ELFa( 4J4 (   `Y"`Y"p"BB((Jkk / /;0&00Qd;0 2 @00Q8$/ // @ P`D  B00 R zР -L٘ bk p-0LSP P ,  4 ` ,  0P,00,0pp 0 $Pp@0D PT0T0S , , -0P@Lp8`  R   0@ 0 d -0P@Lp8`  R   0 @ 0 d -LP@x`0 P  'H0!@ 0',0 0` 0 0' M-L0&HHH0$H@  , 0&&, $, 0`@ * 0 0 0''X(K 0-_02@P L0@ 0'0@-0@  0S  4000$ 4 @4@ -4L0S @440S - L0 -LM40S  3 lH0 ,P K 0 Kh{?? p-LM@`P3PUOx3e H0 P]00 h0 \8S3 @L89H3  : B?$?H?ı@\?l?4? Q-L@10 ,耧?? p-0L @P ,00,0 R 0$ 0 00  0 p,0`0,0 R 0$ 0 00  0 *phPn -PL4p`V$ 4! ,0 J0 ,0 000,  ,  0hP)@0D PT,0 0,0K@@???ȧ?ا? 0-L@IP,@T ` B0Pn -4LSPp `00 0<0000@0003  00   0  dM4S0;0ShgK:4S 0 00L$H@0@@000 31C0 1-L?rcWP`S V @ 0DPT0`T0d  D0PT0C4Q -LàL0L0Ϡ@blpP30 0S PVd0P0,0 00P 03Q - @p`R0 0L PP 00  0 00000\4SX 03g4   -L@pX00S//0W3 ] '00`M 00P00Zpd3 X0  0W  -0pS0L00@`% 000PU00S`U \     8U $Br?ı@ ?? -8@QL0z2>0 p-8P@L@`4 00 00S > S 0 p R  B  h 000 PXp 0 00 $??\? 0-L@LP Y0( Q0( 0hH' p-L@`u ?PUP00SXP ?sp  000PS p 0U 0 0 0P 0UPp@p -0LSP 0S" 00 @ = p`Z8:Xo`Z6 @ 3S `V 0@ 0TTPPQ @Op@ 00000@TP3038P060 0 303 R 00   @F00j$B p-L@ \P`dU  0O00PY YR`pp 0-LP@P 0ed/H@ @0lP' 0H@ 0_ 0' -LM0` Pp @2? 0S3  0BP.0  0&0,0K0,0 Kh  Kh\ 0S 000Khm  0P00 0S  0P3g4 MKhI -0`10#LP8p&@P@ 00 0000  0 0, |0| 004 P_`0  @0@  00    ? -L M0PS` 0Sp K@K >PE 03K3[03K0p Pp]3[03K3[<3K0@0 4 @K?0K1 :`@ 000S3033 T] 3dp0p|14 P=303@To3 `3`V㏏H0"S3R1  KT0 ,pK <3 00,0K,0K3 f @4  0+@K*K( Rs<#t003 P3,00,0Plj B  $Br( R -L M`@^  w P00 K,0 $` 00@BĨ?Pn p-0QLM@`  `vqxR P 0P ,Vx p-0QLM@`  `qxR P P0\Vx p-0QLM@`  `UqxR P P0XVx p-0QLM@`  ` qxR P 0P (Vx0@- @@  P @   0 0< 4("4!̃,<,$,W0U VT0-  00  00 0 <4("4!  < $ W0U VT0@- @@P  N      0 00@ 0 0 0< 4("4!̃,<,$,W0U VT0A-P0p K Q,@ 0@0ll 0$ (, <4!4"<0cT(0 0!(` 0@0ll 0$ (<0cT(0 0 0 (@ 10ll 0$ (, <4!4"(00c0c(010ll $0 ( 0- L0@P0  00!010!,0?@0p?<0,0 A00 P!0p20A 0?A0S 0% 0! <4("4! < $ +0) *(@! 0 T! 0 TW(K0!0R0>0U;0U8! P 0 0S0S00@ P"0!B20T1 0U>0G0D!010?0p?<0!0 400000p00Ġ0U0V0, 0TW0020!0100?<0!0 000Sh0Kd0 ! *0 ! x= - L0p @05 $P i0$ , P0 * 0, 0 (0 $ @ 00 .0P@ T`$00  0(0 00 $0` 0e0 0" $e 0 $ @ 0h? -LMP0 R @p  lM0 ! 0W0U V T0`S  60 (0 0 0^U0VR0VO< 0RN \ Q 0S[0A0@!0?30`0200 >0!0?<0040!000`000Q! 0 TP 0 T!0 T 0|` 0S  ` 0H 0 (00j  |ꤪ??=? ?T? -P0 RLpẀ` @H 0S0800 0300#0! < $ +0) *(0! 0 T@00 @@ ""  0! <4("4! 0 000 # 0S/000 0300P 0! <4("4! < $ +0) *(0! 0 T0800 S0 0 00 0 z 0 0! 0W 0U V T0 000 # 0!000S0 +xܪ? 0-0@L $0P0 Td0 T0 p-L@P40B $C $`P U p0R $0N $ PR R @R  pt 0N TpD 0 0N Tp꠆?|? 0   :4PP  * K # PB?P0`  0 PP! `:PP 1, : !0` , x==??ܫ?H?|? -LM04 (@T ,0  c = -LM0) (@T :  -0L   1 <4("4! 10!, -0L @  <,$!$.!0\ 0- 80"(,#@L(P 80,#(0h -LMQ0p @Rb8` 0 0S[:01!$C0A0bA !!\Lt!`!!A' A10C0  101 - 0$N)` ,0  !< 4("4!,Q 0$\!! 1! c 100 Q0 0 m $0!00| = p-1@L`$  8Q 01phզ -04p@0aA@LǦ00 P0U S` 480@P81080!08娦1Q0C1 -LMP@ ɦpP`' @0 0  B0 P` (0K0 0 *,P 1n`$K0 0 ( 04P 0 P 1 81 0 -LM1! 0SP@# *AT R0001 0  YpP 0  a .0 < 4("4!, ! 0A \!0  ! 1/< 4A!4",/0!1 0 101@! 0!080|00 1 !?\=,B -0Lp`Q@4P @T  4 8 1 40! T 1@01P R 0S 000Q0  PU@0iЬ? -p4`0ALT㼠P 1@ R  ⣥P 0e < 㕥P Y @@0<80P P8 TG I  0Q0 0a8??? -LM0 @p`10! P0UQ@,PP G/c$ 0 h? -L$M` .P  (P NP0  PFP@ 0  00s0 00  0 P@ T0列 # , 0 @, 0 0`  40 0P /  4,3Cp p0 0$ 0"0 0 0! U0V0WT0n< 80 @ 8$40 < (  4Z [XY00@! 0?<=0>00 <4("4!  (  4B C@A00! 0GDE0F00 <4("4!   ( 4HJ KI00 <4("4!  (  4R SPQ00! 0ge0f0d0000 < 4("4!̃, ,,4kj_ \ ] ^ i0h0, <4("4! , < $ a bc0`0< 4("4!@0.̠.$.T 0@ @ :48x (  4 008 80<4x (  4 004 4 "4<x (  4!10< < <"8"4x  4 ( ! 10# < 4("4!  10...̠ 0" ! 1.< 4!4" 10...̠ 0d" ! 1/< 4!4" 10...̠ 0"< 4("4! 10 ...̠0p! 0Q1R1SP ]p0d0 d 0, 0 , d1+,0 S@jp\10\!\(Ko0,@0 <48 ("44 $" <   (Ko (Ko tPT@@GR J0!0 PU@@DZ(갇=pBtBxB|BH???x?? 0-PL@s $ d10d!@dA0h 0-PLc`AT R000d1 0  $ 0 -LM` TA(P0T1000 hQ,0 U  0 10! p0S PU,0SpQ0,0 0 $0S (00 1S X 1SX $0,S 'Z ʊ0(@'Z@P(Z X 00 0 00< 4("4!< 0Z\S0@ 1Y>0 1Y>0 ,$!$#< \10 I LS @ < 4("4!, !10\h @ 0Z? 02|R@ 1 Y>!0@\ T0  @Dh D2@|P".$2@|!.@2|0 S0Z/C1!PZ/B1! R0001 0 dPg?P1pPATP 8Q 0P80 opP0) (\ 00: 1>, \ % @0  !< 4("4!,10\ " @LXP @0  !< 4("4!,10\" @P= B==? -L M4 l440%00KR,0 0 :4Q1 10pW# 0`00P0 @T ,00@,@ 0 ҋ 0 `PR00VZ0S40% R4 hAT$00 0P0,  @,@ 0 奋 @PU04 l10 0P,00@,@ 0 吋~40pAT$00 0P0,  @,@ 0 {hi@PU04 t10 0P,00@,@ 0 fT0@T, (0  0(0P, 0F0 Q$ >$00CS00$0$00$, 2 R000,0  0@ bU(K004000!  x40%e?,?T???̯? p-@LX`@0  <0P(00(0ph? -L(M0` $PD D0SM 0 ,X\ 0 ,Q::Q\:\ , 8 4 0 p @l3 Z0B (0P $<  Wg 4 寊((K0 T0S 0CTTZ >ΟW 0@@ @pl.`#43p pW  4 0 80 , , 08 10 0@ 0 $<0@ = @1 3, , 1@c , T !W% 0 !0 "$#(, <4!4",  @Lgd Ja B0t033 W 0 $ 0\04 $<0@ R R 4 @+0t03%5 W} 0$040 , 0400#@ @TF@ 1p0, \, A, 8p 4p 0 W 4 屉\ 00 ,P@W< $0SS(;T 0CT` & T 0CT  40S 40,0, , 1@c , g0 0@P; T`$00;  L@U W 0 <#0! " rD 8,01n{ 1p0, \ 04 T@ 1?, \u 1=>, \g! 0"4#8,@ ` $PN TL Z G0@P, \`,0@, :D8T( 0CT  0TH04 $P5 $06 p$10!Rh 10P AT 0G?, \db\]TX0 ,@, , 1 c<0{W 0$04 , bJ\D c4P 6T 0T05 $+0<0[ 1p0, \6T |0T0, , !b34Q0,0e+t R! 0B< 4("4!̃B,<,$,O0M NL 1=, \e05 $<@90 $P` #P 4P 0 00 ..ZVd1t!l \|0`apahaXaaz`0@`003Ta@K$00  \x_ _ B6 -P0 L  80C 8(R2 d #8X$ -P0 L  80C 8(R4 h #8X$ -< <0L00\0  (@ $8;80@-8 0 0@0@0 0@0@ -L MA0P` ` ,0K "[P1RC R $K2[mCX#X`+p@  1 R0C8 p (K"[p0 R2K"[0X00@ 0   00   &0Kt t0 00@0@,[H u=@  0'$p$l$# 0-MLM@P80000& 1 R+ 1 t!0Sd1 KX!0KL1AKA AP(1K R000K003X000 K  0C,K 0AKA AP K00C S񟗼H 8 (  000000000000p'D -80(0L 0 '0 0   p-0LM @+P-` x0 00> `P||0 R0C  (P 0PP8 x+r 00a=C4`#hl 0dLx0S 40< `*  `0:0'8'? p-0L P@p ; `  0002  R` ^L00 S 0OPV@p $q$ -1@LP H0 `p 1 R 0 0< S\  SN  SL  SPS000H1  R Д      1 8 0 R 0 0 _0tx 0 R0 R S 0 p0 `0 P0 H0  0 0 00p$' -41` BpL R H P X ` h 0GSȕ ĕ 8 ĕ @  0 0AMP(@ P l0l pᲀ\0 R    p -L\M4@KP  03K/P3#K 8#c[Qr Qn 0S3Q  2 3K2#K 2["[`0 2[d h0  2 ㌂#K3K0[[3 1C 0"Pr0!2"[0<P"KKK 7 Py Ps r2 ">?DFcà.L !2c N"10,Ϡl`P!PdP0PhPc 0` P@(K T1   D1`  T!T1QQZ@K&05K015K P-V0[@S*T0[.S'Q0[-S$N0[S!U0[S[#!BR[ O[3 A 1C "P[05A1!1 00 `p["[2[D?'X=$ $@hQ?ĵ?v'N$?ص? 0-LMP d0  ,]@0@800@ 8H=88' -8L@@, 000 000 0-d3 LR@P H3R $<3R Q03R 20RB R3 00CR "2Rg -2Rv 0R- 0h)V0CRt 72RD >0R@2@ 0C 0h90CRI l2Ry 0R X2@@00CR0 0R( 0? R2 0h,0CR> 0R1@@00CR 0R1@@0@C=@0 1 01@@01@@0x1@@0D@0 ` \001@@0 1 0h1@@0 ; 0 0h0@@0 D 60 >0h 0 0R t00 0 $ C$ $L? -MLM1 0 p 000CSp(KBKII  D v0T `0 S` @ T LpP@VP8K 8K 0h"0C4K02K#K t B("(04"43K@QBK0 5[90K  5K*K L @ 0 B$[4[Q04KD 0 D B0000 <  L@0 Bu,DPt 0 P0! 0C0 0 a ; RB Y0 R 5[TK< 5K06K|NK xpPt w5[K R@0 80Ba=$D?'Bgfff -LdM∠Kd 8 !<(K1 (K:P> `@p10C0P P  Vp W@P0 `8< 82S W@` d0008#88K@0 $K 0 0' 6S-LP` 8SB  zp 00Q8  X@#8  00Q`8X@   #8`@@Dt `X0 R0C  (9Tp<d?$ -LMt!0 0 @P  @ 4QPEֶuD q 0aR0 ` ( U3 0R" D ( R4 h 0X 60aP?`VP\\0 R0C6 l P0XU<'?$ -0L R xPx`x@0 $0 p0Tk 0Tia$ 0-@LP@40 00 @0@0訷?' p-0L M @RP+ 0`0 P PE*ueKpUt 000\01KP01K01K0K 00P$'? -0LHMp$Kh`KD00 ZK P- H(@"(D0#K0K"K0 0H00< 0 04P  {' з? -LTMl p |_l @刴d?` B pQ  | B 4/0  ? p 3p&PE?n*T  C>T N0CT R>Tu >TA-p( 0lpX >Tc 0CT 0T  p0l0IpX 4W. X0S x 囍x\ 㕍- 0:0`偳(K=T !=Tv =T4 =TupP 4WX l 5@p x xpBp d=T` '0CT 0TSpP,= R p  |p X ,FpP4X 0 S <R  R 0CR H= Xp0X,Fp p Tp0X \,]FpP l 5@= < R9 X=pP gpPpqpX [pP (p X X+1FpPX0 \U;Q= ;Q 2 Qp;  Q K0XpPXpPl 5 0"0p  * 0*0004K?4K P;$K NK:Q !0Q;Q |:Q :Q x:Q p:Q X:Q\ pH:T @:TE 8:T,:T" $:T :TxpPpqpX 9T:p pX 9T 0Tl 5C = S @S 9 l0p%9 p5pX 8 Rp 010   j,X X0/ @9 XPX0 8R p 101zl 5 8 R@ 0Dp8X 0X <08 XPoX 0 Sk !.X0 x Zxp  ! ExpJpPr !p0!  x EpP xX 5 Qp;x7 R᎝?