"QzU+ {B]- {l0!{wo,{v"8{fD{CCS{ hRW{۞,f{*BРp{{'T{}{#{4{0{"А{Rd{>{\ 6{(R|m.e|(g|4'|4;|)I|(!V|_sJCЩYl*e@4y'K_j,)<1+'j̀+" ܀t49) ^k+lU- QR> QIЉVгeO%3z@ AAK>+΁)؁o а#-* 8c&e'H66|AY1)XN|+?[*gV7x+Б+Ѐ$R@n,FÂ_ vЂ;,\&l `)U81GC &UTVgOu| }G2*Ъ̃*(НԄ(ZT6WV7'q!\4u+ЬEvZWc{*o%*Сx]'-N&"8V$ЅM%΄p#t˜w;+%&)&"U*^41L=mg ЇP?XFIpG_@yf(noRTPvsLȅU4Ӆg߅ B#y]&,lRu-n7.X*k8'/D} $<V"gg4q|Ёv`UK),Ru):,IN_Æ84چP1)~ t4$kn48CF(O_`){aUmim}hT4-t-п2WwDFPŇʲGχR"߇M/&,4++е(!,>0/y8Ow=!J[%%W#p"А`m6l_4jЫzgVM$ƈTGو6-:.R ;Ж#cHЊ2$@KpУ^jRgiRp<-"r"VXV_щI6.К$j* +E!"K-$44 CUOY)W^8]N-;e$tV~$VptuHY4jRt?*Č0nόڟ')#Ш G&вaУ zR R.@8 4`A`UMЙWIsjUvR@%-qô(m'I'e̍i&uٍ/+0s*3mRև*(`M9t ERTMY4@]lYwzX4mn60&Nr#)-Ž,xݎJ_#  ]4&(3|QRB#Y )NЕW]nh RptJ_{u45^1&\<&Əsҏ#ۏ߰) ''^&E%+'.7[IS-]N%lw`1ЀL'Ь4Rʐ-#%֐{S4C @4Ѐw0 $$$ *<3,Њ< .-Lp*cV#Дa"jqBuDN_$R$4s)r b]пʑ5Иڑ 0'Aa#І-SЇ,/1,'<FzиS H_iЏyZ4nRv EлL4zІʒ!&Љْ,#б#X'b zF-a+Й,imж5l)4C:W\Ri0q|hzh,Ъ5h10ȓ2zؓY4^[ )]ё-\eh"'%Њ8$#J9)$%YSlHxǼ$M+Є3Ќl{%L@j4Aϔb*!<+)>|в,J'}"kF)=(<pK"XW"Іcabpx "-$4<&4?)Їҕ}!  $y+H(ЊHR)pa4)@kXLcl"}rVwU%D+Р)бk m̖z]ՖwRUQ(pMг#YWQ"'ݕЊ7uF7-SRߏ%%eu"<pU)Y,:LIЂ~Hmėk-f՗#мu4#`4$<#!( 3Ju# :F`RC}_lnh}:u"&4 аmP-O͘*eژ a4,"8hn/#C!8`ЃO*jd6WsU~Up)A%"q@*&Й#-Аۙ +M.'Y<g "VT)t5$4>FD(8S`B%is,Пm)Зr#~R#"")Є͚trך>*u4Pj< `) tnR!t_,62X4Cz4R,}e%+zz"'U*`"\_ΛR ֛  CD4ImО v#И{8%=4x4D\!K2N+O\GiX&6`VИ K_!WŜ4ќ~$,>F1 HH`g'Pr#.<>#ATV`m(QR\b4 @)x] Вʝq3Р۝W|( (_4XG. P#С'5@0Ъ G*5Q4\`4u2@U<;QM\W4 +,%ЄȞ;#Gݞ3.h|&'44.J4-{47c,ЊL`$4Z=s[4{+,",U? ]Wи&ПV4؟O *d0|#4-Y8AG4T'7dđRmVuF1u)e~+("SiRĠ!)Ѡ Uݠu*OH e1"4$31FHX4MЕZ)Ai[v;+u"0j*Z'<¡ @eС-Јءu\Ф$QRTxYUfг*(R4/,5Q-:`:Lh],t2Р}9ЪEXcGy $U{o̢ۥДzUОu+^А8ōЕB)lXy:Љnt -\[VI%+ "%-£\ԣL" ܣ\TR~C#^A<G'&Q4oM%`3fl_-{23(M^'ДP /@ >ǤRdݤ3ekx4,(7)2&vRS,<H9@*ІK2]8nRc-'l0Whu$>ГB%HcU8"Ж˥SߥP20j,\]Sd4(' ;ThRFZVUf_|7Ьgso9'7x5"иfn>-U4(P+ͦf*кdN'ЂA."Ѝ&0'DAdKDc)=[+Sjeg*Й0QR" ЕVAΧX"Чק*Сø*[|)j ,б*Ќ2 (Iz4Z>(ki!; xIeaYjЂo-O4$Ǩ)ОѨS$i{Rм, _^+h1C'#O [fRbsi8.8(^)$iس+3éU('ͩ}h%Qک\4 c,PМ#;@ | 4%/<fGīROЖ[,Djջ/wV4'Б- 'В8R_.*+ª4@ݪ?+ Н)6 ,.0(/A!gRr sG+(((ХVDI.wؙͫ*ի n#]*Ї t V^!y"SC-U5z+%AkJIвQ}4$b-]-|Tд]l,бȬЦZ (2 V# U#,?6,iG%ГTĆ4l|k1ӱ]4AВ$(Ѕ %Ћ#в*r;!]EB,`SYf-p@21f4j``4Ų+N"ԲfS'߲ėRSo$Ni0 W4o-ж-+*"9]4E̘Y@Re ЗsN- &Bj&r 0(dzճH$4ܳ- M ЊAЏ iR), <!#ЍIbWUg-*roJ|vtRTQR9I)J! ȴWӴb+ ^ A Oڑ K;!#^!2/i06lRA%Hj"R+Yf piЄ2Hǵ.-׵45 J|ЂKl-%{DS 5P""i]:'-Tm4yZMН h+$j4ߚ#г{(ȶi)LL_ " {]4 A4,Ћ@3SlH+iVљde}"Шp4ܽк1#˷k"Է v߷x$R v45e:(40=gоI[-FY6,pj'+ w+~,Щ?# 3mRo̸<"ӸPD1  w(ЗZ[!,s,Q-ZHRG'!e~rDM Х~>;]qE/ ù$+ԹUݹD,R`0Hw4\&Ѝ!49gnBЂK@VЈU#ij]w 2  VЀ@HЩQ4˺pmRֺ~"4-ИQ -{=6R%,39b$ТHW4T!P`h/xгЪPR+„R»,АܻO*.*3$(Y@BQz]¯ek#vЬ M͎x+Э 20ż&>Ӽ&C$:XT UM"!)(Z 676LY4TtY#[n}i@iRut-,:W4FW4R*H,Бֽn(߽Y4H5- vM-3+8LVHKi*<T\*i*`t^tO-С<'4jRЃǾȘR׾*s#kEl )e9о ЛGT)e,htd~'+(UЀ,Е>οpRտ}&t{H.#~03Ay-F VАQ&.k:wu"Џ܆UX4K_4*Aq/.=*A i0G`<#,-U: N_z*dXVl,cR)ЎlBu#sHS-Y- P0kP (()Й+w,Љ`"<%%P2 @4O$w4]ndhRyqо˝B6CW' !Z@Ri}Ev4(c)Т |4 @*!ϖ*Ђ9ˁ6BXRH Y-ETJ_nUЀyy_wT- =(*C#9 vE.?9,\'qU4K#ЂC"V^iu*#5-,f6Å'0?}O]4]A9'kl,Яv0!IE<]4ЃhRi){9V=k[EwWX)] R&}q)' a),[6ō C0$J!1XI.%`,{3#+#s%nR(А$$c1"$ ПG,|!a% $U:$L4, 8'CAftPhN#Z|(zcktl|5-AXhRw'-$(j.v4xf4G:> *++~4$.5i8+ A NRVVH[Mi'fp06m  x)7$DrX=be*863u*4s"1Ќ LК:j12:Lj'W#d8Do3(zO"Еs#nF,Е SW!Т *ОQe2{X2:#Z`4*Z405)>ЋIϧ(5Z- du*5VK_U>-&>e*-w|"8DWΐ"gk ~45 )Д> #L"&V{$hZ%q k_~$_Ђb+'k0$ Њ]=P+}i&P@DW(,U80zGEMv[$ЭbCot+Єu,2+#ڟ!Л?{*,6g+oV"?&.YA&<9?Ќ,, J4*nRg(Єdh6WmUtt4l%Ђִv$RwM+Y  8VG 8*H0F&(1X#!9@31(Ph DQz, Lm*`&"c)*t"|48{,09*'Ї4%ZH, :U|4]zrB8u4 y"L $ХFh27.*П+П(C UА+jFT<.IPLr[x--g^*op"`uxyи'Ѓ|4Nq@fx #t#P${4d~TP?e,Р)u-2%Ig[SOpb^йq-Њ{ Kz( !u,{4B!;7d)i*"ES$+O%oб3 ^ vB1Qgy=]a^l7),|7u@.4TH.Q+Є,._, & :"C(e337n*{<CORb`rРp=o|K_D"?(Ck)H\"4jyдY-6,ЛFWύt4"-М2S#WK`-bZ\,Ѕrb'U#п$Um;')iОhU~E!P t .+r&$R-,ШAL_LVWz/,4kЛ{zЌ.0PUf^gP%t"!"!,Kx+^ϝ*йS"+kЁ )F<&$'44IRV3-m\w4~U*$nǩ#ҮЙU*y-АMW-@'h% es' ()Б7({4GU0PA\nFiA+Pr<#=y,Џ`,^*,%+"Y4,.xW&Si"Г aC$+*з4-дFV CR:.о\-f@RTu3)U&9L?(н6l6*@Voz`):@9U<BУS( kRW"TxVZxA.xu&#=1 dS4o` U|`4\ RМD}4%I.*4(+:Ho#WQFa(+cjH*z'Б4xbapQRܤRhv4SЬu {e!'x.4<nQJ3eY'a4 ǣ*]NH#!e1!ЄdR ,o3EІ#, /C'Щ:#ЉFpUNFУh1*}8_Iлh$4x$*RN'-+'ЀE<k/}%+45\)2B)M(Ъh tТ~-Q+ВL_|4d* gXH_yЮ;oD9lk%Е<Yo,w*N }&Љ*N# 7^@eQr.Єa (l#K$Rb:UݹSШW%UQR*~5+ |kRY>{a|8&гB]QRf{-_E&4gVwІ v-wqA5W;m,R$ҍ"|/n-$#;6+Г2p*1>P'3KoАXFh v+pJ)G( ݸN<%A,*.<,n\$ua4+YgЊ!0W8*-U> 3S'І]8!1i +Ѓ{.d(>#7,Uk5Rw' TV4$LE8&P#<"!(`4$8`#@44Qzx4We-Џp+l6W[ Ѕ VDoܢRx)0`1l! !3L18o-Ш?oRL *ISo"Јk ,`>1 =1 x,#!H4Xf#UQR+E-oh%p,16dЊBRػ2 f#Їnth1x+Ѕ̫ ЃĀ4)*v&R)!N hOn( u^4))J_~*Wmf4DЃ?i*LqMdKs!](@#-}QХq-мÛУXVIkЀ U# ~u]4-0V;bРE SUgaj+ЇjgAl{Lj*D Л]ػк'--# GW}Ue6RREh VR<anRku4uD3Дl*)$DhR7"]<Ф4D&`K1 Ȭ <>T nЛ02<FtiЗS +kxxX)N{@#Vpr0 -,P-оhDW Xw4 ,d0+ЄI`*ЫX'Іl 4${wT3 <&x,1d)iϭ$Gp-:̿-RRS%ИA$ @U( #!0G#IB^МJq_+Ep^ ~4g Q4pS$$AGLr,A.( 7 I."v**<(-6Q #ІBfQ\epQzqB1'=##K*п_ОHU-t@Ul-Ю+Y*JV]Ѝ? (I {4P@L.(c-Уxp#/* <@R 3D  ]4 "O2 ;< dVE H_@O lG.X (аb ;R!xn z + bA =p @w zR   ',  Y   4$ 9Ь .Z ,72 V> K.(Q (*gc FWk +} ' ' ,=  +~ g 6 `A   oК #,Э w"G z6* TR5 RA m,iQ 5+w^ o I(| 4r   R |J_ 1' Г 9  b4 )W 5а *Й!  R/ h"!9  hM @^4 Z W4j  " :Y ..f +) \+Ц >p(w }4 ) JЮ G./ ߀  C-S &$'. `49 4%J vc U!Йx -: 7"@  U pf-: ,_ #mЌxH_@PR,#T*3H,-,}m# 4(R!+w(7.CFKYarЎk _-c\4-*KY-  $kj*" x>-n|"F`4! 3 30>J `4R*.N]y,Jea Jn8}a_+sKЇE 9*xyHW4,Х`*9.X$%%$d F3 Y@q"JpxX4a6;xmxRydzR&zm `d7 LRМ&ЉwNT\QR пN_)81399&;?<-M Fb,Еu)YJxbJ_sk#,sи"R0 2A\a*OP##К^yDmzL'}t%j1# Xp'4 &' :t:kRc-v$C"H/ p2±"EвP+c-жw'iF|8UP{9гT8#A$D#ӟ X*.,&45 EL_O*]t%#juΗ%x KHDW Vlv4 UW*+>@L40 H.XV*a#"!1@4T?X4SrOaЋs' |fHiU.|Ј\\a'ЀnRU Lӈд"i.ECɑRK__a}!st9WhFFa-/\+Y]t*K?H#D'BJ&Т "J#>%("2x0CbhK.fR+s0("! H.E,2q?>wT4((b4-* H) S-*kp 4z9v+<4$*i*x4PiЌ*Л I_@"@=!ж,59XEF% X~D*mG.:uUtК 7UJ5HR ((#~-Љ$VhzR/t"DDTR<OR V%eXmQЮz44hI7Іv" f O'N# K_ V,OViЏ*=.0Qnz<[M^[$4f[+qбf>+Гi);L,G+UW $Z,>p4 3AuR24G=MvІ[hRe"й$ ( 06 b4C >%\ Af &вq 4 U K f,H * %+ ¨'' DW ԕ4  V&G6g&w&_,N&'F&#&6Є&R&(,&С&&JЫ&w'>, '4'E'"+'^@'-GR'Ja'j0n'"f'T-')O'Cи'*'A4'-'R'#С'Vi}((c()й%(=RЦ.($6L?(=L(`(.-n(hV4u(ԄR(HV(m+([&(V(R(@&н( U<(=aк()п(,)%!f)) 2.)809)[4?)؛+"I)= &"V)0c)3 u)/~)PД);1 )",)()Z*#)h)@U )Un*a|*,2'*(Э7*+?*VK*A}Z*YsTb* ?p*[4w*p,*kr=*R*"*+ **f*T4**_  +)Ч+5I +rw3+;#Д@+e,бN+V4Z+@(=d+$*s+R+wU+V +U+3++U+'4+++ąU+++; ,*lЍ,\R$,hh*F2,b)Џ?,>jL,Pc,Щk, '4t,"S~,,FW,a$F,R,[]+l,,t,ܘ2 ,@U,,Р-*Ю-R (-Q9-{RJ-qbP-@.h-.s-B-Е}-<8#-'-4 -"Е5v4$5L45( 6`6&4 6>Х/6H*Й86+ B6D4 W6ß)h6Lr6@GW z6+ 6+ 6x$46Ǫ)26h&a6V36Ў6b"6{B6.F7,7'+7($в37Hvг>7.<P7i!b7!p7D{737@U7>U7+З7U7jbX7l)7d7E"' 8"88<Ѝ,8HЋ=8lJ8+]_8Ug8#8n8M By8E8k8 8`"4d8R8Pr8yЃ8 48>x8R8#9hkR9#Г(9Џ39`,eE927,U9i*_9xIt9+$;9V9+9 29Q9 4$9ق69EЯ9*!C9 :i1б :LV:^$@(:yБ3:R?: $R:'Ek:_Еu:#н: :+K:R:0,=:d) :;t ;2;`I_@;q#;FW /;M&1>;3v" T;#zc;jq;b4;Ӂ'1;WЂ;Э;R;_-; T; ;;#q<E!М<L.($<l('9<B"G<D.N<o-'W<+Фm<*Рu<&4z<y4<j<#L<"< U< 5<z1D<j~<6)< (=d= =0*&=esE6=nN6?=iRH=ܖ4V=fi=o,m|=d&=.=7=r+К=d:=`w4=3=s=!=P>_ >З->Bi9>_)I>J-#/X>(u^> m>=Ыx>4$>`P>'Њ>s8 >MD>q)>{>DV>eЌ>k+]>?#7? !?x4$? 1?>>?&9T?<a?Z-o?(}?,W?L*?}Х?`Д?XZ+? (T?E +п?'|?4?U(@K@k-м@'{7@mRI@y4Q@b:]@`EСl@ -,@+@)@`@l6)@E-І@V$@mX) @"@ #(М AX?AăR A *>+Aq6A&VLA[)'\A>=gAДzAL.A'AjRAf'йA`4$A4Av!A'Ad-AApZЧB+XB h'B,D4BԒ*P >D%EUDH[DvНbDЀvD)МD RDSDD3-ВDi4ИD"мDIDfD'D".` E(5EЃ*E(V45ETJ+;FE ;WEIdE}%{EE?,.jEW$E2$EUE&EЫE6EA.EЊFUF։Њ(F:FF8'IFq/']Fg+qF+ЏFp*FhF(F*})СFv*.FF FRFTMuG>GܒK&GD.Gr,T@G[\#KG&[dG,%dsGqG'=G UG5WGp[ KGcЄGQ\aG(nG VG3#nHO> HU4H#>H**$HׄB/H<P:HЭZH4 `HY[#hHN sHH&l*IH=|HUHlЂH UH,H@oRHK-HHN]`IVIL'I"1IX9I_4RI`NRpZI44bI4@qIoR|IpyIxI+гI֖)I I;IV4I6+Ie%PINJPVJZm%JF5J6ЎDJq".mUJr-\_Jo@kJd pJ3PJ,J@+]JP)KJn#J~%пJ48Jg/0J@'#!J\VK*K+4%K)R1K-mCK+LKUЀWK,thK(q}KE$K`}4PKPRK;F]K d3K5+^K8O OKtdKRLVLРL kT&Lk5L7 +tAL"TL' gLdR ЃpLf-{Lx L@-L L#PLBezLL&aL$=MԌRMuM#n,MR!*7MD2pEMr^2SMgMA2xM{)ЭM'-4M) M/:MHM)M'*$bMUMR8M>&ENЧ NRN*1N #48NVDN$ULN Ћ\NmN\ ЛN,SN)pN daNBTЦNxN1,;N VNN݃N8'O%.OȅU(ODv2O&|[LO,~RSO @aO&4iO4R{O%" OUвOwOE]O#w(РO7!SOotO$RO+ЋONPkR Pz*+PF(P-ж2Pb*БHP2$\PHBhPHxP(ЀP_,(WP*P3)pP,C1 P P`4$P@PWPН Q*hQi%Q44QmR:Q1,гRQ4&n`QOPwQl}Q2Q'Q(8Q2,Q9BQ ;.QwЕQ$) RBIR}&18R(MRV'HYRIxйeRLEWpRiyRtmRizR@R\R$RPEWRD!1R--ЎR=+]RI#ST2 SԚ/S,i0SL_;S"PSgEЋcS pSyn}SMSv4$SziS S-a-kS^U2S7nS@1 S3,TETy-7T, AT@#!MT(wWTwПbTjЍuT+cTt)TЇTFWTRT(4T#"ЫT%MUVgUBо,U-Љ6U#nEU;d@SUI_U sUZUv U"2U RUk)*U$U=)UT4U PV8-VR"VR,V :V -ЄKV \Vt4fVHЌyVL)ZVOZ-ЭV3%jVgV~)VqбV V#pVd3WTWUWA/W;%\@W҉лFW!hZWj"ЛlWЋyWv:#KWUW&)W;~W0,~WTZWݼOW@ W+ZX=&6X" ИX$R"Xh $/X45Xp@BIX>ZX5-lX΍ЙxXXXIUXvXX">X'гXSX+qX )_X7 Y 7YPV4Y Ѝ+Y3Y"Pv "Z<Щ4Z&@Z4PZ"&`Ze mZUkxZ-pZ7Z*/Z:,ZPF.mZ4Z VZZ)eZ1 [ȳ-b[\$[t*Е/[;[$wLT[$2 l[[{y[[Ш[Sl'p[}X[ ["v[-[3[+k\|#! \-c\-!\@')\ UH/\-*9\($ЁG\ R\4Y\HVg\$%\-\$\,(\ W\H-q\|\E\н][])е']2д6]=?]0O]Xs(^]lfd]0"'i]5s])Ш]']wУ]`X4(]#]=В]Б]WЏ].T^.W-^'"^( 0^+O>^(K^4S^U\^c-o^"^5.r^ci^HK^(,Ѐ/b) б:bfQb&-]b$lbЕ4xb/"лb Vb`VЀbo'bc#Фb$Џb (Ѕb#(cЂc c-?ca&Т-cU 6c4-ІHc1),Rc&\c2/ic@y04xcs-Jcl#c?gХcPcS!bci,xcC ,cdRc4d$ d U&d7#neB8e e\e-@e 'Зe"&Le_)Оefɶ-f $fi+Ѐ3fxC"WGfNЁWf21J`f`(1sfur ПfОfU~f #!f 4$f R$#fȋ=fv4fJ+Vg]gn%##gj0gc)Y9gfFg@QgK*)B[g8Џfg1Uнvg[4|g!Wg\Jga[g)+еg` :gBgЉg*g2"g" hf lhǟл$hd+98h'+иFh2 [h6ЇfhsXth`R|h`hs^4's3s7 Fs]s8RksX%zsL Њs?8sou+s,9s0$*HsC#оs*Ьs̴7s@,s'ЪtХt#д3t-u=tdKtУWtХbt{ ntЏwt>.~tAt&&wtDK_tVxТtd.-6tD4t@w/Рtb4tstȇu uj+`u',uKAuF.Gu%Qu!`u\Vguu7suRzujRu0up+ou3u?1 u1uRuMЃu?|utv-kv V&voR-v<<1 9v,hREvv!kSv| _v5 tjv@rvz-uv&-,vj)%vxj4vuCv$ev%uБv4$v"Lv5v&4wy#yB=2y)R?y4Jya6}Sy m dyNVuy6y-9y&k*2y0'yPy8zRy`&#yi*wyVz9<zTV'zHЊ7z%(PJz'HSze-BczГ5qz^4xzޘz\zRz-;z)nz"sCz_z0Rz.5.ЩzD,{+  {)!#{$kR#{F.({&Е4{#д;{pd!G{ڃ#O{Tk+ _{Tt{@R0{^ 2{-[{R{((Y{PV{{,:{m {4c |(?|_,O%|B0|L4:|1$L|FW\|b|ln|П|g|5$| |h7|d3|t""| o|g|`;K|Ԗ4|`4|HrH }-K}'?-1}(o;}a)K}-a?[}3S3e}t|4t}]}},!4} {},}`1}חH},Ш}-})д}i(Ч ~a4"~X~R-~@wR8~D-I~>'V~O# d~lбp~?*~6W$~j4~j (~ P~, V~ /~L*q~)І~t~V4$XRHR**xR`j)wʀ4s؀ ?S'ЯAv"dY#jЌ/P,7?^`O`;Wi` w4$`4$)"UЉԁ(Э?$,У /+!s+P+z"Х=-(M|[4\^6|lk-|l$,0X%D4 1Â)&҂=܂U߂V)Y`04 eb %6КOR\UQ!kqs UxwS,@2RbЀŃ)FӃd Xj u+!:2-F0Ky++;REvRRmRbO# r=*}! 4",a 4$Ƅ|V4фY *Z"d\3  vR<./\1<+1g66|d%@-.gP_Um>w-&$Q̳#M"Ё ->υ+ЕZmMh/d6*: h/А$U/-KBaKL-bZ(]`7j>*Y+И &xܟ&КH4† aІي+W N1!r*A #k,Ш,;+BO !IH S0Rae4"Hs@_4,,Їo_#1Ba}|ʇ{'оԇC1߇2$=&ЀUz46? )b4(3m" <i ,HГ[&Dmt xI#&p"ji&vuЈ),Ɉ+ڈ?8ܕ4 Л0 V""Ѓ/g,=I,SR_(\ĢВojx-В+LƉ) 8K-؉DR W*f'K4$xЀ"D;8N-ZKdPa"]nm) ~/UZ")},)Ј8QRʊι&&ۊ`&7   j ˎ(б13iE1QT$І`>k"+j2'bT[f-,1ċ\4ˋ٦,ۋI_@#u#h"ZC6,"E "L*q'd9 iD6mS*.Laәs06=oH+KLU|Ї1Љnjq,ٌ)J!4Кik" -L0A1!$%ǯ(=(5NUШ]QfrR|י-мi-ADU &Г .g&&ʍO ,H|-: XTR2hR?@4(W`3g`wl#j uN_*ƎUΎ)І׎`oJ(*u|*R8J)B/*I=VO+]+&eиx (K)8\w'=4|Ù,@3Ə%nۏ" {r*J~&Њ^40\UGRNu[O_RjRt+*+!)n+O c*lؐQ@iR$'AJ*j'#<`RC#V(aбyS4")04jM'ЄyÑ6͑;У"kIk,,F n"К˿*D8M ЋA([w5ul@QOhL_a'#Љ9̒"kܒ!Ћ`U$<. M+{R+W" R&М+%з?СMh+_ |)rhf w+PJ8|8\"PƓR͓!WՓ-Ъ,i JZ1),BrXОVm+i xg+, Ьf&?4Ŕ3n&)$П aГ%++0Yc,ЕCnQ8+ieUn.+i{Y((АdU"ЙM(J~4$CؕZTsz(-/, &+`U-B"9bz tI6 _ Г}+n#;4"-Ζ#+Џߖ6Шoc)#mhU$':4 _ХNS+Ѓa*8{<-p*#3=(#E"~ΗG eۗ%H!}i {4 ".;*ИF\'БSf-g9rɓ inP+û"& U`V̘sh'ܘG &"TJ*!C%i1G#;%CP)cL10`MDЊ~UQRTs+Вu]##3ř "ܙ2$46WV ,Ј,++ ,Ѐ?)PD V]t)h|)-2-H*FʚRךuTЍ#x`Ѓ2Q4:UBXRIJe6U(q2 Pi&x UvZ@*GǛΘ қ R(hF(Ъ0"g=. Nܘ"!&Џ/e<UG+ЙSz bX(|=B{) +^# Ü@ Рќy>u[&]4p4i Е'<58JФF` m* ;W2vy+Y,Gϝ"(ܝ@#S)Яu4 ng$47Ebd+'rk3*а%EN"Йl-ГȞ|RΞ3)дgЈ*8*& h),<;E#Ml*at9&^mܛ"$t`1 (doR7-(#Qp ßӟ-S۟iPЭRu+.eІ#lUdd)+;g=&DGE!ЏQ([jkRt*.U"ОЏ4T(r&@f̠!$Їؠ<'}&IQ1#(!$V24ИPסD.#+8'I$4(;IW]--Ѕd~ИkRktѧ+Иl?cнLV"Кk*Ѝ΢*!?ߢB1 >(PА-"xd,2i*pJd#ЬrWи})Зg*%u +ϣN+ЧA#"ЙJ"p9 *"D(б/HЗFW2fpx0qPRw-tRa(<2yOTq ЀɤVڤ4b$Ц;nЇ&\"?R&#D-ؕ4<4EOЂPkDiLz3pVt"ȥVϥU֥}ߥ+Ё6*n5&z.i ,+ ?;Qj%FD4NT\4Vd$y% ' *Џ)I;(W& ̦4ئBt'`(3 &$'^5AВH l+PZ i]$i+ nc 4ДtRݱ"ŧGا Xq*2е.L^-б 4"U+д+@}4;RI*_])ppu4yB]c*  a46ͨӑ FިЄE ,+&4D*E28G4RRPd 'ntC Ѝ4.Dl)$HeMsǩ שyTxg<#1~Ɯ,Q.)tQR8|4CЄO@RV`,is(zx!}lUPи-.jb%2Ϫ4#0ުN" -ж*" 9")V/о6fEpUM0#oW`4p.9gx-B (Џ<5}*ʫx4ѫm Ї۫DГ5:Ġ(y@RШu .Џ,GJ7_#]AUOtUWcd +lz*!ut&НC"Щ+3d&yh &ɬT4ج@w4,`1<IhQn;l/--<s%WF#ЍVGSg"P *i@`4 mz#д 3έ,{Јڭ<RXRyЧ0о i@,Y.P 98zP6,fa+4s"KPO$д$ J_Ů%+ͮ<Ѕ߮mR''r qпGk"Ѕ-Џ?;.DT˱,4ӱ#>*J_#-6!@`VM$[{zak)zp?|[",_4lRn'Ev0s-И˲D4d3& "`$"/YС$bЍ.˘#l95b^C,VS#pF$\4 ;/0ƳТϳmRճ)+иl*O*b*$k84M@woW+rWj,Лv+5&  <},ô$۴ u4Y;R$<-Ю&I"І2VE<v4F]4Vki H}*-кCWUuT3ʵ+*ШӵgR-j)H&Ї@V ^WBo*$!d\8 FeA[Пg&)мqURR-4<.Ў[%ɶ ԶB,,.$`4 d`+R4*V$3rp<?)R@\4XA+a/;+Hp  D]b b-$%.ȷ4޷5iy+u$|xU =ЄLzR&$B'3Թq<(<J 0$Q_K'`f*R$ c[$RøF+!Ҹʅ,M TI$е&4-e!I1 -\n8[)_GhRP]Γm0ЈrhR, ,Kйɹ86WعR8:)k z1$Ѐ1<#N<#2Hl"Q V\Vl&F}qA(*'ШV( $Aκ ТL_#Эi J !;2`] F`ZP_N_d"Yqފ%Ж4;,-Ђ$|50%2ŻwRл5P %кS+4*1V=5ИF~Q%Эg';лq*Ѝ|U@% W >,=*Ѽ(R޼۶>-РlГ Ѓ|#[/.W8?.>'eN Gb U`iZ7 vJЃ R`N_ P*оU x' ǽ:нZTܽfРtЏ )T)%',!V<FMW]_sw2*' *G VVb ǾX'Уپ,X4xi@V@Ѐ B,"W*/_*2>Vм LQZX*ohe s@20Ԝ,(iRʿiRӿd)И>kCWаrjt.#V:5-gDGX mYx,7i+ !$wPU8ЎF,3K'pU~~G).Б  U 5*D(4 3 A$5T@e1`Rg3t,v4 y"23̉Rp*+ N*Xb"Е$н4 p(U <{6P'F RRLV_PQRl2Дw"Р3"]YИK.(V)0%|\$#z+U@\ E"U."A"I;(c(4ufR}Z4(oR$*AХ'-,w$.-г|Дh"akp=iR4&v #9 Є+4 7h ЬE*Od_ pj '2~& &n REP0` V#FR"=3$4C5G%R~RY',p$UzШo,*%D \ КV"СR@ ,/"\,..&I'B82C1#\WP/(s-*zhp)wН(!3(,fЯo%И2P,Blf. :3!g$19i{K[O[؄Ri5E'Юt2&H,"wАЇ!)wb'&P{R 3.<"+,k6TEW>XXYH1QZ2`2ty OН>з R$4ĢR* + _ &|%м |!j*]/"7i4L4X@#b=lۤzv؞,E&r44w4V։**/U[-Ю ĊR 8-Ѝk2 0}WCDR~,Сc>%+TmR*#.3m( !Z! MИlPR:',3+QBgQdLb_o_4{hk)!$;[c'V0Ik:, )"о du}C.(м)Т6-kF )S#`XEWfiЁmp-ВwXk*AВлx4eT؋R4J,+l_); JpЋSz8`S4B^EM*-ВXDx-#e:&Ax]e* K.(,$#SЉN_ q#oP|-,W#)m4\E#W/amE uI_@sЕ1M $Љ\4[4+Z&;tUH.P- J_@ +>,Jw7HTREН[sEwa5#P,А6,bЌ)aY'#d`TR# ( U$FF92xMJVo&g-9w'42$4(#4*Hq@*>,*F+#V.pU4-NlЃbLИu^Pٸ+^-nL]v&"mRV' UЄЄR'r $o!/+I}#S~2_\;idX-zB8R'$%N Ѝ-H RT3]-Y4U8 /L^)>%1WY*i^Zrݝnb4"*0+2 (I4 ^L.9*(ЍmI+#oJ4<4G^'P&CcocJßb*+[iH`h\4n#Ѝ"8w4t[)#,uЌ:*UEfNsY+vO#MV gY# qW ЍV U,в/"Зg4$+.,Aol*YHx mY ~4$kЭnЇХpwRM+b KfD-ГPR ғ'?V\V  &e". -;3I,+bB#Ft>~[0Z##нVUK_+[E 8id%  2к!LV)V:FOKs,&^al w-5(Ь[TR*б6W`TVx>Ѐ03d'wЀ4D*`Ad);K=5ЌUR`'s9XР~&A<KS-ЋYSd}D"jOwRM'v#)Ђ0քK@)^)3jiB#Шxؕ(НK_Qha8{&3O"п0\$4*еqЏ S+Б9&Џ-:} Et4T=Ha^q+4W6&ПV/-  ]+OlbZ< (-$ xoU#Q2V4:6 *IX _U+"bs#FkP a(zWa D-v& I'T_7##$4ٺЖ(PR0/%bIf)$Z $og- Йy&$ q:j>3#d{}3'"АsЯ_4(}e9$0.;.]7UBa4 MhRSb ]H-BiyOu#/Щe.J'ЈL$Т#!ԃ!V ā4%Vd-!Ч94jRB'SZ+%e( (2}#5'plR(s#d"6NiYвwпy/&<.=yR.pX>iu&GAS7*_d"{#4t,ЁؑRQ#! 0{4&Xa+N%(Ke--}*w}<R&@TR0  6MA]C2-5O"%Z^foa#p%j4K&^$Bwy+J2) !Ђ`d0R.=b @X4}*,6v'о>{CG V<y^-Єm &!j49,`3$ *FRnRЮ1en%v !~,QR#l$+}(Б8UйAo)!KO doo_бLY UMTЛ|.'w;cЙ0R4!Н13?04Ayh%[aComi*hR<'[4V4$ИaQТ4$U},A`,#"Dd(J0z;A>X#I"BU+N 6bYLm_#  4Vj8^0bnVx  Rs( $Vt $tR-Q48<PF&5Xg+3fc(0xEУ 'LA6Йl%,$!) @2@mOР-B/'>0WHR[^f -<tbР}-p;Ћ 'Вx4Oz&Љ $^G͊!Хug\Z0':7F#<F;*V, y0Z&Evл n#Q йQ..v~,Ex(&Љ+}9 V$4%*)^8&E!oпR"[$( eDn6o|Q3+ L_*.1-!ЂаR\+>1(Т="K+]*mjR"VvUJЕR'4= К+!1W4w'Ж &#l"~#xPQ1b47@LWH@ ]+бi$i'4,VtЈe*W)ZРe=В,pm*=6&?.-QؙБ`Tid$4w*pf* ^:Ǚ5[h С,o?Ќ|'H6 *1"е$E-А/W&:UFfRH.%Ybm&-N}:#lR%$O2VqZK`URH|4@ 44h:`R8&P~ Rb4 +f5:`EWF/rdN_vC&@&|sGЀdQRl+4L'Y3K*> 1`54$C\K+S4(^PRhp~Rrf+C#c N_r>+"V!mF(K 4 -0#Ђ1V<]P2,мd vRo*#q\=[*HK&п#ЌS4 VWY4`4BP /$@*.H(8 P{t`0-Іul~PR)#!`VK*$)10U*PVOЙ t7Ѝ$J|4[МKV5# Y}7kx/}Hy''R~Rzۆ0! Jкă4d4'*- W;4QO aa;vЬjkRs%3-G4 &И%)k0{BKz  lR U b4'Qz1jR:(N,WKStb;U9Жb4 P$hRo06.<;( 3 .lT е-v<Q.<^+dp #OHr5WQϳк VZМ<5B04 i%Б+-:5QKЪG^S:[j~#uHR7'ZԺ".ЬA<-Y4/&T '4{#SN!,C)л9ƨ&WY<&3k&{" 'o  (HH#fXЫd4 E#1-N<4 43UA)ІL#ЬZ_4 dP%rvS!at4'HVV-.([XlJ_Zr&#У/"J8BDULжY5-k#'ЍE(Ḃ)k"\)$2Ы|(I :Y[&БQ$#  {{,ЛA!$Х"С8~"EsNM&NbЮk[t Vl}4<[,)+!Ї`4$ܾ*"Mh^4ME&'@94F<NyЁWnІzXE(:0 (+Z*ЃD! "%0'5{ l#e3+ЎG$L_QL V[=гb_4 mK<zCt9h0)H 4$dCWthR $" (P + P4A "T bVl tA{ !- Fc 16 T$4 5o)  N {o R K_  4$ D), 0V % d>к- U@  3J T "e {,m d Mu L+ ٠*\ hR qo TTR JM -? GW 0'v mR }DD% uul/ L> !I 7Jb z-Dr + f$l ,N Ы \ 0 0"n <-Ё yl |R  1$+ 4W4  Uf= =)("F ]J9\ J,Ѕu e#п 4 f!H {4 $R oeh  R +d)R "І P " o % < ]4J  4X ~e#a ր Tp <Ёx   XR |' $'\ ~ +Ѐ b J_ GW` J# U$nR /H.AhV:OЊY;Yf|j- sQ\}?.У ,Ќx#lh5'VU(f Ѓ? #J+ "Q%Ц9F#ФA2(*gL$$X#Фd3![+9U,%Г43 K'-y ed"Г+oM4#E1cSEWLeL3(vo%)s'ж)#q.dKf-е"!vЌlT& (L_+:DOJ U,ju#x`^ZV4a#^*аE<@U MX/Иc-(("T?6+ܗR6~$Dc #SjqfЬ.6Ъr0`ۛЪJZT4M*1`J_a'Ѝ'%Ц:R@AuKdzWxap("m?*!uM5|!Гv|X}'М#-4_4]4bT ʧW +y( B8rANQ4Yض2 n@QRm\ p7yW%E ЈжZЕ,d"fZ.yE|).RЉ\Гh[9An+< Г*5"dР+&Л+s(@ ', "B$$O0lKoX cKqV}R#Хx`a4,orU ;-JJ_м a*0v'<9#GKX@6e-}u f8'-nid)d=@V<DW*:fRR0hRC#tR*473D2Sd|R]+f%wd#J%ЁliR'4apm_standbysspec_vnodeop_opv_descwi_set_nwkeynge_mii_readregpfslowtimonanouptimeaha_free_ccbuvm_map_callrandomreadehci_device_ctrl_closeuha_scsi_cmdaxe_tickem_set_mac_typeuvm_page_lookup_freelisteephy_mii_phy_autopmap_alloc_pvpageahd_handle_devresetie_readframepcscp_write_reglongjmpwi_usb_rx_list_inittxp_download_fw_waitffs_vnodeop_opv_descAdwISRep_eisa_matchvfs_opv_descsvfs_allocate_syncvnodepcmcia_printuhci_pci_attachvga_pci_mmaparpresolvedp8390_readchange_displayparamseaattachchrtoblktblXnmisys_minheritputcharural_update_promiscsea_reselectbufq_default_allocchild_returnvga_setfontrtlabel_unrefatw_watchdogtrm_initACBne2000_write_mbuffdcresultuvm_map_initne_pcmcia_caipsec_soft_first_usenkmempagesuhci_device_isoc_donewdc_atapi_drive_selectedrtw_sa2400_calibratencr53c9x_scsi_cmdgscpcib_caste_cdcopyinstraue_miibus_readregray_intr_startsys_getgidgscpcib_cdcpu_cache_ebxext2fs_vnodeopv_descsdofilewritevste_cawi_inquire_usbdumpmagttyflushsys_setsockoptfxp_stats_updatecomdefaultratepcn_tickvop_lookup_vp_offsetsar5k_ar5212_reset_beaconieee80211_watchdogahd_set_hnscb_qoffdefrouter_lookupinetswohci_powerpowerhook_establishwi_get_fid_usbpcdisplay_erasecolscdce_rxeofath_ledstateste_rxeofip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksrtw_cardbus_disableip6_get_prevhdrscheduler_startpciide_triones_productsatw_start_beaconar5k_ar5212_radar_alertaic_isapnp_attach_insquear5k_ar5212_set_intrahd_unbusy_tcldisk_findatw_stopdc_ioctluvm_maxkaddrehci_pci_cansphy_cdan_ioctlral_pci_detachicsphy_resetar5k_ar5211_eeprom_writecmoscheckrlphyattachrtw_sa2400_initohci_waitintriomem_exiop_print_identsys_closeahc_run_qoutfifosea_donede_cdusbd_do_request_flagsxl_encap_90xBrtflushclone1stge_attachtxp_reset_adaptertl_mii_writeregin6_purgemkludgeffs_inode_allocmountlist_slocksys_setsidieee80211_encapax88190_init_cardahc_platform_intrusbd_intr_transferre_cardbus_attachinitclock_funcem_init_rx_addrsiha_pci_ca__ashldi3nge_intrwb_encapar5k_ar5210_is_cipher_supportedvn_statcom_pcmcia_disable1vop_getattr_descunp_detachsiop_scriptnd6_nud_hintether_ip6multicast_minusbd_submatcham7990_watchdog__mainray_cmd_scheduleef_tickepreadwdc_ioctl_getaue_stopufs_quota_deletehardclockbioscninitwi_read_data_iomyip_ifpstge_cawdc_reset_channelvga_extended_attachin6_domifdetachdevopnudf_mountfsahd_scb_devinfosiop_pci_attachwskbd_cndetachXtssnge_jalloccd9660_vgetiop_intr_eventieee80211_inputif_group_routechangetprintf_openahd_probe_scbswdc_isapnp_caisp_reinitohci_device_intr_closeurl_csr_read_2sis_miibus_statchgdest6_inputgsignalrtw_rtl8225_pwrstatear5k_ar5211_resetacphy_caahd_check_cmdcmpltqueuesbioscnprobeahc_eisa_attachehci_pci_matchipport_firstautoehci_strwi_txeofmii_mediachgaue_devsipsendredirectsbpf_setifem_encapunp_internalizetk_rawcc__wdstartevcount_intrvia_devicesfc_lfcemptyvfs_export_lookupif_cloners_countifnetyieldohci_endpdm_freemwsmuxattachfilt_seltruesc_print_addrcomspeedar5k_ar5212_put_tx_bufdc_setfilt_asixlogusbkqfiltervn_writechkin_ifscrubral_pci_cadp8390_media_initpdevnames_sizeahd_build_transfer_msgbge_shutdownscsi_mode_select_bigroute_dstpckbdprobeinit_execi8254_microtimewskbd_cdbcmpsys_getdirentriesieee80211_node_detachrtw_maxim_swizzlend6_dad_startioprbs_cdexec_maxhdrszuhci_device_ctrl_doneam7990_stopieee80211_ifattachmmmmapieee80211_clean_nodesuvm_map_spacefitsrtw_next_scansetjmpar5k_ar5210_get_intrcacminphyswdc_disable_intropti82c700_set_intrwsdisplay_switchiha_alloc_scbsbge_stopxl_cardbus_matchste_resetpdc203xx_dma_finishpci_subclass_communicationsuvm_deviceopslogread_filtopsre_ifmedia_stsXrecurse_legacy8vndxfer_poolfilt_fifowriteath_node_freecpu_info_primaryem_set_multiffs_specop_ptcp6_mtudisc_callbackcopyoutstrmainbus_matchext2fs_fifoop_opv_desccac_scsi_cmduvm_swapinrtw_rxdescs_resetieee80211_countrycode2regdomainusb_transfer_completetrm_RecoverSRBapm_suspendlxtphy_servicear5k_ar5211_reset_tx_queuefxp_mediastatustcp_attachbios32_servicewskbd_cngetcvop_print_vp_offsetsbuf_dirtysoo_writem_zeroural_alloc_tx_listpdc20262_dma_startffs_specop_entriesunp_gcingath_cardbus_detachwi_pci_lookupbdevswciss_raw_devbaddynamicportsohci_root_ctrl_closeahd_aic790X_setupural_ack_rateuvm_mk_pclusterath_resetdomainnameehci_endpdar5k_ar5212_get_ack_timeoutlockinittl_hardresetttywrite_filtopswi_usb_devswds_pollnd6_ns_outputbpfkqfilterVOP_LEASEar5k_ar5211_wait_for_beaconre_ifmedia_updwi_headsk_xmac_miibus_writeregttyunblockioprbs_unconfigremovedevga_accessopsudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachpckbc_xt_translationle_isapnp_attachufs_quota_free_inode2trm_MsgOutPhase0filt_procdetach__divdi3ahd_add_col_listsys_clock_settimesiop_led_offural_txeofwdc_floating_busiha_pci_probelocnamesdisk_busynpxdna_functcp_pulloutofbandopti82c558_set_triggerelwatchdogsddetachsqphy_statuspool_set_drain_hooksis_stoparprequestsiginitpci_mapreg_mapuhci_device_isoc_aborttrm_StartWaitingSRBepconfigvga_console_screenvn_default_erroriha_pop_done_scbusb_task_thread_procbioscnputcpcim1_quirk_tblip_sysctlmpt_free_replyuhidev_closemsdosfs_vptofhscsi_mode_sense_bigffs_fifoop_opv_descusbd_clear_endpoint_stallbus_space_allocsetdisklabelknote_removesii3112_drv_probedc_ifmedia_stsroutedomainhid_locateicmp6_errorVOP_MKDIRdc_txeofnpxsave_procrtl80x9_media_initepgetip_protoxsys_settimeofdayrtw_disablepcmcia_read_cissdstrategyaddlogehci_sync_hcath_stopep_pcmcia_attachstge_set_filterep_cdrtw_verify_synawe_isa_cauvm_page_physgetrtw_sa2400_vco_calibrationmsdosfs_syncudf_inactivescsi_mode_sensestackgap_randomrtw_dequeueep_pci_caar5k_ar5210_is_intr_pendingeisasubmatchffs_clrblockusbd_set_hub_featurestge_stats_updatepdc202xx_chip_mapbpf_filterchgproccntaic_free_acbahd_get_hnscb_qoffip_drainrtw_txring_chooseumass_init_shuttlesoqremque__adddi3comattachvr_stoppci_classuvm_map_inheritfifo_printinfompt_ioc_statusapmopencd9660_syncar5k_ar5212_get_tx_bufahc_isa_irqbge_init_rx_ring_jumbopmap_free_pvpccom_cdath_cardbus_cabios_printem_display_debug_statsin6_ifawithscopevop_inactive_descfdc_cdbge_tickuvm_schedulerral_stopxe_pcmcia_matchsync_printnchashvnopspcic_ident_okgdt_pci_enable_intrpool_cache_initsys_lchownieee80211_rssadapt_inputskc_cdmsdosfs_removecd9660_readaic_sensestge_startieee80211_regdomain_compare_rnwi_get_idgdt_timeoutzeroin_addrar5k_rfregs_gainf_corrbmtphy_cdehci_device_bulk_closewdc_set_driveuvm_map_protectusbd_get_xfer_statusre_encapprintfpcic_chip_do_mem_mapahb_donein6addr_nodelocal_allnodessched_lockehci_alloc_sqtd_chainahc_find_softccdce_devsrandomwriteuhci_device_intr_methodsprelist_updateahd_pollbge_readmem_indtl_intvec_netstsip6_protoxsys_recvfrommpt_intrXhold_legacy3ttrstrtsys_sbrktrm_print_infoiha_se2_instrwskbd_mux_openi386_fpu_presentrandomyc_chipsetssiop_modechangekcopywsdisplayopenext2fs_initpdq_ifattachahc_platform_set_tagsrtfreertw_rfbus_writetxp_watchdogahd_fetch_devinforay_matchcd9660_linkdc_list_rx_inithostnamelenupl_cdsk_ifmedia_stscd9660_specop_entriesif_printftwe_thread_createusb_needs_reattachray_cmd_donemulticast_register_ifm_tag_freeahc_shutdownlgdtisapnp_map_readportttyopenraw_ctlinputudf_printwi_usb_ctl_unlockccdlookupnd6_ioctldc_watchdogar5k_ar5212_has_veolaxe_miibus_statchgar5k_ar5210_tx_startusbd_get_stringipsec_exp_allocationsbpfclosedevwaitrtw_bbp_initusbd_probe_and_attachvge_encapiop_lct_getsoftdep_setup_removesys_writevsys_setpriorityami_cdm_tag_prependE_abs_script_sched_slot0_Usedaxe_cmdray_shutdownahd_handle_scsiinturl_unlock_miiumass_detachusbd_free_iface_dataahd_pci_ident_tableip_defttlrtw_set_rfprogepic_mediastatusfxp_detachwi_usb_attachurl_rx_list_initral_cardbus_matchusb_schedsoftintrapm_powmgt_engagearpintrcac_pci_attachbge_deviceswsemul_vt100_output_scs94_percentkqueue_registerpci_conf_readpciaddr_resource_managecred0isapnp_bestconfigin_delmultipiix_get_triggerwdc_isa_probeuvm_forknatsem6x86_cpuresetvfs_op_descspdq_ifwatchdoguhci_device_intr_abortpcic_chip_mem_freeuid_findumass_activatend6_rtrequestncr53c9x_selectuvm_km_suballocusb_delay_mstweminphysep_pci_matchgdt_mpr_set_sema0sys_closefrombpfdetachfifo_ioctlehci_devdttydefcharssigexithidirtypagesar5k_ar5210_set_opmodeepsetfilterisa_dmacascadestge_mii_bitbang_writein6mask128dc_eeprom_getword_pnicdead_lookuprtw_phy_initatapiscsi_cauvm_amap_poolin_pcballocXprotVOP_LOOKUPar5k_ar5210_get_isrdc_stopbrgphy_looppccbb_conf_writepcred_poolenqueue_randomnessusbd_set_idleexphyattachpcibios_presentserverworks_pci_intrieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputar5k_ar5211_get_tsf32re_miibus_statchgahd_write_seepromciss_shutdownacphy_cdvop_rename_vp_offsetssys_ovadviselockmgr_printinfowb_intreisa_bus_dma_tagwsmux_attach_scusbd_pipe2device_handleaue_rx_list_initwb_bfreebufq_default_freear5k_ar5211_setup_tx_queuewsdisplay_kbdholdscreenufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimetwe_pci_caamd756_getclinkpmap_is_activesocket_poolahd_scb_active_in_fifopgrphashsys_setpgiduha_switchfd_set_motorfxp_int_delayprofhzwb_fixmediatwe_attach_bus_space_unmapcache_enterahd_run_qoutfifoexec_elf32_makecmdsar5k_ar5210_setup_rx_descbha_get_ccbext2fs_bufatoffsys_setlogintxp_cdem_id_led_initudf_statfscpuresetfntcp_do_rfc3390ieee80211_req2nodesys_setresuidrtw_rf_pwrstatewb_caadv_cdaha_cdvr_miibus_statchgrn_deletedp8390_debugnge_stopsd_get_parmsiskmemdevstat_rush_requestsgdt_put_slottrm_Interruptwi_watchdogwe_recv_intpcmcia_poweripsec_def_compfc_lmdistanceath_cardbus_setupwdc_atapi_ctrladw_build_reqnch_poolsomaxconnural_readpiix_initip6_mrouter_verpmap_pg_gipsec_exp_timeoutar5k_ar5212_set_rx_signalip_directedbcastath_calibrateahc_softc_compisp_cdpci_mode_bus_dmamap_loaduihashtblcac_eisa_l0_completedscsi_get_xsral_tx_dataral_tx_intramap_initffs_flushfilesffs_blkprefetherip_allowahd_outlicmp_sysctlsys_lseekar5k_ar5211_fill_tx_descexec_aout_prep_zmagicpool_cache_getahd_inqcyrix3_cpu_namenprocssmc91cxx_mediachangempt_minphysllinfo_arpmsdosfs_pollwds_get_scbpci_lookup_quirkdatamsdosfs_accessaddupc_intrdvd_read_bcaam7990_copytobuf_contigamphy_servicerl_shutdownwsevent_finiip6stattxp_inituvm_pageboot_allocconfig_pendingmii_phy_updateswwriteti_read_eepromudf_islockedxl_read_eepromether_crc32_leaue_csr_write_1sm_pcmcia_funce_enaddrpiix3_4_setup_channelosb4_set_intrrn_searchXosyscallec_read_hdrar5k_ar5210_stop_tx_dmampt_pci_lookupipipstatsecurelevelwe_media_initresume_ireturl_matcharpt_keeptl_dio_write16ar5k_ar5212_clear_mcast_filter_idxral_cardbus_casavectxisapnp_printioprbs_watchdogsys_seteuidtrm_EnableMsgOutahd_pci_test_register_accessbios_getoptwskbdpolluvm_map_checkprotmax_protohdrahd_platform_alloccdce_activateep_isa_mediaural_rf_writeray_powerohci_pci_matchsis_rxeociop_msg_freeextent_findepstarttrm_scsi_cmdumass_scsi_attachahd_check_extportwdc_atapi_intr_dataar5k_ar5211_nic_wakeupbufpagesrandomkqfilterusbrev_strpciaddr_resource_allocatepckbd_consopsegwatchdogath_pci_detachrlphy_cdpccbb_pcmcia_do_mem_mapsys_keventcopyargsadw_reset_bussk_intr_yukonarc4_reinituhci_device_bulk_methodsiop_reconfiguremi_switchcd9660_statfsrndwrite_filtopsmpt_free_requestkern_sysctlwi_pci_common_attachsis_ioctlnd6_delaypckbc_send_cmdvge_startin_pcbinitar5k_ar5210_setup_tx_descpccbb_intr_disestablishsqphymatchnmbclust_updateie_hardware_namesfdremovepcic_event_processnge_eeprom_idleuvm_tree_RB_NEXTigmp_fasttimophtree_SPLAY_INSERTudf_getattraha_isapnp_cascsi_user_donekillprocehci_device_ctrl_startwds_cduserconf_cmdbufwi_get_pmumass_bbb_statetxp_set_filterohci_device_ctrl_abortatw_txdrainvop_pathconf_vp_offsetsahd_queue_scbar5k_ar5212_set_mcast_filterstge_shutdowncdce_startpcic_deactivate_cardray_set_pendingapmioctluvm_map_entry_poolcrgetuhci_activateopti82c558_pci_icuunp_bindtcp_delackuhci_device_isoc_closeiha_msgin_sdtrem_clean_transmit_interruptscsignalreaddisklabelmpt_print_reply_hdrusbd_clear_endpoint_stall_asyncwskbd_set_displayehci_pci_shutdowntcpstatwddkdriverrtw_intr_txepic_statchgbha_pci_attachpccbb_pcmcia_attach_setupncr53c9x_pollfillmapentryelinitpcicbbmatchiop_util_claimtcp_timer_persistsata_chip_maprelookupciss_devwsemul_vt100_output_esc_hashgdt_from_waitudav_newbufsys_umaskrtw_txdesc_dmamaps_destroytrm_StatusPhase0pci_subclass_i2osyn_cache_reaperfilt_fileattachsysentieee80211_find_rxnodear5k_ar5210_set_associdisapnp_free_regiontcp_setpersistwsscreen_lookup_syncufs_ihashlookupar5k_ar5212_is_intr_pendingsii3114_mapchanicmp_rediracceptapmclosevop_reclaim_descusbd_get_hub_statuswsemul_vt100_detachAscResetBussoftdep_setup_inomapdepisp_getrqentryural_attachip_outputcardbus_function_enablear5k_ar5210_nic_resetray_free_ccs_chainpcn_mii_readregbpf_mtapahd_download_instrtl_eeprom_getbytepckbc_cleanupahd_save_modespckbd_set_ledsti_eeprom_putbytefindblknamertw_suspend_tickskue_rx_list_initpool_initpcmcia_card_attachbpfreadath_enablexl_pci_attachpool_putm_copym2rtw_sa2400_dc_calibrationsysctl_structam7990_startohci_hash_rem_tduhci_poll_hubmpt_set_initial_config_spipmap_pinitaxe_ifmedia_stssysctl_rdstringuvn_attachxl_newbufahd_is_pausedti_64bitslot_warlasttimefiforead_filtopsehci_freexatw_bbp_io_initxl_pci_devicespagezerosysctl_disklockcnkqfilterdesiredvnodesufs_pollusbd_remove_devicecac_pci_l0_intr_enablemsdosfs_readlinkcac_ccb_allocahc_restartusbd_get_device_statusosb4_pci_icuspec_vnodeop_pahc_initlookupahd_platform_dump_card_stateec_fake_test_mempccbb_pcmcia_mem_freeath_startar5k_ar5212_get_tsf64comcngetcnchinitexec_mapsnprintfext2fs_readlinksoftdep_setup_blkmapdepether_ioctlatw_cdsyscallumass_bbb_transferrnd_attachedciss_ldmaptqphy_serviceip6_forwardinganon_swap_offural_cdkue_resethme_meminitarp_allocated_bus_dmamap_load_mbufwdc_print_capsahb_debugbge_blockinitwi_watchdog_usbgdt_mpr_get_statusi386_has_sse2ifindex2ifnetcd9660_ioctlgdt_eval_mappingatw_cardbus_caem_initvga_50lscreen_bf_isa_bus_dmamap_destroyatw_write_sramcac_cmdusbd_get_config_desc_fullin6_savemkludgein_pcbnotifyalluvm_pglistallocsyn_cache_addohci_device_ctrl_transferwsdisplay_addscreencomeventsar5k_ar5212_is_cipher_supportedcpu_initincorehzdcphy_mii_phy_autobios_cdne_isapnp_cawi_pci_acex_attachdefrouter_resetcd9660_ihashinsahd_namesiop_script_writewdc_atapi_send_packetcpuidcheckaliasrtw_sa2400_destroydl10019_mediachangecue_activatesk_initttyretypestartuphook_listre_tx_list_initahd_search_qinfifoefgetkue_detachnge_mii_sendrtw_resume_ticksrt_timer_queue_changelf_initwi_ioctl_usbcpu_attachuvm_km_pages_lowatmpt_rd_dbdpt_eisa_irqsd_switchath_suspendwdc_preata_drivemii_phy_matchsdclosevop_poll_vp_offsetsvop_generic_kqfilterpffasttimoar5k_ar5211_detect_card_presentsea_pollinitsiginfosys_getuidiha_del_pend_scbaic_print_active_acbuvm_unlock_fpageqexec_setup_stackpcn_mii_writeregioprbs_free_ccbpager_map_wanted_lockuao_createloccpcic_isa_chip_intr_disestablishrtw_media_statusvr_list_rx_initioprbs_switchaue_lock_miipccbb_pcmcia_io_unmapffs_realloccgar5k_ar5212_start_rxiha_devwskbd_load_keymappmap_remove_ptecd9660_bufatoffiha_state_5epic_resetgroupmemberuvmspace_inituhci_power_vga_scrlistether_sprintfmsdosfs_unlockselwaitre_cardbus_cartw_intr_timeoutar5k_ar5211_set_gpioicmp6_mtudisc_callbackssys_forksysbeeppmap_free_pvpageip_setmoptionspccbb_winlist_insertuha_get_mscp__qdivremspec_opennge_mii_writeregfilt_bpfreadehci_alloc_sqhdc_eeprom_getwordwsdisplay_emulinputuvm_fault_wireusbd_abort_pipepcmcia_ccr_readrtc_update_centurysis_newbufsi_freeahc_lookup_phase_entryvge_ifmedia_updXrecurse_legacy2vm_nphyssegadw_ccb_phys_kvip6_randomidproc_filtopsisapnp_id_to_vendoruvm_lock_fpageqelf32_os_pt_notewdc_print_current_modesXrecurse_legacy5bge_miibus_writeregtl_watchdogfiledescopensys_vforkehci_freemvop_reclaim_vp_offsetsmpt_check_doorbelliop_adjqparamuvm_pager_initwinChkNamest_decide_modedvd_read_copyrightvmi_list_slockpool_drainrtw_continuous_tx_enableral_set_txantennacac_l0_completedem_setup_receive_structuresmyip_initializedath_gpio_pin_readahd_resumetrap_typesync_vnodeop_psys_mkdirdl10019_media_finiahd_inluao_reference_lockedufs_fhtovpcom_pcmcia_activatewskbd_translatedumppcbray_start_join_net_donerttrashohci_root_ctrl_abortmblowatefioctltxp_stopgetnewvnodear5k_ar5211_get_rx_filterxl_cardbus_attachufs_inactivepciide_natsemi_productskue_load_fwnd6_mmaxtriessiop_intrsys_socketuhci_abort_xferuhci_detachatw_beacon_len_adjustdead_vnodeop_opv_descohci_shutdownpcic_chip_socket_disablebha_cdwi_init_usbpcic_detach_cardrtw_pci_productsahc_match_scbpckbd_caiop_release_mfavop_generic_bwriteep_mii_clrbitnanotimere_cdpccbb_make_tagufsspec_writedead_vnodeop_entriesxl_freetxrxmpt_check_xfer_settingslxtphy_cahme_tinthme_startiso_disklabelspoofpcmcia_cafifo_badopfdfreeepmbufemptyahd_find_scb_by_tagahc_update_neg_requestadv_devtty_countadv_intrpciide_chipenahd_handle_nonpkt_busfreeraw_disconnectaic_abortipsec_ipcomp_default_levelseaprintsis_south_matchgdt_raw_switchumass_polled_transferbrelvpre_intrgdt_dequeuewdc_logmsdosfs_mountfsahd_setup_data_scbahc_pci_intrXhold_legacy12em_82547_update_fifo_headehci_root_intr_startwi_stopip6_sprintfsync_fsyncvop_setattr_vp_offsetssetstatclockratecd9660_strategyohci_allocmar5k_ar5210_setup_xtx_descwds_scb_phys_kvuserconf_parsebootargcural_tx_bcnip6_keepfaithray_recvdc_cardbus_setupext2fs_allocwskbd_deliver_eventepic_set_mchashst_loadfdcopyral_encryption_intrbha_scsi_cmdste_init_tx_listhole_startgscpcib_attachb_to_qar5k_txpower_tablempt_read_config_info_spivga_is_consoleef_miibus_writereguhci_pci_matchcmd0643_9_chip_mapusb_blk_freelistudp_sendspaceahc_set_widthdc_newbufifg_headvfs_rootmountallocehci_device_isoc_transferahd_dump_scbscue_tx_list_initrw_initcd9660_opendpt_create_ccbswsemul_vt100_output_dcsray_start_associsapnp_submatchip6_mforwardsoftdep_setup_allocindir_metaohci_root_ctrl_startinit386cmaskpckbc_cnattachbrgphy_cdiop_util_abortext2fs_blkprefwi_alloc_nicmem_iovga_stdscreenahc_pci_ident_tableiop_msg_waiticsphyattachfdcintrVOP_ISLOCKEDsys_kqueuertw_max2820_createccdgetdisklabelXsyscalluao_referenceisp_copy_out_hdrurio_causbd_kill_pipeuhci_freemin6_addrscopevr_rxeocieee80211_ifdetachcninitmaxlockdepthwi_usb_tx_unlockraw_usrreqnblkdevuhci_find_prev_qhahd_iocell_first_selectionuhidev_detachiop_posturioclosescancttyinputahd_resolve_seqaddrukbd_consopsbiodoneopti82c700_initural_activatenge_encapgdt_pci_release_eventahc_isa_idstringehci_free_sqtdar5k_ar5212_set_gpio_outputXhold_legacy8wi_usb_txfrmelstartmaxslpext2fs_makeinodeehci_device_intr_methodswds_start_scbsatdevbasecue_startaue_csr_read_2usb_eventsst_read_block_limitsi386_fpu_fdivbugufsread_filtopsufs_symlinkrl_initpvalloc_lockapm_doidleeisa_attach_hookpcscp_read_regtxp_dma_freeufs_mkdiran_stopex_cdtxp_ioctlpci_subclass_satcomahd_build_mode_stateusbd_get_no_altsami_intrin_iawithaddratw_filter_setup__anddi3atw_cardbus_detachrt_missmsgdofilereadVOP_BMAPre_txeofip_dooptionsvn_lockcue_tick_taskrtw_shutdownahd_fini_scbdataahc_handle_seqintrip6_ctlinputcdce_capmap_free_pvsahd_reset_channelcac_eisa_l0_intr_enableatw_tx_statewsemul_vt100_handle_csiumass_cbi_adscsbdropcardslot_campt_alloc_fw_memxe_pcmcia_lan_nid_ciscallbacktcp_debugusbd_transferinpcb_poolneed_reschedohci_hubdohci_pollnextralocpcib_callbackstge_mediastatusfxp_ioctlsys_setegidath_startrecvwdc_wait_for_statussm_pcmcia_prodrn_matchfifo_readam7990_setladrfcd9660_symlinkautoconf_verbosewds_free_bufpcn_mii_statchgin6_setpeeraddrunp_externalizesys_munlockallpcic_powerwb_mii_syncuvm_faultuhci_waitintratw_rf3000_writear5k_ar5211_get_lladdrsk_xmac_miibus_readregrandomioctliha_append_free_scbcomsopensoreceivedc_decode_leaf_miipool_getuextralocrootfsudav_csr_read1ohci_root_intr_startrip6_outputsoftdep_freefileahd_softc_insertscsibus_cdti_cmdpmap_alloc_ptpndflushaic_pcmcia_attachcompose_tab_cmpsea_initsis_list_tx_initrn_insertspec_pollgdt_watchdogAscInquiryHandlingahd_get_sense_bufaddrnge_read_eepromfilt_kqdetachaue_unlock_miiwsmux_getmuxipsec_exp_bytesbufqueuesconfig_deferem_check_for_link_bus_dmamem_allocwscnprobear5k_ar5210_start_rxtrm_Reselectm_tag_initan_pcmcia_cafilt_usbreadusb_add_eventbsearchif_attachuha_devpciaddr_ioaddratw_bbp_io_enable_delay_isa_bus_dmamem_unmapm_reclaimahd_inw_scbramnameigdt_cntdpt_waitaic_scsi_resetahd_update_coalescing_valuesXstray_legacy4em_read_pci_cfgcpu_ecxfeatureext2fs_readdirip6_ctloutputdead_pollar5k_ar5210_get_regdomaintqphy_funcsversiondc_rxeofwihap_initar5k_ar5212_get_power_mode_bus_dmamap_synckqueue_initahd_adapter_req_set_xfer_modeaxe_rx_list_initichpcib_devicestl_dio_write8ata_dmaerrcom_common_getcuvm_pagezeroin6_setsockaddrigmp_leavegroupAdwInitDrivervga_cnattachre_pci_caamd756_initmountlistuserconf_histbufwds_queue_scbwdc_atapi_the_poll_machinewihap_mgmt_inputcomsoftudav_initpdc203xx_read_regVOP_REVOKEconfig_deactivatescsi_probe_bussesclallocepic_mii_writeciss_inqipsec_esp_trans_default_levelbiowaitpci_subclass_inputpentium_base_tscdepca_isa_probefilt_ufsreadpciintr_pir_lookupunixswudf_reclaimar5k_ar5211_get_tx_bufdc_apply_fixupadv_pci_casccsrtw_rxdesc_dmamaps_destroyath_gpio_pin_writesis_read96x_macath_gpio_pin_ctltqphy_caath_cardbus_attachintel686_common_cpu_setupehci_check_intrwsdisplaymmapccpuehci_device_setintrncr53c9x_readregsuvm_map_replaceem_setup_linkar5k_ar5212_set_powerti_intracard_chip_mapi386_use_fxsavexl_intrfdinitarc4randomboothowtonsphy_funcstcp_delack_tickspdq_os_addr_fillupl_stoppcibios_pir_initttopenata_get_paramsether_ipmulticast_minconfig_rootsearchstge_intrrip6_sendspaceieee80211_countrycode2namempt_free_fw_memscsidebug_lunsuao_dropswapenxiobha_findisascanatw_enableusb_cdrnd_event_headahc_check_extportwsdisplay_switchtoconsolepmap_tlb_shootdown_job_putin6_maxmtupmap_enteramphy_funcsxl_list_tx_init_90xBmpt_ioc_diagtl_stopsys_setreuidusbd_ratecheckvga_console_attachedwi_usb_open_pipesudav_tick_taskbiosprobeu14_start_mboxsk_intruvm_map_findspacear5k_check_channelbha_intrwsevent_initsis_shutdownpdc203xx_pci_intrgdt_mpr_release_eventahd_get_scbusbd_devinfo_freesdsizefdstrategysys_pwritevudav_lock_miikqueue_scanvop_print_descvia82c586_getclinktcp_closeepioctlicmpsrctrm_DataOutPhase0ami_scsi_cmdgdt_simplelockohci_free_stdath_dwelltimeu14_intrsd_patternsscsi_initmsdosfs_advlockatw_node_freedl10019_mediastatusar5k_ar5212_reset_keyar5k_ar5210_resetkue_attachif_indexlimatw_tofs0_initusbd_free_xferpdcsata_chip_mapst_switchfallocbuffersisapnp_print_regionpcscp_dma_resetahc_set_syncratestge_mii_writeregnge_ifmedia_mii_updep_pci_devicespckbc_submatchlxtphy_cdiha_reseltrm_initdeadproc_mutexcomcnprobepfctlinputphys_mapuvm_anon_removeumass_bbb_methodscomintrufs_lockisa_attach_hookbge_setmultisys_accessem_read_mac_addrnsphy_statususerconf_initiha_read_eeprombce_cavga_isa_matchpccbb_pcmcia_writekillpg1ar5k_ar5210_fillti_ifmedia_stsxl_ifmedia_stsurl_tx_list_initpchb_printuhci_strvputonfreelistuhci_device_ctrl_transferXillgdt_raw_scsi_cmdierintwdioctlext2fs_mountrootrtw_newstatetxp_cmd_desc_numfreeaic_dequeuepciide_mapregs_compatioprbsminphysregyearurl_ioctlem_update_stats_countersahc_validate_widthsetrunnablesk_caeisa_intr_mappool_do_putmpt_ctloprtw_cardbus_attachar5k_ar5211_detachali1543_icuahc_pci_attachwi_set_ssidcue_ioctlnd6_prefix_onlinkatapi_to_scsi_sensewdc_atapi_ioctlcue_attachosversionelf32_read_fromray_resetstge_rxintrhid_is_collectionem_free_receive_structuresami_attachwi_usb_tx_list_initem_set_d0_lplu_statetvtohzip6_mroutervr_startvmi_listudp6_usrreqratecheckmpt_send_cmdsm_pcmcia_cain_rtchangevfs_syncwaitgdt_chainudav_ifmedia_statusaue_crcieee80211_node_lateattachcansignalmsdosfs_check_exportlf_setlocknbigpipetrm_Nopcue_devsin_controllmaxwsmux_srcopsrlphy_funcsmpt_print_replyahc_send_asyncuvm_pagecopyar5k_ar5212_set_ack_timeouttl_casysctl_quadsys_readexec_process_vmcmdskue_tx_list_initstge_read_eepromem_phy_igp_get_infocmd_chip_mappcn_79c970_mediastatusahbintrudf_disklabelspoofrddkdriverohci_freemuhci_remove_ls_ctrlmbstatuhidev_intrvia82c586_set_triggerahbminphysdcphy_statusttyinfoisapnp_newconfttyinami_schwartz_initramdisk_devsohci_root_ctrl_donewe_cdgetnulldevusb_get_next_eventti_ioctlxl_ioctlstge_mediachangepciide_dma_initextent_destroyip6_forward_srcrtif_group_egress_buildloop_clonergetcttsetwaterwhichqsudf_readar5k_ar5212_query_pspoll_supportahaprobe_bus_space_mapfilt_apmrdetachray_cmd_ranral_free_tx_ringem_clear_hw_cntrspmap_enter_pvmsgbufenabledunp_disconnecttrm_pci_probeufsfifo_writesys_listensys_mountehci_root_ctrl_donepgsignalehci_waitintrath_hal_attachsmc91cxx_set_mediafirstcaic_print_acbtcp_rndiss_initahd_sync_sglistpcdisplay_eraserowsuhub_detachahd_chip_namesstge_resetwi_pci_native_attachuvm_page_rehashvop_getattr_vp_offsetsstge_watchdogvop_islocked_vp_offsetsral_node_allocne_pcmcia_enableral_cardbus_attachti_free_rx_ring_mini_isa_bus_dmamap_load_uiotxp_intrffs_fsyncmpt_pop_reply_queuewsmux_mux_openpmap_remove_pteswsdisplay_consinetdomainehci_abort_xferahd_clear_msg_statememcpyppbprintwdc_enable_intrkthread_exitral_set_bssiddc_parse_21143_sromaxe_activateiha_msgout_extendedcpuar5k_ar5212_get_rate_tablecue_newbufsi_getdisk_constructvfs_unbusyar5k_ar5211_setup_tx_queuepropswsdisplay_paramip_nhopsrip_usrrequhci_setup_isocath_cardbus_matchahd_write_flexportfilt_usbrdetachspec_writesiop_wdtr_msgiop_handle_replyipsec_esp_network_default_levelin_broadcastpool_page_free_oldnointrfd_getfiledc_setfilt_admtekncr53c9x_free_ecbmpt_initahd_minphyssdioctlutsnameexit2__hex2asciipdq_os_transmit_doneral_alloc_tx_ringaue_resetrl_resetkue_open_pipesmpt_read_config_info_mfgvr_miibus_readregacer_setup_channelip6_mloopbackext2fs_cgupdateuhci_add_hs_ctrlpccbb_powerrddumpgdt_pcinew_get_statusem_enable_intrcpu_setperfmpt_run_pprufs_lookupahd_update_residualsiop_pci_resetar5k_ar5211_reset_tsfufs_bmapdoasyncfreeudav_miibus_readregip6_mrouter_detachip6_randomflowlabelsync_vnodeop_opv_descttpolldegetlogpollkthread_createahd_verify_cksumfxp_cardbus_deviceswds_ipollsi_findpckbc_cleanqueueam7990_copyfrombuf_contigwdc_default_read_raw_multi_2ahc_isa_capmap_add_pvpageffs_fifoop_entrieslogcloseconstabar5k_get_regdomainaic_dump_drivernbufpcmcia_submatchatw_media_statusudf_readdirohci_rhscudav_detachtl_ioctlufs_strategyohci_device_requestrtw_attachami_raw_switchkue_watchdogbounds_check_with_labelether_input_mbufif_qflusharc4_timeoutpci_subclass_networkiop_shutdownext2fs_checkpathns_scx200_chip_mapsocantrcvmoreepreadeepromAscISRadw_dequeuedevclsfile_filtopsrtw_watchdogiha_print_infost_cdvge_miibus_readregdc_pci_attachmsdosfs_renamesiop_adapterahd_known_modesext2fsfifo_reclaimpipe_wfiltopsar5k_ar5210_set_ledstate__lshldi3pci_intr_establishAscInitDriverpckbc_init_slotdataPTmapcd_load_unloadar5k_ar5210_nic_wakeupahd_intrrtw_txdesc_blk_setup_allpmap_activatepcic_printvop_create_vp_offsetsxe_statchgconfig_make_softcncr53c9x_msgoutunp_discardexec_aout_makecmdscue_csr_write_1dumpmemip6_outputrtw_rfchipid_stringwi_read_record_iovga_pci_ioctlfd_caudav_rxeofip6_mrouter_getath_init1pcic_isa_probeswap_syscall_lockufs_kqfilterem_is_valid_ether_addrrtw_ibss_mergescsi_autoconfcheckdirsexecswar5k_ar5211_rfregsnsphyter_cdumass_atapi_attachwsemul_vt100_output_csiin6_are_prefix_equalin6_controlahd_handle_scb_statusahc_print_registerwe_readmemem_setup_ledleapyearsys_sigsuspendcd9660_unmountwsemul_vt100_output_scs96pciide_dma_startwdc_atapi_the_machineehci_device_bulk_abortpccbbintrtrapsignalste_encaprushjobar5k_ar5210_set_cts_timeoutrn_inithead0ahd_find_pci_devicewd_flushcachend_defrouterfdcloseexecpckbc_slot_namesapm_bebattevcount_attachlimcopyste_miibus_writeregwi_do_hostencrypttcp_timer_rexmturl_ifmedia_changepcmcia_io_mapsiop_pci_cart_timer_initcpu_featurend6_useloopbackieee80211_next_modeputsaxe_tx_list_initehci_pcd_ablegdt_pci_get_statusrip6stattcp_debxcnpollrtw_rxdescs_synccd_casys_truncateral_txtimeesigcodescsi_xfer_poolacphy_serviceudav_csr_readste_introhci_add_doneem_read_phy_regtl_newbufsrv_ipohci_add_edwdc_xfer_poolcdce_newbufsoacceptkqueue_pollcdgetdisklabelvop_bmap_vp_offsetsadw_asc3550_mcodeasc_mcodepool_page_alloc_kmemem_mng_write_commitehci_device_isoc_donein6_ifaddloopne_isa_attachufs_creatend6_optionscd9660_seekfxp_cardbus_attachnd6_llinfo_settimeraha_switchxe_intrsis_list_rx_initmsdosfs_unmountelf32_load_psectionXsoftclockuhci_device_bulk_transferan_write_recordsmc91cxx_resetahd_clear_fifouhci_remove_intrrtw_txdesc_dmamaps_creatertcintrppbattachm_tag_nextohci_intr1ray_casea_switchmsdosfs_writecue_resetath_pci_caXrecurse_legacy15AdwGetEEPROMConfigami_freemempccbb_pcmcia_intr_disestablishexec_script_makecmdsfilt_pipedetachcd9660_rootath_hal_computetxtimene_pcmcia_get_enaddrrgephy_statusiophyattachselrecordpcic_isa_chip_intr_stringste_txeoccomstopral_attachrip_outputbge_cdcpu_cache_eaxext2fs_accesshme_rxcksummld6_fasttimeoef_miibus_readregbus_space_freekthread_qar5k_ar5210_dump_stateichpcib_cdimaxste_mii_sendvop_unlock_vp_offsetsohci_free_sedstioctluserconf_pdevpciintr_link_map_listclock_secs_to_ymdhmsmbpoolst_write_filemarkstcp_canceltimersahd_wait_flexporttqphymatchrip_recvspaceroute_initccdreadvge_setmultilink_rtrequestwdc_get_xferuvm_vmspace_poolcac_eisa_l0_fifo_fullvr_mii_readregath_rate_setupep_isapnp_castge_mii_statchgsis_mii_readregioport_exspec_lookuppipe_createahd_default_configfifowrite_filtopssysctl_vnodepdc202xx_setup_channelnd6_sysctltrm_read_allrtw_enable_interruptsnge_alloc_jumbo_mempciide_amd_productspci_subclass_multimediavn_openan_txeofuhci_freexif_clone_createcdce_tx_list_initle_isa_attachuao_detachpckbd_set_xtscancodetxp_ifmedia_stsmallocopti82c700_set_triggerwb_txeoftl_dio_write32ar5k_ar5210_init_tx_queueahc_platform_freexe_mediachangeamd_family5_setupamap_pp_adjrefep_pcmcia_matchtl_dio_setbit16ar5k_ar5212_set_key_lladdrapollo_chip_mapin_pcbrtentryudf_readatoffsettl_dio_read16rtw_max2820_destroyaicattachknote_dequeueuhci_root_ctrl_startwi_cmd_usbvia8231_get_intrtcp_outflagskqueue_statcdce_ioctlcd9660_rrip_analyzeohci_hash_find_tdexphymatchahc_isa_matchuriowriteip6_v6onlysys_preadvidentifycpusys_recvmsgvga_setfontsetgdtxe_set_addresspipe_statwb_read_eepromvn_writemtdphy_servicevop_mkdir_vp_offsetsVOP_LINKxl_txeofpcmcia_megahertz_xjem1144_func0icmp_inputuvm_km_free_poolpage1umass_cdvcountmtd_attachrd_root_sizevm_page_zero_enableaha_reset_ccbin6_delmultistathzrl_setmultitxp_ifmedia_updahc_qinfifo_requeue_tailatw_next_scanar5k_ar5212_set_regdomainvia8231_pci_icuwskbd_cnattachwe_test_memwdc_ata_bio_intref_ifmedia_stsuhidev_get_reportsys_getloginbuckstring_inituhci_free_std_chainicmp6_rediracceptext2fs_vnodeop_opv_descpckbcintrdetruncahd_pci_attachpmap_unmap_ptescopyoutmpt_pci_attachahd_handle_hwerrintcomconsaddrcpu_dumppfindip_ctloutputpdq_hwresetuhidev_set_report_asyncwsevent_readti_add_mcastarp_ifinitufs_dirbadcd9660_readdirvfs_unmountallccdattachwsdisplaypollrgephy_loopohci_allocxar5k_ar5212_set_slot_timecopyrightar5k_ar5212_setup_tx_descaic_timer_resetsdattachtcp_timer_keepar5k_ar5212_init_beaconusbd_devinfo_vpre_cardbus_shutdownwsemul_vt100_cnattachtcp_mss_updatepciide_lookup_productffsfifo_reclaimehci_root_ctrl_startrw_enter_readvunmapbufehci_device_ctrl_transferpcic_attach_cardip6_sourcecheck_intervalahd_alloc_tstatesis_watchdogroute_outputrti_deletevop_kqfilter_descsys_geteuidrl_mii_readregdectohexdechostzeroisbroadcastrtw_rtl_pwrstatepckbd_bell_fnral_tx_bcnisa_intr_typenameem_mng_write_dhcp_infopmap_exec_fixupicmpmaskreplin6_pcblookup_listenmsdosfs_mknodef_isapnp_attachcd9660_specop_pip6_defmcasthlimsys_munmaptrm_StartSRBdc_mii_readbitsii3114_dmactl_writeXoflfilt_solistenvsnprintfrtw_hwring_setuprl_read_eepromcardbus_get_capabilityisaattacharplookupdc_initwsemuldisplaydevprintuvm_map_pageableproftimer_trampolineem_write_reg_iochainallocstge_rxdrainvia8231_initec_test_memifmedia_baudratecardbus_detach_cardpckbd_hookup_bellatw_read_sromedataaic_pcmcia_matchrtw_led_initar5k_ar5210_reset_tx_queueusbd_setup_default_xferem_82547_tx_fifo_resetuvm_pagelookupudf_trans_poolsoshutdownuserconf_hist_cmdtcp_rndiss_reseeduserconf_listproc_cansugidcd9660_rrip_getsymnamear5k_rfregs_gain_readbackwsemul_vt100_scrolldownwsdisplay_getc_dummybge_ifmedia_updnge_setmultinswapbpf_iflistem_reset_adaptivewdc_downgrade_moderl_cardbus_setupieee80211_node_leaveip6intrqath_disableel_probeste_startaxe_newbufnd6_rs_inputAscInitASC_SOFTCmpt_init_requestpciide_mapreg_dmawdc_atapi_real_start_2soabortdpt_eisa_attachem_get_bufem_82547_move_tail_lockedunp_inortw_cdlogkqfilteruvm_tree_RB_INSERTuprintfrtw_txdesc_blk_init_allintrtypepccbb_winlist_deletemainbus_casoftdep_flushworklistsys_issetugidinitclocksadv_switchudf_hashinscd9660_mmapsd_reassign_blocksif_detachxmphy_caaue_watchdogrtw_intr_beaconwsmuxopenisp_controlwdc_ata_bio_startnd6_cache_lladdrifqmaxlencatqsession_poolpcic_intr_findisa_dmamem_freeray_rccs_intrpciintr_icu_handleext2fs_specop_opv_descunp_connectisa_freeuvm_pagermapinar5k_ar5211_get_rate_tablexl_setmodebha_collect_mboif_detached_startbge_intrpci_decompose_tagpool_serialral_plcp_signalaic_debugaue_ioctlvfs_mountedonrtw_max2820_txpowerpckbc_slot_enablefc_lookuppmap_deactivatevr_ifmedia_stsep_mii_readbitpcibios_return_codenge_proberbus_pccbb_parent_ioif_downndqbfilt_rndreadle_pci_matchallocsysVOP_GETATTRuhci_root_ctrl_methodsieee80211_fix_ratesiop_add_reselswuvm_km_pages_headahd_pci_intrieee80211_node2reqahc_freewi_usb_matchelf32_check_headertcp6_usrreqahd_recover_commandspckbc_poll_cmdadw_pci_matchatw_attachdc_decode_leaf_siaeephy_cdinphy_cdukbd_parse_desccac_l0_fifo_fullcyrix3_cpu_setuptcp_rndiss_cntar5k_ar5210_setup_tx_queuepropsural_set_txantennacac_pci_findtypeieee80211_crypto_detachopti82c558_get_intrpmap_unwireipaddrxl_mii_readregahd_timeoutatw_pci_attachip6_auto_linklocalpccbb_cb_intr_disestablishuvm_pageunwiresmc91cxx_intram7990_intrehci_device_intr_abortapmcallti_mem_readahd_rem_wscbrtw_sa2400_filter_calibrationdc_setcfgapm_thread_createtl_miibus_readregip6_mrtprotouvm_unmap_piha_selectdc_eeprom_widthsis_miibus_writeregcdattachuserconf_devicepcic_chip_io_unmapurioreadin_localaddrtxp_dma_mallocsys_sigaltstacksii3114_dmatbl_writeath_next_scanray_update_error_countersbrgphy_resetsoisdisconnectingwi_media_changegdt_copy_internal_dataAdwRamSelfTestsyn_hash2rttimer_queue_headbha_initdp8390_enableiha_bad_seqexphy_caiestoprtredirectsis_eeprom_putbytewdc_atapi_pio_intrtl_stats_updatettymodemfpa_cawsdisplay_defaultscreensmtx_enteraxe_devskqueue_poolvntblinitrtw_rf_macbangbitsallcftablesudf_hashremahd_set_recoveryscbuhub_activatebge_free_tx_ringti_startti_newbuf_stdtxp_shutdownax88190_mii_bitbang_opsxl_startnpxprobescsiforcelun_targetsVOP_REALLOCBLKSuhci_globalresetdc_shutdowndc_devsE_abs_tag0_Usedahd_alloc_scbssys_setresgidsdebugmsdosfs_sync_vnodesplassert_failvr_watchdogtty_initaxe_ioctlxe_pcmcia_interpret_manfidahc_setup_datawsdisplay_clearonclosesdzerorefatw_bbp_io_disable_delayvge_allocmemudp6_recvspaceuvm_km_freesys_killadw_build_sglistapm_clicomconsiohuserconf_numberperfleveladw_intrcopystr_faultem_watchdogrt_setmetricssys_getegidst_spacear5k_bitswapahd_restartste_mii_writeregem_phy_m88_get_infopckbc_flushem_check_mng_modertw_collect_txpktumass_init_insystemserverworks_setup_channelst_quirk_patternsem_validate_eeprom_checksumdirchkahc_eisa_caXrecurse_legacy13exphy_resetipip_outputpipecloseext2fs_fifoop_entriesVOP_REMOVEpci_mapreg_typeahd_free_scbXsoftttyray_stopwi_usb_activateec_attachiop_strvisconsinitiha_msgoutpcibios_entryti_cabootdevhme_initext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachsis_ifmedia_updmtdphyattachifaof_ifpforaddrtwe_donepcic_chip_io_freeste_attachrt_timer_queue_destroyisa_dma_stats_bouncesan_stats_updatewi_cdsd_cdar5k_ar5212_eeprom_is_busyicmp_mtudiscipport_hifirstautosys_fstatem_read_eepromrgephyattachuserconf_enableciss_syncwb_txeocumass_bbb_resetvia82c586_set_intrahc_intrgscpcib_matchahc_set_recoveryscbem_driver_versionsa6_anysys_getprioritygdt_internal_cache_cmdray_fill_in_tx_ccsdpt_pollpci_subclass_cryptosysctl_diskinitE_ldsa_abs_reselect_Useduvm_km_vallocieee80211_send_mgmtcue_getmacgdt_initnatsemi_chip_mapgdt_mpr_test_busyvga_pci_attachieee80211_dump_pktsys_unmounttwe_pci_attachapmkqfilterxl_cardbus_productspcn_rxdrainelf32_probesahd_inq_scbramin6ifa_ifpwithaddrvgonelrtw_rf_initiha_se2_rdpcic_chip_mem_unmapsis_read_cmossofreear5k_ar5212_detachahd_print_patheephyattachinphyattachsiop_timeoutXdoretipmap_removebpf_mtap_afbootargvtl_miibus_writeregahc_acquire_seepromisa_dmamap_createicmp6_fasttimoext2fs_removemtx_initamd756_get_intrif_clone_destroyehci_close_pipewdccommandwe_read_hdrahd_pause_and_flushworkcopy_faultpmap_steal_ptpmyipbpf_setfuserconf_historydc_mii_readregcac_eisa_l0_submitaha_finduvm_page_unbusybha_polliop_pci_catk_noutsk_init_yukonext2fs_mountioprbs_startmif6tablepmap_collectuhci_check_intrsmc91cxx_ioctlukbd_enablepciide_compat_intrcpu_sysctlcd9660_vnodeop_pcd9660_deftstampral_cardbus_disableip_randomidfxp_attach_commonaue_tx_list_initiop_initiator_registernosuidcoredumpukphyattachvop_poll_descrtw_intr_atimsk_init_rx_ringcddumpath_rx_prociha_state_2pckbc_attachXstray_legacy6tcp_disconnectintel586_cpu_setupvop_open_vp_offsetsuvmspace_execuhci_timeoutwi_usb_detachwsmux_createsys_mmapehci_bus_methodsbootral_intrar5k_ar5212_init_pspollaic_donend6_is_addr_neighborar5k_ar5212_set_lladdrwsemul_vt100_output_normalgdt_sizeunp_rightshostnamebha_disable_isacompatcmd680_setup_channelsetsegmentwsdisplay_emulbellupl_outputfdstartem_disable_pciex_masterext2fs_bmapar5k_ar5210_get_power_modeuvmexpehci_detachPTDpaddrdc_intrbge_chipinitufs_diremptyreinsertfinishdupray_activateaha_init_ccbahd_get_hescb_qofftl_cdukphy_serviceqsphy_resetpool_destroylogwakeupdl10019_mii_readregshutdownhook_listahc_get_scbaha_isapnp_probeiop_cdep_pcmcia_lookupip_dosourceroutesoread_filtopspcic_attach_socketieee80211_media2ratecpu_swapoutbdevsw_lookupdisk_changewsemul_vt100_resetopi386_ioplan_read_recordsc_devsamap_lookupsdoreallocblksadv_initcache_revlookupiopioctlahc_minphysamd756_setup_channelbpfread_filtopssoinitisapnp_alloc_drqdc_read_sromem_get_speed_and_duplexVOP_MKNODuvmtrm_ResetDevParamapm_evindexnd6_ifdetachin6_ifaddrroute_protoral_update_plcpxe_getbrgphy_funcsext2fs_truncatere_newbufti_txeof_tigon1cd_play_tracksscsi_do_mode_sensevirttimer_trampolinear5k_ar5212_get_lladdrip6_maxfragpacketsehci_confdax88190_media_finiaha_inquire_setup_informationuvm_km_threadpckbd_keydesctabnge_eeprom_getworduhci_root_intr_methodslminscsi_probe_bussys_fpathconfepic_shutdownahd_handle_seqintwsmuxpollarpt_pruneohci_device_bulk_methodssoconnect2knote_poolcnopenath_node_allocami_devfdattachnatsemi_setup_channelscsi_test_unit_readyural_set_bssidarc4random_bytesnmbclustural_get_rfvop_reallocblks_vp_offsetssominconnep_pcmcia_get_enaddrcpu_cache_ecxuhci_device_clear_toggleredebugpcmcia_matchnchashtbluvm_vnp_syncgdt_free_ccbadw_initem_transmit_checksum_setupcac_devahd_handle_proto_violationXstray_legacy12wsmux_set_displayepic_mii_readarpt_downudf_accessrdgetdisklabeltwe_scsi_cmdwb_mii_writeregpckbd_cdbpf_tapar5k_ar5211_radar_alertwds_initapm_set_vernge_startmii_phy_autotrap_typeswe_set_mediamax_datalenuhaminphysmsdosfs_initohci_device_ctrl_startar5k_ar5212_reset_tsfvop_readdir_descwi_write_record_ioesp_cdext2fs_writeisa_dmamem_maplf_clearlockbioscnpollcprocess_fninit_xmmi8254_delayath_node