@^ ]>P x *@N`K@&@@(7@4KDK `G$K HK l x5 0x 㞑pP(X6 R l 52p 6 R  h6X 0X0)   6 XpPnM=@V   6!h%0@a  20C%~pl 505p0 0S/ 5 pp=pX ?pP4 R j$5X 0X0, <5 R 05 XPX 0S >0T0 p X 0T 00bYp 0{SX |0 P\ d0 t UX t0 `9  |@h p h'n #nt0 0$30 R0S   05 %<0 S  S  7S  nS  0t B02 R B000 C B0 2 R0x0 hPx00x0p0\ | rDpPp0 T0 p0 X 0T 00b Sp 0d | Sd :|0B\0 p^pX ㌐pP 廊p X X!CpPsX.p 婊$2X 0X0, <2 X@PX p0 m \及1X 0X0, 1 XPX0 p0!CpPp 1S n?X 0p 1X 0X8pP"l 5 1 1 p000p@ q?ii i5i i i iiii 81-71$%Ci8i|6i(iii8i i #AB` gfff?B#$$'ppX 4p3p0 >! CpX 'U lj 0  g 0 Rh 0 4K04K0$K NK[| ݉P 1Rc 0RP 0CRk 㚏PB XDhP1  : 0 R; l1 4K04KAX0 u 2 0T X 0Z1>p,0Xp ꎝ@? x JxP X 00"0X 0S00) XD U#D2 RlBX0 u sl0X 02X 0000 X 00200X0 T 0X +002Q' D0CQz >0QDv3Q. 0Q=(3 RX H3  lX3 u -l3 p j3 @k b3 f ZX0 pN3  Y 3 R 3 Xp<1>p,03 -LR=CK5K [0HA5K 1!5K %KK01!#00 `1PN 0SK P @1@!5K 05K0%K ;05K0K5K0+0 Qʀ0KK5K0'  ###: -$$?? $$$$*$! -` L@LtPi@Djte q쁟0 ( TXA 8R  #8X PR 8  #8X PR8  #8X 8#8 XJ,z/ pP 0@R0 ` (  0R  ( R4 h 0X Z8 T<<8  002<<$H?p? -LMP,0 60  Pqa,0> R6 l vF R6 l 0X @R6 l 0X 60 f@P R6 l (T0P R6 l ((0P(K$4xV -L0M`P? QC ,3P 3QX Fd0CQd  80*P/ @rR8 p 0X R8 p 0X\ RL8 p 0Eh2  0TP (K0S,2.`K0K2K02K2Q7 0Q0ST2K?2K.`K02K00C SG, $    0!02K0"K|.`K2K p10S4 `10S* S[.`KKh<@0 fL=  +A$[P& >K 8K  *K  0  0D P 0 0@0@u|o갤[>0P 6[Pc lK 0 <0< P P8 <00 0lK CM @ 0zp G,P 8 ,00 @0@C= G$0  K''$Ը??? ?`?? - 3L  8sc @RR2 d 0X R4 h 2X蜢b r0R2 d X 0R0 ` ( RP4 h 42Xsc 0R" D ( R4 h @0X1 Rd &4  1 R0C4 h :XTT1 R0C2 d D1X 2S0M0 R0C4 h 0X0 R0C4 h B=CX R4 h 0X R4 h 0X~$p -L$M8888H}/` `P, 8 $K4K JKpP , 0R(K˯ FK Z ᰯv` x 70P8$ ! 0|1( ! ` > P DD7D'p0C 0'00(7 ' <07 pp0d '006 &6pp ?$K3K@K0P66#[   6Q Q) Q +>3K ,6$K P3[ST&000  ,,媶 T $6:@K3K 03K5 P5  [^5ࠃv5  P AM(@%5n 0Il 0C0 @e0y_0@IU  cᬰ$000h$010s4 4@ Q 44 $}.  x42Q t4Q @$0 <0,4D   @4Q $0;0,4  W3^ʎ04\`0@  03\0003@ 0ʹ|c 0Ǵ0  0Ỵ 0ᵴc 0L寴0 20p 0ᠴb 0嚴0[R J20Y 0ዴ 0bㆴ03L (0D  0x: 0"r01 0k0(2(2 P0À 02 P 00 01 0Q0 0J0 0C 0=0 060 0l/0 0T(0c 0<!0Z (0p 00g 0 0^ 0D对Do'? ??@,?+ $$$ ı@4?$'(j)'_eNaL=-0 |0"32C0cPP 1S!0S!0SP~H -0L@P` 00p@P 1ж;0 l= -L@P 1帶 0-P@0@@L 00000 -LP\`@0Sp\@0^  00g0   -8(L`P"x lL@ T0 _     qhX? S0-L@ P 0P 101 0 0h8 ᰬ0hu? -LHMES, `Ph l0 (ھ0ᲀ0 S0 Nh0 l & l@K`pK!hK 0nPaK hK @0KdP 8\Da [0R 8 8D, 0R(KR0 Bh0 l ͆0?a[ '[! ? Pp @P  Y:<$ @ @ 000CS d d d d d d d d d d d d d d d d d P :0 0:0<  P2: < : :P;Uq8[\P2@@O0 h0    h0hKⰀh 0h0 岠h0h0 ,2岐h0 0h0 }040K@@(0K {0 0B@(0K t0 0B@(K i0@ 0B4 K0& QR:00:0:0< 0R:00<0ĕ:0< 0R:00<0Lz8 0r(卷 ,0S㶃 8 ^ ; R  8 O  0S 㴓 8 t?01d08 D0 Do#h?D???P=??\?'$? -8(L`P"x JlL@T0 _     qh꨽? -PL @`p8z 3>!R 8 i  _ !1S?!RZ듍 ZPP 1 8D  ᠢ`1_0 3ᗢ0P8PD "2R:0O  1  0 0@0@<0!0 1Sq<p10q "8   "0% ᝪ`cP 0 pP 1<1202 ?Ľ?.'?ʚ; - LPDp`s|P pE 1‚32C0c0QA20`><@ ,=A?0C @300  00S 0 0=0h 0 0P0 00@ 8 ᛱ00 pᱳ~H&$$& !' -SLM` 0 ʼ8b(K0L 0  0A 0  V@K0KPK P0SK 0KPP  WpPQ 3iQ> Qb 8 \P2  O    0Y$ 2ᲂ $ ڨ K0 K& :⮩8t ᧩ 0k2 R@ 8 _1  1!Q ʼ89 @pAWx1 R0S( S Y@PU 0  Q9 A 0R  R1Ḑ0 1 @PU @@P8D@T 8^  .{PP@101Az0@0'H?t??&&??ľ? 0-8]L@P 0 R 0t0t P00h0X0 qP  x +>8  0hT $&$$ !8? p-CPID@DL`ر0 #DB@@0 00 R 0\00 0   R 0 0 0 @Pzz 00C0p&$& -LM8pş@`h5P, p P5MQ@| 0CQ 0CQ Tpş, 0R(K4Q :4Qppޠ4 @T  0{S|㨐K˯ 000@TI 0|SE:|pH| ) KS]  KO]L4K0 6K34K3U K#4V0Kf KK:00 e0Kf K:0 f [(0K0=0AfK:0 f [(K 0=0AfK:0 f [(0K0=0AfK | 3pP ۟긠K  !3pPD3 s@T 0S`؀K@T 0`S:pF K K33p%`K 2pPPp  K3P 00D0Q 40> 900) 2 4 ?* p-PL`@U 8.04< XV V Vph804< XVph ph? p-`Pe,:L!;@,:5=5i847 0T8@4< 0X84> 0X P 0jj@k3S <0$"03@T@l7S <0$07@Tp -LMⰧP b0Pe 0 0@0@0/"-0?0b b0#RO <0(C\E 0 00 <7(r\ 0 00 W2@7#<07(`V  $0  B< $03 0 0@0@0 0@0@7rW'尧R:;ü:7S0Ӻ: 8(*4@0T 0-@LP/h<308# 0g -LM5P+`,:  7p 0 @0  BQr0CW 087(*@04T05 020#R KUP P0@DQ!0S*DpP  i'7R 5;50@DP0S*!00 @0@ 10R!!  10C1 10R!!  10C1 0-@LPg,*  839,:R0h83 <30S ,2)S,* Ph 0-LM'P"X0  @@RC0<(\ ; B$0   7G7GG8 -LMPP ;#@P7 0!0 0 y<凁0g 1 P 7(K<(\' $0 <੕( \,  0 00 < (\ 0 00 Z 90,0 0G,0@,0, ?WA0 @<(\ 0 0 0 ,10<(\ 0 0 0 0/"-0?00b9? -L@9?Sj7P -L M9PP0 S䙕sd3 0*R1z01*zpz0/"-0?0Qb[<I( b\pO 0 00 <(p\,p  0 00 X=1@w9<0C9(`V  $0  < $ P#$2 @R``  T 7S 0 0@P0@ 0::pX,p 䙅p (K:S0D0 0 t!0Ca% BbQH1 L! 0 Q AC1 01*pz0 D:: 0 0@0@0  ,: ,0  202, :S 9S202P  ㇋ 0סE  2022:S 9S* 00C0 07t  0-@PL YYYZZ0 0-L84@7 0TPPU :8047 $U ,:  84 0T0b@? 0-8L#88P814` \@@T 804` ,PT 0h;\? -PL@p`ΗP#0R  0iVT'!&!&!&!&!&!'!d 884#8Xi 0f h j {b tt? Qp-L@ plR 884` \PP⦘U 804` ,`PU 㗘 p804$p? -`LP@_P#@1pR  @ᮖH$TUU* f U XU  ᙖUU Ud 804(@ᅖj 804 $804h (@804b (@@tt? -LXÐp0 6H804P@T`$00P d804@PP T`$00P 804@PP T`$0P dȀ P 804@PP T`$0P  -LMp,  804@PP T`$00P d㹗804P $ 08#804@PP T`$0P d㝗Xʠ,0尐 -LM8pK@4P0 P T`$<<0P dzZ*804@PP T`$00P  * K804@PP T`$0P 0"[0 X 804@PP T`$0P (K -L M80 "Kp@ `4,x+ RP# d;R *X;R| L;R9 &R7 !5CR,: , , 08: F0}0@:@:<*P3*S!0D\3 }0\3 D,:@ f @0PK80 4$@TP#l:R d:8 :(*O <:\+ P#0S \Q  "( ; < Q)m}>0 `@ 0 `@,0,PP  (KR R R R R,:, }, Q , x0X3*K0C"[96@KR0X30 0PK 00[S/0[S.0[S-0[S,0[S+0[S|Zz  t+0[ 0+0Ko<7{ '2 4P <0'07@ :(*W<{>0  0 PJ<7'2 P@L hX<08804S $0!0@\3 St @!0\3,:0,:Rc }R] R[ R,  , ZR h RN RR R, ,  , t<0'"8@Te 2<'?0  B  6 P@ @[@Q <0T<0$P#",:Q , R R 5CR,: ~, ~,:8, zB0\3R R Rp,: , kR R Re, R R R], S , X,  , <$> 0⟮?@D0 0@ ,,P t<>) 0H4 4P 0<0 )0~<> 0  0 P i<0#8<)3 P@ S<0@T6 1<~> 0  0 PP@ 8@\@Q <0T<0$804 ,tB 804,00r Pp,:l" h2*1`2`"1\2P1!0 0B828"$1! E  ᓢ,:.  0 01!@31_@D#H3!1(f 0̠a0CT/  T8 ^ Ṝ804@Po T`$<<0o P3 S804@P T`$0 ,: "0"|@H|t?=?? ?)nn8???\???*?? ?L?p?\?!>!!L!\!'!$&!!!T!? p-LM80P4D ,*x 3S<<: 0` 0 `0 ,:" 8 <(4"4!<4 \ 8 <(4"4!<4 \840D \Kp84 0 \8@4 0\ K`P @@゚ P 00 @  01 0 0 T -LM匒 %08 )  ,:@  004 X0K 84P 0T8@4 ,0\84 00\8@4P 0Tp98p,P`04 \8),04 \'8,0@04$ \'8@,04 \8 047 T :Ss P#1RC 84@ 1\84 0T8@<4D \ :S1 84< 0XD:8@8#84> X8L 04\P#1R 84 0X :S =(K84@ 0\D*:P_804@PR T`$ 0R 05 @0;5,:9,:Ӣ84@ 0\t? -L`P㟑pD00 @0@}fh? -PL@`p們<1T% 0CT-  0P|@4T ɐ0T 0T0/ⱞ@4T5@ @᳐5 @ Mᨐ@50@5 0 RP@@ @@i 5i 6i( -:L@@`804> (1PP P`Pp DQ- W ,2S 804> X %7Pp` !00! 00p ,  ⃡`,:  Ap`p`  ,804H \#`4 2 -@QLPppU@4LpW?`0OOP$ 2>AB?NPP``0O?0@@ cAQaQ p- @L`0T 0TP$ U  $8P pp -0L040 T -,0L8l02 0BĶj -,0L8l02 0 BĶj0 8B0 -1LMpQKP 0K 00`P 0@  T 0@`\ ڔ 0S 00 S R0Ġ T 0$ 04 000Ġ B0nj4nljg! n -04Pp008@L `T0 T0  00G  0Td $)d㸐0 T0@@P*P 0T 0T 0T0 T $P 0T0 T -0L`4P 0T 0T 0T 0T 0T 0T0S0'0 Tp0 T}N@T 7 $  T 0pWd'}~@ $ pW 0@W}~ $0P0P@0T A@T? 0-@L Վ04 00P T0h# -0㈠4p0  LT64 Qg  $  0PT  0T  0T  0Td㸏@T T! 0  T0So SO!M!O!,O!8O!`O!lO!O!O!  $ P5 P$0000  T  $@P80  T  $P000  TP00@0S0 0 T !0 T  $P  0T0  T  $P00  $0`  T  $Z0P  T  $0@  TZTU000e N0} 0 S0 00  0T  $q0@  T@0  T0@ 42P ("(Ÿ0 S[00 SY QT ᰜ< ᬜ WyPlf 1 R0  01Q000pdQ 000D<40@000~m  $0 r0$ 0440 0S0 f0 @0 0 00\0n?jljg!t?]!KZ Ƞ ,4Z0 8 00 0L0Ba21C0aW  Q  R ,{0 0 颋. -BmLp@8 0\(P320 \4 0\PL QD00.\8SM0 08 \ -BmLpP0O/\8-0\@Q/0\R/p0\-T0\@Q/<0\R/$0\p8 8  -LM(0B}(Ⳡ`R(00@  ,0 Z, [,P<0, \ 0H \, P0L \l8S 000 p-LM8@SS0 `0 0P 00 R x8t t0g/B(\ 21C $0  B x0 00 R| -`0L R B=0 0\B=0 0\ -,0L8B8  \F -0 @B8`Pp4 P0L< \ 04 \ -0 @B8`Pp4 P0L< \ 04 \ -B}0``@PL ,  4 ( 00 , 40 p-BmLHP@ ,8 0 \pPh!p!x!!!!`!`!`!`!`!`!`!`!`!`!!840,($ ???? ?(?0?? -LP@@dT Bm0tp ,PdT  4%#61 \1 0m%8? -@0L @R < )0 @ h -L@PPÁdU( B}0缀 ,idU  49 \PꩁdU B=0 ,0 P պ кT? -L@PPdU Bm0Xp , dU  49 \ m覺t? p-LP@@\dT P dT8叺p,`@0 @@Tp?Ԍ= 0-@LPkT T 00CS 0h -@LpST` T``p0BM AQR` HP0W/,080W/\ -BMLDSpT 0`\T 0\T 0\؀T 0\πT 0\ƀT 0\㽀T 0\㴀T 0\㫀T 0\㢀T 0\㙀0T , PPZEBm省@AT 0\぀0T \xPUZT 0\mPBm0T \`0T ,, Ŋ@ ȠT 0,PE\KuT 0\@T 0\7T 0\.T 0\%  -Lp!0 Š B Q@= @PGm 0P"`@@ 4#T0`G]P@ 4*T0P -L@03`PPT P@3#0Pp1p#S,X!!!؊!!!<#83!3yDp V #"2! "8S 8S FV  F B=0 ,D2!p\ ("j"f2!a#)D [!!U1!P#@ K!F1!A#)D ;VP! -5T!0P1!+#@  $$1!#)D 0V  ~   0!#)D  f -8 <0!  -S==d===L==,= -2LGM2px2`p 2P AC81 , \Ÿ4!  00 PP`~,2Y P0 P \0CI͇0@40C$0@010!8!(1(!10@!0` `S-vf0 0(3 0#2 嵛  X03` 0 D0C @<0D BD0s pl!!????4?X?ŵ=յ=(!!!hp!!\}!!(!`-,hf|? -LM0@S  # 0 30 S80(\  $0  B 0 0$0| -(LR00080 000CS! !(!0!!H!8!@! P P@7P,@nPX@l`0 $H0AhSw(!@!@!@!@!@!@!(!!@!@!@!@!@!!@!@!@!(!@!!@!@!@!@!@!@!@!@!@!@!@!!@!@!@!@!@!@!@!@!@!@!@!!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!!@!@!@!@!@!@!@!@!@!@!@!!0 0 Rf Q Q0-L@P +  0@ +T  08#0`08#0@jPj!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!      -L p(6"L#T".d"Ƞ@0P`p@  W0Y Y 02 04Ƞ8,Ƞ< * 0"*#"#? ## 0P 1 0 0   !4^-0, I *Y Ƞ ,4Y 0 8000P0Ba21C0aX  Q  R ,{0 0 颋.@PL!D!0@ 2 "8!2"10@!0` `&Gp1!18!1(3!1#2!<J , X0Y1  D0C!@<0D BD0\ACC- P 80hq  C-B&p@$P@1P DU=0@@ P20P U=0@@%0@ T=0pl??ŵ=յ=" " "8h(!`!\pB]04@*, 0\pT0 -B}0x`@L*,P ,8W0*W,0 \P0 -B}L`@*,0X ,Up0 0 *U,7 \P0 -B}@`0LPȠ*,,0!,,D 0*,78!,\0*,0 \ -L@``fdV( B]p*,0 ,PdV 0*, 4$610 \1 0mٟ08? -L`ppfdW: BMQ*,0 ,dW' 0*, 49 \pffdW B]l@*,0L ,0p$匟凟0T? -L@``8fdV" B]p*,0p ,dV 0*,(0 4 \mO0t? -|1L`  (+ = R' B]àA0 S p j f PA `0 %Z+d T P   J0 %Dd > :  50 %/ip 0SS Z  ^0 mc= =, -pBM@BmL `pXNsLsZ *!!!!!8pFl8HS 6a"'l(RRA RC R 1  ^0}s  08p8pssUBM0P*,l ,0`*,44 \l(tl(hd0 -LM Ip, Q0P@L `1 PQ   PePB 0\E Q8 8 8SP 0\D1 T\8` V0X@1 p0  @C ADP0 pŸ  04 P`H2P <"z?C0!,2K͇ 0 "40240C$ \B=0 0\_ -B]0`L@p ,0 \W 0l ,8#8:D \0, ,0 \,( -0 @B8`Pp4 P0L<0 \ 04 \ -0 @B}8LT`4 P0<4 \0 84 \  -@B]LLp`@ ,\80 00 \ p-0P@B-0PL`` 0..\\8 |Ph PhB=$ 0/\pf -NpLP@l0T T6BT8 004 \1`V@>.4 6.02/\>.4 6.02/\>.4 6.02/\\ > 08".\40. 08/\ -0L`p BMP*,0 1# 0*\HBm08PAK ,0 \@ P 7"7"7"7"7"7"7"7"7"|7"7"|7"7"XTPLHD@<840,?8?@?H?P?X?`?h?p?x??0? -x9xIt9t)QL ,TI   4-3,  4/3.  4013 M@xP8 P 4U0D@8(QH 4#(Pt8R 0  L8 88  $88  8P 7 ' 0G 4#8S7'000S 7' 0 B0h7 xm?`pO@@)W 0@ 40  4X706p 0 S00ƅ60S060ƅR`m `pO@@<\V S@ 40  4(X706p000S00ƅ6000S060ƅ(Q`5 0S `4# R }oxU  @ Ȅ 00< C<S0?!"P0 0< C<S0?,"Q΂yY(pT/ $ =8 4$ 9 D4 $ : 4$ ; 0h$Sd4 0C  j <4<$ k  4 $ l D4 $ m 3# n 0#S3 0C  # 3# $ 2"Qp3ʗ0S`3  X3 $ B% <3<# &  3 # " X2\"ŸQ2 {0 ʇʗ0 $0C0S" ʇ0 0C0S 0ڇ+0ʇ 0 00S000 00S00R@0`@00c``$2  0"0 0N 0S Q00 1!0Ss 00S00nM$@P0 P 4U0D@B=0-,PH10l0J@;JdT B=0P ,0@$gb(p? -1LP8p 4101   0P3':ࠃ0A1 | B= 0`\p0 0< C<S0?,"^΂ 0 0@T0QNSA: ^00S ^1 H7D`P dT1  @@ !d00T H7*0`0S  T0D@@  % < -L` @nH B=0|#,p3 R 0C !R 4BMDS0#\0(#, 0#\SBMD0 @&T r@ 묂0S( "@D ;50@ @  X @"/ ;60 A' @2 !R[BM0QE/,0E/\1 R^ u0SG 1 R 01 R s 1 Gk @d1 !R0 R 1 R0 +O $H 4F x00S`0 S@0X00S S7(='55(6(''''=( - K0@ L7 bp >P 7 b ? @7 b V W2 RrR KP B=0", 2 RRR zKP vB=0L", B=0,"/\2"2"P \S WF1 1P \f BmA0!\1!Q> W$1!Q!!0Շ0՗00.0  B.iFR 'KF #Rb KF  ;00! 20 0 0P \P$P0/,0  WB=L :00/\P$ W9(,:(''5'(p01(VUUU 0-LP0qx0@PP h0h QT@TT0hnF0'p0 -LM }2 p Pp  0 `Pb !M,0K@0 0 *,`P |Q 瞝(,  ;4`PI  @;`PC (\ 0 0; 0,p 0 p 0Z 00p  BAD0n $0 0 0 ~  nM@`P L L)(K0!$|?/\+9\@0 0; +<\`P9O0 }UXIX 0 s@ B$ \$9T@@CdT B0h/,0 dT } L<`} CB=0/,d}~>/\@/08\+7\@P ;P +<\@'0\'0\@ ;P  0d'\\GB] g @\T,7,'Q00 , @@dCdT B0稦, ,PdTpd&000/,@0}0/\u-B;\ 4&0\@  &0\ r0"C`PE\ 0P+@; )00 0P*@\E 0P+ 0P+@0 *00Bm$`^B缤 $1\@ @0\ P 0\)U@0 \ /0\@ /0\ @$@4\@@BdT B]0c/,0 dT >/\@0!.\]M@#P0A0S @Tt3 A QRT3R 0G@3S 0A,3B 0T:R0S0"0001 +0S.2 0S  S 2\ @2x"Q` r2"Q(8p0 0rBM뤁0",!0 4!\(10P i`P',0\@/1\0  `1 05;@05( 8S   D\0 \0 @21C! c.  @JT?8(l(?|???='p0?(pp|'x(z(|(''5D'80' -PL@`pc@1T* x1T4 p1T  34P@4 ?<10S01T4 0H@4T?@505 0S' 5@ @@@  4P@8S 5A0AS@0H@0ᄿ5A0AS4@Di i i ϖ1i 0-0| LQP@AT@05 0h]i<Ezq00 @0@0'? -LM` p` 00 P`  0 @Pe ",0K 0 0`  ,@P  zT p`,  ;4@PO  P;@PI0, ` !P;B  L @  2@P/ Z, ` -00.  /00@* Ԑ!  00 0  @P; y;(Kly`yXy7@ (\ 0 0; |?L80཈841 `H R<; 㾤13HCA7@P wH7z"1  0 0<1!0!0 0= K00L$1 H1KK L,1 ( 0jH1 0HJH00H 0   0@P!00P P!T 00 0(10G=  ?R8 0$ݣ7@HQ ` L@wӣDo<=<|'''' =?<<<0= -LM5P=@S`0p"  1R0' '  $8$80C0C$8$80 0 P  / qPV1  051 RY > RU. 0@ BT0S*8S. 0@ BT&0S* 00S:A BT  1R0! !  11D0C0C11P  M/ K@P 1R04( 8(  t8t80C0Ct8t8 ᦕ00 @0@5;5' -LMP0 0B=0"00180 00/3<0 ,8<0,  01!00,0 Q4 F p01ထ0 @Tp ) (`V $0 0 $4Q!00@ 0@010 0  0G̀0/"-0?00b, AR08< 00l 010G= ?R0 02<0   84;8(Ko|'' p-8LS@0` hP8 0# A80p@0SA-00C0C00-0 RȎD -LJM B=, 0P/,6 @ @ *00T@! D1 50P6 R Ds@D N?K0 4 фDᰔ 049#$ %0(@T ^= 00# 0%@00@Q@ 50H1 (\` ^=  0  03 0 48< { ;vP $(\A 4A  $0   崤0@ $4 4 0p;P< h$ p,0H!0-  .00/  @D10 04:#:0 0<8  @@  81081  0@F3QP 0RࠓࠃQL00 Xx3 ࠁRG  00h#0\3 0 Q<3 0C 09l  S| 3@D0CͅD0> s00 @0@w0S꬝"""4"L1   @TL@2<A ,g0 [0 S00(4ڋ$q ,0 ,P\0 2S P UZ#0  0N \ @\@DJ0NS` 2"0 P`0, [0 S, (K20  @H>00!0+0!0t<= -pHLT`p` Xꈠ"ġ""""TBM0Q!,8\!\@ <168pl8S 'Yl(RR' R) R }8p   8p8p}T il(l(h(2! -< A  ,g -0LM PR B}0` ,8S  0h t 0\@0 0; 9, 0\h,"8S S0 -B}0haPL,,p@ P,0\   @" %(+ .       @       ~ 0-LP@#e4P 0p 0 |" 330 2S Q <0 5A0AS 00<=  0-0@LPxej>@3B @T]80P/0 BB--L` P|2 2RR8  <QA`A@PM-U 5 (6 #@P`h1P/UN>0@H1 @!@1(18!810@1!0` `l=e1!1(3 0#$3 0(#3 0 #3 0#2 Zb ( X0& 0 D0C @<0D BD0 0hq?'= =ŵ=յ=Ѓ"h""hĥ""<."."."3"4"Lt"p6"@""`-,<.<? -2L M P `0@@)8dT B=0*,0@s dTUq9q1?1 0 'q@3B pP8@T]m8`pP ( q@D3B @TZ 000QpP0 Q  0 0S 0  R B xplp^0P PA*zl?'`(Y?'''(?|?'Do?\?l"رj -1Lp <,$!$(0S!B**("(B! ! o!CL  ("(0P,,("(0^ $,       tL  ("(,iTLLLz("&+ 'U -0LSPp #0S L+("(+@ @@Tc_M00:C d3@T0SPcSDc@0 @pT Rc 0BS c@0 @_5T RJu .U2@T* D @B2"Q  5 1T2 0C R02  $$"h"- -("(Z  aK00 :C @Y TaALD00:C 01@T|aJ109C \1@TdLa K10 :C ,1@T A 1@Ty@ \p X Tk `<`< H D꘺Tv+t===&== <<x|nO),'===5 =5$TTPPI=aq -@L  ' ("( ("(,h, p-LPL@ 8`("(  phsQ 0S0#R Q 0  B=0 $ -L@h Q0-LP n? 0m/00m?@C q0d f"\0R 0S 0m0hRyn?p "("(RTP 8#8 0 -`L] 08# = P-L -LM0,  㰐Რ\Ppp` `0eS0cS@`VP0V ( 8B(C62 ~0P, P0-:@C,S 0C8:0?S?0?0 Q p-LP!h@f@P P  @{@Tp 0-41"LRP 00! ,0S:0C *0b10 0?A2c>S@>@OL G$( ,0S t h \ L @ 4 ,0hP |gfff  8( c31 0P @PP p-0L` 0   8P@0Ch h0P@@\P* phc(PK$H H|  0- 0LSP X@ @00\T@ @ 0tT0 -Lp@0P`  0S 8$#:# #("(X 0S/ X (" 0S"ڼ ("(, 0Su t , \0SH XP T 8 L$H=08#8T " *=08#8" b/=08#8b/ 0S@ AQ4,\0SC/4\封0DS;#HM- ("(8X#P`0@ p  |e w0 P@^ X`(08#8^ $z*("( YO~a'+ (-L`"X@p  4 0@(T"X 0 S R10lAC 0CS? 0C@m@S@P @ -(0L("(0*(A- BRq0 /h 0bS1b1P# &L#$#&Ġ& 0`@ -pLtP@`T@ @P P,@ dU`U 0-H0L0P@0 ,$0 0 $#20 00!  r 3R0000   -rL@z@0@P00000 Q0C @R000|xkN -Lp`!HPY04 4 0P(U"H -H0L0@pPK/\`,0K/ -L0L0P`@K/\p,@0K/ -pL P`@!1 $O\H@0 \0@1 0C\ -L M$  0@  KU -L M@00 @K--- p-8lL@` 6P#8B.X`40, 0`4 XVp",P+@P P -@31CLp`PP PP@0AT  008#`08#H0Ba(0 R 08#Mbf -0LϠ̠ 0( 0@0l 1 \ -@0L 0( ,  P 0-LP808 @ B,H@@T05@  0\ -0L  -0L MP@ (pK`. "K @ 0! Q @- TK p-L@cP+2U  80(0PP  @pp`UdU -LpA`@ 0#0PW@ @p P@D  Q+ @J+0@ =+dU`U p-`L@Ph y-+T s '+@ m(!+,P U hp蠯 -@!XL<p#X`!O K* E* ?*,9*-O`Vp \,, $*, *,  -LM0@  *KD0  *K> D` 0< 40 Y`@ @I@I``T@V`F*K,K 080 T0 T@@ D,0[  + [2[08S9p 0^S ,0S>0@``1@T  6`P@ ] KQ0@11Sʜu]J01">R 40`1l@ n` RL`]`80R4 `!0 [`|CpH??=$?ȡ= -2p"LQ= Rb0x"X0/(HD"0X0,"(@>ʠ2,ʠ#$N 0R10% R. R ]!1P\E ]0@T@ T0@@Rxh10d1P \1PE P\81P* 4\00 110!S1 !1 1 !111!11010,@0T@000 10!10 S000! 10t0110p 1T0!1| 01!pC?` h?P S ??x#8#P"x"m##Ha#T""""\"e#" }\Ч=,? 0-1@L!P>.(<#$R *\B @b\0R ([\0\ 0 S 0 S5 0 S4  G\0\ ?\010 ^0$ 0 :#600|0 $0t0 1G.0!2X0 $0r01s01t0 2L??=p??#r" -X1@LPpP% P 414!Q à 0n010   0S  R [ [[R 0n01`0 C  <\0Pp@ 00 0 RL 0004 000v$C= ??? -LMp`P  [,K ) K2[ S 2"B 0S 0S>*P z[`BR0 ,t2)[h"0`2[ B0 8 #X,2[(" SZ 2U  0 S R D[`!1 B PU 0X 1   @t0C!! PX0/0"0)[0P!P1 @@T .`P ) K!a[ 1 !PP 1P) [Z)0[S4 #0  Z`Q ZL|0 Z`CC8 `<0?vt=L?lC$=p?r???? -`@p0PL.,1 010P,00 X |0 R lZ,8\0,,0000 ? -@P0Lp.,`43.\.,0S@@!dT @ P dTKZ<? -p@圀0P`L.\,0. 0J/\0.,J/, o -@pLP>.(0`@.\P,7.0S8Sw1 011 01 -LfP p0@P.\`,0.0., @ `0@T H0H J/, $0TY< '(? -0LS8S!tpt0P@.\`,7.0., F 1 01 -LM8K`P@m  pw#[3[,K0K@P ,@ 0P C[" 1R 8#H2[3K3[CK3K :(K,P0QTQ,0S0 A0C A@,0 0 ,0 0 @ 8#HT,0 0@,0 0 00  , 1 B !H, 0 P | -LM1p@ Nx1t!QI )PKX PP 0SA p P;)0[( ['[&[ 0  ?0? ??)0K( K'K&KP"[2[[00[00S 0C1UA% KP[! a00B1Zc?0 b c!B0 E$KZ =P`0@0 0Hx p-PLI8`S ph80 S $@~00B (S/ -@0L <4,4!Z Bp`JRPP0 88 S L23:I^Oh1@`0 4`NX0ZPF) V/0 88 S-*Q ^`N304 8<̠Č@ Č#<\0ZPFV  t+Xd&X 0HX8X(X?0&088#8#8ESF0C8#Ƞ  0b8#Ƞ\ 08 #(Q"(0S%48U# U BTp9S:0C8#Ƞ -S.0C0C88#Ƞ #Ƞ U 0Uppp|0   P 48U# U p U (0U pp pp?| - 0LSP 0@R`p R0Sp0"R 0@`p i0S 0`00@ p@0@`pSP |? p-`0L`hQL[\@\P0S 40 $f00 @TpU -L!Ȱ`oR6$ᘠp 99 B1 0t 0Ph0h@ `$6 Q 0q Q(08;8?