_copyar5k_ar5210_detachsiop_resetbusurl_memip_srcrouteip6_accept_rtadvsys_setregidar5k_ar5211_dump_statetrm_RequestSensepcmcia_cdusbd_device2interface_handleurl_csr_read_1ccdlockusbd_dopollne_pci_prodvinvalbufpckbc_poll_datamii_bitbang_writeregmainbus_attachsys_ftruncateuhci_device_isoc_startm_splitisp_doneefstopuhci_remove_hs_ctrlncr53c9x_attachahd_add_scb_to_free_listfifo_pollar5k_ar5211_set_powerar5k_ar5212_nic_resetar5k_ar5212_get_intrurl_stoptcp_timer_initpdq_runeisaattachsii3114_dmactl_readudf_find_partmapsaicintrnd6_maxnudhinttcp6_inputwdc_atapi_donesosetoptehci_set_qh_qtdtcp_mssath_mode_initmpt_read_config_info_iocahd_sg_virt_to_buscache_purgeudav_stop_taskskcprintti_attachbpf_mcopyath_hal_mhz2ieeeax88190_mediachangexl_attachpcmcia_3cxem556_func0atw_pci_devicessiop_printstatspcmcia_intr_disestablishaha_ccb_phys_kvfork1am7990_ioctlcurpcbec_readmemvfs_hang_addrlistst_cacue_tickmrt6statdead_writeath_beacon_freeufs_dirrewriteinsmntquettreadtk_canccrtw_led_fastblinkcac_l0_intr_pendingvga_initext2fs_blkfreeudp_outputfind_last_setcd9660_vnodeop_entriesahd_acquire_seepromdelay_functcp_rndiss_msbsys_chmodccdsizeahd_inwwb_rxeofprelist_removeffs_vgetaxe_encapinitprocath_rxbuf_initahc_set_unitisapnp_config_isa_dma_check_bufferti_init_rx_ring_jumbo__umoddi3ar5k_ar5210_clear_mcast_filter_idxem_put_hw_eeprom_semaphorertw_resetpci_intr_stringvia82c586_init_isa_dma_alloc_bouncebufip6_log_intervaltrm_DataIO_transferuvm_page_physdumpiha_append_pend_scbrootconfccdbufferwsemul_vt100_nextlinehme_intrcac_ccb_donesyn_cache_timervt100_initchartablespccbb_pcmcia_do_io_mapsolisten_filtopspci113x_insertin6_update_ifa__wdcerroriha_busfreeep_mii_sendbitscdce_detachvop_bmap_descXhold_legacy4hme_ioctldpt_pci_attachsuser_ucredfxp_startray_cmd_is_scheduledisapnp_mergear5k_regdomain_from_ieeeahd_read_flexportsd_shutdownwi_shutdownmem_noext2fs_buf_allocdp8390_startxl_start_90xBral_pci_matchuhci_free_stdpciaddr_resource_reservebge_startpcn_watchdogiha_switchep_pcmcia_detachstwriteXhold_legacy1revarprequestkernel_mapuhci_device_isoc_enterwi_init_iodumpdevciss_attachray_simple_cmdciss_put_ccbciss_cdcd9660_lockdc_list_tx_initem_check_polarityrl_cardbus_caietintieee80211_mgt_subtype_namevia8231_set_triggerar5k_ar5211_set_opmodevfs_mount_foreach_vnodekqueue_kqfilterbge_newbuf_jumboip6_mrouter_donear5k_ar5210_query_pspoll_supportwi_mgmt_xmitpckbd_enablepccbb_pcmcia_readpccbb_pcmcia_mem_mapzeroin6_addrstrncasecmprl_tickohci_device_bulk_startwdc_atapi_minphysisa_defaultirqin_ifaddrnd6_optionwin2unixfnmax_hdrrbus_deleteffs_readm_freevop_default_descar5k_ar5212_stop_pcu_recvar5k_ar5210_set_ack_timeoutahd_get_sdscb_qoffne_pcmcia_dl10019_get_enaddrar5k_ar5211_proc_rx_descpccbb_pcmcia_socket_enabletrm_write_allscsi_inqmatchfdesc_poolusbd_add_drv_eventpcic_queue_eventcmd_pci_intrvop_strategy_vp_offsetspool_page_allocin_pcblookupfilt_pipewritecd9660_pollm_tag_delete_chainpool_head_slockahc_actionbzerosis_miibus_readregfxp_pci_devicestickfixintervaladw_reset_ccbmii_bitbang_syncufs_closefixjobcpcdisplay_getcharehci_shutdownpci_subclass_daspscsi_execute_xsbge_txeofin6_addmultirn_newpairvop_setattr_descath_attachvge_rx_list_initsis_devicessys_obreak__udivdi3fxp_powerusbd_set_config_nortw_rf_hostbangbitsiha_xfer_datargephy_cdpcn_ioctlusbpollpciide_cdcpu_classintrlevellastddateaic_isa_probeem_check_downshiftadv_pci_devicesahd_cdar5k_ar5212_get_rx_bufin6mask0bpf_validatertw_rf_attachusbd_get_string_descvaccessatw_voodoompt_resetieinituao_set_swslotmbinitisapnp_attachmpt_pollusbd_get_reportsk_ticktxp_rxbuf_reclaimrtw_media_changevga_common_attachwskbd_default_bell_datascsi_readsafe_cmdvga_cdamap_allocVOP_LOCKMD5Finalaic_datain_piofxp_cardbus_detachpckbd_cnpollcwskbd_matchcp_timeaxe_rxeofcd9660_vget_internalwi_intrne_pci_matchrl_pci_matchvgetrd_attachrtw_txdesc_blk_setupuha_isa_attachar5k_ar5210_update_mib_countersieee80211_create_ibssatw_dwelltimeahd_sglist_allocsizewinChksumcb_resetserverworks_chip_mapiop_hrt_getfreeclusterchainmld6_initray_recv_authprocfs_checkiopermdisk_initi386_cpuid_featurescd9660_fifoop_opv_descohci_hash_rem_itdohci_bus_methodsAPTmaprip6_ctloutputwdcrestartcardbus_caral_bbp_initgdt_pci_probenetiompt_cdaue_sendusbd_getnewaddrnd6_na_outputatw_xindiv2mpt_read_cfg_headerpcic_isa_caext2fs_fhtovpumass_cbi_transferext2fs_createdpt_hba_inquireem_local_timeratw_txthresh_tab_loXhold_legacy9cpu_idusbd_bulk_transfer_cbwi_sync_mediavfs_opv_init_explicitpipe_pollnsphy_capcic_chip_io_allocbmtphyattachsysctl_dopoolcd9660_fifoop_puhub_matchep_detachahd_targetcmd_offsetaha_devpmtu_expiretcp_respondsys_readvamap_cow_nowroundrobinapm_periodic_checkuvm_map_createvfs_opv_initissignalwdprintiop_tfn_printrtw_node_freenetclspcibios_cacdevvpuhci_intrpci_intr_route_linkar5k_ar5210_reset_beaconbha_create_ccbsigmp_joingrouprandompolluiomoveohci_device_isoc_donewi_usb_wridrespmsdosfs_startdevioclf_allocar5k_ar5210_wait_for_beaconwi_intr_ackXstray_legacy13pciide_dma_table_setupbpf_reset_dnd6_dad_stophid_start_parseuseloopbackar5k_ar5212_set_opmodeuvm_waitfilt_apmreadnexecsststartnge_eeprom_putbyteieee80211_regdomain2namexl_powerapm_op_inprogpmap_referencesys_bindath_countrycodeax88190_mii_statchgray_disableloioctlrw_exit_writetrm_ReleaseSRBar5k_ar5210_get_rf_gainpmap_bootstrapipsec_auth_default_levelar5k_eeprom_read_macepic_mediachangeldt_freesys_mqueryar5k_ar5211_get_rf_gainpcic_isa_alloc_iobasebigadjkmeminit_nkmempagesspec_vnodeop_entriesiha_xpad_inusbd_new_devicewi_pcmcia_detacheisa_devinfofdsizeray_find_free_tx_ccswdzerorefamd756_pci_icuscsiforcelun_busesfillinusemaprecvitrtw_txsoft_blk_initbmtphy_funcsep_media_changevge_attachfxp_scb_cmdcom_pcmcia_enablear5k_ar5211_get_diag_stateXspllowerti_alloc_jumbo_memfilt_sowriteuvm_kernacccnpollcsys_linkahd_platform_set_tagsar5k_ar5210_get_keycache_sizere_cardbus_probelog_openevcount_initdpt_eisa_cafragtbl124userconf_totdevtxp_download_fwvop_inactive_vp_offsetsahd_outwrt_ifmsgrt_tableswdc_atapi_real_startrealitexpirear5k_ar5211_eeprom_is_busyipstatunix2dostimetrm_get_dataahd_force_renegotiationscsibus_caiha_reset_tcsurl_newbufusbd_delay_mspool_page_free_kmemcrfreecnputcec_capcic_attach_socketsgdt_pci_attachami_raw_devip6_lasthdrdl10022_mii_bitbang_opsahc_clear_intstatohci_device_isoc_abortuhub_uhub_catcp_reaperral_initmpt_print_scsi_io_requestpool_sethiwatwi_read_record_usbwsemul_vt100_output_c0c1wdgetdefaultlabelahd_devlimited_syncrateahd_update_modesgdt_enqueuear5k_printveratw_txintrxl_resetuvm_swap_getepmbuffillatw_cardbus_setuppciide_serverworks_productsext2fs_reloadif_detach_rtdeleteXstray_legacy15elf32_copyargsisochariha_pop_free_scbiophymatchuvm_km_alloc1ahd_done_with_statussiop_cdcdopentcp_usrclosednsphyter_caaue_ifmedia_stsphysmemudf_checktagiop_ictxhashurl_cdwskbd_holdscreensm_pcmcia_ascii_enaddrinferiorrtw_txsoft_blk_setupukbd_attachclusterallocahc_abort_scbsXrecurse_legacy7bioscngetcext2fs_fifoop_pinitrtclockltsleepwskbd_attachin_pcbbindmpt_wait_stateXrecurse_legacy4umass_cbi_statesis_attachmtdphy_caxl_mediacheckehci_cardbus_cauhci_timeout_taskuhci_root_ctrl_closertalloc2endtsleepwihap_check_txpckbc_isa_intr_establishuvm_pageratopsigactssharepcdisplay_attachpcic_poll_intrbpfattachpccbb_chipinitif_detach_queuesitimerdecrusb_create_event_threadether_outputpci_cdem_phy_setup_autonegbpfilter_lookupm_copym0trm_DataInPhase1ahd_sync_sensevga_init_screenaxe_miibus_readregvm_physmemar5k_ar5210_get_slot_timeiso_shipdirrdwriteintel686_cpu_setuprnd_timeoutral_newstateahc_softc_insertbios_memmapicmpmaskpipe_ioctlural_set_chanwskbd_enablecd9660_mountrootnetlckbpf_allocbufspcic_isa_attachmsgbufmappedohci_device_setintrcomprobe1getphysbufaha_donecdsizeuhci_device_ctrl_startumass_lookupupl_activateufsfifo_closewakeupsoftdep_slowdowngetnanotimevge_newbufbiosclosewdc_pcmcia_disk_device_interface_callbacki386_get_iopermpciide_matchresume_pop_gstcprexmtthreshkprintf_mutexahd_assert_modesclassnamesrt_getifawi_get_fid_ioahd_search_scb_listviac3_rnd_tmoenosyslockmgrpccom_isa_cartlabel_name2idisp_uninituvm_vnodeopsisa_dmadonevfsconfami_copyhdscompwroffpccom_xr16850_fifo_initVOP_OPENef_cdurio_attachwsdisplay_console_inittedbuckstringuhci_device_bulk_startsiop_scsicmd_endusbd_fill_deviceinfosk_shutdownscsi_interpret_senseXstksqphy_cdext2fs_flushfilesfakeintrwe_mediastatusmsdosfs_vnodeop_pcomconsattachedwi_usb_txeof_frmbrgphy_probelxtphyattachufs_readlinkrdopendoscheckpathcac_eisa_matchpcbmapgdt_pcinew_copy_cmdnd6_option_inituvm_km_alloc_poolpage1brgphy_servicear5k_ar5211_is_cipher_supportedskc_devicespiix_setup_channelahd_pci_probeext2fs_setsizear5k_ar5210_get_rate_tableiha_state_4egprobeem_print_debug_infoar5k_ar5212_reset_tx_queueti_loadfwin6_init_prefix_ltimessoftdep_change_directoryentry_offsetmsgbufpnchstatscd9660_fhtovpar5k_ar5212_set_gpio_intrE_ldsa_abs_selected_Usedsys_setgidpcibios_entry_infouserconf_common_attrrtw_sa2400_tunertw_set_access1fd_dev_to_typeswapconffilt_ufswritertw_led_newstatert6_flushehci_timeout_taskaic_cduvm_mlk_callste_ioctl_pcdisplay_scrlistsis_read_macatapiscsi_attachar5k_ar5211_setup_xtx_descE_ldsa_abs_slot_Usedmmrwffs_bufatoffepic_intrahc_queue_scbfdcattachem_init_hwwi_usb_rridrespuvm_errno2vmerrordohooksahc_find_pci_deviceiha_state_8ahd_print_registerresume_pop_espcscp_adapterem_pci_set_mwiwdc_atapi_tape_doneehci_free_sqtd_chainieee80211_rssadapt_chooseukbd_activateem_disable_intrsiop_sdpresume_pop_dsaue_setmultiem_powerif_detached_ioctllocnampmpt_pci_matchadv_pci_matchvop_close_descwi_usb_caar5k_ar5212_disable_pspollcom_pcmcia_attach2ste_initi386_has_xcryptuserconf_showip_mtudisc_timeout_qwe_mediachangeupdate_cpuspeedffs_fhtovpgetvnodefilt_ufsvnodepool_setlowatray_initehci_pci_givecontrollerkmembaseXstray_legacy1iop_msg_allocrip6_inituvm_aiobuf_poolisofncmpnpxintrpcmcia_card_detachwb_resetsys_sigprocmaskath_xchanmodevga_load_fontray_attachin6_if_upfilt_pipereadatw_writewep_delayar5k_ar5210_set_lladdrrtw_pci_capchb_rndar5k_ar5210_reset_keybha_queue_ccbsoreservepidtakenu14_polltl_attachhme_resetuvm_mmapusb_activateufs_quotactlaroundin6_pcbnotifystrrchrusbd_clear_endpoint_toggleaha2840_load_seepromst_check_eodgetdevvphme_cdbge_resetpci_mem_finddefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangetickdeltaisodirinocfrootslease_checkchrtoblksiop_get_lunswscsiprintbge_inituserconf_pdevnamminphysukbd_matchmicrotime_funcahd_sg_bus_to_virturl_tickvge_probertalloc_noclonetimeout_mutexcd9660_specop_opv_descether_addmultivga_burneropti82c700_getclinkvop_mknod_descvga_ioctlfdcstartudf_strategycdce_cdip6qffs_vptofhifunitvfs_isbusybha_isa_attachami_pci_find_devicebawritetputcharan_reset_isa_bus_dmamap_unloadrtw_powerwskbd_detachcyrix6x86_cpu_setupi386_nocpuid_cpusffs_fragacctar5k_ar5212_get_cts_timeoutre_diagahd_sync_tqinfifosys_fchowndcphy_attachvwaitforioskc_attachmii_phy_tickcd_read_subchannelextendfilexe_cycle_powerlortrequesticmp6_inputwsemul_vt100_outputuserconf_addgdt_waitwb_deviceswdc_atapi_resetohci_device_intr_methodswi_func_iocreatedeepic_ioctlbge_writereg_indsbreleasemsdosfs_islockedrtw_chip_resettrm_DataOutPhase1bios32_entrymax_linkhdrumass_attachem_dma_freewsdisplayioctludav_resettm86_cpu_nameviac3_rnd_presentsysctl_rtablemsdosfs_reclaimvop_mknod_vp_offsetsvge_intrsqphy_servicesetregionuserconf_hist_eocfxp_stopext2fs_getattrrtlabel_id2namertw_recall_eepromapm_standbysbdroprecordXhold_legacy15ciss_pci_matchuvm_coredumpahc_find_periodisapnp_unconfigem_write_phy_regpmap_tlb_shootdown_qudf_ds_poolral_set_chanar5k_ar5212_calibratewdsizertw_rfmd_pwrstateapm_cpu_idleray_if_startrl_pci_devicesacphy_statusip6_sysctlsuseran_pcmcia_matchpcibiosattachdiskconfrtw_sa2400_txpowerural_tx_datatl_intvec_rxeofvn_syncer_add_to_worklistusbd_get_interface_descriptoriestartwi_pci_plx_attachgdt_freetk_ninsysfilt_opspciide_mapchanclusterfreempt_pci_link_peerrootdevisapnp_alloc_regionehci_device_isoc_startufs_ihash_slockm_tag_firstee16_eeprom_inbitstrm_Disconnectem_82547_move_tailcdmatchi386_cpuid_ecxfeaturesar5k_ar5210_init_beaconvga_setscreentypeusbd_get_config_descriptorclock_expandyeartxp_download_fw_sectionpciide_machdep_compat_intr_establishdumpsysicmptstampreplif_detached_watchdogusbd_ar_pipeem_mng_write_cmd_headercy693_setup_channelext2fs_fsyncdoforceuhci_root_intr_startiha_intrsys_fsyncwi_usb_stopuserconf_add_readusbd_reset_portep_isapnp_matchre_pci_probeifconfrtw_identify_countrysiop_led_onre_cardbus_detachpciide_pci_intrcpu_apmwarnamap_wipeoutuser_configar5k_ar5212_setup_tx_queuehme_mediastatustcp_rndiss_nexttcp_outputatw_linkintrnsphyattach_bus_dmamem_mmaptrm_ResetAllDevParamwsdisplay_emul_attachbha_doneupdate_ledsext2fs_updatetcp_timer_2mslne2000_writememaue_openpipesvr_shutdownffs_reload_vnodeif_addgroupmsdosfs_setattrVOP_RMDIRmpt_send_port_enableciphy_cdieee80211_setmodeudf_readlinkcac_flushpool_allocator_freefilt_proceopnotsuppsk_stopfifo_lookupahc_validate_offsetffs_reallocblksrandomcloserootvpath_beacon_allocaxe_miibus_writeregmpt_print_requestem_print_hw_statsatw_response_times_inittrm_pci_attachpcmcia_intr_establishuserconf_maxlocnamespool_reclaimusb_quirksahb_findpci_subclass_serialbusbpf_sysctlar5k_ar5111_channelvflushehci_openef_ifmedia_updiop_submatchath_tx_startcddetachtcpctl_varsarptimeradw_asc38C0800_mcode_datatcp_reass_limitm_copymruaddrdstrategyar5k_ar5211_clear_mcast_filter_idxral_reset_tx_ringam7990_initpcic_chip_io_mapif_upehci_intr1ciss_kthreadhme_encapne2000_ring_copyde_caupl_intrsis_setmulti_sisrgephy_resetural_matchsis_setmulti_nsclock_broken_latchVOP_BWRITErt_timer_queue_createahd_fetch_transinfowddonemsdosfs_ioctlpchb_caupl_matchpciide_dmatbl_writespllowerwdc_isa_attachsk_rxcsumsys_openurio_matchrgephy_funcstl_dio_read32inet6domainvga_pci_caural_enable_tsf_syncfxp_pci_attach_bus_dmamem_alloc_rangepgdeletepccbb_ctrlvge_ifmedia_stsuvm_pageidlezerowskbd_do_ioctl_scphtree_SPLAY_MINMAXciss_heartbeatste_shutdownrtw_srom_parseieee80211_media_changeraw_attachar5k_ar5211_set_associdural_set_rxantennapcib_printuhci_noopar5k_regdomain_to_ieeeether_ip6multicast_maxpipe_poolar5k_ar5210_disable_pspollami_put_ccbpccbb_rbus_cb_space_freeuao_initudf_CompressUnicodevop_abortop_descadw_asc38C0800_mcodeioprbs_timeoutbus_space_unmapxe_mdi_readifa_ifwithroutespec_kqfiltertcp_notifycd9660_tstamp_conv7ieee80211_match_bssural_free_tx_listrandomattachsys_sstkatw_frame_setdursem_smartspeedrtflushclonear5k_ar5211_get_intrral_cardbus_powergetblkti_jfreeem_tbi_adjust_statsdead_vnodeop_pdl10019_stop_cardcac_l0_submitmaxsmapaic_resettrapwritewdc_ata_biosoconnectural_initwskbd_repeatpcibios_get_statuspccbb_detect_cardnobuffersath_mcastfilter_accumar5k_ar5210_setup_tx_queue__lshrdi3rtrequest1usbd_errstrisa_nmicnsetral_rf_writedc_crc_letcp_identtcp_rst_ppslimrtrequestuhci_openifinitcd_load_tocunpst_recvspacertw_set_nettypedc_miibus_statchgar5k_ar5211_set_rx_signalne_pcmcia_attachkue_initpcn_79c970_mediachangeraw_inputcd9660_reclaimiha_next_statekue_ioctlfilt_logrdetachtrm_MsgInPhase1pccbb_intr_establishnd6_ifattachunpdg_recvspacepipe_closear5k_ar5212_nic_wakeupcd9660_inactivertcdrainahd_compose_idsoftdep_mountmsdosfs_rmdiruvm_km_getpageatw_tofs2_initiha_timeoutahd_inb_scbrampcic_intr_probemsdosfs_fsyncsmc91cxx_initcfdataffscardbus_save_barahc_index_busy_tclwi_usb_tx_lockusbd_do_request_async_cbufs_checkpathem_init_eeprom_paramspfxlist_onlink_checkm_tag_findinittodrxl_miibus_writeregadw_alloc_carriersahd_parse_msgvga_mapcharapmadler32vputmpt_disable_intsdk_establishtcbhashsizecd9660_setattratw_rf3000_initusbd_get_configan_pcmcia_activatecyhc_slockufs_quota_initkqread_filtopsusbd_setup_pipeiop_initiator_unregisteraue_csr_read_1pcmcia_check_cis_quirksem_read_part_numiop_reconf_threadieee80211_beacon_allocbioopsbpf_setdltti_eeprom_getbytewe_ring_copymsdosfs_statfslboltpipe_inittrm_set_dataepic_attachapm_set_powstatebce_cdusbd_open_pipe_intrapm_majversyncerprocpcmcia_card_gettypesmc91cxx_attachufs_ihashinsin_setpeeraddrccdbufsizeofadw_pollwdcactivateeephymatchinphymatchmpt_doneefbusyeepromwsdisplay_delscreenkvtopral_tx_mgtatw_nar_initether_ifdetachtwe_pci_matchvop_fsync_vp_offsetspcdisplay_cauhidev_get_report_descuserconf_histcurrndstatscy82c693_writest_touch_tapemsdosfs_inactivepanicstrwsdisplay_kbdinputupl_newbufumass_scsi_cbste_eeprom_waitpdc20265_pci_intrext2fs_sync_vnodeatw_startahc_softc_initunpdg_sendspacesession0mpt_timeoutami_stimeoutu24_initviscpyray_update_mcastrtw_cardbus_powerisa_nodefaultirqeisamatchE_abs_lunsw_return_Usedray_media_changeahc_calc_residualtxp_attachhookgdt_growar5k_ar5210_set_regdomaincopyincomparamsiop_common_resetxl_mii_syncural_stopudav_sendep_pcmcia_prodcd9660_defattrohci_device_bulk_closeath_initkeytableahc_print_devinfoehci_reverse_bitspckbc_set_inputhandlernge_list_tx_initrtalloc1elstopuao_swhash_elt_poolufs_ihashgetne2000_read_hdrsigacts0ncr53c9x_dequeuepccbb_cb_intr_establishfindblkmajorpager_mapar5k_ar5212_setup_xtx_descntohlsorflushxmphy_mii_phy_autoiophy_funcsttioctlarpintrqttycharsslpqueohci_root_ctrl_methodsvprintfan_media_changesyncdelaywi_usb_infofrmatw_cardbus_disableahd_assert_atnffs_mountahb_pollwsmux_mux_closeste_mii_syncext2fs_specop_entriestrm_ResetSCSIBusicmp6errppslimXresumeusb_neventspool_inactive_timeral_alloc_rx_ringrtw_philips_pwrstatedp8390_mediachangewb_list_tx_inituhci_add_intrar5k_ar5210_set_gpioral_cardbus_devicesconfig_process_deferred_childrenohci_ifcdwsdisplaywritepool_cache_reclaimrtw_rxdesc_dmamaps_createluphymatchin6_setmaxmtuem_carbus_pccbb_parent_memmsdosfs_rootmii_bitbang_sendbitsusbd_finishti_mem_settqphyattachbpf_getdltlistfxp_eeprom_putwordahd_setup_noxfer_scbm_tag_getahd_update_neg_tablepckbc_startcpu_vendorsl_probesb_lockdc_attachwb_stopem_enable_tx_pkt_filteringudf_unmountohci_root_intr_abortuhci_pollpcn_set_filterrt_labelssea_scsi_cmdstge_matchar5k_ar5211_set_key_lladdran_shutdownciss_intrupl_watchdogamd756_set_intrapm_epsuid_clear_isa_bus_dmamap_loadttwriteisa_dma_stats_loadsiha_exec_scbtwe_copy_internal_dataahd_set_scbptrehci_activateswapdev_vpdp8390_resetre_miibus_writeregatw_test1_initdead_readufs_pathconffile_poolohci_timeoutAscExeScsiQueuehme_pci_cask_setmultivop_symlink_vp_offsetsunputcaic_scb_timer_resetendatw_si4126_tuneppb_cdpcmcia_verboseluphyattachVOP_CREATEprobe_switchath_resumecdce_stopcac_eisa_attachar5k_ar5110_channelvop_readlink_descAscReInitLramuvm_map_referencespec_ebadfphtree_SPLAYahc_swap_with_next_hscbnd6_recalc_reachtm_intervalbha_devin_ifinitfifo_closeohci_device_ctrl_closedc_startwi_pcmcia_activatepciide_mapregs_nativein_pcbhashlookupudf_cksumray_download_paramsapmread_filtopsem_setup_transmit_structuresgdt_init_cpure_eeprom_putbyte_isa_bus_dmamem_mapem_enable_pciex_masterural_writecd9660_vnodeop_opv_descVOP_ABORTOPehci_pcdvr_encapral_get_macaddrrtw_startahd_other_scb_timeoutem_identify_hardwareuhci_idoneami_copy_internal_datadefault_chip_mapsys_acceptral_wakeup_expireuha_eisa_matchnsphyter_statusuvm_map_entry_kmem_poolatw_si4126_writeaha_finish_ccbssis_ifmedia_stsem_process_receive_interruptsccdcloseasc_mcode_chksumwi_inquirepccbb_cardenablepccbb_pcmcia_io_allocehci_pci_takecontrollertcp_rst_ppslim_countukbd_detachcom_pcmcia_enable1if_clone_listsys_futimesccdinitsdgetdisklabelwb_startar5k_ar5211_attachwi_do_hostdecryptsiop_table_syncXrecurse_legacy1internal_commandpci_subclass_wirelessciphyattachin_losingfddumpmpt_scsi_statusbha_start_ccbssis_chip_mapVOP_SYMLINKgeteblkusbd_set_interfacewsscreen_detachrtw_srom_readem_force_mac_fcscsibusmatchvn_ioctluhci_remove_bulkwi_usb_ctl_locknge_attachioprbs_enqueue_ccbufsspec_readaxe_cdpipespaceohci_alloc_stdar5k_ar5210_set_key_lladdrepic_startcmd646_9_irqackip6_sendredirectsdc_eeprom_idlevga_mmapukphy_caitimerfixar5k_ar5212_set_ledstatevr_attachip_stripoptionsaxe_setmultitl_intrsyn_cache_countdc_eeprom_putbytexl_list_tx_initieee80211_add_xratesep_vortex_probemediartw_intrnd6_timer_chne_pcmcia_ax88190_set_iobasegdt_pcinew_intrcpu_resetgdt_intrudav_tickahc_eisa_matchelink_idseqste_setmultitcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1isa_dmaabortcbbprintohci_detachahd_get_snscb_qoffbdevvpiewatchdogifa_ifwithdstaddrAscInitFromASC_SOFTCehci_cdrbus_new_root_delegatear5k_rfgainpim6statudav_ifmedia_changestge_mii_bitbang_opssis_rxeofin6_nigroupxl_cardbus_detachwi_pci_matchscsi_mode_sense_big_pageuihashdpt_readcfgti_shutdowntcp_keepintvlvop_reallocblks_descxl_shutdowntl_read_eepromar5k_ar5211_get_regdomainpmap_is_curpmapvop_remove_desccdwriteufswrite_filtopsttybgconfig_searchusbd_printdc_cardbus_matchgdt_nextuvm_km_valloc_prefer_waitsyn_cache_pooliha_msgin_extendedcom_pcmcia_prodpckbc_isa_matchpci_subclass_mass_storageffs_allocar5k_ar5211_get_gpioahd_qinfifo_countaue_tick_taskatapiscsi_cdeginiti386_proc0_tss_ldt_initray_user_report_paramseephy_funcsinphy_funcsrgephymatchipsec_exp_first_useral_iter_funcrlphy_serviceplimit_poolral_read_eepromip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingrn_walktreepool_prime_pagepciide_ite_productsstclosesys_chownatw_cardbus_attachuvm_pagewirevop_lease_vp_offsetsu14_initem_stopin6_joingroupsys_munlockiha_setup_sg_listuvm_anfreeuhci_bus_methodsdofilereadvipip_sysctlvn_statfileiha_msgintwe_threadrw_exit_readieee80211_iterate_nodeswi_intr_enableip6_mrouter_settablefullepic_watchdoguhub_exploreahd_clear_critical_sectionupl_txeoftrm_ScsiRstDetecttcp_maxidlear5k_ar5212_set_keymclpoolststrategycttyioctltrm_clock_periodffs_vnodeop_psys_lstatfilt_rndwriteiha_reset_dmarbus_newpckbc_poll_data1ahc_freeze_devqohci_timeout_taskohci_hash_add_tdiso_uiodirahd_index_busy_tclahd_calc_residualatw_shutdownath_media_changeurl_activatenbtportscttyopenahd_setup_initiator_msgoutinet6ctlerrmapaic_scsi_cmdfifo_vnoperateioprbs_cadisknamesXrecurse_legacy9umass_quirkshexdectodechmematch_pcidumplopmap_zero_page_uncachedmsdosfs_mounttl_intvec_txeocacphy_funcsath_hal_ieee2mhznullcnpollcuvm_km_initahd_parse_cfgdatapciide_acard_productsffs_sbupdatear5k_ar5211_init_pspollahd_dump_card_stateatw_pci_matchudp_sysctlax88190_mii_bitbang_readral_reset_rx_ringvmmapbsyusb_add_taskurl_int_miibus_readregpmap_tlb_shootdown_job_mutexuserconf_histlenusbd_set_protocolpcibios_get_intr_routingisa_intr_allocem_read_eeprom_eerdvop_mkdir_descrl_txeofukbd_accessopstl_setmodeusbclosertw_tunepchbattachncr53c9x_resetAdwWaitEEPCmdudav_matchcdce_get_descpciintr_icu_tagsis96x_setup_channelpcipowervmspace0stmatchscsi_decode_sensettywaitar5k_ar5211_tx_startbios_getdiskinfouvm_map_setuptcp_syn_cache_sizebha_attachwdc_default_vtbldpt_pci_matchrtw_bbp_readrl_detachifa_ifwithnetmemchrrd_attach_hookohci_device_ctrl_doneetextqsphy_statusnpxdna_xmmsk_watchdogsqphyattachsysctl_cptime2ncr53c9x_scsi_resetadw_enqueueahd_platform_freedc_pci_acpiscsi_mode_sense_pagevt100_selectattributepdq_ifinitumass_scsi_setupproc_poolaue_intrali1543_getclinkudp6_inputsys_writemap_forwmergear5k_ar5212_set_mcast_filterindexnge_txeofsb_maxvga_50lscreen_monousbd_fill_iface_datacd_set_pa_immedwsdisplay_maxscreenidxcnstopcbb_cdihashtblsys_dup2em_phy_resetem_poll_eerd_eewr_donewdc_ioctl_findwsdisplay_switch1pcic_pci_machdep_chip_intr_establishsiop_productswd_get_paramssys_readlinkar5k_ar5212_eeprom_readahd_set_unitvia8231_get_triggersis_intrext2fs_sizertw_identify_sta__ashrdi3scsibuszerorefohci_intrcardbus_read_exromep_isa_attachip6_auto_flowlabelgdt_attachskc_cacardbus_mapreg_mapuha_free_mscplf_splitopti82c700_get_intrsk_marv_miibus_statchgifafreeVOP_STRATEGYtzrip_sendspaceudf_sysctlan_cmdisp_pci_caamap_addtcp_freequhci_device_requestsii3114_dmacmd_readdvd_authahd_print_devinfogdt_mpr_intrexphy_serviceumass_scsi_cmdpcn_attachcdreadspec_inactivedp8390_stopehci_device_intr_startahd_sglist_sizebge_encapahd_stat_timerwi_func_usbpckbd_cngetcwsmux_do_ioctli386_has_ssesys_sendtoicmperrppslimgeneric_filtopsknote_dropcue_watchdogin6_selectsrcpmap_tlb_shootdown_q_drainwi_usb_threadem_82547_fifo_workaroundtwe_startin6_pcbsetportpckbd_initalldevscom_pcmcia_attachdp8390_rintsk_marv_miibus_readregwddumpicmp_do_errorvmcmd_map_readvnusbd_get_interface_altindexste_stats_updateamap_extendsigpropvmapbufXalignaxe_rxstartisapnp_isa_attach_hooksis_cadehashtblsocketopsXstray_legacy3siop_pci_matchiop_hrt_get0deviortw_cardbus_intr_acknd6_maxndoptip6_iduvm_map_clip_startrawcbtablespec_readami_read_outbound_dbpcscp_dma_goste_watchdogunp_markPTDacphyattachpcdisplay_scricmp_mtudisc_timeoutnwsmuxttyread_filtopscac_initpci_conf_writeusbd_bulk_transfervop_lookup_descath_beacon_configcac_ccb_startgetinoquotafifo_ebadfscsi_do_ioctlan_setdefehci_free_sqhcd_resettimedeltaxl_txeocuhci_pci_cabicc_isa_probeem_is_onboard_nvm_eepromudpstatmpt_downloadbootsea_devsetrootcd_read_toccdioctlcue_stopsetup_buffersahd_chip_initatw_recv_mgmtifmedia_addahc_release_seepromrtw_rtl8255_tunefxp_eeprom_shiftinwe_probelxtphy_funcsi386_set_iopermar5k_ar5212_set_gpiopcdisplay_mapcharusbd_set_config_indexlogopenpcic_pci_machdep_intr_estluphy_serviceatw_write_bssidiha_wide_doneopti82c700_pci_icup4_model_isa_bus_dmamem_allocbreadndpt_shutdowntrm_cdpmap_tlb_shootdown_job_gettcp_hdrsztcbtableimaxlevel__xordi3nge_jfreefrag6_draindosdiremptyre_cardbus_powerhookigmp_slowtimoifpromiscrtl80x9_mediachangepcn_cdidleste_ifmedia_stssys_getsocknamecd9660_lookupvop_fsync_descep_mii_writeregwi_usb_intrusbd_alloc_buffermask_rnheadvga_40lscreen_monopcdisplay_putcharsi_headfxp_cardbus_setupufs_rootath_set_slot_timeray_media_statuspciaddr_searchtcp_sysctlVOP_SETATTRahd_set_sescb_qoffahd_flush_device_writesahc_alloc_scbsusbreadpmap_kremovesigactsinitcbb_pci_caohci_pci_causbd_set_reportahc_eisa_irqexec_elf32_fixupsk_init_xmacrt_newaddrmsgvop_generic_lockrtw_cardbus_cacomconsiotwb_ifmedia_updan_write_datauvmfault_anongetconsttyrtw_txdescs_resetvga_alloc_screenpcdisplay_copycolswdc_pcmcia_caunsetgateuvm_pagealloc_stratatw_rx_stateciss_raw_switchpmap_tmpunmap_pvepterl_startural_bbp_readfdcloseapm_err_translatepcscp_attachusermountvge_txeofext2fs_dirrewrite__ucmpdi2vn_closefiledc_eeprom_getword_xircomumass_discopci_findvendorip_mtudiscvfs_free_netcredpool_cache_do_invalidatemld6_start_listeningkue_matchpmap_kenter_papidhashtblaue_matchusbd_get_protocolle_isa_probeiop_status_gettcp_drain_bpamierrsea_get_scbtrm_RewaitSRBiha_status_msgm_pullupenterpgrpwdc_pcmcia_lookupMPFailisp_resetwsemul_vt100_output_string_esccnbellm_copydataXhold_legacy11intrhandumass_atapiscsi_devpcic_chip_mem_allocwdc_atapi_timer_handlerwsscreen_attach_syncray_ioctlral_cardbus_enablecd_setchanuvm_cnt_headcpu_camtx_leavefilt_signalsigactsfreewdc_default_write_raw_multi_4ttymallocar5k_ar5211_set_gpio_outputciss_errorahd_set_sdscb_qoffpckbc_cdupl_attachwsdisplaykqfilterkue_setmultipcisubmatchegioctlmmioctlumass_matchsendsigohci_device_ctrl_methodspcdisplay_emulopsbpf_ifnameehci_allocmohci_cdural_ioctlxe_initvfs_busyfilt_ufsdetachiha_state_3sis85c503_set_intrlf_getlockar5k_ar5111_rfregsieresetsolistenami_switchray_detachwskbd_compose_valuertw_join_bssAscInitFromEEPpciide_dmactl_readip_ecn_ingressmsdosfs_bmapfifo_bmaprip_ctloutputffs_vtblif_getgroupciss_pci_capcn_copy_smallem_set_promiscuserconf_morekqueue_ioctlath_calcrxfilterec_cddc_mii_writeregem_free_pci_resourcessys_wait4rip6_recvspaceamap_share_protectusb_all_tasksfs_sysctltl_mii_syncukbd_cnattachieee80211_ibss_mergexe_pcmcia_activatewe_paramsfilt_sordetachrtw_chan2txpowerpsignalwsdisplay_console_confieee80211_regdomain_compare_cnconfig_pending_incrsys_osigaltstackusb_task_threadahc_execute_scbaic_pcmcia_caepic_pci_devicesisa_intr_checkxmphy_servicesmc91cxx_startti_newbuf_jumbopcn_initamap_pp_establishwb_rxeocvr_list_tx_inituvm_anon_initffs_reclaimbmtphy_causb_free_deviceAdwReadEEPWordpmap_zero_physif_link_state_changempt_read_config_info_raidpmap_virtual_spaceahd_attachamd756_set_triggerusb_disconnect_portsis_txeofbpfpollnumemptybufsupdatepriohci_activatempt_do_uploadahc_timeoutciphy_fixupAdwInitCarriersbmtphy_serviceuhci_device_bulk_closertw_txdesc_blk_resetwskbd_cnbellipendingaic_dataout_pioapm_errorvt100_decmodexmphy_statusuhci_intr1pciide_print_channelsahd_donewi_seekfilt_soreadmpt_get_iocfactszeropageipsec_def_encpool_logsizegdt_pollingle_isa_intredgeip4_input6pdevinit__iordi3le_isa_wrcsrnsphytermatchinetctlerrmapffs_specop_opv_descresetprioritympt_read_cfg_pageenoioctlar5k_ar5212_get_regdomainahd_construct_sdtrwi_usb_start_threadudf_mountar5k_ar5212_stop_rx_dmaar5k_ar5211_set_keyioprbs_devsigacts_poolXosyscall_endexecsigsconfig_initrtw_rtl8255_pwrstaterl_ifmedia_updbios_pciinfoicmp6_redirect_inputiha_push_pend_scbpckbc_set_pollaue_read_macpciaddr_print_devidnpxinitar5k_ar5211_stop_tx_dmadc_ifmedia_updst_interpret_senseepresettl_startpmap_tmpmap_pascsistrategynd6_ra_inputin6addr_loopbackttypendvprintar5k_ar5211_query_pspoll_supportin6addr_linklocal_allroutersqsphymatchin_revarpinputstrlcpyxe_mediastatusudf_UncompressUnicodeByteieee80211_wep_cryptdc_setfiltdpt_cdbge_miibus_statchgehci_device_isoc_methodsar5k_ar5211_get_power_modegdtminphysusbd_reload_device_descext2fs_advlockknote_fdcloseefcompletecmdvop_lease_descehci_device_intr_donexl_setmulti_hashif_clone_detachpipe_rfiltopsahd_get_scbptrahd_currently_packetizedcomcninitimaskin6_cksumath_initahd_dump_sglistpciide_print_modesrtw_max2820_pwrstatestrncmpvfs_opv_numopsar5k_ar5212_get_isrXstray_legacy8vfs_shutdowngetsocknge_capccbb_pcmcia_card_detectpccbb_pcmcia_intr_stringiop_intrupl_startin_interfacespcn_casyn_cache_respondnatsem6x86_cpu_setupllinfo_nd6uvm_iosbcheckreservepreemptieee80211_begin_scanunixdomainral_ack_rateuha_timeoutahd_resetwscngetcuvm_tree_RB_REMOVEsis_startscsibusattachbios_diskinfoetheripstatral_set_rxantennasyn_hash1xl_list_rx_initulminral_get_rtswihap_data_inputahd_set_widthproc0paddrrn_addmaskar5k_eeprom_bin2freqali1543_set_intraha_queue_ccbtrm_linkSRBray_ccs_donepciaddr_do_resource_reserveudf_quotactlahc_resumeusb_attachbpf_bufsizeselscanahc_pci_capciide_promise_productssoo_pollath_gpio_attachsmc91cxx_stop_randseedeg_cdepic_pci_attachsig_filtopsohci_device_bulk_transferukbd_cdwskbdopenem_startttclosurl_rxeofipsec_soft_allocationsepic_pci_ca_bus_dmamem_mapst_mount_tapenet_sysctlar5k_ar5211_set_beacon_timers_vga_scrlist_monortw_grf5101_host_cryptwskbd_do_ioctldead_ioctlec_mediachangefill_eprocpdq_interruptaue_initusb_match__wdccommand_starthme_newbufsysctl_iflistrl_watchdogep_read_eepromtxp_command2AdwSendIdleCmdvwakeupcmd680_channel_mapar5k_ar5212_get_keycache_sizebha_pci_caXhold_legacy7pci_subclass_bridgeif_clonersahd_validate_offsetwdcbit_bucketvgonewdc_probe_capstcp6_ctlinputusb_allocmemar5k_ar5211_set_mcast_filterufsspec_closene2000devsnd6_prefix_offlinkuvm_anon_dropswapccd_need_kvmdl10019_mii_bitbang_readwi_detachigmp_inputvop_ioctl_vp_offsetskmemusagelf_getblockusbd_add_dev_eventec_probepciide_irqacksis_mii_writeregpmap_pmap_pooltcp_rttdfltcleanerprocisa_strayintrpdc202xx_pci_intrfifo_reclaimsbappendstreamm_tag_copy_chainusbd_intr_transfer_cbpiix_set_triggerfdformatahd_platform_intrxe_cduha_eisa_causb_event_threadee16_eeprom_outbitsisa_mem_headsowrite_filtopstl_ifmedia_stsstrncpymc146818_writerevarp_in_progressgdt_exec_ccbi386_cpuid_cpusbge_watchdogsdreadicmp6errratelimsys_opipeep_statchgste_mii_readregpcn_79c971_mediachangeupdatefatscue_memem_set_pci_express_master_disableata_perrorvfs_getvfsaue_txeofffs_sync_vnodencr53c9x_sensebge_free_rx_ring_stdahd_aic7901A_setupproc_stoppcic_pci_carrticks_initXhold_legacy0usbd_set_port_featuredelaycountpcibios_flagsbpfilter_createsysctl_lockax88190_mii_writeregtl_prodslockfpoolahc_set_tagsvga_console_vcieee80211_find_nodehtonluvm_km_kmemallocusb_find_descin6_mask2lenste_miibus_readregmrt6_ioctltcp_dooptionsdos2unixtimesys_sigactiondeupdatehci_ifcd_isa_bus_dmamem_freesoftintr__negdi2npxsave_cpuin6_purgeaddrcpu_modeluhci_softintratw_power_bpamiccbsii3114_read_regiop_msg_polluvm_tree_RB_FINDcttyreadcd9660_unlockisp_put_gxn_id_requestsis_eeprom_idlepciide_dmactl_writeuserconf_cmdsatw_txthresh_tab_hiural_taskwsdisplaycloseahc_tailqidle_exitiophy_statusschedclockbpfioctlconfig_attachohci_alloc_sitdcue_rx_list_initatw_detachem_get_hw_eeprom_semaphoredl10019_init_cardfxp_write_eepromahd_execute_scbep_pcmcia_enablesis_initbmtphy_statusrtw_check_phydelaynpx_cdray_reset_resetloopsysctl_filedisk_unbusysoisconnectedmpt_run_xferray_intramap_clean_worksti_handle_eventsuhci_alloc_std_chainusb_block_freememetherip_sysctlVOP_PATHCONFrtw_led_slowblinkumass_fixup_sonydk_mountrootrtw_max2820_initwsscreen_detach_syncsiop_script_syncgdt_sync_eventahb_cavattr_nullrw_enter_waitsys_getsockoptre_rxeofwds_findpdq_stopar5k_ar5212_fillciss_get_ccbahd_release_seepromuhidev_attachtwe_cdstge_copy_smallfrag6_nfragpacketsefstartvr_mii_writeregwildcardpcscp_cdtl_list_rx_initpckbc_consdatafxp_add_rfabufxl_encapray_send_authin6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlan_cdcpu_matchite_chip_mapVOP_READLINKumass_cbi_methodsufs_seekahc_chip_initnsphyter_funcsmii_submatchohci_root_intr_transferwsdisplay_unset_cons_kbdmsdosfs_pathconftimeout_wheelbpf_m_xhalfpdq_os_receive_pdupcic_wait_readybge_ifmedia_stsfdioctlaverunnablecd9660_getattrttyfreertw_io_enablemtd_cdcom_pcmcia_matchttysleepwi_pci_capmap_do_tlb_shootdownehci_root_intr_doneahd_handle_scsi_statusdp8390_initaic_devunp_disposerd_open_hookufs_getattrvfs_exportieee80211_mhz2ieeescsi_inquirepcic_submatchciss_switchbge_ioctliop_pci_attachdc_cardbus_caiha_minphysuvm_km_pgremoveramdisk_ndevsbiosattachex_region_plfscaleisapnp_unmap_readportccdmapahc_reset_channelpciintr_icu_lookupip_optcopyxe_pcmcia_camc146818_readpci_intr_mapvfs_registerieee80211_proto_attachsys_dupmcllowatmii_printbpfilterattachiop_systabAdwResetChipwb_cdisapnp_newdevrtw_cardbus_detachadw_asc38C1600_mcode_datatimeout_todopcic_event_threadwsemul_vt100_scrollupudf_checkexpahd_wait_seepromwdc_sii3114_vtblpanicrtw_sa2400_vcocal_startural_rxeofcue_rxeofciphy_resetmsdosfs_lockseltrueeisa_cawsdisplay_console_devicepci_subclass_systembpf_m_xwordepwatchdogahd_compile_devinfoti_rxeofsoftdep_initializexl_rxeofncvhashtblunp_shutdownwi_resetami_allocmemahd_qinfifo_requeue_tailahc_run_untagged_queueext2fs_sysctlcluster_callbackkthread_run_deferred_queuesmc91cxx_idstrsbha_free_ccbpcn_stopvop_lock_vp_offsetsar5k_ar5212_setup_rx_descar5k_ar5210_get_tsf64wdreadlastdaycheck_execwi_usb_cdtcp_initpcmcia_attachdeferred_config_queuedp8390_getmcafar5k_ar5210_set_mcast_filterindexisapnp_flattenciphy_funcsahc_platform_allocray_cmd_cancelem_wait_autonegipport_lastautoudf_unlockuhci_endpdwsmux_detach_scsis_setup_channelath_hal_probecom_raisedtrvge_rxeofcd9660_fifoop_entriesahc_unbusy_tclami_pci_matchbios_sysctlahb_initicsphy_statuswinSlotCntvn_kqfilterem_validate_mdi_settingext2fs_syncep_mii_readregvga_40lscreenudav_ioctldc_cardbus_attachpciide_intr_flagcache_purgevfsatw_cfp_initfxp_mdi_writeem_led_offpostsigsys_pathconfcue_open_pipesin_addmultigetmicrotimexmphy_cdmaxumass_clear_endpoint_stallnpxdna_s87vge_initohci_setup_isocaue_newbufbge_rxeofscsi_probedeviha_data_over_runmpt_print_event_noticetcp_templatemsdosfs_readam7990_zerobuf_contigahc_pollcomopenohci_initusbd_setup_xferisa_dmamem_mmapsata_setup_channelispdevahd_dump_all_cards_statepiix_chip_mapbcopyfxp_read_eepromurl_tick_taskef_mii_synccue_detachusbioctlle_isa_rdcsreftxstatAdwInquiryHandlingkqueue_wakeupepic_tickip6_unknown_opttcp_reasssys_getfhcomcnputcext2fs_vgetrt_timer_timerehci_alloc_sqtdral_free_rx_ringar5k_ar5212_setup_tx_queuepropswsemul_vt100_output_scs94ahb_scsi_cmdaxe_resetdefrouter_addreqin6_clearscopefifo_vnodeop_entriesmainbus_printusbd_set_addressar5k_ar5210_detect_card_presentne2000_readmemudav_openpipeshme_setladrfwb_ifmedia_stsffs_setblockipsec_expire_acquirekue_stopwsscreen_switchwaitiop_systab_setrtw_rtl8255_txpowermemcmpti_free_rx_ring_jumbowskbd_init_keymapudf_lockosb4_inittl_shutdownmsdosfs_createcd9660_startar5k_eeprom_initcomstartpmap_try_steal_pvpool_allocator_kmemcfroots_sizevge_miipoll_startpdq_ifstarttickadjsiop_clearfifoelattachbiosioctlvop_rmdir_vp_offsetsvga_isa_cnattachsbreservebtportsvrecycletrm_write_cmdcpu_brandstrahaattachem_phy_hw_resetieee80211_alloc_nodean_read_datareserve_dumppagescrcopyural_newstateray_update_params_doneste_miibus_statchgwdclosesys_revokeural_free_rx_listip6_setpktoptionssysctl_stringsys_rebootmpt_print_dbbufpooldl10019_mii_bitbang_writefdopenMCFailwdccommandextpcdisplay_cursor_initar5k_ar5210_do_calibrate_bus_dmamap_load_buffercpu_forkan_startdpt_scsi_cmdwi_write_data_ioahd_busy_tclcardslot_event_throwttylistwdopenuvm_vslockrtw_rtl8225_txpowerre_initxl_mii_send__bin2bcdahb_devttyoutputar5k_ar5211_set_lladdrkue_cacd9660_tstamp_conv17wskbd_calxtphy_statustqphy_cdwdc_atapi_intr_completeudf_lookupep_pcmcia_enable1pcmcia_scan_cisclockintruhci_root_intr_abortahc_pci_probern_mkfreelistath_bmiss_procahd_parse_vpddataahd_initvop_bwrite_descVOP_READath_tx_procin6ifa_ifpforlinklocalufs_ioctlffs_freefilelastdtimeAscFindSignaturesys_setuidcardslot_cd_wdc_ata_bio_startar5k_ar5211_is_key_validxl_setcfgioprbs_intrstart_updatesiop_common_attachudav_cdusbd_clear_port_featurepcic_pci_machdep_chip_intr_disestablishufs_quota_free_blocks2ath_intr1re_stopintrstraysenditisadma_dmamtl_ifmedia_updintel686_p4_cpu_setupioprbs_enqueuecluster_writernd_event_tailwb_miibus_readregmpt_scsi_statempt_send_ioc_initapm_dobusyuriopolluvm_setpagesizeehci_root_intr_closetcp_xmit_timerst_rewindin6_recoverscopevga_50lscreenem_mng_host_if_writensphy_servicecac_l0aue_tickvia82c586_get_triggerelprobetickmclpool_warnmsgscsi_preventmmclosenumfreepagescd9660_accessrtw_tsf_extendahc_search_untagged_queuesstge_mii_bitbang_readsk_xmac_hashffs_statfsuhci_shutdowniegetiha_msgout_sdtrwdcprobeiophy_cdudp_recvspacewdc_ioctl_strategyral_cardbus_detachvr_probear5k_ar5210_get_ack_timeoutudf_fhtovpefinitsyn_cache_unreachuserconf_histszsys_getrlimitbpf_attachdicmp6_ctloutputral_update_promiscahd_set_tagsufs_dirremovetrm_timeoutpci_bus_maxdevsrgephy_servicecinitif_attachsetuppipe_writevop_symlink_descatw_cmdr_initste_txeofin_pcblookup_listensbappendhme_stopm_copybacknextgennumberfxp_mc_setupapm_powmgt_enableiopcloseuvm_swap_puticmpbmcastechofifo_advlockevcnt_attachrtw_dmamap_load_txbufehci_timeouturio_activatebge_init_tx_ringsm_pcmcia_detachegattachconfig_scanwi_get_nwkeyisapnp_matchpccbb_pcmcia_socket_disablefdfinishsis_tickripsrciso_nchstatsre_attach_commonkue_txeofem_update_eeprom_checksumscsidebug_targetsnlineswohci_rem_edether_ifattachusbd_devinfo_allocfdcstatuswdsattach__wdccommand_donestge_mii_readregumass_adjust_transfersignal_initath_pci_shutdownnsphyter_servicesk_init_tx_ringffs_updatetrm_pci_cawsmuxclosedp8390_getar5k_ar5211_reset_keyrtw_pci_disableunix2dosfnahc_search_qinfifovga_screenlist_monospec_advlockmtdphy_cdsis_resetfragtblraw_sendspaceisp_copy_in_hdrnullopatw_disableam7990_meminitadw_scsi_cmdsis85c503_get_intrip6_ecn_ingressusb_discovercomdiagextralocpcic_isa_bus_width_probebcedebugsk_encapunsleepti_init_tx_ringmpt_req_statewb_watchdogwdprobeargdevatw_clear_sramsk_yukon_hashmtdphy_funcsohci_alloc_std_chainar5k_ar5212_stop_tx_dmapcic_chip_mem_mapegintrwi_pci_tmd_attachgetnanouptimeatw_ioctlipintrudav_activateohci_pci_detachuhci_pci_detachmaxdmapwi_pci_powerti_watchdogxl_watchdogalltrapsural_alloc_rx_listusb_block_allocmemwe_write_mbufext2fs_symlinkwi_pci_plx_print_cistxp_capabilitiesip6_savecontrolrtw_rf_destroypciide_chan_candisableXintrq_to_bar5k_ar5210_set_keyisa_mallocmountrootsyn_cache_resetuhci_device_intr_doneuhidev_openudf_vnodeop_entriesprocess_read_fpregsip_initreaddeohci_freexural_txtimebge_jalloccd9660_rrip_getnamegdt_switcheisa_intr_stringufs_check_exportsysctl_rdintpdc20268_setup_channelAPTDural_eeprom_readgdt_pcinew_release_eventAdwASC38C1600Cablinglodirtypagesem_probefindwin95VOP_WRITEsys_nanosleepre_rx_list_initstart_init_execahd_rem_col_listXrecurse_legacy11epic_pci_matchem_get_phy_cfg_donecardbus_attach_cardifa_ifwithaddrclock_ymdhms_to_secssiop_add_devuhci_root_intr_transferhme_mifinitif_clone_attachrtw_rtl8255_destroyaic_isapnp_casys_getfsstatohci_abort_xfermpt_get_requestbpfopencom_pcmcia_detachcdstrategyem_config_collision_distnatsemi_irqackahc_suspendsis_encapkmemstatsnd6_slowtimo_chuvm_km_valloc_alignath_node_getrssiahd_set_syncratenge_rxeofmntvnode_slockiop_msg_unmaprtw_rf_tuneadw_devstreadcomwriteVOP_RENAMErtw_detachar5k_ar5210_update_tx_triglevelXrsvdcdclosesys_fchdirar5k_ar5210_set_rx_signalrtcgetsysctl_ifqalleventsath_detachrandompidmpt_print_ioc_factswd_cdurl_initahd_reset_current_busfilt_ttyrdetacharp_inusewb_setmulti_bus_dmamap_destroyvn_polluhci_device_isoc_methodsinet6swrouteswdosdirtemplatemainbus_cdre_ioctlXhold_legacy13pcibiosprobeisa_dmacountsys_mincorene2000_test_memgdt_cdapm_power_printpdc203xx_setup_channeldc_tx_underrunlastsecondsahd_find_syncratexl_mii_writeregwi_get_txpowerural_plcp_signaludav_stopvga_getcharXdnausbd_error_strsusbd_sync_transferu24_pollaha_pollbrgphy_statuspcn_79c970_mediainitffs_vnodeop_entrieslun_switchamphymatchtcp_maxpersistidledc_pnic_rx_bug_warali1543_initisa_mappageudav_tx_list_initfdcprobespec_ioctlxe_pcmcia_detachbge_init_rx_ring_stdufs_initsync_vnodeop_entriesproc_reparentrtw_rtl8255_createar5k_ar5212_get_gpiorbus_space_alloc_subregionuvm_exitan_attachsis_cdfc_bmapcallspr_rmpageffs_initcluster_wbuildfd_nvtotypeprocess_xmm_to_s87sis_eeprom_getworduvm_initaue_attachieee80211_crypto_attachsys_ioctlsys_xfspioctlif_free_sadliha_state_6ieee80211_node_joinfilt_bpfrdetachar5k_ar5211_set_slot_timewsdisplay_emul_caudf_startst_loadquirksicmp6_initrtw_recv_mgmtfilt_ttywritepool_update_curpagesiop_script_readpcdisplay_cursorhid_end_parsevge_ioctlin_setsockaddrsmc91cxx_enableisaprintcy82c693_readrandom_statedpt_eisa_boardstl_softresetbpf_moveinpcscp_cawsemul_vt100_output_esc_spcostypevndbuf_poollastpidrtw_rxdesc_initXrecurse_legacy0uvm_page_physloadrtw_pwrstate0isa_dmamem_allocwdc_exec_xferwdcresetXhold_legacy6ray_start_join_timoipintrqohci_noopepintrwb_miibus_statchgar5k_ar5211_get_ack_timeoutccd_softcxl_detachahd_reinitialize_dataptrsppb_caatw_wcsr_initmaxprocusb_frag_freelistpmap_apte_fluship_slowtimordsizertw_rtl8225_createpcscp_dma_setupip6_nexthdrrtdeletemsg__bss_startapm_disconnectath_chan2flagsdcphy_cdahbattachdc_setfilt_xircomkue_rxeofisa_intr_disestablishpciide_via_productssiop_attachXstray_legacy14bge_stats_update_regsskc_probeVOP_KQFILTERstge_add_rxbufukphy_funcssys_msyncvop_rmdir_descrtw_sa2400_manrx_initahd_print_scban_cache_storewskbdreadsbappendrecordevcount_detachsd_capcmcia_function_disabletl_dio_setbitsoftdep_fsync_mountdevinitmsgbufehci_device_bulk_startan_alloc_nicmemvge_read_eeprompciide_intel_productsconfig_activatememsetar5k_ar5210_proc_tx_desciop_pci_matchpipe_free_kmemar5k_ar5211_get_cts_timeoutbge_compact_dma_runtti_chipinitufs_getlbnspmaps_lockohci_strahd_find_busy_tclphysiopcmcia_3cxem556_func0_cfe0mpt_pci_read_config_regshole_endin6_selecthlimupl_senduha_eisa_attachwdattachti_devicessmc91cxx_mediausbd_set_report_asyncapm_minvermii_phy_delete_mediaicmp_mtudisc_cloneread_seepromatw_rf_resetsodisconnectpool_allocator_oldnointrsys_setgroupsmainaue_csr_write_2asc_mcode_sizeral_set_macaddrlxtphy971_funcsdc_cardbus_devicesohci_device_bulk_donear5k_ar5211_start_rx_pcuusbd_initmtdphymatchdc_detachisp_attachiha_reset_scsi_buscardbus_mapreg_unmapmpt_read_config_info_iouahd_setup_iocell_workaroundiop_systab_sizevge_cange_miibus_writeregpmap_tlb_shootdownsiop_lookup_productip_flushrtw_sa2400_createkue_startioprbs_get_ccbdp8390_configre_watchdogahd_stitch_tid_listsiop_scsicmduvm_unmap_removeste_devicesfd_typesisa_drq_isfreegdt_pcinew_test_busyicmp_errorinpcb_pool_initalizedar5k_ar5210_fill_tx_descukbd_delayed_decodewsmuxdevsisapnp_caresume_pop_fsupl_rx_list_inituvm_swap_markbadkqueueopsmpt_write_cfg_pagevholdurio_detachpciide_map_compat_intrar5k_rfregs_opahd_set_nameahd_sent_msgahd_get_sense_bufwdc_atapi_in_data_phaseusbd_no_quirkre_read_eepromami_startar5k_ar5210_attachsis_hostbr_matchm_adjmld6_stop_listeningpmap_free_pv_doitppsratecheckscsi_free_xskmemlimitxl_pci_intr_ackahd_intr_enablepcic_intr_socketath_getmbufmpt_print_request_hdrXintrspuriouspcibios_print_exclirqtl_setfiltamap_copyeg_cauvm_rb_spacedevinrtw_sa2400_pwrstateami_scsi_raw_cmdahd_restore_modesuhci_allocmral_next_scanieee80211_ieee2mhzrl_miibus_readregan_initahd_get_sescb_qoffste_newbufieee80211_dup_bssre_cardbus_setupahaintrlf_findoverlapaic_minphysgdt_devaic_get_acbovbcopywscninitlf_wakelockef_isapnp_cakue_attachhookdumpconfwi_rxeof_isa_dma_free_bouncebufehci_pci_detachbrgphy_cahpt_pci_intrfilt_rndwdetachwsdisplay_cons_kbd_pollcsk_attachdead_badoppciide_dma_finishcalcrusys_unlinkrt_setgateahc_find_syncratevr_setmultitcp_ack_on_pushpmap_growkernelext2fs_rmdirsysctl_intupl_tx_list_initkqueue_closewsdisplaystopatw_intrstrlcatifnet_addrssysctl_int_arrtrm_minphysaic_show_scsi_cmdar5k_ar5210_get_cts_timeoutcdce_matchXstray_legacy0comhwiflowdisk_unlockep_roadrunner_mii_enablepciide_cypress_productsufs_ihashremiha_mainti_encap_tigon2cttywritear5k_ar5210_eeprom_is_busy_bus_dmamap_createurl_stop_taskatw_cardbus_devicespciaddr_device_is_agpsdmatchusb_freememudav_txeofccdopenproc0cdce_initvga_pci_matchufs_renameaxe_caext2gennumberar5k_ar5211_get_slot_timeudav_attachAdwSleepMilliSecondsk_resetrtw_rxbufs_releaseusbd_get_hid_descriptorrt_ifannouncemsgsoo_readrtw_swring_setupar5k_ar5210_set_slot_timene_isa_matchpciide_vendorsufs_openehci_pcd_enablepcscp_dma_intrm_catsplxahd_pauseaha_timeoutohci_pci_attachrtinitncr53c9x_variant_namestqphy_statuscluster_collectbufsepbusyeepromsiop_handle_qtag_rejectwi_write_data_usbumass_scsi_minphyssis_probeuvm_swap_initosb4_get_intrpccbb_winsettcp_nowttystatsaue_miibus_statchgbus_space_subregionural_bbp_initunp_gcsys_clock_gettimeiha_mark_busy_scbaic_platform_scb_freeip6_hdrnestlimitpool_catchuppckbd_inputfrag6_initsiop_sdtr_negahc_attachbuf_replacevnodemsdosfs_vnodeop_opv_descadw_async_callbacklba2msfbge_miibus_readregre_miibus_readregtimeout_setgdt_pci_caisapnp_initrdread__subdi3wb_shutdownwsdisplay_resetisa_has_been_seenntohsxl_cardbus_intr_ackmsgbuf_putcharmpt_soft_resetxe_mdi_write_bus_dmamem_freeiha_set_ssiginet_ntoange_shutdownsd_flushcd_setvolext2fs_mkdirohci_openext2fs_direntermii_pollstatrlphy_cawdgetdisklabelrtw_rtl8225_tunepciide_machdep_compat_intr_disestablishst_erasedupfdopenfxp_scb_waitifmedia_list_addpidhashvfs_mountrootar5k_ar5210_noise_flooref_mii_writebrtw_macbangbits_timeoutpcn_add_rxbufuvm_totaliop_msg_postencdebugath_ioctlahc_pause_and_flushworktimedl10019_mii_bitbang_opsbha_pci_devicesvia82c586_get_intrpcic_isa_chip_intr_establishstart_initelf32_olf_check_headeruhub_attachami_pci_attachtcp_mssdfltar5k_ar5211_set_gpio_intruvm_swap_freetcp_rndiss_sboxti_init2wdc_atapi_update_statusudf_hashlookuppccbb_pcmcia_io_mapioprbs_exec_ccbtwe_disposeXdbgaxe_initem_init_lockedrnd_wseluhidev_set_reportstge_stopvr_setcfgin_pcbdetachmsdosfs_vfsopsaue_ifmedia_updcd_sizettycheckoutqiha_scsi_cmdicmp6_mtudisc_callback_registerne_pcmcia_detachohci_cardbus_attachrcc_bus_visitedaue_caciss_pci_attachrnd_event_spaceiop_config_interruptsahd_inl_scbramrt_getmetricsbge_free_rx_ring_jumbowdc_ata_bio_kill_xferin6_ifdetachcn_tabbge_jfreewdc_atapi_intr_commandip_forwardar5k_ar5210_start_rx_pcuti_stats_updatepcn_spndextent_createrdclosexl_stats_updatebpf_freeddisklistsys_fstatfscac_intrec_mediastatusurl_txeofkue_devsbge_stop_blockbge_lookup_revpccbb_pcmcia_mem_unmapm_injectmpt_rd_intrar5k_ar5211_stop_rx_dmaudav_setmultiem_mta_setvr_rxeofpci_make_tagar5k_ar5211_put_rx_bufahd_reset_pollXdivpci_intr_fixupnd6_setdefaultifaceffs_isfreeblockccdioctlnge_miibus_readreguvm_map_lookup_entryhztoadw_init_ccbicsphymatchvop_pathconf_descahd_aic7902_setupm_pullup2ar5k_ar5211_setup_rx_desceisa_intr_establishdead_strategypciide_dmacmd_readahc_free_scbwds_doneprocfs_domemahd_detachstge_tickspec_fsync__wdcwait_resetdc_cdip6_optlenpckbc_cmdresponsear5k_ar5212_set_associdahbmatchuvm_map_deallocateicmp_reflectaic_initelgetmii_phy_activatepmap_write_protectext2fs_reclaimtwe_cmdisapnp_get_resourceahb_send_mboxpciide_acer_productsffs_ballocsys_getgroupsurio_cdieee80211_node_attachuhub_cdaha_cmduvm_km_pages_freewi_start_usbip6_raw_ctloutputsoftdep_setup_allocdirectkernel_textpcic_attachpcscp_dma_stopufs_startar5k_ar5210_calibrateahd_attach_to_HostRAID_controllersray_update_subcmdxmphy_probebrgphy_mii_phy_autoohci_devdath_rxorn_procmpt_wait_db_ackAdwInitFromEEPROMbha_isa_probepccbb_shutdownkinfo_vdebugurl_sendcdce_encapnsphy_resetuvm_rb_insertufs_bmaparrayfragtbl8wscnpollcuvn_sync_locksysctl_initXbptpcmcia_function_enablerbus_new_root_shareciss_scsi_raw_cmdXrecursepcdisplay_accessopsrtw_txdescs_syncurl_resetwdc_get_logusb_needs_exploreufs_quota_alloc_blocks2fc_fileextendsdc_read_eepromvr_txeoffilt_sigattachre_startVOP_FSYNCffs_sysctlipport_hilastautoarpinit_donespec_closecd9660_closeem_initialize_receive_unitsys_shutdowncngetcam7990_resetpckbdattachehci_rem_qhral_rssadapt_updatestatsrtw_txsofts_releasedc_delaypcn_matchrnd_statesahd_extract_mode_stateahd_find_softcsm_pcmcia_lannid_ciscallbackseaintrm_gethdrar5k_ar5211_reset_beaconem_dma_mallocpdq_pci_matchconfig_rootfound_isa_bus_dmamap_load_rawmpt_hard_resetcue_cdputcar5k_ar5212_update_mib_counterssiop_resetsii3114_mapreg_dmamtd_intrsysctl_rdstructuhidev_cdtrapumass_scsi_devfdintrem_config_fc_after_link_upschedcpupckbc_isa_caopti82c558_get_triggerec_init_cardtprintf_closevga_stdscreen_monowds_scsi_cmdpccbb_close_winsbappendcontrolnge_ifmedia_tbi_stsukbd_set_ledswsdisplay_screenstateem_get_cable_lengthfddi_inputsiop_update_scntl3atw_cardbus_powerpciide_nvidia_productssoftdep_flushfilessea_free_scbipv4_inputm_getclrpool_headrtw_max2820_tuneepic_rxdrainfix_f00fax88190_mediastatusncr53c9x_watchnge_delaywsmuxioctlar5k_rfregs_gain_adjustwdc_atapi_send_cmdncr53c9x_msginahd_flush_qoutfifousbd_interface2device_handlewinchip_cpu_setupipforwardingohci_device_isoc_transferusbd_open_pipe_ivalbufhashtblsyn_cache_lookuparc4random_stateprtactivepcic_intrcac_eisa_l0_intr_pendingksym_upcaseufs_makeinodeatw_bbp_io_enablear5k_rfregsadw_isr_callbackahd_unpauseip6_process_hopoptsufsfifo_readusbd_find_edescbge_probeath_newstatetwe_completewsdisplay_set_cons_kbdcom_common_putcfifo_writefilt_ttyreadsys_getpgiduhci_runldtcache_lookupwb_eeprom_getwordem_get_auto_rd_donerdioctluhci_allocxrtw_bbp_writein6_purgeifar5k_ar5210_get_rx_filterle_cdurl_detachumass_scsi_sense_cbrtw_cardbus_matchdp8390_intrwsemul_vt100_handle_dcsin6_ifawithifpieee80211_recv_mgmttrm_GetFreeSRBncr53c9x_doneaxe_detachwskbd_set_console_displayahd_pci_split_intrdumpsizeccdstrategyar5k_eeprom_read_antstrm_wait_30usukbd_keydesctabnge_miibus_statchgpci_matchbyidrtw_host_rfioextent_freeuvm_aiodone_daemonar5k_ar5210_get_rx_bufusb_cookie_nopdq_pci_attachaddupc_tasksched_syncahc_handle_brkadrintusbd_clear_hub_featureieprobesc_err1comclosecac_ccb_freepcmcia_print_cisem_clear_vftartw_intr_ioerrorar5k_ar5211_update_mib_counterssetsigvecatw_write_wepsys_sendmsgan_promiscvn_marktextami_donestrcmpmpt_whovr_ticksys_quotactlral_bbp_writeuhidev_matchvop_close_vp_offsetsep_vortex_mediarndread_filtopsrl_mii_sendisp_asyncaic_reselectep_isapnp_attachsis_mii_sendtcp_mtudisc_increaseulmaxciss_donein6_pcbconnectdehashan_watchdogkue_cdluphy_caXrecurse_legacy3out_fdchook_disestablishexphy_funcsbpf_catchpacketapmerrorsffs_isblockar5k_ar5211_set_ledstateiha_reset_chipusbd_find_quirkuvm_aobj_poolpci_caqsphy_funcscpu_apmhalticmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrpcibattachrtable_initdp8390_detachata_set_moderal_startvop_access_descmii_phy_auto_timeoutsyn_cache_getnetisrttyrubnpxattachrevarpwhoamivop_generic_islockedieee80211_get_ratewsemul_vt100_output_stringwsscreen_attachbufcachepercentm_pulldownar5k_ar5212_proc_rx_descioprbs_scsi_cmdrtw_grf5101_mac_cryptath_shutdownan_seekacer_pci_intrahd_num_pci_devspmap_initufs_rmdirrlphymatchieee80211_next_scanminuhci_device_ctrl_abortfxp_initidtisapnp_configureip6_initconfig_detach_childrenrawcbukbd_cngetcahb_ecb_phys_kvpdc203xx_write_regtcpcb_poolti_init_rx_ring_minimii_bitbang_readregvga_selectfontrtw_rf_txpowerudf_openrtw_anaparm_enableaha_scsi_cmdipip_allowsys_polluvm_map_clip_endufs_makedirentryar5k_ar5210_enable_pspollusbd_set_configfindcpuspeedem_write_eeprom_eewrrl_list_tx_initfpa_cdem_write_pci_cfgegrecvvnode_hold_listar5k_ar5212_radio_revisionlastdosdateahc_intr_enablesk_alloc_jumbo_memste_waitudav_unlock_miiuhci_add_bulkral_cdufs_linksys_mkfifoapm_idle_calledifa_ifwithafaha_initiha_msgout_wdtrami_quartz_pollisa_cdural_read_eeprompcmcia_parse_cis_tupleapmattachin6_leavegroupsqphy_caiminem_reset_hwsddumpsys_chflagssdstartef_isapnp_matchieee80211_media_initvt100_outputuvm_km_putpageral_eeprom_readray_cdsk_jallocext2fs_vnodeop_path_draintxqusbd_get_port_statusuvm_pageoutrtw_txsoft_blk_setup_allncr53c9x_timeoutray_enablepffindtypepdevnamespci_subclass_dockiop_ictxhashtblqsyncwi_setmultire_gmii_writeregfifo_opencd9660_vptofhath_intrwi_attachusb_camii_phy_downuvmspace_forkraw_initknote_enqueueudpcksumtcp_sendspaceiha_msgout_rejecturl_csr_write_4dl10019_mii_writeregisp_startpci_mode_detectffs_oldfscompatwdcdetachmaxlocksperuidath_newassocin6_matchlensys_madvisepcic_chip_socket_enableatw_ifs_initmpt_get_portfactspcdisplay_copyrowsupl_openpipeselink_resetbge_attachehci_device_ctrl_methodsmtd_pci_cadpt_pci_casmc91cxx_disableahd_sg_setupscsibusdetachdisk_attachwskbd_displayioctlgdt_lock_storencpuspccbb_pcmcia_io_freearptfreeipq_lockedatw_txlmt_initcom_detachwds_get_bufath_getchannelsfifo_vnodeop_pvop_write_descep_isa_probemediaaxe_stopvop_read_vp_offsetsural_set_macaddrdead_printsk_vpd_readmpt_prtem_enable_mng_pass_thrueephy_serviceinphy_servicemii_media_tableatw_add_rxbufdpt_init_ccbpcic_init_socketst_pcic_readwdstrategytcp_rndiss_encryptti_cdxl_cdpmap_tmpmap_pveptettyprintfccdinterleaveaha_start_ccbscb_chipsetsigcodear5k_ar5210_set_gpio_intrhpt_chip_mapipip_inputem_adapter_listwds_devcomttybge_capcibmatchne2000_detectbuf_undirtysysctl_tstringti_setmultiintel686_cpu_nameudf_unicode_cksumxl_setmultiusbd_start_nextfilt_ttywdetachgdt_clear_eventsbootargpuvm_tree_RB_INSERT_COLORpool_allocator_nointrvop_unlock_descepic_stopsys_sysarchar5k_ar5211_nic_resetsk_xmac_miibus_statchggdt_pci_test_busyigmp_initxe_full_resetahb_get_ecbfdtimeoutmii_phy_add_mediaatw_rf3000_tunefxp_bundle_maxvga_free_screenbha_ccb_phys_kvputphysbufath_fatal_procpdq_pci_ifintrvop_remove_vp_offsetsMD5Initvga_isa