$($,$U -LP`p0.,@P]/ 0,0$00 @0@8 0 -0LMp0(`\P $ $0  B 4@T , 20 w0/"-0?0@bV4` U -x0x` tP00pL ,J$JA1 \8 0 U -L`0p@R0h0 1 ,:#&RS R @ T xQ T \!TT0h0 0\@$$0h0 1 ,  @ T Q T 0h0 0 0\ 3 $0 01<(0@P0PS `0 $2~000S p00U@\T?? -QL`0p%3$001<,0@P0PS 0 $~Qip0 @U XYx0x  QL[T@TP0S @0 $} 0 @TTT -LMp, , ,3$00PPU0 "10 0؁<(00@`0`@  0 P , 0 QU <$0@h1 `V@, k (K,  R, ;T00@ 0 P @ P,@@T a 0fQ<\00 P0P 0 P p PT L 0fP 0P U0,  ? ?H?\QTT -0L M`,z0(\ $ $0  B 0(@40P0Pp@ p@U@P0(\  $0    00PK K U -$300 1L@ 0M  0 Oz0(\ 0 $0  B p0ppp@Ph` 1 1\$OH 0\$(tTlTpT\T -p@Lz00S* S0  ,P` 80UaP@10\0\  , a00PPP `@`=dU 0- L M0@'PK0C$ KPP Kl0l  ,41C  c<00(0 Pl~ -!L M0p0KC$ KP1!Q |1  0 R'c0CX!@P \`,8#87   w00S/ S0 ( 0\(K6$000" c`P@#9 \$l 20a #9 \40, ( ?\p!Cl?BC -0@00L py|yH0 88 0  @R00<<O y81|1 -L0M`@VD@T@D6,D@T(())("( ("(h`  ("(D<4&, 0Szp ("(zz ("(zb[P7 zz r ("(xp%h D ("(,$ ("( }0 ("(t0 ("(kZ-gY.cX _0S t*("( Sdk ("(LJDb@$4 BZ` @ ("(8z# ("(z2@K$x03K0K2KAC  Cp  {0SPP@0VC @ T @D0Ÿ,C @Dt ("()("(0SU@ᔢPBKp 0 @TPڶ%[%[(%[(K "f@BK @TP࡟@DBK@T. /   ,("(h`@ ("(H`@ ("(`y,("(ppP {; HPW$HPEpUW  DpP {#p HpW$HPpUW  ,ꢠ==)="x -8L#8MP@0  *K< w080 40 00 0"p0"烀<8@`H4 R Z  !*K wX_X080 X0080 C)(02R   2@8@0 z10  !*K 0pW4000S40 0 8(K)h @P *K v C,1Z 080 @@R} _ @ C)(p0R k M @0 @80 *KvZ)(CV d08 8@0 )H 7*K qv CC08` 8 P=== -2@0L`CqTP p<%40pP21C0`0gSp 0-P@Lp<0 p-@LP`~P P  ph phLp? -LM< <  @ D 4, P0p81  0! 8041 uY qI D4 "  3300<X6 4$`V $@P0@p0U̅p 60 40C C4 00 @ Fp FkFgFc ?x-#,U&#K#l##0"p"@K#",#@8#8?.L \0 0P@X`]2>@8#8?. iuCP `?X= -L,Mp "JKT imRKW3"ЃR0P0  *]"3R` +#U@ ("(R @T`\S@ ("(R8#@6#8S!h1P1 T R`@T<8P#X/ !0"8#h@6#8 S11T<8"#X, ("(/"@2R $[;(K+$"*"$[ $[*#[5$[$[$[0"[C"[zR"[ RT h1T0`!P0.BX *K5KKK0KCKzK@TK0P/(RP {00 2KT/h0X3[X  5y2[  zEP ?? -L0M,0pS s((Sk'W JG0'(X 0`P`'X@(98#88'@,7.0D@T@D7=<0D@TBM0V&(T 0/(P 0SBzp ("(z4K k03K0 3K03Kzz 0S 0 ("(0  ("(z ("(z{z8#z 0S ` @ ("(050%@P/X`(:8#8/z ("(zj$0S0 ("(0 ("(t} sk03K03K 03K,0S RY ` ("(R6CO ("(C,Z-VY.RX N H@8DQ8 X0 cf0tZǡǡSӜSLLH#< ,(D(# $@2.0D @TRbX0"X@T0"XP0/X@x2<0D @T70 ("( )("(0SZ @PLK` 0 @TPC(K褑@LK@T.  0SS) S' SS9 `@ ("(`,("(쐟@LK @T0UC Z,,("(~@ ("(uiL  j)==0t=x -L$Mp@4<.D@T@D>K^@TCS0#(H 0#(/(D 0Szz LS0 X 0S@9  40)T ` 0 @P)X`(98#8(55d (5 0 ((P 0 /(L 0S S@ ("(0 P@/X`(:8#8/H 0S 00S l'h+'d00SP Wl'SQ> ("(Q,0S RC. ("(C X 5P@Z-/Y&+X '00Sڜ\ |& 00SPl 4& 00SY %-XP 00Sژ>X @t%T0 㣤X `PF x s@Z6-Y$X 00S $ S00St4 X$ @00S }$y --XP o00Sڼ| b@#]T0#TZo:`Vt3/R00000#[I@L3@(K/B00 c 0Ÿ S T@D0Ÿ6C @.TBRP0"X0SHd 5Z 0S1 00S60P@,"X`(88"a@BPK @ T\ X (Ko!H` 0T0/X(KL0/Xl1 0!XQH 0SHx& CC ~\ X ` T  0T0 `0 0P` 0@/(0T 0/X0X0 \0 <=4=(=) |VUUU " ??" 0R00 /x6!` -1LQ@p- 8#8 TI``! 0 PX`@+>@8#8?.Z 0aP@/X`(00/} B= R! @0P` 0 P@/X`(;8#8/ Ey@0P`  -0L  -`PCL@U! 8p-pP!l8S U%  1Up0 U B (m 0p<c- ;蠘'|0vp0  l(R R 8s}*80B $ l(k(U|?lU -@L)w3+s0   l hd -L(Mp0"JKP0 Qe0<@E@U08%(98#8%X0/(T*KP5KL`KHCKzKRK0K 0 CB0/X. x 3[# 52[#z +#*#08@ #[0@| ,L &"(`$H D~ (8@m.#0a /"Rb 0/X$[*$[5#[`#[C"[i"[zeB[R@BK{00 R2KX 0!X0 #[x#[t#[p#[l#[h#[dP (K! ("(W/!Rt1e#[ DG3[T! 0ApzX ("(z, 0BSQR 8FP  !??`aˆh@|+ -0LS`p 4$Q 0$Q DP PLU@51,,("(5LD2S 00S=ڸ2S 4$0 $X,("(*("(# ,5 d ("(5] ("(]0S &3+0 3# 3.BX0Sh  "0SW  PB@2S u ny jP fP# b2Sd [{ [ \Wzp ("(zN  t2 p*!l2S8 1!P@/X`(?008#8/X1X!/:X L!C&,>!,!:" !6#!2$!.l] P Zp 8 zP ("(zz ("(zQ ("(Qx !P +j"?0>c7~g p-0LS@`  R RP D  R0 B RRuPPPPPp  R0Rx ,0S 0S0,0S63#Q "3R,0S Rn?  ("(R_0S03 L .#0SL/#{00Sm"n2 @ 00S:sy ,0S: L2 |2(R> p00SXX"ILL"EU @[ ,(; {."50S/!.0l J,0S! 1 1(R,!  X$P((ph60*&("(6iG+  c ("( ("(> "("(R5~P |uxpC02)> 0-|0@Lp .,  0S 000PU  -2pL"`2.BX "q& m0 i>,eXBP P^LDU@DR/:X0S A2S u y P  P# 2S;  .2 *2SK 5h!#&3+2SB </X*!2S Q0  i* P Zp [{ \ z 8` 2 &,"?0=<P |ˆw -LMH 00 `P@C ,K ^, <(4"4!<S  X R,0 3 PpL@,0S  X RH@& H^H ^ ^PPp@@< (4"40 !<0D <(4"4 !<0m(K@ -LLMc0@ 0 q/PϏP 2O4 0RK1S 1S= 1SZ 1S  RR R0BSvP.4DH 0`pKS0#@,"3!dKs?_P d0!u0P  04 0`pKS00@!3!dKu?8Pd0!p0P  RR 0BS030`pK@ 3!dKw?Pd0!i0uP| k`pK@ 0u3!dKy?Pd0!i0XPb NDo??@TX1PP:1 81@P50 !P0X!P0y}? t101; b/1\@ c/4\x 00000C x2 l|2`x2Pd?VUUU~,U4U,0,  B,+ -$LMP$100!0#0#?A3c03@0C @@C  B  B  (!=`P ~`P\3  6`P`P`P`PD2 Rp(K31C01C=80@ `PM`P (`P2p R5 `P`2`"1!X2X"1(  0P` \<2\$B @0AB-SQ` _25 㥳0S㠀h 068 㙳N@p< p1/Wᰀ@OH ,3:XM1T1  0@!08810@(N-B(3$1!"1!3( !U x X0Q0  oD0C @<0D BD04T ,3 E  | 1BMbpUV#tE#D ##X#X#?ŵ=յ=?hU"(U#U#lU#@#`-,UU? p-1L`P+0@@0T00000I00` 000T0L 0X 101p08U0U@U -QLMPC 0 8@?D1 R(JM4@ ` 1` R0zO 31C01C=80p( KP (0` RZ" 8@=8 BQ@8H8@ L0@!<0< .B,c\U -LP@P10SCm8` <P m{pPDO0 HL  @0!00 $1 R3 P8Z@0;80@) 8S,  mV@0@,T p吀0.,]/T`/N  XUkg0? -Lo -L@S"4P 5A0AS 4@ -PL@`p51T* 1T4 1T  D4P@4 |L10S@1T1 0n@4Tk@505 0S$ 5@ @@@  C4P@8S 5A0AS@0@0Yt5A0AS80p0(4@Dp Ei i i ϖ1i -LM8`@(KSs0J/,p@ 0K/, 2P0@KD0 PU 2唂%A@r@!U 7KwK,07 1  PP.UJ/ 0\@2 0 0@\T @V P@(c@0PY408@OIk1 R9 x1 R5 0T0U  ' P1P!0QE8|AQ0-,-0XD 1 .>_SRU Vu.D@l0@X0PD^.VUUU8?g0tU`?t?TUHU? 0-L0@Pv!hP0 R @@C 80@ R00S0S<SH0H0<<0S<<   <0CS,<00-,000-,000@-,00@0@<0<0 Qp-L`P @Vp040 -0@DL4 0 l\|0St 040x R|00|0x |- 2! 00202 -0L@3 0< p-L0`P="R p0X 03MD0 @/A#b, lpBMb# -L@P 0h 0-0P L@3  $0S0$00h@-P4@pT D`  !00\;0 #;^0 L00dL00 0@mP# 5 )P  0;-R#;  'Pv Q  Q0 00000v 09040 -L0@SS \ 0 \0! 0:0::Q: ^   Phx p-LMlR@`pt2 ` l” 0pXdB%lRpt2 ` l” p0Xx -0LP@ ra00B@0U0 0 30"2R0CB200& -0PLD`0pSS  4@0T0 1* **P\^h0 p-PL`!0 L@0U0 0 <SLp00 p-| LRPh` x0@S | 0|@Dp ph'p p-0LP` L@0U0 0 <SLp00 p-0LP` L@0U0 0 <SLp00 p-| LR@h`P x0S | 00|0 0S DX0Spp0t phD p-PQL`@p-VU 000ESQ 000 0ASQ0pp 0-LMLPT 0< UK0 0K!P  ,0 0  ,  ^ @< 0-LMLPT 0< ^UK0 0Kf!P  ,0 0  ,  ^ @< -L$MPp@H L0 8 @  h4@ +(K@* @D  P@TT 4*0*40 |1|!Q @D< ,@ "< , RG,p,`0hP00 @ L0S88 444i0 079 @ 0`V , 00 00p#J*PHq@P" @ ,00P< 0V @0  ūPDQ @0@ @ H ? -LM`pDPh@U L0 0P0 p 0(Q | R x0S | 0|KH0 < K$@K @8$ U040 $0p t0 L0 0P  00 0-LLTP H0S<> 0< RThP0e e@P -RLMp, "*R@@LgP KP= T`: U  0"100"P V `^U#`00 `V# oP  V1@`F4V g,0LDPj`, LDP` @`, L0@T? -0@Lg ` P p11$$00WW@D4(D0@T =PPT1Q@CRJD0PU@DZDg@PD 0  ^ 0@` 0H0L i 0-PL80@40 <R P P 0X1000P100000S#t#P#,#0, 1r00 0h000PD00000hm000PD PPD40PTD*P#0 H0)P DPT0@BXBBBBpB -0Lp@D0 0 Q50!uP`•D0\ PP 0S0 0 ` VPDgi(i ? -0DPLp`BU@L0@T:!@L0@T-!Lgi -L0MP,+0  Q`%8 <  D 4 H TDPp@@  040<,K < 400@K @,P[00,@ 00 < H0X  L% sH0D 68Ǡ-0 0b @H0L 40S,08 001100 f  0 0 pptl`@  p00 0pS @ @ 03 < LLC0P\ 004 0\ lb pt2 P l—0p Xlbpt2 P l—p 0Xmj$B\#бj p-LMlP pt2  B l2p (?0@# s# <S N!x``` `A! `;!  =2S! 0=2Vx0=2xlB pt2  B l•8#8p X\20\2 x!???,? -LMl@ pt2  B l2p (?h p-LMP0U`0@PUJl” pt2  B l2p (? `0S x PP 0Sxh p-L0P`="R 04  RD0 BAIt@lPp@<Sx0,x00h03-<| <2Spp p 0-LPP@0T0 -LMP`0p="R @ K0< $@K0?H0  K @7@P$ 040$0 l`t0p D0S<@Sx0,x00h03-< | @8<2S F L0 0  D0S -L@WP 0h 0-0L P@=2S 0P<2S00 -L@2P 0h -LM@P0`="R  K0 Dp0H ?L0<$K(@K @P( 040$(0plPt0 $0  g0 0 R 0 0 0 !1?0P0S0SP-(0#16S,0&,000a>000, R000000 !1?0P(0S(0S,P0 =2S, 0 ,(4 000 - 0p`L<0@@pP4; p-PL@` 8 0 Hph( p-PL@`x80Hph -LMRp`4`R 0K0S@C ( TP,@ 5<*U   0010#Q Y@, Z, 10"0 0  U ,00010# Q#0,0@0S@ `X00090l ,o @PIa oq??$0S0$0 0-L@P0h0  p-LM H`T } X@ 0 8D040 0=Kp 0KPPPa@   ,0 0 ( (@ ^ 8 -LM408 0<0 =P}<0s<0"00<0<04 @0 ,08@\^j4 PL@&j, ;, p0 0, 4R0><ʅ0 S00,0 ,4 0PLCJ 3( 25 < ( 4<0, ^0, P<0@ B00p*0 W!`<apP- ,#(0L",A P p4,<0@ 00 <0@ `(08 08p090(Ko(K<0$(Ko<  (Ko? p-LMH`T X@0 8D0$00@Kp 0KPPP@   ,0 0  (0 ^ 8 -`P(0 SL4p8@P 00$1l00< @0, 00 00C 00$P202L@0080004 -LM<0 <0, 0@,0<P,0\GFǠ0E0@8 0 4 @4k:#:zc>0`P*P S= R; 00 ယ `PP0E  0`"0X$0<\,  008 0bPP45P!  0 0R@$PR @(K00C 00 市P`2$<\ -L MP`%8 0+p 0<0 ,8@P, } P $4 0D4 $2 <0 $084 ^080,000   ,K@E,0P , h0440<0@ % 10<@ 0, 0 0 $`0L!,PD10L@0,0,0, ,0 , 02,0, $`M04 08lBpt2  B l—0p \0S <2S  (KP@ T)P0 H0 ,! J,G(0d$BMb 0-LMHPT 08 }B00K0 0KP  ,0 0  (  ^ @8 -LMP0@= `Z0 p ;80 S9 P2 pW4[ P, Q 8 0 40Q # 800 0S00 00W#$4$\$ $@ 7(KP 100 P1 00000 @  <00  PP , R  P 8 (" , , D0r00 (Ko$000(KoZtBBԒBBBB-0 =\ 2 0 xt0| h( $ -LM=BT (KX20X2"084X4H40 0HwU%Z P" $`V 0SS P0S 0C0b20000#>80 s2(Z P40S`  4P$0U00 W 0SSQ 3N 4 @00b@0 L, 0 倐3. 0 p#> 00Y R00`V,0@ 1@*C6"*0S8# 00V,00,0 3 Y@ 0L0@L0 R8S?X20CX2^$pW@$0S 4 00lB pt2  B l˜p 0\80S 0 000`@@0S800R@R08 -$HLT H0S$8>0(8 @e ȵ@P  0-@LPP yPP LQK0бj -L4M⨚ , 0p="R =,+ )0*T d<0@ %0& P('$Ry .0:R <R R R 0lB pt2  B l—p <\00@#, 0R$(K Rk  R z`9R 0RU80R _(9R 0R 0 R H9R} RV8VUlB t2p  B l—!pP ,0 L#Ġ# XK WKVKU@KX0K V8V!0NPPS񟗆$$$$$$$$$$$$$$$$x$4$$$7R RmU000zx7Ru 0Rr 0sRn 0o7RWVU8VR!0NPPSL$@$$$$$$H$$$$$$$$$$$$$$$$$$$$$$4$^Ǖ= 0=lB pt2  B l—p <\)lB pt2  B l—p 0\@d =^l— pt2   l2p , @TlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 6\l— pt2  B l2 p, HlB pt2  B l—p 0\lB pt2  B l—p 7\lB pt2  B l—p 7\lB pt2  B l—p 8\lB pt2  B l—p 8\8l— pt2   l2pH ,T`K@( ᜖8 R0K$40#  $<@Q KO0KP@Kl— pt2   l2L p,P 0  @P ! 0 0R@1@!  T0Kg^ 0N4S= S* SH(U@1@# H8 C4  0IU00U  &>U0 0 U 0R0* R# R   U`1 `#@f TP1 P#p@e T@#  x P \ .  Do#  #/BBH=@?BB(B$? -L@P 0h2 -LMplBP t2  B l2pP ,Z8 <0 @1pCWp!=W"@T`l• pt2  B l2 p,/.00 b` T!0,!@W 0 0 m 0-=2LSP 0,@O0h< -LMPP "R pWO 0``c00v[ VlB pt2  B l•A0p \4` X2\"0 X2\"|smW@IX2V0CX2 lB pt2  B l•p 0\4 04 l• pt2   l2p ,` "p0=2l• pt2  B l2 p,"`,o@`lB pt2  B l•p 0\he`\80\8P`z $\(`0\8r?d?P?4? 0-LMlBP pt2  B l•p ,488h -LM`0Vp0P`VJ =2 SlBt2p l•p ,4 0S 00h -0 L=2S<2S 0-LPIP@0bT0 -LMP40, =Z 40 000 p8@`P) 0 &$ 170<0@ ,0 00C  0"`$PL@s0,08`090<2S(K a( -L@P 0h -LM@P ` =2S  $K0 40< ?@0(K8p(P060( 060(202( 0(0 $Lp(0W   $P(0 S00( 8090lBpt2 l–0p \0S <2S O<2S P@ ($0 0 ,!d$BMb -L@dP 0hv 0-0L P@=2S 0P<2S00 -L@?P 0hP =2S 0 R<2Slj -LMp0  R0 0 R0>0/8 $(8 80P (Kx2|" ,:[04WP I 090MP < 090CP0 0@9P02>U 0 .P@/0E?01P E 0R904 0 @RJ1?P5l@TZf c`8$3 2 \!l—Ppt2 P l2p ,l—@pt2 P l2p4 ,l—pt2 `P l2pH ,0 l—pt2 P l2pL , L, 4@ mdlBpt2 P l— 40p\dlBpt2 P l—p 0\@ l—pt2  l2p ,@ T@P@T ]l—pt2  x2l— |,00 p\lBpt2  l—$0p \lBpt2  l— $0p( \lBpt2  l—p 3\lBpt2  l2p ,lRp t2O  4l—0@0p \lBpt2  l2p8 ,l—Y %Ypt2@a  FN.B Bl— c0#1A80p4 \lBpt2  "`l—1p@ \lBpt2  0l—:pH \lBpt2  l—P 8p\lBpt2  l—pH 00\lBpt2  l—,0pL \0@ Pl—`pt2 ` l2pH ,@ T0@T 004 0THPH AL llRpt2 ` l—4p1 \lBpt2 P l—p 40\8B?@%I$XB#бj!$ -LMl`ppt2 p l2p , H T81S[ l–pt2 p l2p ,lBpt2P p l–0p \@ l–ppt2 p l2p ,@dTP ,lBpt2p l–p 1\lBpt2 p l–p 1\  D+lBpt2 p l–p 1\? p-LMPl• pt2  B l2p ,d B`0 @`0P T < 0`2xV0`2x?@??? -QLMp` Q Q P0=2<2l0<2pt2 p x2l– |,00 p\lBpt2 p l–$0p \lBpt2 p $l–0p( \T8SPHT lRpt2 p l–@@0 p\'lRpt2 p l–@0p \lBpt2 p l2p8 ,l–XH pt2Pp  10CxN>C 0Cl–0b "!HQ0p4 \lBpt2 p X8! l–1p@ \lBpt2 p l2pH ,lBPpt2 p l–pH :\lBpt2 p l–P 8p\lBpt2 p l–0H p\2<2 0C<2X(T(P(<2l0<2Ppt2 P l2p ,PHpT lBpt2 P l–0p \2e<20C<2l–Pxpt2 P l2p ,l–Tpt2 P l2p4 , Xl–pt2 p l2p ,@lBpt2 p T(l– 00p \%I$0U0 !3  22a0S1 0-Ll@px"0\lRx"p0\06SH0H064 010 0-Ql2x"@P@L p,l”x"*0 p:\00 =2S 0 &6D0 0-@LP6S\0&\0`0V`@0h 0-PL@640F0h -`LQPp 4@T0004 L00 R0S R06 0 -L@P 0h p-0L P\` 0S @R60 0 @ 00<php -@LTp`; 0S8 `PU# 0 0l0t\0\0\0S `Pd@TQ d@T Q`d@TQY000x&\01x2 x0\0S; 80 0c S@1p301 :J$JJd h@`pW00, RP <_P6 8:#: \ &0^ 0004S804E I CT4 !4 W,0S ,p D<4 0w` P(K0<90D4 0i, P -LMp`(0 S0S 0S @R06 0 @0 0<00> K0 S*0"*:! ,ʠ (!804 0080 80\4  4 K00PU< 0P*@0, R00@`>  0^$0ʌ@ D P 0 $ 040$0 ,0(,  $::5 0(0%,0   <,0, S @(K1914 0d0 D@0S<l2x" p,D 2P 0C" 00C3 R PS0Q<0S&@\@@E\C 2 @ 0S00h01&0\0&\0xS`0`02<Pc TdD @0<0@0@0嘠060&@p$@<2S( T`K( Ã6 R0Kl—p, 007 0P0KQKO KP 0  @0P0 00S@1@!  TK嗃V ڼ6VUx"l—1@  p,5  A4 XKW0K6 SL4 XK U0KVKd R 85R 0TFǕ 05R 0Rr [, ml2pBPxb \p,@0 D 0?00 P Z,0(KoB? -PL `p=24Sc80 XQm0 W 0p0 @0!0 0@00pPh[\T@ 0\@00 ;0CPU D<@ 0D@00 ;0C4PU m06@  | 0 R 00~mp@P[hE00???$0S0$0trp 0-L@Pf0h0 =2S Z h 0-@LP\T 0JHD0 D0D0 SHH \0T<0h -04`L@pgP0 ?04h -FLT H0S6m>06 (< 0t |0x@0e Н@Pr$' A-LPQt$ u$v$Tx$t$%P0=2<2&0R<2@6Sx"l2a@  p,3@0Sx"l•@ 0 p\6Sl2px",l•0`px"0\@dT l2x"p , @l•10px"\@dT l2x"p , @ <20C<2<2lx"0<2 p0\2l•x",2 0p\&lBP0x"0 p\l•x"6 p\6SFp`6Sx"l2A@  p,=S`x"l•@ @0 p\6pSW$ 2r6S@6Sx"l2a@  p,=S@x"l•@ @0 p\hl•px"2\lBx"@ p0\@>dT l2x"p , @2-<20C<2h(}yU u9 $?? 0-@LPP \PPnK0 0-=2LSPX20QX2 @T|2 6S n6SX20CX20 06 -LMl2p $l™xp ,l2p ,l™0`2x"0Cp\ l™px"0\@dT l2px",@l2px", P|$|$p{$|$<2妏 *0P, B0"0R2 ,2 !Q l™,0x"0 p\e P 0,0  #j>060 H07 ` @40&@T' P? +0,0 ,l™p 0\t 0,0 ,;2<2} 0,0 ,@:!0=C 0Lp@Dp @@@\TD ;0C`@0P1TpD 0 P@PD PPLp\TT"P@Uf:@TP!0 O@P P :0 @0 0 LT\H@D@D ;0CFl™P0x"0p \n $m l2pR@xb \p, 08 10l™x"0@ p\dZb l2x" p, l™x"6 p\Bc "P001"PlB@??F$8? p-T0L@`TP @T :S  @Tpln -04 10@LP  >00x*R90  q@-@p+ P`^ X) 0!"4# 8̓ \0S \0S  R` VPPP \0SX P Pp0: p0C*:p0: _0C*:0p30 P  0 00@-: Q3 @00S)% 0S$+ 4 0R0 40S  40S0l04*lp  >0@  P:TJ00Sp0 Q 0 0Sp0 Q@-Q 9S$ $$$$0@9I ) \ 0@)9I 0@)9I 0@)9I9S ܩ -RL`0  R* ē \^0\. XIr 0! "4#8<W*9X ",0( 4;2( +>pP $% Q 0SS 0QBTX ",0( 4;2( +>$P0"@ $405 6478`:p ?;P L<$+4"2X)540674 8<2X)! 0"#4 8̃ˆX405 6478;P8p 4 ? 4 8\,Q0P , D8K00K0S@P`P`D0 @@ DKB2MP`0 K @}?c`XP 0 S S 0PPR,0( 4;2( @$0" 2" # #W? Xz -`Lp@P4@S X)` 0!"4# 8<P T+ #" "202 0-X@ 0 9PL)p #⋨09l#R 0 Elp30考$ 0-LP@@ T0蜲@ -L M0 4 X, 04 8 P ,$0S ,0 S S] SA p0,(Kp0 08< 044 @0 0@, $04``p4 `00p` pX998< =>@ $?:P(; W ,0 04804@V0 :0*:1 0C*:,0 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(Dp#L440@Q?p?\? 0-L MX@! 0Y"4#8 0 K00SPڀɔ0X R1X R0K! 00P000SU\p 0(ɄK0p 0 ?? p-LMP`~@$ 00  0 00 p(00(0 ,00,0$00$0Kp4   (?? 0 -L4 8<S\? p-@LP`uh0S @00 000 < <0P< ph迼|? 0-@LPXh0S t!8 0P80< 0? 0-@LP? 0 0 9@)0h苼 -@8LP R000<0 0 8P0,000$0(0 0-PLIT R0009 0  \0 -Lɐ`p0P$ 0 0`0=00000090000p匀@@ 0<@H08@4:8 000,0\  D ` p l00l0q -0.@L 0P h$? p-@L`P U 4PS @ XX  PppP lQp0p0p0:lp0*R *R lQp0p0p0:lp0 *R*R lQp0p0p0:lp0*R PҕP Q00090)R P㾕 -@L R 0S0S PP  0S00㠕 R0  00ln 0-@PL YU 0)9  @2ౕ)>0 9Y   @)2@9 P R0 p-dPL `R@ 0S0S  R  P00ppln -LXM@ %o,  0D P`p0 %4 8 < @ @0 4P `p$8, (<4@,@0D8,(K? 0-LP(0U@  0h@ı@4? 0-XILPL @f 08 H 0 48 X HNK9X X>K4: Do= -1L M P U( 0 0@K P& p4S' hiV#`V P0 48<S@@T (X lP @ w( 0R$K Xp 8nDoXo= -LMp)(0! *@@"`+P 48#\, @ n 21C0a1 @ c  P0 48Q Q QD H F0 $ (,    048 < +  Pa0 48<@(0) *4+8<SL, 0RM(KO0 0 PP0   0 $ (, B 048<#,##Ƞ 00 $(,0"̠""N 800PPPW00PPPk Do??= -LM Xy@W ßd9 "10 0 0 垒P $̠$$$H  @ 0 P$ (< L  "\!4!!̠""HP 0@00 4 !" 4#`8D \<0P@P0hP-Xɚ! 0"#48 8<S8 048<0###,  0 P@0 D0h X@)H@8@( @Do`o?̨=?@?x?\? 0-RL0 0h 0? 0-L M@P90K0 p-d9PSL p  |I`T X NJp\@T \ 0P? 0-L Mɠ@P 00K0 -L(M0P ,0 P0 0 L0 ˊ`P <KP|yW H D @ \q P 0P048 L2 $(T\= pWH0SZ  @Qx P|9St \pq $0( 4L8T\r P 9 X WW \q0x pP 0P L1U% $0&'48 0S> X)0,0 p h0㝮 Q@ @8 R 0 S@RlQQ 8 R 0 S@RlQ׭T 0 xY,h 0(Ko-0S*c4P@@ <F*\ $P2"0CR202 0S00㫇᛭?? ;90: =!"#0123456![8 1[ <0@!1HC0!X> t密XdɀɀL h ំ " 2|9P"Oه"R' 0S0202嬇@X PHEZ @t  Q 5@ ‰Do?? =?qedAH?\?KdIA 1 1K01 <Qp^ 0S0$0 $yK! -WPK 0jP@0 @PH048 1 $(Y |!0 jSX 0jSsD唾@1ZL K 0 0P$ 0 jS,]VS XO 0C  (t@ o :100 $0@Do?qedA marc,=CRAMt???L? -LM0  80 Jpd "10!P040 Q|iV0` + 0㨀00 ,0  0 \ 4P0\X0048 L1 $(T\ `V X0S\`VۃY փ0(K0U \ 0P,\ \ 0\0 4 . 8LX 0,0 000 괔BmarcCRAM -L0M0RX ,0 `S RpT @ T0|900| APt0\@X0, LK 0PKUP4!P0 iP2 hP0 `0 0S @00$@S p TqT  XpW@d, 0TR(KT0P T 4 0T0 PRT MDoqB?H= -L0MOp \, P T0 D MPQ6   lA0h9T PT p ?<Pe? | "aV*@ P@VP# YP L@K 0 .  `  <P `x, 0RE(K  $pd 7 " P2 P PPp@ P! X)540647/8 <S g` b` ]` tX`h塼? I2Xʘ0\`9 9I @ Px0  )9P R0 J``P@( X 0 4 80P 0#,##8  0X" 048 <  " "4"Ƞ 0 @ t9S  3#s 0@@ T0 TU T *  1A p |`P ``TQ$P`P0S`9V X) p X)0WhIT |:S P @T\ʘ\q  T0 Pi `#V#`F h` X`X `o<@  ~㯁X | hp lP9`SQ 0:X `M@ p uQ"&X) p P` x, 4S PX @p0SP&$<$$$301 20@X  p X)p0 H SP  9X) p ~~Pp PX  X9 p0l X Do ?X?T?8??p?X=?