_attachtrm_resetqsXrecurse_legacy12ath_pci_attachffs_vfsopssysctl_mallocwihap_ioctlieee80211_outputar5k_ar5210_eeprom_writeusb_dev_openfrag6_slowtimouvm_map_hintahd_handle_msg_rejectahc_num_pci_devsphtree_SPLAY_REMOVExl_miibus_statchgmsdosfs_mkdiruhci_free_sqhieee80211_ioctlkthread_create_deferredahc_run_untagged_queuesuhidevsubmatchefwatchdogne_isa_caral_watchdogscsidebug_busesscsibusactivatecomcnpollcnd6_timertcp_do_ecncpu_waitray_free_ccsvop_open_descami_quartz_donetwe_switchahd_softc_compec_set_mediaqsphy_servicepckbd_accessopsahd_pci_ca__cmpdi2cd_patternsraw_detachpcn_startural_read_multiXhold_legacy10domainnamelenehci_pollacard_pci_intrpciattachiop_configure_devicespmap_alloc_pvusbd_get_report_descriptorpcibios_print_pir_tableip_rtaddrfiledesc_initload_dsaie_find_mem_sizetag_switchvgaconsoleurl_ifmedia_statusudf_initcue_csr_read_1vrelewi_set_pmwsmux_do_displayioctlohci_alloc_sedem_set_media_typeem_update_link_statusprtrealloccheck_consoleapm_record_eventamap_freein6_domifattachwsdisplay_cnputcwdc_atapi_reset_2ray_issue_cmdar5k_ar5211_calibrateswreadidle_loopusb_blk_nfreend6_prefix_lookupuhci_device_ctrl_methodsrl_stopan_pcmcia_detachcddonesync_inactiveath_beacon_procwb_newbufspec_printtxp_devicestl_setmultilocleanpagesarc4_stirext2fs_lookupmsdosfs_openehci_hubdwscnputcext2fs_linkvop_generic_revokeohci_hash_add_itdcpu_switchiop_ofifo_initviac3_rndfifo_printar5k_ar5212_get_capabilitiesusbd_get_buffervia8231_getclinkieee80211_decapfilt_sigdetachtcp_do_sackext2fs_renameipsec_def_authmii_activateuhci_add_loopusbd_setup_isoc_xferttywflushcd9660_rrip_offsetrtw_initurl_startali1543_get_intrhmeattach_pciar5k_ar5210_get_capabilitiesar5k_ar5210_stop_pcu_recvwskbd_default_keyrepeat_datacomioctlclosefvop_rename_descral_bbp_readar5k_ar5210_is_key_validumass_cbi_resetsoftdep_sync_metadatapmap_releaseif_clone_lookupgetmicrouptimeudf_vnodeop_pmii_tickpcic_vendorwds_timeoutip6_dad_countem_pci_clear_mwippbmatchuvm_pager_dropclusterfilt_generic_detachral_setup_tx_descnge_list_rx_initrtw_establish_hooksahd_suspendadv_pci_attachtss_allocehci_intrlist_timeoutexec_aout_prep_omagicmpt_send_handshake_cmdpcmcia_card_deactivateiha_cdwi_pcmcia_matchintrmaskcd_get_parmspmap_extractpckbc_is_consoleray_alloc_ccsnd6_ifptomacti_ifmedia_updamap_unaddxl_ifmedia_updural_watchdogrl_miibus_statchgcd9660_printohci_rhsc_enabledc_tickif_congestionnfilestrm_MsgInPhase0epstatusrtw_cardbus_setupaha_collect_mbocd9660_islocked__bcd2bintss_freeatapi_printin6if_do_daduhci_root_ctrl_transferbge_writemem_indrevarpwhoareweahd_initialize_hscbsisadma_cdcue_txeofaue_detachpipe_kqfilternforce_pci_intrext2fs_opentxp_tx_reclaimsoftdep_setup_directory_addusb_insert_transferPTDpdeaxe_matchahd_set_active_fifopcic_isa_intr_listcpu_f00f_bugmsdosfs_vnodeop_entriesukbd_keymapdatafxp_mediachangest_mode_sensestopprofclocknullioctlukbd_is_consolear5k_ar5110_chan2athchanisohashvge_stopncr53c9x_schedsk_marv_miibus_writeregre_eeprom_getwordaic_dump6360wi_set_debugpcic_isa_addrsea_abortiexmitbreadosb4_getclinkem_intrdc_miibus_writeregamap_lookupsea_send_scbne_pci_lookupipctl_varsxe_startre_cardbus_devicesapollo_setup_channelpmap_page_removert_timer_remove_allwskbddevprinttxp_rsp_fixuprtw_rfprog_fallbackpckbc_console_attachedahb_cdwdc_output_bytesvga_isa_caisadma_caisapnp_mapegstartdc_coalaic_timeoutapmprobesoftdep_setup_allocindir_pagewsdisplay_closescreenatw_initieee80211_media_statusiophy_caem_read_reg_iotcp_usrreqgdt_get_ccbar5k_ar5211_start_rxnge_cdsd_interpret_senseudp_usrreqar5k_ar5210_eeprom_readifmedia_initstge_ioctlext2fs_vfsopsti_init_rx_ring_stdext2fs_inactivedead_bmapif_getgroupmemberssoo_kqfilterne_pcmcia_disablefifo_pathconfcpu_startupwsemul_vt100_output_dcs_dollaramap_refehci_device_bulk_transferuhci_device_isoc_transferfilt_fifordetachahd_verify_vpd_cksumwdc_ioctlapm_suspendsamphyattachfilt_fiforeadtrm_initAdapterfdexpandtickssrandomwdc_ata_presentpiix_set_intrisapnp_print_pintl_probepdc20262_dma_finishmsdosfs_closewdc_isapnp_attachhme_eintext2fs_setattrapm_resumesysctl_clockratevn_rdwrohci_close_pipend6_need_cacherl_mii_syncsea_cdip6intrurl_setmultiusbd_get_device_descre_setmultirw_exit_waiterswdc_default_write_raw_multi_2isa_dmamem_unmapiha_append_done_scbcac_l0_intr_enableXstray_legacy2wdc_isapnp_matchuvm_pagedeactivatetxp_show_descriptorvop_write_vp_offsetsar5k_ar5211_release_tx_queuear5k_ar5210_release_tx_queuecy82c693_initahd_update_pending_scbsufs_unlockep_pcmcia_activatetcp_ctloutputopti82c558_set_intrccdbufplahb_free_ecbsk_jfreemono_timeukphy_statusMD5Updateblktochrvop_create_descar5k_ar5211_set_regdomainifmedia_setpcscp_dma_isactivepcmcia_function_initem_setup_interfacetrm_eepromBufpmap_createuvm_map_extractar5k_ar5210_get_tsf32ahc_adapter_req_set_xfer_moderbus_space_freeioprbs_copy_internal_datand6_prelist_addar5k_ar5210_put_rx_bufvia8231_set_intrufs_removertw_maxim_pwrstatepci_intr_disestablishiopopenboottimecd9660_readlinkar5k_ar5212_set_rx_filteramd756_get_triggerwsdisplay_set_console_kbdVOP_ADVLOCKaxe_watchdogwskbd_mux_closesk_rxeofwdc_atapi_intrpmap_exec_accountxl_rx_resyncfrag6_inputuhci_device_intr_closetrm_SetXferParamsunpst_sendspacebus_space_mapwsemul_vt100_output_escsis_mii_syncieee80211_add_ratestcp_rscaleuvmspace_freettwakeupatw_cardbus_matchpmap_change_attrscissminphysswbufffs_ino_poolti_txeof_tigon2ahd_handle_lqiphase_errormii_phy_statusmsgwsdisplay_internal_ioctlpdc203xx_irqackVOP_PRINTfdsharewdsprobepci_subclass_memoryahd_handle_transmission_errorbuficmpv6ctl_varsef_miibus_statchgcdstartioprbs_internal_cache_cmdfilt_generic_readwriteuserconf_disablecnvmemgdt_countspechash_slockusb_detachehci_cardbus_matchehci_cardbus_detachpckbc_isa_attachipforward_rtuhci_device_intr_startwds_cmdohci_device_isoc_closeurl_int_miibus_writereguhidev_activatevt100_ansimodepcdisplay_cddc_setfilt_21143ahc_probe_scbssys_nosysar5k_ar5211_set_mcast_filterindexadw_print_infoat_pollallproccdevswbha_dequeuepccbb_pcmcia_intr_establishne2000_attachrl_attachtxp_alloc_ringssys_mlockallar5k_register_timeoutwskbdcloseuvm_sysctladw_alloc_controlsnge_initsk_setfiltpmap_map_ptesgetsnepstop_bus_dmamem_unmapdisksortsys_fchflagsnamei_poolpckbd_ioctlrt_timer_countuhci_device_intr_transferpowerhook_disestablishvga_loadcharshme_rintpiix_get_intrukphymatchuvm_pager_putohci_device_bulk_abortmpt_ioc_eventtxp_chip_initath_outdoorudav_caip6_ecn_egressin_canforwardrtw_rf_hostwritear5k_ar5211_setup_tx_descmpt_dump_sglwsdisplay_shutdownhookndumpmemrl_ifmedia_stsefsetmultiohci_device_intr_abortwi_pcmcia_attachpmap_destroyscsi_mode_selecthme_mediachangepowerhook_listar5k_ar5212_get_rf_gainetherbroadcastaddram7990_configieee80211_rssadapt_updatestatsfdcpseudointrie_drop_packet_buffersii3114_chip_mapieee80211_lookup_nodevfs_getnewfsidaue_rxeofem_cdsis85c503_pci_icuu14_findudp6_ctlinputitimerroundudf_vptofhee16_eeprom_clockisadmamatchami_quartz_initscsi_print_sensewskbd_update_layouttl_mii_sendmmopenffs_inode_freeohci_device_intr_transferwdc_cdukbd_intramphy_statusrtioctlan_media_statuskue_ctlpdq_flush_transmittersk_cdefresetrl_rxeofeptxstatprofprocswdc_free_xferfxp_cardbus_matchtl_calchaship6_inputar5k_ar5212_proc_tx_descicsphy_cdwi_usb_cmdresppagemoveroute_srcvge_miipoll_stopvr_resetspeedup_syncerigmp_sendpktAscAbortCCBwb_inittxp_responseloop_clone_destroyahd_complete_scbpccbb_powerhookwdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcm_getptrukbd_caufsvnode_filtopsccdmakedisklabelahd_abort_scbsreadbuffersral_ioctlar5k_eeprom_read_modesuvm_fault_unwireuserconf_common_attr_valuhci_add_ls_ctrlopti82c700_get_triggersis_reverseext2fs_vnodeop_entriessys_getitimerar5k_htoclockhid_get_datadonicewdcstartpci_intr_header_fixupudf_allocvfxp_statchgetherip_inputcpu_configurei8254_initclocksip6_freemoptionssqphy_funcsbge_read_eepromieee80211_end_scanudf_synccdce_txeofne_pcmcia_matchwsdisplay_common_attachpool_page_alloc_oldnointrdcphy_servicern_refineswdsprintsockargswsdisplay_getactivescreenhpt_setup_channelvop_generic_abortopisapnp_testconfigstattachpmap_copy_pagesetregsar5k_ar5212_attachtrm_FinishSRBsk_intr_bcomahd_handle_pkt_busfreeXrecurse_legacy6rtw_node_allocepsetmediael_caupl_rxeofusbread_filtopsvge_resetsobindvmcmd_map_zeroadw_create_ccbsvfsinitarcbroadcastaddrupl_caAdwLoadMCodecnclosefxp_pci_matchdev_rawpartpcic_isa_alloc_iosizesddonetcp_do_rfc1323ip_fragsral_detachar5k_ar5212_is_key_validfilt_fifowdetachar5k_ar5210_get_gpioar5k_ar5210_set_gpio_outputwdc_dmawaitmii_phy_setmedialo0ifphostiduha_doneopti82c700_addregreadtl_dio_clrbit16wi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutpcn_intripqmaxlenepic_cdXhold_legacy2AdwASC38C0800Cablingext2fs_vptofhep_isa_probevge_watchdogsk_starttxp_probertw_txsoft_blk_init_allip_maxqueuesysctl_ttyste_probeieee80211_chan2ieeeuhub_cain_socktrimatw_node_allocar5k_radar_alertrl_miibus_writeregrtallocsys_mprotectaic_isapnp_matchmsdosfs_reallocblksvop_readlink_vp_offsetsuhci_alloc_sqhwi_pcmcia_capmap_zero_pagedequeue_randomnessar5k_ar5212_tx_startar5k_ar5211_eeprom_readdpt_initurioioctlcue_caisapnp_findsyncer_maxdelayxl_cardbus_cawsdisplay_getscreenpcdisplay_cnattachdeadprocdc_mii_sync_isa_bus_dmamap_createstart_reaperehci_root_ctrl_methodsath_stoprecvuvmspace_unsharesys_fcntlisp_prtohci_cardbus_matchnforce_setup_channelvfs_free_addrlistsys_setrlimitsys_sigpendingwds_switchloop_clone_createem_hash_mc_addruvm_map_cleanicmp_redirtimeoutccdiodonehme_configttyclosepool_allocator_drainciss_scsi_ioctladw_free_ccbral_beacon_expirewdrestartdisk_resetstatxe_ether_ioctlahd_actionicmp6_nodeinfomaxvfsconftimeout_addcpu_cdep_pcmcia_disable1pcscp_dma_isintrip6_forwardnumcachempt_event_notify_replyural_write_multicmd0643_9_setup_channelrtw_led_attachcpu_initclockscue_sendwskbdioctlrtw_rxdesc_init_allmii_downkinfo_vgetfailedbrelseext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miipccbb_pcmcia_mem_allocahd_setup_datawsdisplay_switch3ttyoutuvm_map_pehci_device_requestdevice_lookupnge_ifmedia_tbi_updwdc_pcmcia_prwi_usb_txeofral_get_rfcdminphysnumcleanpagesschedhzcac_ccb_pollfdprobecomprobeem_allocate_pci_resourcesrip6_inputfd_motor_offtxp_rx_reclaimuvm_tree_RB_MINMAXtcp_totbackoffuserconf_basexe_stoppci_subclass_displayfddi_outputlooutputahd_reset_cmds_pendingcue_setmultipcn_resetiop_passthroughsoisdisconnectedar5k_ar5210_get_diag_stateaic_findcpu_coredumpec_ring_copyrevbitsdvd_read_disckeyuvm_aio_aiodonebha_timeoutfxp_pci_cawds_caclrbitsar5k_ar5211_set_intrahd_construct_wdtrral_cardbus_setupidle_startieee80211_proto_detachpcmcia_card_intrath_cardbus_powermii_phy_statusfddi_ifattachar5k_ar5211_set_ack_timeoutAdwResetSCSIBuscommajorfdwritedl10019_mii_resetscsidebug_levelem_mng_enable_host_ifsoclosewakeup_nsys_connectbuf_daemontrm_CommandPhase1skpcluphy_funcspcic_cdadw_cdohci_root_ctrl_transferipv6ctl_varsroute6_inputvop_read_desccluster_newbufsys_socketpaircnreadswitch_exitpci_addr_fixupti_encap_tigon1pcimatchudp6_sendspacedounmountuvm_swap_allockthread_create_nowwskbd_pickfreekbd_resettcp_ackdrop_ppslim_countfxp_autosize_eepromiememinitidt_regionpool_cache_destroyahc_dump_card_statettspeedtabns_scx200_setup_channelkqueue_readapm_perrorAdwASC3550Cablingcd9660_mountamiminphysahd_init_scbdatast_mode_selectuserconf_maxdevcue_initre_pci_attachfork_tfmratesiop_del_devacard_setup_channellxtphymatchar5k_ar5210_set_intrmpt_enable_intsvga_putcharpv_sizeiop_create_reconf_threadwskbd_activatewsdisplay_cons_pollmodewi_media_statusurl_miibus_statchgnd6_purgetcp_keepidleif_attachheadnextcichpcib_attachami_get_ccbiszerodevuhci_devdciphy_cati_initar5k_ar5210_radar_alertxl_initupl_inputvop_advlock_vp_offsetsumass_caem_hardware_initlf_freecac_pci_l0_fifo_fullsys_fhstatatw_resetst_unmountnullmodemohci_hash_find_itdar5k_ar5211_set_rx_filterahc_search_disc_listif_attachdomain1raw_recvspaceccdunlockXstray_legacy11diskerrwi_startcd_cdahb_send_immedwsdisplay_screentype_pickudf_bmap_internalwsdisplay_addscreen_printbha_pci_matchieee80211_state_namesys_preadar5k_ar5211_disable_pspollne_pcmcia_activateefintrem_media_statusehci_root_intr_abortwdc_pcmcia_detachmpt_pci_set_config_regskmem_mapcd9660_check_exportpccom_pcmcia_caconfig_pending_decraxe_startqsphyattachsoqinsquediskstatsath_calintervaldc_decode_leaf_symrtw_rxsoft_init_allcdce_attachavail_endar5k_ar5211_radio_revisionudp_inputpciintr_icu_tableieattachnchrtoblktblepic_add_rxbufisa_dmastarttl_encapihashrn_search_mresettodrar5k_ar5212_put_rx_bufsmc91cxx_readahd_setup_scb_commonufs_readdirsys_flockarc4random_initializedbios_caohci_cardbus_capvwi_usb_do_transmit_syncle_pci_attachspec_badopsm_pcmcia_disablemsdosfs_linkohci_root_intr_methodsisapnp_process_tagicmpctl_varsigmpstatudf_bmapvn_initialize_syncerdsm_cdu24_intrdpt_eisa_matchcd9660_quotactlicmp_senduhci_root_ctrl_donesiop_morecbdcdce_watchdogcy693_chip_mapvop_bwrite_vp_offsetssiop_ppr_negefreadwdc_ata_errtime_uptimear5k_ar5212_resetle_pci_cati_mem_writesowakeupvge_cam_clearinsideti_newbuf_miniar5k_ar5212_detect_card_presentdc_encapcac_pci_l0_intr_pendingar5k_ar5212_set_gpio_input_edataep_eisa_attachsigactsunsharetimeout_hardclock_update__wdcdo_resetrdattachimenupl_detachxmphy_funcsttkqfilterrtw_pci_enablewaittimem_tag_deletecd9660_ihashremar5k_ar5211_get_capabilitiesepinitip_fragmentsea_caXpageusbd_endpoint_countsys_statfsrawin6pcbtablepci_bus_dma_tagpool_cache_invalidatesea_transfer_piokprintfdevice_unrefrc4_keysetupscsi_startdcphy_matchin_cksumvnode_poolvnode_free_listrtw_rtl8255_initrtw_stopsk_txeofste_read_eepromtcp_savetiuvm_pagereallocrtw_sa2400_agc_initncr53c9x_reselectapm_battlowiop_lct_get0an_init_tx_ringuvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadar5k_ar5212_fill_tx_desc_endpmap_get_ptppciide_attachsogetoptAPTDpdehid_report_sizearc4maybeinitpcn_79c971_mediastatusami_pci_casoftdep_load_inodeblockar5k_ar5211_set_cts_timeoutpciintr_bitmap_count_irqwsemul_vt100_attacharp_intimerpollscandomaininitsii3112_setup_channelvflushbufepic_read_eepromtime_secondacer_chip_mapip6_forward_rtusbd_get_interfacewskbd_get_mapentryle_isapnp_campt_ioc_functionusbd_read_report_descsbcreatecontrolsys_mlockdvd_read_structvdevgonehtonsehci_pci_attachahc_controller_infobucketkqueue_writesys_syncaic_msginfddkdriverpcibios_pir_headercominitmb_mapaic_schedenodevan_rxeofffs_mountfsar5k_ar5211_update_tx_triglevelin_delayed_cksumwds_senseuha_isa_probein6_is_addr_deprecatedrtw_txdac_enableiha_find_pend_scbahd_swap_with_next_hscbahd_sync_scbwsemul_vt100_edec_media_initicmperrppslim_lastrtstatttvtimeoutahd_run_data_fifouha_cd_sk_mclgetncr53c9x_intrspeclisthbdwriteray_user_update_paramsVOP_INACTIVEwsmux_do_closetcp_syn_cacheadw_minphyswsemul_vt100_translatear5k_ar5212_get_tsf32ami_cmdpciide_sis_productsmpt_print_headerami_scsi_ioctleephy_cainphy_cawds_free_scbrtw_txsoft_releasep3_stepkputcharsys_getsidwi_write_record_usbahd_clear_intstatcue_csr_read_2uhci_device_setintrar5k_ar5211_has_veolwdc_pcmcia_disk_device_interfacele_isapnp_matchadw_pci_attachfileheadrc4_cryptusbd_alloc_xferwb_attachnextvnodeidcttypollural_startsys_swapctlbd_reqcheck_ie_presentahc_resetsigcode_xmmstge_devicesAdwSetEEPROMConfigst_patternsisa_cain_selectsrcmsgscpu_exitisapnp_knowndevswe_isapnp_caahbprintwsmux_add_muxbpfilter_destroyunp_attachohci_device_isoc_startmpt_attachtcp_syn_bucket_limitsys_renamernd_rselath_mcastfilter_computeti_free_tx_ringusbd_nbusesfrag6_nfragsip6_log_timeem_deviceseephy_statusinphy_statusiha_abort_xsvga_40lscreen_bfath_pci_matchsii3114_chansetupgdt_pcinew_set_sema0ufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnvga_console_typeprocess_s87_to_xmmsbflushehci_device_intr_transferipsec_require_pfsswapdevsiop_devwd_cawsdisplayttyath_watchdogkue_senddc_rx_resyncural_tx_mgtaxe_tick_taskvn_readsetgdtbwriteleavepgrpqsphy_cdtl_dio_clrbitiop_param_oprtw_rxsoft_allocuvmpageropsuvm_page_initudf_closeohci_root_intr_closeiha_state_1em_write_vftaehci_root_ctrl_closeem_fill_descriptorsar5k_ar5212_enable_pspollfxp_cardbus_cartw_rtl8225_inittcp_timer_funcsipqent_poolar5k_ar5210_set_mcast_filterpcib_cdbufq_default_addif_attachdomainicmp_ratelimittxp_caxe_pcmcia_funce_enaddrinvalhashieee80211_rssadapt_raise_rateieintruhci_rem_loopXfpuuvm_km_page_initrttimer_pooladler32_combineieee80211_regdomain2flagax88190_mii_readregusbd_get_config_descxe_watchdogti_jallocvr_devicesrgephy_load_dspcodear5k_ar5211_is_intr_pendingsosendhme_tickdosetrlimitpcdisplay_screenlistnge_ifmedia_mii_stsrn_initcmd_channel_mapbufq_default_getloopattachusb_match_devicedp8390_watchdogrtw_cardbus_devicesepic_fixup_clock_sourceahd_construct_pprwdc_input_bytesstge_1023_bugti_cmd_exttl_dio_read8usbd_do_request_flags_pipeprocess_read_regschainlengthdc_miibus_readregmpt_print_enable_replyisa_dmafinishedvr_intrwdc_pdc203xx_vtblural_disable_rf_tuneehci_cardbus_attachpj_freern_lookupahd_outqahd_lookup_scbpciide_ati_productsuvm_map_reservedc_resetuserconf_show_attrsys_execvedc_pci_cabootapiveraic_pcmcia_prodahc_isa_attachite_setup_channelamd756_chip_mapfdallocar5k_ar5210_init_pspollwsdisplayread_remqueudf_vnodeop_opv_descdc_mii_sendscsi_donechkvnlockhw_sysctluhci_device_bulk_aborttl_intvec_adchktcp_syn_cache_limitconsintrnumvnodescomreadepic_mii_waiturioopenuvm_pagefreeehci_device_isoc_abortie_cdukbd_decodeadw_asc3550_mcode_dataext2fs_inode_allocXstray_legacy7sm_pcmcia_attacheisaprintwsdisplay_switch2ahd_set_snscb_qoffvge_devicesiha_pci_attachin6_ifindex2scopeidin6_pcbbindXdblecluster_rbuildreaperahd_loadseqatw_pci_caar5k_ar5210_set_beacon_timerscoredumpfilt_kqueuepckbd_cnattachmalloc_roundupar5k_ar5211_fillrl_powerhookep_mii_sync_bpamifailichpcib_matchpipe_readuhci_root_intr_closertw_init_channelsifioctlsys_utimesatw_tsfusbd_do_requestahc_set_namend6_storelladdrrip_initsocreatenge_resetar5k_channelusbd_find_idescwe_init_cardioprbs_matchvmmapureadcaue_startcalibrate_cyclecounterufs_setattrieee80211com_headlogprinpx_cadoclusterreadsys_exituhaprintfdretrypci_attach_hookar5k_ar5211_get_rx_bufuha_attachm_applyahd_handle_ign_wide_residueahd_tailqrtw_enableudav_startaxe_lock_miiem_disable_promiscwdc_exec_command_isa_bus_dmamap_load_mbufvga_stdscreen_bfray_cmd_is_runninggdt_pci_set_sema0wdcintrusb_seleventcd_playsys_clock_getresaxe_attachsm_pcmcia_enablevge_tx_list_initsyn_cache_insertioprbs_start_ccbsspec_bmaprtw_rtl8225_destroyiminlevelttystats_initar5k_ar5210_reset_tsfpciprintne_cdrl_cdapm_cpu_busyem_allocate_receive_structuresncvhashpool_cache_destruct_objectuha_mscp_phys_kviunmaskfd_motor_onbhaminphysnd6_umaxtriesohci_device_intr_donear5k_ar5212_wait_for_beaconral_prio_intriop_util_eventregray_start_join_netpcmcia_intr_stringfxp_mdi_readisadmaattachti_gibinitdcphy_resetnd6_debugstdumpehci_root_ctrl_transfercpu_cpuspeedmpt_print_init_replypciide_cmd_productsudf_vgetget_random_bytesurl_csr_write_1rtw_disestablish_hooksesymosreleaseVOP_RECLAIMatw_write_sup_ratessiop_update_xfer_modempt_recv_handshake_replywsmux_evsrc_set_displayan_pcmcia_attachahc_isa_probetcpqe_poolpgrp0ar5k_ar5211_stop_pcu_recvahd_qinfifo_requeuertw_collect_txringar5k_ar5212_get_rx_filteropti82c558_getclinkurl_watchdoguserconf_changetxp_startmakefstypecddkdriveruvm_anon_addadw_get_ccbvge_debugste_stopcac_pci_l0_completeduserconf_helpar5k_ar5211_enable_pspolliop_resetufs_advlockicmp_initral_media_changedpt_minphysti_del_mcastsii3112_chip_mapuvm_growvfinddevfd_cdvp3_cfg_intr_shiftar5k_ar5212_start_rx_pcuE_ldsa_abs_reselected_Usedgdt_wait_gdtXhold_legacy5if_detached_initral_pci_attachpciide_unmap_compat_intrelreadahd_controller_infodopowerhooksehci_device_bulk_methodspmap_tmpunmap_paapm_handle_eventpccbb_conf_readether_delmultivfs_op_initvga_screenlistec_write_mbufsk_vpd_readbyteexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutti_probevr_miibus_writeregre_allocmemwdccommandshortieee80211_rate2mediavcleanahd_sg_sizeuhci_device_bulk_donear5k_ar5212_get_diag_stateepic_copy_smallcd_getvoliophy_servicesplassert_ctlrtw_pci_matchwdc_atapi_startsys_getresuidsys_fhopenatw_idledos2unixfnpciaddr_do_resource_allocatescsibussubmatchrtentry_poolXrecurse_legacy10cdzerorefuvm_km_pgremove_intrsafeext2fs_sbupdateray_report_paramsdefrtrlist_delsys_fchmodvop_strategy_descar5k_ar5211_init_beaconray_update_promiscrtcputuvm_unmap_detachvop_islocked_descath_hal_init_channelsiha_msgin_ignore_wid_residgdt_scsi_cmdadw_pci_caisapnp_alloc_irqehci_add_qhahd_set_modesupl_initwskbd_srcopsuserconf_common_devwb_tickpdq_initializestartbha_cmdusbd_devinfosiop_wdtr_negcardbus_function_disablest_identify_drivevn_isdisksys_selectxmphy_attachvnode_free_list_slockzombprocpckbd_bell_fn_arglogreadisapnp_unmapdead_lockieee80211_name2regdomainpcn_shutdownadw_asc38C1600_mcodetcp_issfc_largedistanceahd_createdmamemcom_pcmcia_disablesys_setitimerisofntransurl_attachpccbb_rbus_cb_space_allocar5k_ar5210_set_gpio_inputnd_prefixwsemul_vt100_resetbootstrap_gdtext2fs_specop_pvfs_unregistervia82c586_pci_icurtw_transmit_configiha_done_scbvt100_setnrcpchbmatchselwakeupwdc_isa_caem_update_adaptiveffs_reloadem_initialize_transmit_unitcnwriteumass_bbb_get_max_lunehci_device_bulk_doneuipc_usrreqdc_powernd6_na_inputrtl80x9_mediastatusichpcib_cati_free_rx_ring_stdvflush_vnodefilt_rndrdetachwds_inquire_setup_informationaha_get_ccbscsi_scsi_cmdnge_tickbios_cksumleniha_xpad_outdpt_free_ccbem_media_changerip6_usrreqin6mask96xl_eeprom_waitcoldelioctlunp_scanexec_aout_prep_nmagicisapnp_com_submatchtl_mii_readregsbappendaddrehci_powerbpf_maxbufsize_vga_mapcharextract_entropysis85c503_inittl_eeprom_putbyteufs_islockedusb_detach_wakeupisapnp_wait_statusffs_unmountfifo_inactivene2000_detachsk_vpd_read_resgdt_mpr_copy_cmdsys_pwriteisohashtblwihap_shutdowntwe_devuvmspace_allocrevarpinputpckbd_cnbellcd_pausesoftdep_setup_directory_changehashinitpccbb_open_winttstartXmissingumass_setup_transferrd_ioctl_kallocsis_read_eepromciphy_statuswdwriteipsec_keep_invalidmpt_print_scsi_io_replypchb_cdpciide_channel_dma_setupvga_pci_cnattachbad144internuao_detach_lockedpci_devinfodpt_done_ccbrtw_bbp_preinitsdopentcp_traceciss_scsi_cmdwb_list_rx_initmii_phy_resetip_getmoptionsuhci_hubd_piixral_enable_tsf_syncdp8390_mediastatusin6mask32__moddi3disk_countohci_confdel_cddead_openkue_setwordatw_rxdrainatapiscsi_matchuserconf_attrwdc_kill_pendingem_commit_shadow_ramrtw_pktfilt_loadahd_configure_terminationbmtphymatchicmp6_redirect_outputroute_cbvop_revoke_vp_offsetsva_nullrtw_led_setexphy_cdste_init_rx_listreadeppckbd_bellpccbb_pcmcia_wait_readylxtphy_resettcp_slowtimoamphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbsys_fhstatfsar5k_ar5212_eeprom_writeelf32_load_filesys_getpeernamevr_ioctlccdintriha_init_tulipmpt_wait_db_inttxp_tickdpt_timeoutee16_read_eepromehci_device_intr_closeudf_rootehci_intrxe_pcmcia_attachfdc_cascsi_strvisbpfwritedoingcachesys_getrusageapm_threadnge_ioctlaue_reset_pegasus_IIelintrral_disable_rf_tunecomconscflagnd6_prunem_getffs_truncateuhidevprintmii_attachadw_timeoutttylclosecmd680_chip_mapmd_diskconftl_initcac_pci_l0_submitpool_allocator_allocwdc_default_read_regin6_ifremloopchar_typeuha_isa_caohci_free_sitdrl_intrncr53c9x_debuggdt_internal_cmdusbctlprintti_stopvn_closexl_choose_xcvrxl_stopudav_csr_writein6_createmkludgedoclusterwritear5k_ar5112_channelusbd_close_piperl_cardbus_deviceswsdisplay_cfg_ioctlvge_cdffs_writebremfreefilt_sowdetachpcn_rxintrnd6_initip6_maxfragslimfreenge_mii_syncfxp_intrwe_attachsoftdep_setup_freeblocksuhci_reset__wdccommand_intretherip_outputuvm_km_free_wakeuprootvnodeehci_initifmedia_ioctlahd_check_patchwb_probecac_copy_internal_datadc_mii_writebitbha_isa_caicmperrpps_countuserconf_modify__one_cmpldi2wi_usb_rxeofcd9660_ihashgetaic_pollmii_phy_detach__muldi3wskbd_add_muxmbtypesahd_shutdownvga_copyrowsuhidev_caurl_lock_miiip_mtudisc_timeoutvfs_opv_init_defaultrandomopenamd_family6_setupin6addr_linklocal_allnodesfxp_watchdogamphy_cabufiniteisa_intr_disestablishpcscp_gluecpu_exec_aout_makecmdsath_cardbus_disableisamatchscsi_quirk_patternsuserconf_linesepic_initath_cdlimit0rtw_pwrstate_stringep_mii_setbitbrgphy_load_dspcodeciphymatchatw_write_ssidE_abs_targ0_Useduniqdosnamear5k_ar5212_set_beacon_timersusb_async_procext2fs_mknodvttoif_tabwdc_pcmcia_activatebgetvppgrp_poolegresetucred_poolatw_rxintrvga_doswitchXstray_legacy5pj_pageadw_pci_devicesarp_maxtriespcibios_cdcd9660_bmapax88190_mii_bitbang_writeaue_eeprom_getwordgdt_get_slotldt_allocstge_cddcphy_funcsufs_dirbadentrydpt_intriop_printlogioctlbha_inquire_setup_informationste_ifmedia_updicsphy_funcs_bus_dmamap_load_uiostrlennge_watchdogwds_free_bufferstartrtclockvop_abortop_vp_offsetsahd_freeze_devquhci_cdfifo_kqfilterray_check_scheduledvge_tickeisa_cdkue_activateray_update_paramswsdisplayparampool_page_freear5k_ar5211_put_tx_buftrm_StatusPhase1wdsintrwdactivatecopystrtl_intvec_txeofsys_pipeural_setup_tx_descusb_detach_waitarp_rtrequestar5k_ar5212_dump_statepcic_pci_attachegstopvr_initext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initle_isa_caproc_trampolinelapic_tpraic_isa_attachsys_rmdirudf_ioctldp8390_disableAdwExeScsiQueueem_attachcd9660_vfsopsar5k_ar5212_get_slot_timepckbc_attach_slotami_schwartz_pollgetticknkpdeem_get_bus_inforl_mii_writeregfxp_cdcac_cdAscResetDeviceallocbufsocantsendmoreproc_zapvop_revoke_desccac_sdhusb_rem_taskep_pcmcia_disablewi_pci_attachsiop_sdtr_msgcdactivateether_inputuvm_vsunlocklockstatusami_write_inbound_dbquotaoffarpioctlffs_fifoop_pfs_posix_sysctlif_slowtimouhci_root_ctrl_abortar5k_ar5212_txpowerep_pcmcia_cabge_handle_eventswd_shutdownudbtablewi_setdefbgedebugahc_chip_nameswdcattachrtw_seg_too_shortpiix_getclinkcb_detect_voltageufs_printem_rar_setfatentryar5k_ar5210_get_lladdrath_setcurmodear5k_ar5210_set_powerpcic_pci_matchhme_shutdownciss_pci_devicesar5k_ar5212_update_tx_triglevelwi_update_statsncr53c9x_abortmf6ctablear5k_ar5112_rfregssiop_startusbd_printBCDsys_statatw_media_changevga_alloc_attrXf00f_redirectin_baddynamiclineswtxp_commandmsdosfs_symlinksys_symlinkicmp6_sysctlahd_read_seepromclfreeconfig_found_smem_check_phy_reset_blockioprbs_dequeueatw_recv_beaconusbd_interface2endpoint_descriptortxp_attachfdreleaseehci_disownuvm_swapout_threadsural_bbp_writesm_pcmcia_matchbge_alloc_jumbo_memmpt_dma_mem_allocatw_cardbus_enableknote_attachmax_keylenextmemisa_dmamap_destroyxl_pci_matchdp8390_ioctlsplraisesk_newbuf__assertath_desc_freear5k_ar5212_release_tx_queueif_congestion_clearapm_resumeswsdisplay_emul_matchin6_prefixlen2maskar5k_ar5210_proc_rx_descpcmcia_megahertz_xjem1144_func0_cfe0cardbus_matchbyidvge_cam_setar5k_clocktohahd_sync_qoutfifocom_activateudp6_outputcn_devvpwi_get_debugmpt_actionisapnp_cdmaxfilesuvm_pageactivatein6_addr2scopeidip6_sourcecheckvop_access_vp_offsetsne_pci_attachrl_pci_attach_bus_dmamap_load_rawffs_mountrootrd_cdahc_donetprintfuvm_map_pageable_alldofilewriteehci_device_isoc_closertw_80211_dequeuewb_miibus_writeregipqiha_sync_done_isa_bus_dmamap_syncath_rate_ctliha_push_sense_requestdl10019_media_initrtw_cardbus_funcregenmsdosfs_strategytimeout_delem_ioctlural_media_changeuhci_alloc_stdXsoftnetcpu_cache_edxwsemul_vt100_el_isa_bus_dmamem_mmapif_delgroupspec_strategyieee80211_chan2modeuvm_pglistfreeusbopenax88190_media_initext2fs_readsoo_statwskbd_cnpollcdkcsumattachkue_newbuftl_wait_uprusage_pooldisk_detachstrchrral_decryption_intrhid_clear_localahc_clear_critical_sectionscsi_sizergephy_capci_mapreg_infoadw_queue_ccbisp_initgenericconfiftovt_tabtcp_backoffvga_scrollbackisa_bus_dma_tagsys_chrootehci_odevdwdc_ioctl_freeavail_startieee80211_rssadapt_lower_ratepcibios_pir_tabletl_intvec_rxeoctl_list_tx_initehci_device_clear_toggleuhci_portreseticmp6_redirtimeoutpci_bus_fixupsoisconnectingpdq_queue_transmit_datadpt_cmdwsdisplay_pollcpci_subclass_processorvop_link_descisapnp_findcardaobj_pagerne_pci_carl_pci_cacardbus_intr_disestablishahc_compile_devinfostopenuvm_tree_RB_REMOVE_COLORpcibios_pir_table_nentriesMD5Transformu24_findmld6_inputsk_intr_xmacvop_link_vp_offsetsrgephy_mii_phy_autobpf_d_listuhci_root_intr_donepcic_chip_do_io_mapsyn_cache_cleanupip_pcboptsfc_purgeiha_scsilance_isa_probeem_detect_gig_phyiop_msg_map_bioahc_cdar5k_ar5210_has_veolifmedia_delete_instanceE_ldsa_abs_data_Usedurl_casoftdep_update_inodeblockgdt_pci_copy_cmdelresetccddumpep_media_statusudav_miibus_writereg_sk_mgetcac_eisa_caacphymatchicmp6statwsdisplaydevprintgdt_pci_intrvge_miibus_statchgccdwritewsevent_pollmap_backmergeieee80211_pwrsavesys_profilvmcmd_map_pagedvnrtw_rf_macwriteahd_update_neg_requestciphy_servicein6_pcbhashlookupar5k_ar5211_get_isrwb_eeprom_putbytetwe_intrwsdisplay_cdvr_cabpf_detachdVOP_UNLOCKehci_root_ctrl_abortsyn_cache_initieee80211_find_txnodevop_readdir_vp_offsetscd9660_wchar2chareggetip_ecn_egressether_ipmulticast_maxuvm_init_limitsiha_waitukphy_cdsii3114_dmacmd_writein_pcbconnectdevoutahc_busy_tclem_free_transmit_structurespciide_dmacmd_writeokaytocloneVOP_POLLVOP_IOCTLaic_msgoutXfpusegmahb_switchsafeprinumccdsys_rforkluphy_cdvge_miibus_writeregxe_ioctlwdc_default_read_raw_multi_4pdq_os_restart_transmittergdt_wait_indexdpt_alloc_ccbuao_swap_offmachinewi_cmd_ioVOP_CLOSEar5k_ar5210_set_rx_filtergdt_start_ccbsuvm_anallocin_pcbdisconnectuvm_vnp_terminatepool_cache_putahd_probe_stack_sizewi_usb_rxfrmdc_cardbus_detachar5k_ar5211_get_tsf64rl_eeprom_getwordsys_getpidnd6_defifindexunp_dropath_rate_ctl_resetuvm_map_advicetcp_mtudisctimeout_startupudf_vfsopssmc91cxx_mediastatusami_schwartz_donecue_matchpckbc_enqueue_cmdrn_addroutear5k_ar5210_get_tx_bufsdactivateaic_isa_caem_cleanup_ledpmap_test_attrsural_detachukbd_cnpollcvr_ifmedia_updXhold_legacy14ahc_handle_scsiintshmsegdvd_read_manufactconfig_activate_childrenst_pcic_writeami_quartz_execem_allocate_transmit_structurestl_miibus_statchgnforce_chip_mapem_mc_addr_list_updateremrunqueuepccbb_free_tagsoo_closeral_rx_intrsiop_handle_resettcp_recvspaceuvm_meterahd_set_hescb_qoffuhidev_maxrepidsubnetsarelocaltcp_ackdrop_ppslimudf_node_poolsea_selectioprbs_attachuhci_ifcdsii3114_write_regehci_device_ctrl_donend6_lookupieee80211_cache_sizefxp_shutdownXrecurse_legacy14pager_map_wantedfillwurl_openpipessk_probeadw_attachpentium_mhzsys_getppidahd_allociop_initmii_anarVOP_READDIRdomainsatw_newstatetrm_GoingSRB_Doneami_write_outbound_dbem_led_onbge_newbuf_stdsys___sysctlhme_pci_enaddrin4_cksumextent_alloc_subregionrtw_pci_attachAdwDelayMicroSecondisp_intrtm86_cpu_setupneedbufferu24_start_mboxwsemul_pickusbd_do_request_asyncbge_stats_updatein6_ifattachiop_sdhsetperf_priotcp_rst_ppslim_lasticsphy_caahb_timeoutwsdisplaystartisp_get_ct_hdrsis85c503_getclinkpcn_txintruvm_rb_removeohci_root_intr_donetickfixath_chan_setath_recv_mgmtusbd_get_device_descriptorcd9660_initccdstartar5k_ar5211_proc_tx_descumass_fixup_yedatavp3_cfg_trigger_shiftipsec_soft_bytesnselcollemul_elf32usbd_open_pipenumdirtypagesm_tag_unlinkohci_softintrpcdisplay_matchbiosopenbufhashahd_enable_coalescingahd_freedmamemvga_show_screenmsdosfs_lookupspec_pathconfgdt_async_eventmountroothook_listhook_establishtcptv_keep_initsys_chdirxe_reset_sk_mgethdrwds_collect_mboext2fs_diremptyuserconf_cntdcphy_caE_abs_msgin_Usedep_default_to_mediasea_timeoutem_config_dsp_after_link_changeext2fs_inode_freepcmcia_ccr_writexl_txeof_90xBapm_cdahd_handle_message_phaseip6_rr_pruneapm_cavr_cdsbcompressami_schwartz_execahaminphysmsf2lbabus_mem_add_mappingnd6_outputcdevsw_lookuplogsoftcsys_adjtimexl_pci_carbus_space_allocohci_device_clear_togglertw_intr_rxpckbd_keymapdatavop_kqfilter_vp_offsetsar5k_ar5212_set_cts_timeoutpciintr_link_lookupwdstartwsmuxreadamap_splitrefwskbd_do_openwdsminphyswb_setcfgnclruheadmpt_pci_cacac_pci_caural_next_scannge_newbufuvm_aio_biodonern_initheadrtw_config0123_enablertw_set_accessahd_validate_widthusbd_get_descem_start_lockedahd_aic7901_setupvop_generic_unlockuvmspace_sharert_timer_addsm_pcmcia_activatepci_get_capabilityieee80211_print_essidroute_usrreqdeextendem_receive_checksumahd_freetcp_dropicmpstatudpctl_varsral_update_ledstge_initfdreadm_prependXstray_legacy10vop_advlock_descwsemul_vt100_output_scs96_percentsetgatecd9660_pathconfrtw_dwelltimepckbcprintax88190_stop_cardin_pcbrehashre_tickre_resetahd_platform_flushworkin_arpinputmpt_statebge_eeprom_getbyteehci_root_intr_transferne2100_isa_probeufs_accessin6_embedscopeif_alloc_sadlmpt_pprem_arc_subsystem_validunix2winfnncr53c9x_get_ecbrtw_chip_reset1cardbus_restore_barapm_flagsXbndreassignbufuhci_confdsiop_minphysXstray_legacy9ip_freemoptionsnetconsohasoutofbandspec_vnoperatevop_ioctl_descieee80211_release_nodei386_fpu_exceptionmodifiersnd6_dad_duplicatedsoftdep_change_linkcntfifo_vnodeop_opv_desc_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovppim6_inputether_crc32_besiop_setuptablescpuid_levelpgfindxl_waitahc_scb_devinfoie_isa_capckbd_consdatavop_lock_descseaprobetcp_ackdrop_ppslim_lastrqinitloadfirmwarecd9660_ihash_slockip4_inputtcp_inputsysctl_dumpentrydkcksumar5k_ar5210_put_tx_bufahd_match_scbcardbus_intr_establishwsdisplay_cnattachpcib_caiha_msgout_abortnd6_gctimerncr53c9x_initurl_csr_write_2isa_devdc_pci_matchcd_switchiptimerip_inputwi_set_txpowernd6_setmtuar5k_ar5111_chan2athchanaxe_ifmedia_updpci_intr_post_fixupwdc_ata_ctrl_intrusbd_get_endpoint_descriptorudp_ctlinputatw_beacon_minintervalmii_detachudav_rx_list_initpool_sethardlimitep_isa_capci_subclass_prehistoricn6expireip_freefsk_ioctlwdc_default_write_regpcic_create_event_threadrlphy_statusudbhashsizeicmp6_mtudisc_updatesun_nonamecpu_info_listkmeminitatw_tuneaha_isa_capcic_pci_machdep_pcic_intr_establishnsphyterattachnd6_ns_inputdevice_refehci_device_ctrl_abortath_regdomainrd_root_imageffs_syncuvm_map_submapcnioctlufs_vinitehci_nooppccom_isapnp_cawb_mii_sendem_set_d3_lplu_staterl_eeprom_putbytepool_primepdq_ifioctlcomconsinitwds_bufferiop_devinfopgrphashtblsddkdriversys_getpeereidsmc91cxx_watchdogifmedia_matchstatclocksiop_ppr_msgaue_activategetnewbufwi_read_data_usbohci_cardbus_detachdvd_read_physicalrw_enter_writepccbb_pci_callbackuvm_mlk_hintuserconf_argbufaic_selectm_tag_copyehci_idoneeisa_maxslotssiop_pci_attach_commonst_readee16_probepci_io_findiop_msg_mapar5k_ar5211_set_gpio_inputopti82c558_initcac_get_dinforay_check_ccspcn_79c971_mediainitrtw_txsoft_blk_cleanup_allami_read_inbound_dbgdt_enqueue_ccbhid_get_itemmsdosfs_getattrwritedisklabelm_devgetioprbs_adjqparammsdosfs_printkernel_pmap_storewsemul_vt100_opsstge_txintrem_write_eepromiop_simple_cmdstartprofclockohci_device_isoc_enterrl_encapupl_ioctlnsphymatchsys_getresgidprocinitar5k_ar5211_get_keycache_sizeapm_userstandbysahd_softc_initmsdosfs_readdirdead_ebadfusbd_interface_countbrgphy_attachudf_UncompressUnicodeath_desc_alloccac_switchwddetachintr_calculatemaskssoo_ioctlforkstatral_node_copywi_card_identaue_miibus_writeregsk_ifmedia_upddl10019_mii_statchgcardbus_cdcac_pci_matchicsphy_servicear5k_eeprom_regulation_domaintrm_DataInPhase0wi_send_packetmpt_send_event_requestin6mask64ohci_rhsc_ablere_gmii_readregadv_attachsoftclockaic_switchupdate_modifierisa_dma_stats_nbouncebufspccbbattachpdc203xx_dma_startswdevtdisk_lockbha_enqueueuhci_initpcscp_matchieioctlsbwaitudf_transnameufs_reclaimwb_mii_readregsdwriteohci_device_intr_startvga_common_probetrm_MsgOutPhase1trm_switchciss_cmdfilt_logreadsysctl_rdquadath_cardbus_enableuvm_vnp_setsizerl_ioctlvmcmdset_extendural_cadefault_product_descip6_use_deprecatedar5k_ar5210_stop_rx_dmaehci_softintrtrm_check_eepromep_pci_attachuserconf_hist_intextent_alloc_regionsys_mknodxe_pcmcia_manfid_ciscallbackext2fs_mountfskill_vmcmdsuhci_device_ctrl_closehme_watchdogufs_mknodsbinsertoobknotexl_cardbus_lookuplf_advlockpffinddomainwsmux_do_openeephy_resetfreeem_phy_get_infopci_device_foreachpccbbintr_functionwi_ioctlsis_delaypmap_tlb_shootnowxl_miibus_readregAdwResetCCBieee80211_compute_durationrtw_pwrstateswstrategyuserconf_pnumehci_allocxscsibusprintrtl80x9_init_cardehci_root_intr_methodsrtw_cardbus_enablesys_getpgrpccddevsukbd_ioctlwsemul_vt100_console_emuldatasonewconnral_update_slotisa_intr_establishwb_ioctlioprbs_intr_eventufs_direnterar5k_rt_copyudav_csr_write1pffindprotoan_intrudav_watchdogahd_lookup_phase_entrycluster_readtcp_saveti6wdctimeoutwsemul_vt100_initnchrdevex_caieee80211_merge_print_intvlep_eisa_caath_poweraue_cdcac_shutdownpiix_pci_icure_pci_devicespciide_cafddprintnatsemi_pci_intrrtw_ioctlpciide_chansetupqsphy_cashmmaxpgs