$б$ ????????t???T$8? -P4LȌ?; ,H  P ,#LK09=8< >:; $? (H3 L \(@,P, 09=@8<>Č?:;P|H Ȍl0`4p ,H3 8@ HLH H0oLHO0X0孀L"RD 0SH0L202~(XP( s8< 2K 0s0S   P 00h0  CR @#00D3  @0 QPZ2Q80L@K0C80L 00L 0H@@1 r! 0X @P @DX3 0|Sl : $Z 0@1 r0@嚀P`p@ČDȌ,$Z 80R L#$ 1@6K0p 16K   ` 0CSv PL4@L<! 2K0LL<# <# XYY8cP@XpT $PPj~g~U@a~`W4P @$PPV~S~U@$CT $PPH~E~U@0Q0C 0#@8~T@3S 0~D\ *~L, 0<R>(K4Q @  P0h0 $@T  PP X 0SB*KLDs @s 83S# `< $?(<L  %P\ X A P , 0RZ(KL@K =X0X #?`@p嬁 ČɯȌ9 0:`8̌Pp弑 帡 ;币崡 嬡T/ᣀX 0OOl 堁  p㤜jOK0 0OS! 1 jK\~K<@  ! !sc ʃ|qK  ̑ ȡ sKPQ a   ! X! ڌ1m!1d Z*AY& @ QUKjKpWP`P`B2MP`j/K `c0`Ap <Qd p p CXQ 1 \0Ku 1 KӠKPKpKDP1`@HL!TQdqрK吁ڐKKРKKK K0KPKq 0@0 0少@P004Pl@!A:lp0q*@9P Z됁 00|${됑 0 jj밡40QX)...̠%H%%<0@4[堐0[夠X9 @壀妠᧐Č Ȍ89p:`< =P p ;>@l ?$(Yx t .K ^KpWP`P`B2MP`^/K _c@`hQ,q刁0T0W Z  0 rPVhA A9S@ OKp`P0PU`p80<@X)]0\^_ Z9L? 0- @0LD@0  8 :09`*(0( \:X* 0 d:*p?%4%@%%%%@-X)@ 0!"#48 <9 0-PL@00P4@T01x? -@LpP`ޞ$ 00R7:(0R7 0,0 :SEl0SB Tl Rp0p0p0:l p0 4P (0S^l 0R0p0p0:4p0p0l 4 ' 0  @l9S L:S7 m0  0,00,0 0- 0 0T p /h0S 808  <0 P00 0+N\4???? -L$M0Kh"`P=X)0K0P 48<@0 ,  .  8   0XY@y40 !0 "# Y00@1X R4v y 1X R02I *;(KXY 0! "#48Q8  0@ 0S S !P@02A $0O0 K  P L80Y! 0"4#4 8<S 4 X)p ?(?,? 0-L MXI! 0Y"4#8 0 K00SPڀɞ0X RO1X RK0K! 00P000S/ S 0S$0S,0S> U%(%%h%L%%\0<' \Ɏ$ K0\0<&p 0\0<\0< p 0,L 0  ( w??$H? -LMP@`")q0X@T) T <%%L%%%L%|%V V f)0X)p 0PIV0X`t0p9 0 T  KiH0FSV ViV VT?$ -@PL 8h -@PL P P M-L0Rp`T KX9%:&,%%̠&&H? 9;=>@8P<`쉇`? 0- @0LTqP0  H t:09`*808 \:X*000 d:*(0( :p*?%@%X %%%@ % %%M@-RP0p)X)p0^0_p\p]pX PE] \0^4_ 8<40c@o  1.#@$,#Ƞ#$T$h? 9:;=P>`80<@@Ѝ @-BA 0 0#^0  -pQLP`@h@|TXx@D 0AZS@@W.lT`gWP?@?ı@ -LMP 0 ,0 @PH XA   !0@000000 0 000090000000K: 000@`H<`8`4 0,   1\ D 9 !`pl00l0 P <0 0< @00<000(K }P(%q 0-PL@i00P4@T0x? 0-L MX@! 0Y"4#8 0 K00SPڀɔ0X RM1X RI0K! 00P00 R$ @R 0S$0SR4U %|%d%|%%%\0<&p 0\0<' ɄK0\0<%\0<p 0 ca??H? -@P`Lp 00 c ,00,0P H< 0g$00 Q$8:(0Q8 W0,0 :S^l0S[ Tl Rp0p0p0:l p0 4P (0Svl 0R0p0p0:4p0p0l 4 @ 0  Xl9S L:SO m0 6 t0,00,0 0E 0 0p<(00(00q0A  p0 H< a0H0 W% q 0 808  <0 P40 0/R4c ????? -LM 00K0 @'@ PP匐X9P]!\ "@ $#( ^_唐 ZD $0`KP P0@Y0@ 0H l h  d ` 唀`P0Hd 0c@ XBd K QHQPW@K`pK X9T P lK H0TKXY( hd d K W| x 0S @d K P 0Wd K x R0 S\ X0   |K| x  T@K0 PE06NPU>E DKT p t0##8 K 0 )|0{1 X Rz P b(KL XLKX0S !`P D Uˠ| 0 p`<P\ 0 `/PD| 0 P `\ 0 PL0K0S @L0 H@ 0w @K0@ P@ P DPPDP p t 0 ##wdK\ X S026 |KFD ^`\`p| ^ 0  DPc` `WdV| ^ 0x\AG  D@|0 @P >2bP v 8|R㌘됀PX 0 0@ 00l 4l*p :嘀  0 0S S PL἗?$??? -LMP@`R9q0X@T( T |$%%%$%$%$%$%$%V V ᖗ)0X)p 0\PyVX`t0p9 0 $  KiyV@?$ -@PL u 0-@PL P 0PPX9\] ^_  p 00 Q-L@ | t0 t: 0 B9)X0X `:\*P0P X:d*H0H x:*@0@ :p*4 |?P%L%%%%%%%H%(%$%t?-0 4 8<S, p-L@P夗`ph -LMp$!(KPPP W0 0(0 KX $( ,0(K 0( $0 $  oP 0 000 0pH0_@P ᳖=X)p ?,? -800 P`p@8`L⮙`(  (0@(@h蒙 p-h0LSP` 8@T P@Tl9S L:S pph[? 0-4 (08PS 0L,0@\0 p-(04`SL8P 0 , @HphL p-`PLF 0P 0CpTXp4 ^P0@pPqP5$@T R000(0 0 <Pa0 R 40800p$@T6pqp&% -2L@P 2S P P p"`()pP Poo0S0 (  R,(00P2  -LM4 0@00 ,@ 8 P4幘$\ R000(0 0 @ 嗘@0 0$00   0 00 S Se S $04 4cQ00S4 0088 0 ,"?P1SAO.!0 T8XH0@0 0s $0000$00 00 8PU p$ 0 0  ,0 < $<(<SO S 0 080 (K400  0K@ 900K0 @00 ,@ 4P@U^ p 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(D#Lp4 0 , j<00< 0 $ @ 0@ SV 08<04@00 ,@ M0sm 0480@00 ,@ >0 40804἗? p-L0P  ,Q O@ph褔`P 0 @0<08P `=@0壜ph蒔 }{8)%?? 0- L0 @P@ 0 <0<0P0兜P00@(@q00hu)% -LrM#P@L K 0`, A A PPppzK@PLs@ 0TP$.K0TP1 S02(K01SSx  kn 0}@P- p`AT !P&n#nU@@V@Y nP00S 0"0 STw=, 0R}(K 09pPp`405 6478<sc n\`!0p@0@` \  y/KxATS @T, 0 48<S L Kp`  L Kp`L Kw`z`x=p`rL Kthp`j0 S< p``L K0V`Z$埧DoqedA? ???H?D?= 0-L, \@0 P S  lX) 0!"#4 8<90q P002 Q " R'P0#2  <P  00-P0 L0 0) 0@ QT8XHH0H `:D0*\:< <0X*d:4 40h*|:, ,0*:0\??%0%,5%G%)%HE%&%0%&% -LrMt% 0L K@, ?_PPFyKk?PP$e 0SP N<@T $0 SB<L K, 0 R(K.K0kSP 1 S L K\@ 0R<@L K$s02(K01SS L Kg@ l\@1@P`0LK h@PX)LK5406748 <00@4P!(@,P X  8rH0  1X0 l@m0a 0 0 0 /0C B0 0C B0 @p X = B?P0407 P!@! " # 00123568 9 : ; < = > ?  "2H0"X El48Xy01`d99  hɆ4l   |) (l @ 8"l00!   08   Bh90X)h)(0*+48 <0# #Ġ#+)*(0CPY kV@ Pkk@W k\ǥL KPvZ kDoq?edAH?? ?`?< L#?1SDOpP3400  D0 厖`P P0U|r pTXpr ^P0@pPq]@8& p 0^0>' K^0> ^0>p 0H@T `9`X T????? -LMP@p000 `3, 00u㸐,0V0,0 P H< IP H< 0P f0l$00 Q$;:(0Q< Z0,0 :Scl0S` Ul Rp0p0p0:l p0 4P (0S}l 0R0p0p0:4p0p0l 4P4 C 0  \l9S L:SS ,(Ko)0 800 '0,00,0 0G 0 0ᅒH(00(00q0C  p0 H< v0H000  Z& 00 C 808  <0 PG0 0B e4~-U00 ????? - 0L0 0l0*lp :8@T  @T -LM00K0 @|.@ ~PeP`X9`]!\ Pp"@^ $#_` p( Tp $Z 0`KP 90@Q0@G 0H@P@ P ĀP0H ㄐ 0c9C  0 Q 8@Q㣔4ˉX0 0K0 @P0 L@ 0K0 @ \ P儀KH0 D@ \0K0S@@0 <@ @_8 4 d@ `P 凔ˉd ` `>@ VB K QFQPI봀`X9pPKK l h lK KQ t p p(` ̂Y ʄ K IH K  I8KX 80K0 @ P Uʶ 0K@  Yʦ 0K@  P l0K EP6NU>E ;|0 x B X \@0##@`KDp WGڴ 0 0 @ 1X R02 X 0S `V  @D  RO P R $ `Pp)90 KoTt D^-`@P\p | K ` X t@K00TPˠ ppPpPDp@_W dKt0KQ d `  PK`P`P ` T``T` H0SP  tPP tP } 8@<pPvTt 0Tt | K pKt`Kp @pPBPYt`K| K p @p0PGt`K| K p @pPP6tKT  | K  P#t0K| K @`@  pPtK| K P pPY Yh  R(KY@ 0SPU@ `VpW@^3 X"Y .dQwdKt p rX \P0##@@P P@ P wH\ @  t`K| K Tp pH\@  oSP 30X]T^LCK$@0-pt T5tPK`| K `T`ˠ  @@`pOPfD\`0@X) R+ \. ; 0 t K T0C0| K  )P@`DP0OUʓH\XY RPU \^K0@0 @$ t pTt@K0| K T`0` [` P`P Pt@K00| K TP `PpPD`VL`0@X- ^/ Q2 PU5 ; 0 t K T0A0|| K   P`DP0OUH\ XY ^P Q R PU\HPH\H^'LjpPW 0 0@ 00l 4崀l*p :帠 0 0S S P g??|??pn?$?L? -LMP@`ወ9q0X@T( T c%$d%c%c%c%c%c%V V χ)0X)p 0\PVX`t0p9 0 $ Q Ki貇V@?$ -@PL  0-@PL "P 0 PPX9\] ^_  Tp 00 -L@x00 \X0 t:0 9D D0`*\:< <0X*d:4 40x*:, ,0*p:?dN%hd%I%e%8d%J%lT%P%0c%ME-Rp0.X)0^0_\]X PG] \0^_4 8<40c@o  1.p@Wp3$,##Ƞ#$T$h? 9:;=P>`80<@yEЍ") p-L@P巇`ph  -LLM` 00K\0 @#X@ P\$X)! 0"#4 8<4  D @  ?< 80 ,00 @@4;T$P0 T a\0P@ 0 dkVTn 0L H0 TKpP0S[W \L0 X 0X$(^ ,K &X y908 :=<;`$>0(?P ČȌ<L "l!4!Ƞ!"D"X Z?`90:;=@>P8<  29? 0- @0LD"@0  8 :09`*(0( \:X* 0 d:*?f%j%xf%0k%j%f% -LM  0"a&Tp% -LM) 0a&Tp% -eL`Ppe< (00p04S80,0d0804p 00 , 0@07< wП&((0"4#220$00 (O 0i!JB??WEVTp% -P L d&@ pP` |1TI p1T) *`iP1T* H1Te//B`(10S ` 0 `P 器`P0T$ Ϥ0 00" 0`0 e _@ 0ce/^ 0V 4,0( UI`jrdAhdsd edAk~gdTp% -DL!88#!mP1 凟p" D0020p(P00`4Q!<00@aT@!0   HA<00d@0@ i o̚0 <+0400 @@ oWH AjBB 8 8-#TLL%p`P 0@3 +រj 8 8-#L@(PPp 0`pP ლ0S  0㏟p0 pPj -L@o0⡤ r%0L00 -p`0L %^P$  ^@P P00 `(Pp 0᜾P,0X@P00 @ i嫿婿jkj$?@o ?,?800S SP 0S(j -0L -L@\p``h菾# 10 0 P 0%W hyL?p? 0-PL@s0 00h -- LM K00, 0 K -- LM K00, 0 K -- LM K00, 0 K 0-@0L@PT@T uP0(j 0-`0L PRT  0@ST000@]T 0(j 0-PL@ :]P 0 @ P00S0 0 0(j -LM q 1@T  P0 1T, %0T( 0T% @0T*0CT*0T0`K 0@PP@ 0RKp0T h0TP  @80T @(ÖDo'B&B"B!B$BB B(B%B`= 0 0 kkkk 88#4 P00kPკ0 Rk -@L4 R00 0S00hPk -1Ls@ $080 00@=,jk -pL0PS҂\\0`@ L 0?V0C0kkk 0-LMDP00@K0 P  0R0K0 Dokl= A-L 0 R kk -LMp0PS  @ 0RK8`K0HD PP v# Dokx?|= -ĠLp@W `P L @?V@W00 h dX0 R L嘼@ ,0?S?0C00kkkkk?k -LMD@0 ( $K,0  ,K 0RK劕Do= -LMD@0 ( $K,0  ,K 0RKqDo= -QLMK 0K 0SB$ <  p-LMPK@` TCJ |4QZT00V0S 10C x 00@j80 P0S0SPDj@ P P 0S00&Dj? -H L@T00 ((0 R00@@jPPg 0@^SD妵 0H@K 0p SpP  卵G   儵>  0@^SyP2p/-t b llh0`*`l0aP8KDod?ı@op?x???\???o(8?o= 0-0LSP@t   0hx dj -L@P P P P P# P P3 P& 0 0 0  P 0 |0 lP  P D P oooooo?? -L@P P hP  \4dP 00c0X? p-LM`KP Kp @@50 0@ PPP PS@ P# K`P T 0S T U  v5 T$T  0 4T |5 800?? p-LM`KPKpD0@S@ PK T00  00b0 0 40@S@P 00? p-LM`KPKp0@S@ PK RT002320 0 0@S@ P4 R$ 00?? 00Cs0 -(0L @Rh44lj -@`LpP 0 @0 SR0 ӧ P R @ 0a0CSa0Q-S   RDγ@T 0a_S@ Th迳= =?? -L(M 0sS  P `PLKV>  T a0@S( K$ \R0S  0S0SQ+0@a$0Lv U TA00 01 }(KP0SJ }1 n` Ut!0S PPBXaTU Up0K0 0@ =00cP H 0 3,U`$0S@  @ 0a0CS0@SV P0P000 R  a0BS(0K +00B R0:S 0:S_0PE$0L000C SP0 \Yoo?j% 0-@QLPJ @TZ0 Q-L`ሀp@00fT*P 00fS 0c00f000f0oo p-@@@`08PcL0`000pooo 0-@QLPJn @TZ0 0@-L@~S~괧%%$%,%X%%$%Ȩ%$%%%$%%%$%%$%̩%$%%x%$%%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%Ȩ%xx6 Q 0@^S)\V Q0q0 R:@0 00 `P0aU 0R 0 0CR0:E%0S 00C0x5l%0Q*LU@0Q* 0 RE5 Q* 0004$0Qd帄0\ᔔ $0ST t吤T000 0 S\4T00S0  0 0 @04#0S*cC3Q`3 be#C0 0Sn0RR0B B  0S 0S S0R SU K 0RLRr 0Gb 0SQ P000B Q6br00CS0吢% G"8:|R0B0 S C R0!H"010Q? 0$RC 0 0R "p쑟000 0 1R R 1 1`1蠡 G0000R010 0QH L!<000 0 41R R0 0R0 0p Đ P* Q% 0Sp0PQ 0S|0\^0SRL0 @J oooojjjoj?o -P@L@PpP`P0P @D@PPP P  00`oooo0 00 ooo4 P00 0 Q4#5joo0j0j -L 000jj -Lt T8 !0@]S@00@ SE0P03P0cp0 QR`TWpD@T7pD0u" @/TA DaDU9070T0pDU A D00DR Sa0D_TS0oPOPP tPTP P xPXPP 2P@A @a0@SR2\T( 2@P2@U tA @a0@SR@0@_P Q:P\P00 \Tbp P@8M0J0hSp P@>\P_P 0?SC|%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p%p% %%%%%p%p%%%%%ز%Ȳ%%%p%p%p%p%p%p%p%p%p%p%p%p%%%`%>P T +@<P*@.P @  jo?oo ?,?@? P 00j -(@xL0P 00@ ooo0j p-LMPP`V DxhǮ@8@î0 ,$0r庮`xkP?t? o(@? -SLM@ 00S S h0Pd  0^0?l 0V000 P  0 P j??????0 0 `R姮 jjı@ -造倀`LpVl0@/WV@@ HT0fp`Vp =`jjj -1L `Rڴq B0R !0F]S& VT V1 VK VZ tQ-@@T cP: qP8 PP@ 0P0C0(APU @0 0 S 000P@2/00CR 0  0P0X 0000@0 (0 hjj??j jjj -DL4M088 S, 2PLKHpKPKTK ` 0L @@ ޭ L (TQ 0P PL0P ʭP Rŭd P0Sl0HH, 0R (K0@,孭$嘆hjDo`j?|j?ı@q?,=r<0  4 40pQ 0ooooo40,0, @pQ0 oooo<04 40pQ@ 0ooooo cR(0$0] B   0 0ooo -8@LP }00@P v00jj 0-H@LP  Q 2l 6S Q X0X 0S 2H 8S T p$0l00jj 0S00o -pL0@SSHP S 0S i w`0 Q00 2| 6S Q e0000SXP 0  i;itoo -PL`eHpj@P8 00CS0 @TR]@0S S' S: SJ 0S 00J 0 00C0 4 S 1!0S 2!8S 0S 10S 0S x10S 0S HpX!00CS0D1 R 8Zz,V 0Q/ 2 8S* 0 RT T U 0Q 2 8S0200 CR@@D)TG`# U\ 000D 00CS0u ojjoo?ı@o?o@ -L\  o - 0L0S o -L\  o -鄐@L0Mp`0 ,0 P \ ,0K ,0SP11@5@T00 P(Koj -L\o -LM@PP` \p 0KPV 00@0)V 00o 0-t0LM R8K L@PD0T 0S@ xP UP 8tjjlj -LM @K< 0S0B :00A0 R 0 kk -LM$\  o -LM$@0 0o -L\  o-0   o -0L0So -L1L`MD0 PP(0 `pl KtKx KHtP 1l R*x0S@ hK0@@( 0R$$Kl RW 0pK| KP p| T@hK0@@$境xjDo|j@#A0??<= p-L@P`P 0S ppp3p - LR`P; R :R0p0E@2S P @T:00E` RZ p|0"P@0pS@ hP WPT:00E0Ppj0-: 3:*fA*Q 0, ::,!,,,\V0 !0!"Y!0` 0Ѝo $o$$o=1s s080 080j j; 0: 0Pკ@-44 0@0 0 @* @@#oj= -LM   0{ hz %lo -LpPL@ck 0, `0P`P`hAk jjo 0-PPLMJkK< 40 0@0@(k8 jjo P0-LP `3$@T-$00 -LMk00p̠`0@hP \hl 堀0,0 ( @j,K\j P@P\0 0S@0%050%\j$Kyjojjo#oo -#LM0pŸ @ 00, :Bp PPj 00 0bC2S0c0S U 2@xP x| Tj(K`0D"\B"\ s \p 00,0&:#0 1 1b 8 4 @ `P`P`P`}p=8K !\!PP``dq儁$A00SA Ij 0 0c bo"oFS0c aR bV00S0 "^08PP C4PC2P C1P0PPUh/j 0XXfP0@pP pt 0K~qE`xo#ojjjo#o -LlM蠟0P`(0 %UpK8K pK8K*lF*HU@1@#3I 0dPU`<cX`]( 0R$K zDok$$oX= -pLM0lK @,0 P1 ^_KD0 0# 0Q i!$0S:  @05[KJi@   ui 0p P`<p@ P`x P$`p ri @` @, 0R (K^_Kp 0S}zDoo jojh= -LP`p  @PP  P@1J# 4[pP  00 RA?P PpX $@{V -p0LP \0R E@ <u00 hu !Doa0P%loo% -LRMh@0T`$0 $ 0RM K  @ TpP1Q$  Q@1J#U YK @~ Z@P UO?X Z@PQU@ YK@`8{dPKYOK@D@?@ ~z~@%PyDot=C-0 pR 00P`U%  p00 N @ l3)^Q<0PU hl 0> n1 ^2R P R 8 - Ql08! j00Re R0O4P`P` 4P8`Wl004PXP X< v>p* K<0PlD"[0R 5>X X R h@X0O|0 x@ 4`S< ph P26B 0bC  R7AQT7Rx 0P0K |K0P h `@800 j H0l0 |K48d R 0@@PSPT00S40,00@8V` w0<S t0X@lL4 K0T0}@0{TV ^< t%D06040H0D 0  H0t0P]D@0 :@^^ `P`p4P8`2@8P 8< d UL0.S#%@DP@ L T pX :LsPH~=8jHt TN8jt0< t4%D060<t X@L0T04 K@P>V UF40H0d1@0P 04 O0tt H y\@ @p0plLP! Pl0*0 04PXP 4h 0K 0Pw h0Sl* ;0S9@0U5:0S\ \ 0S 0S 0S0PG R @ R 0@4 R(K0S  R P`0OTS/0 0OR 0 C, l5.)0S#Q 00K7P0 H00@PQ -L4M  $0 0<0 @K;   1KB Klj -L4M0@ $ @K <0 3 K*V2S/00@0 S\ &@ & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & & &h@`T  N 0P,0pS(0$p@0`0 0S000 (K`@T (000 $00a$0 `ᐐ@`p@`d0\@`0pd `㸐 @` pd@ꐥ@$@ [o [o0@- 0P840 PPdhP 40| x @ t*| K  0| x0 |@K0 p@ lP P 4!t0KtP 8PP Q )*?dt0t0t0 Pt Pht0tPt0td02D>PPh K PPd0NSڀ@``0NS @0S  )>PP  >dDo:&h?:&@= -LM<0 0ps` \, <l .0a 0 cA 0 , .0>   00000 n04 8 h X T*"!Bp2P@@00 Y ^400 00 X T*00"!B2P@ hY@0 B4 00   0 <.>, 00 0^nP`U TG*AT1 @f0P  00,80 (KT/*. A.0P @@0 0 Y 400 00< 0S0c<0la0 , NK@G@C@b?@y]&\&X\& p-L M@P0`   0K`P0SKp -LMBPB p)` 0@@P(22 V(*@ @T#*0S 0 PP: (P  0@P R @U (((@0S  }P -L4M 0 , 3SPp%LP!10C8S1< R (KBB (  0@bP \(G01 1\$ @`L 0 Sh*1  0@P]`\ @0SYl SLPL L 1S D  04 41, 0 S  4@@3P 3\. @,`K0  0P0\PS2S@ H `< @ 4@ 8@ R R7 < 2 S< @ `4@ 8@ RY}  yRL 3R@P Q: 0R_*21C   0 @@DP a@  @@@DQA L V L 0@ c0  00K4K8KP@0 D0 0 80 1sY Q40000b0a1!1H L0SY D Z 1sB Q40000b0a 1! 1D@ 0  0H0 1s0 11s* @0DY0$1  'HD 00" 0D00, 8D! A'40!1J40! 1F !10>0>0 1!D0 4K 8K00K60 D {ꨳojt@jۣe[& -LMş, D pN  1 p KPP@0`V Pd00YDş, 0Rp(K0 0F PPL0$ @0 0' PP ` 0  V &@@`@K 40PPP5[S PC[ B&`D 0@PPC[TQ "Q ^  0S0.(K ! 0>00b>01 ! l`x 0LlQ0@ DA O(0K!    h 1t>00>0 Sa1Q>2=12>303h0 5T( 0! 1 1 hKP PD́@ h0!R .0C 0b0@D  ! !@Rʴ#[Rc0ˠ@1 1 1Q5 1 @0R1 Sh l Q!RT  0 cd hKlK d0KH\2:h0\d%* d b 00b$1#[0d0 ! Q!0Q**"!B00  000 #[a hd  P 10A 1 d DoP=ۣe[& -LHM@aD1V@$0 p 8Q$K 0rP P z%} Kq%}Y0d0  0\0 ` 0T0 X  0P L0 *0D0 H  0@ 4 8 <0 0<dK7 ( , 00 ꨳo -L@P @1S<@ -L$M (18 @ `@ 0SX °P 0PSU *0 S   0 S  R:p(K00@ T T@ T T TH@ L@ D@  0T0S% T L  0L0  T LL @T TT D H 0;00 0 40  8 = 0 0%   ,B&,K.p,&W0<0 w(1, 0(1,0, $,0 , (00(0, 00CS 0  c00P L0 @(1? 0(1 $?< $0 0` Ȍ. qΌ@P 00 `Kp -LM pR`$K0.>0 0`. 0 @P`0 y`P0@ `  0` `P0S   . . 0`` -LM @R`@" 0:#:S%0:#:S z'zW p7P @  @ Ȍ PqΌ00p '@P K0@ 0-LQ@ P21C 0 P  QP P0\0 ?"00P0 -0LS`P pP2C@0 0 000 R00P0SPp p-@P00L? @""`!BᲭ 0P?"`p p-1!1!0@ 00>0>0PL 1/*"`!B ` 10a 0`0PP PPP0P:"!B00` 1 0 10a0P PPpX\&800q0q -0LHM,0 0@ L0 T0$ ( TK BP T0 FP P $: K6@@@@ -L8MA 0R<0 0 !BO0S $0` a1(K *0!@0P0 `PW ,0hx0PUL +ᔭ0@c 00 0`Cp0K 8@ 0p X.@F 8K80 PKD KP0 L@ Hp P% P ւPU 0- ,04 KJ 0@cs 4K3K2K00 <@ `F<K z(K,岂(喃$唃Fo@ j@Do,@@@@ -\6\LkDJonpJoHJo 0-,0L 0, T 00CS0@P0S B,0, @C0hAhJoHJo>k>k -,0L  , K\ 00S0H0 R B404 @,0( sChAhJoHJolJoDJo>k>k p-LM@ K~J  0PQ@c=YB@DB ]BT00U00S Kp0Tڀ0`Td0@AP8 41Cc0A0cBB p-lQ`LP ,0"  L1 R* @00CS@0,ڸL/RPp0@0S0 0S0S 0MPRR0@P `gD0S phND@00CS@0pU000 0@@0^A0S0S (0qMPRqHJoB`Jo33 -L n-x0P l l0@@@wC\0\QT00S:<<0 R@hI$|'`Jo>k>kHJoDJoB BlJo@-A" J1S 1 0<S RZ20Q^1S100S^0Q:0P(0 p-0 !L$ Q$b1@sP 0<!0 ! 0U 00C0p0 #  1 0 10 0C0p 202 (("@00 0-0LS@P P R000 ! 00C0r0Ko8Ko p-LM0`P@P P \-P Kp 00 0 0$( $ 1K0 , $01KP K0900 00K?P 00CS 0 00K/P01K09 0 -LM`Pp Q B  Q D00BS 0 K0S@$@P K40K,@ (P 4@ 0P K ` -pL2`0C8#8S2? P@U R 00 0 PU@Z000S0202S''P P8P@P8hq'00202StJo 0- @LyrTP @00R P N,\qX00@2000CH 400  @2$@0tJo@@j -LM,0,0 8ErPH WP P,0 2; 0SPH0 @ `P0 0a 0q 0 @4 0 , (,  0@S`S  0 `S@ R 0s 0SB 0`S@40s 040< 8 @ U@cTڃ ?@cTT' 02` 0Q q ' 0a'  tJo@ -L Mp 1R,2P4 , !`' @A Უdଣ@   ᩣ,0dࢣ0SP020V400(K040 042!Pb, a' PQ0 ' @@B@BA 0s00dl@@B@@A  ed_00202S'W'T0'M0 -`LpoPP ` 0 S  S0S<0 ``0BS 0-`$@4   `  -LpMPp7@P ` 0吀K0 0  0`0CS 0 V  KkVP@` p ` -L `qP@1 00qW 00 000   Q$  0R0W0S 0WP( 40U  1 2 1 1s 0U0 P00 1 21 0-@ MLPPPPT 0Pq804 P@q0@K04j@8Ko@tJoLo -L(P p, `^@3P9 00R2 0s% 0` 0 0  00 0101 1s 0U0 P001 21 3 R @0R  q -LM0 000p0$\ 1! Y 01 0!,0 X0 R4 8 \C:0BF  c03P? 2@`v`  V1@K0 SSBC  c03P< ߡ2@pI00 0$ P1! Y 01 0!,0 X0 R4 U Y(K@020Tp 10 pR@ @Tp 10 pR@ ڷ2,^  1 @2 1 1s1 21 0$ ^ 40R00$8 0 0$B -L0p `@a@c @0 @P0` P @ (K @L>0`0`,K@0 @P0` P 4,0, tj -LMp4 8 @P 8K` P*840 @10@0!0P,0 P@8 ,K ,KP8 0,0 B0R,0 P8  P'00K@ (K4K  P`@Z`J,K ,#P0 ,0@T0P,0 ` J P'00K  P -L M"0(0, `PP 0pWx W P8d R(K0  0DPPL0$0! 0@;00 0 !PP1 I 0  0PP @0 Pp0 ,K ^PP:, 0h0b 0 RP/Pq@ P41<  T T (1#29P0 pS00S 0S T P P @ 0S* PW0  0 c8`cwPT$1 !SP#P3R0! $0S UcPaDojПj -LM0X T2 0\" 0 P2 pP (KTTJ,` X"c0? 0 @ lp hp p d M ʟ8" 0K < 02 ," ">K K Kq 4r q q (r $2 QbP P" 0@\b(L'<? `# 1 RLB LBP0S 00S00?  R? 101 0,1  ', X2PU Hr , R 0 nHPH 00@`d,K 0` P00KP p?W8pGHr LW0S | ! 0H"0 00010L00a0 !0S00 pr 1  !81 P p041 K>0#6`001t0,!0. "&h0d 1>0#6l0(!x $1|0:P00H"1cL@KD2 @ H  KL2 $P = `P0 %Q0bP \)bP" 0@5L'<?  `Up?Ppp 00C {TFO @ #,aӔT0S0# X00 ΔT2C 40T"0P@@1`1T,00 Q0Q `0  P`0 00 0  T",0Y#L'\a 0P"@T2( ,0S KP D"\2 K ( PsT,0  !<?c 01S# L R  S  1 3  1S30D 0R K  101` p  /T2@Fk@T0000000000000/`8w0P@0  0 000 0 00, 040 0P4  X,W V`\T",WT2R54 0Q90Q6`I5< K4K X@@Ph1'8KOP& 0$ 8 P'h8 <00<040@4 408 40$ 4(00(04  00CS 04 (<4 , <4 8{DoLjXjojj0ST0  Q 0(0 R 0 0 0 $ R0 0$0 0$Do 0-,0LP@9  R 0 0 0 ,   R 0 0 0  0a P6`10CS`1LP*LPho`0Pg`Dd`@ 00C00]`, 00C00w `WoRoxSo԰jUoذj -,0LP@`DPL L00$S$0#L0[/00tP/i pP ,mDr(Qia4  -LM0pS00  b  $@T 40Q 0 r @Ti P,q! (0S00S1`Vb ,0; S V5   ,400Qj 1(K0  k0,  (00S000S 1X,0,400\R 0[/0(K400  G,0   ,400Q/ [? (K$   -^& 00% 4P{ 400Q [? (K  P Q PH P  @ @ 0-@L8?04P,0S80 80<0@kܰjkxjtjpL@Uo'5MoMoMo UoUoUop@BT@ -LM 0   K -LM0@H ( $ 0@@zK& p-L MP0L S`@Kp0 $K0 $0 0 庻@P 0$0.@ `Q@p& p-T`T0@ TL 00PSP0S@TpjMo p-d0L@`TP p  mP $ `P@0pdMoj\@ @P-k8Noj@No0ÃɃH!>D0C64 P@00 6R80  0PP @@@PP"  Y0 0cC61`0 0@ 8 0 iU *ii 0U :^  ,9% @ a 46`(aDNojLNojxj8No0 à 0Rl PR 00S 00 p-0LP`@V0D  PpphX+ -0L(!(M10 p  `@0   PP0S (K3+@8K" 0P* p38K+  #8Ka+ p38K+8K'+P qx= -L @ hP -L@ h AsP -40L   @fPhq -L@ hs QP<0S8<0 -LMbp<0 P @2Pp8 p (K)0 $ @*W2`00Dp004P,P)$0Sprp4P 4 10S 00<000 00*  4, 0 00S8<0<0<0 @T -0L0@SPp ` 0S $@T@T P 0S 100CSW00000CS0@TR00000CS0 - 0L @R |0S0|0 R000 00CS0 S hSP 0 P @\N04 R gP 0  Q@,0  @Uo -@L0|4POphO0` R BP 8N,N 0PT!00T1T!R9Xo -LM$PK*`q )0T}P@T@PV 0x倀 0@,0 @T ,0TW00V0Sp`XoYo4 -@L 0@@?kXo -LP00,P0!00 @\\0$@\@T1 @0P @ P  C000 X@ TP d` ` \ U T  0pP01dK0p [sP| ,0 g d0Sc 0Spw D] + 0 \r$Do@ @ıj @= 0-@P,L⡯C0h 001  `Q0S  PP 0hD0S,j  @0-rL`1M@ 4 $P`A `1!S0 d1h,0 4\!00, 4 S< ,0.10  !1 1 0V1 0!10101 `!0R000\1`1h1d101,  40 0 0 (K,8X(Kowq,j -@010L,`#, |0 Vh$!X0@P p0S 000 0@@0Yo`Jo -,03LP0#,!03PB t 0@CA`$ 1, , ) >  SB !1R,40S23 , 0 R[?Z`U @F, ,  !03P`R ᑮ1J, ,[?` Z @W,  [?P  @0`@p$ <8,q,j @ -LQ@Q 0,  10 OP,0 E1 1<0 -L Mp,PQeR0 Gb Y (V1#@a,0 $ 1O10,0 1,   0S00ʅ 0 R9 0,0 A 4 000 $00Y00S @T T @T,P 10`Sv S S@. iT (Ko40S 10S (K W00 00SPA(Ko豭 R1P R ,0 1 P,0 ,  @Z,p34P00ST0P00S@F @A⒭[?p^(KoNHp儭, 4 { A3z000 x At,qqA^,@ f,0K W 40S0PX0S ,0 0 ,P12S201Ņ"kAF,@2>,P ,0S@ X0S@ 010 TA+,jn - L N -x0L@T@T ,0 ,0$ 1  @TUo -LM@,  P$`0A s  hd\`Q Ki!00000 10! !1 1 0U1 0!10101 K,j Pp-L`P @T U  ,0 b@Tp P-L@P  h -LS`p) T1@TN @T 400S, T00Q0S 0P W f@TX* R P$ PU PU @t 40S,0 R  0P W 100CS7Uo -LPp`P GP U 0 R Q 00S U U U  hlCP @T0P \ 00S U U U @T U  -P0 UL@p #R#0R = B @`P  0S  `P ,0 0:P  U r R 0ij 0i b0i @B$$10CS$10$0R>0Yo 0-LP ?$J/@L0$100Yo 0-$0L$!PR @$@0 -`L$P!R pq0 @ ! 0 !1@ A T101U!0R1M 1P 0R 10P0,j -L M<< t4@0 ,J 0@:@KYo4L'4j @0Yo p-L`P @T @Tp@T R0000 0  R0000 0 -pL@` PP W` P 00  00S00@ P0-LPP@@@T:P T 01 R0D003G @ 0-LM0PS Q@ R  R 0A@S0@ 80SK` P  0 B0 00 0@@ 0 @8S0 -pQLPT\Q 0 0CW .\, @ R W`1`!P$0 70S( ᣞ^ 0 f0 0 0pf0@ fW0 @P0S     q -LM0 K -LDM 0P@, H0 D@ PP #0S CPU0L0 ` P`P p`P`U`L` pP w`#P rP3P @1`,3 P3P  "P`Vj p=KB 2R20L g"E@o2P PpoB ,  000@8 @0$0(@H,0 P0408@X \0< @0` d0D H0h l0L P0 `TV @  oT @HK nP A @0 B C  D! EFG@@DW00`C,00E, 0PR=(KU 0`V Pp P P@Io ,  000@8 @0$0(@H,0 P0408@X \0< @0` d0D H0h l0L P0 `TpV(DojTo`ojjpo@ @ @=-P  0S 34\^ AQ0S :P00 (0q -QQL Mp`1Q1 $0K`P) @$ P~$0( $$ $ ,0(0,@$0 400$84$<8$@@<`1 K(K`P lW(0@ (n(T E(0l lh  0w` -@LPp`nT  0R U T  h讜  M-PL0 0S R K P ⓜ -PLM0  0S R  P  K}  -QLM@MQN "`PL Z: @0B 100CSA,0L> 0  0R>,0S2P U;P00 U"@#0 @@0pK P( K0E0"@E0`0@P Ie(K@@,  ` @P@P -QLTM| Q0JS-@P |P 100CS,0  ,0S0JS @ l@ P00P0 Q`=1X 4 @PHK`0 \@ p80K lhK8 TP h0 dP P` L xPZ Z ZD< x x H@0x|p0 p t 10 0!P,0 A eZ,Kt 㤛Pfp00KT d  @P80 l80KhKP `@ \P X 4 h0 L =PN0 RA :#:jc0T0 d0 0@P8K lhK`@ \P 8p 4` h X` P L0 !P2V6 0S@10S @T000Z8, XP ,0 0T ,0 50 0 00 (K Z(K00 t <l夿x@ 0 0RA dP<  | D0, P ,0x 0^x ,0 tt Zpp U | <0fZZ|0700 -LM0< &. p9l   0@ 0$@(, 0@ @004@ P`8P<`$0@@0D@ 0@H0L@PP`XP\`(d,,000h00x0000000 00ˆ04ˆ0<0S0 -01=L  00 40=9 =X2 01A !P0[0T  <0@1A8 !1 1!$!$0S1(1$0S1,11001 M?3!C/ 0 0 lF Nl k0S`00`00 S`00`01 0BRS' 0S X01 `01 h01 l01L1@0@1 0!x00| 01 111!2!tQ  kX0@X1\A0SP0@2DB100CSL0@1A!!0O1A/!0O1A/!0O1A/!0O1A/!0O1A/!0O2B/ "0O2B/"x0|d1t P= @ @ $0@H2LB \"04 l 0S04 p 0S04 t ,0 Q p00|0S00C|00@P0T@0|001 0BSR 0 08 K0Kq,8K !1(KT00X 0X2 \00@d!l01 A?B -L MRH0 D H  Q8 `V pW&V0DQ1,0 @  & @ 2D @< 4 0 T2 10S, P R( XV|n'n'n'Tn'|m'8n' n'm',0 0 0S p0 S,0#80SWI00000 ,P 8QW_00 @T4Qh1 @4 0 R @0  Q @ 00S 04 R @,0  @0 S @40 S @@ R  (K@,P Q Q@T 000Q@< ᵘP<8  fpG< 8 @ @< ᣘP< 80 0fpG< 80 D0S <00cSH  30010H00UoUo -LhMp o/iW| 0@  (0 0  00  0@ 0$@ 0(0 ,0@004@$P`@PD`P"080<@,HL 40P0T@<X\ D0`0d@Lhl 00CSJq'ps'Ps'8s'tr'(s' 0 0 R 0@80<@W$x0@p0t@0 x 0|04 0@0@L  LQ ` i 0 0 KPt0O0@pPK`2D!0xP`  R 0F 40x10 00@A40=9 =1i R0 !(KZ 0y0000$04 t!$0 l! p$0< `d!@h$01 !0@1A 0 1 0$L0S? @1AT!Q $1S# S S 0@X1\AD0@(1,A#0!,0410 8!40<18 @!3D1 H! 0L1$ P!(0T1 !|D0@(1,A#0!8041#D!(0H1 !mP0S 0@1Aꈺj -QL,MH0 Q `oV RH @  @  0@V8 (Ko oV01o?#TD <0 n TK T4  D\X4Y0!0  H0S 3#H8Ph7@T P4 4  4 @T 0S @ R030#Z0S 0D\D< ޖP@PfJ@ 6@T , 4 ,0P ,0S 10S S 8\*0  Q% @T80s{ 6@T 0 4 ,0Q0, R 10S S 8\g40 Sd @Tup\ @ R030#Z0S40040 \ @P030#Z0S40040 0<\ @P030#Z0S40040  RP40040 PR0Q (0@P030#Z0S 0D < D,BP ,@  f, @  JDup\ @P030#Z0S40040 \ @P030#Z0S40040 \ @P030#Z0S40040 0<\ @P030#Z0S40040  R]P40040 PRU0Q (0@P030#Z0S 0D Q< D0ӕP 0@  f0 @  J 0D9D,< 廕PQ,@  fJ, @ F 0D#D,< 奕P,,@  fJ, @ ! 0D D,< 叕P,@  fJ, @  0DD0< yPa0@  fJ0 @ V 0DD0< cPY0@  fJ0 @ N 0DD0< NP(0@  fJ0 @  0DD0< 8P=0@  fJ0 @ 2DmLoUo -LdM 0P  PH U00 0(KS񟗐,'t't't't't't't't't't't't't't't't't't't't't't','t't't't','t't't't','t','t't't','t't't't't',',',',',','t',','t','t','t't't't','0BMSꄌ'h'L'0'4'''''H'''''Ȏ'''̋''''@'̋'D''`'0' ''ē' ''''''''' ''Ĕ'''Е''|'4''L''''''''d'@'''''ܒ'''p'L'(''܍'L','X'|'$''', 0R(K 0 0 0ʟ 0z̠ :% : : l: T:L 0@H(ʟ 0Dʟ 0;ɟ 02L 0@I@ 0 P00CUSzl 0 Su @_`pd 0!lÉ494)fL 0]ɟ 0Tȟ 0cL 0\Eȟ 0T=ȟ 04-2 \8B+ %  #H0MK 4 410 ǟ0 L@b0W0P0S 7 ꌧ0 0K PW 0S0ŷ S40S 7 ǟ 0mƟ0 L@$0W0P0S 6 6F@ 0PFP0S J/L 0@,Ɵ 00 Ɵ 0'ş 0~50S00<1 <1  O?Kn5\ 5R/ d0 S<0V] KOK SL 0JL 0o"Ağ 0P8f6L 0u/L 0&L 0ML 0R<ğ 0 Ϡ 4Xß 0ß 0 ß 0ß 0ß 0zhß 0q <30CNK 08 ^P81 CRS0L 0+  2` 2|~`p 000QL@垷@T 2@{L 0@q 0i 0xaL 0pMX 0gP1^ 1R  0>$ 0M6 0F/00|D(Doıjo=Y==\j$jj4B`j8B,o1 11 @000n0hs&q@ 0-D0L @"1 P11 000U0hoq -l1l!`0Vム\1L`T1@T< Dq@T7 10x 0CS|0 0|0x |0T S5T0 dVTPP P"1bL0 T P ZLe1Q10S! !$@TצP o!"1!S 11JHJoqqDJoUoj(o -<@L 0,0, /C!b0 hd?k4'Bgfff,o-444 40 000j8oHo@o 0- L P0(@S 000(0P(@0-0 0000o - 0L 0S ,00,0 Q-L@0Q0P (0@ ,00CS,0 -@LTP`p" p@T $0SV VʹpW V V V $0S 0 @TUpd$^$P@,@00C0 R0o -pL@`TU@ 0P$ RU00000 7U@Ho 0-$0LS@P  VP 80@ P0  00hE $$Ho\@@ -"LM0rP,0  0S ڈ2xx 0S0CX0 <K fN P0S P ~ 00S0? , 0 Rl(K R P!0S@ @ @0S V0QI Q0(0BS0A0- R 0$10  0  01' Q0S  Q00000 R<Kf1S Rv0000 Ti#0 R000}  $A$Do4oj@B@olj@0=@ p-d`@ L0P0 P $0S1P0 Pp@o -LM0p@/P`` [PP_ 0 0( @0S* 000h!"PI$p @RTR 4pP= T*p 0!R20,00Q0S Q0!R 0S S0 R 0Sʵ!L8#4#0#(#$0T  #X@ @`@ @@@@@ -pQL 0 Q0`V) P0S" 0S 0C8S 0J@0J0 5RZ0Z P0S`V>8o -0LS@`p3 0S$0S  0PS'0U 0S PRPp0S00S0x$#0l:"0S T4"p0 0*"i*#"j@@2@ @@ -QLM0p0 4 ,0 (  0 Q0$ `0V 0  P0S 0S 0C8S  0J@0 5R 0Z P0S`V`0 R , R $0DS 000!,K4K^!8oj<@P@ -L M`p\00 @0S @200 0S00Wi 0 QP `b @ 0,0 Q0S00a 00 P W[ ` !00S  `1\ 0S 0S T 8CR0S00 S00 0S\ Ṫ ,00 R X00CS0l h=(K`Pd 8CR00` *!4oj@@ot@8oljh@ -@PL` pP  0hGV0!j -LM08`, J|pP4 ( 0 $ 08JE00C8S0(KP4Kl08Z,K\BB p-`@L PP  0ph p@@-X@\F @@0Q:XP @ @0R:Q:& XPXX@XP @0@ R* 0R X0S @ Q: X0SXX@ 0R 0R 0RXXX@XX820P#! 0Q "p@-(0 S<3(057<@ @00@09780<S3 ; @@0@008<<7P`@ +7P`@ :00;O0$TP7p"p -LM, 8 p0 RDP] 0T<0 8@ W<Z (@<K4 04@ ڣ 00 ;4 00@0(K 4P0,PP`0 @80$"S/ < c080 4K H 00B0 S>?( K Q02\ 0A1@T (0 P @  HP+ @TZ \ 080 VIP0.S a0BS8 a0BSW0B$ZDo`o^@@@@= -L MPp`q* ((0"4#220 $00 D,KP 0 @?(K, 0季P ,0P 0t $` ,0 㧣,ˌ0<  0,嘣,弌 p@qedA@@ -LM`00PK  0 HP 0RK00[S  00C S00•0SLpQ @@Q _HP10/DoDjL= p-0LM`@K Kd0 _PP"0 K0 @@0@0  K0\S QT0 QL0 QD@0 0RKp `kDo8!& Ri @0@@T(PKT` 0 s50 A$,0@(@0 00<@9000bP4l $0 _@K0H0 K 0)l 0sH 0S S0S  $< P040000`0  0@pj j 0-LM@PP \ 0P@T  ,@TK0 @@D@@= o( -(0L@T @T?ko( p-0LP`x @P00p  P @ 0T R000 toX@ - L@! 000 0S0 0  0 00h( 00 R 0  0h  to -L@`PppPA DQP 10T' TU4 5:Q$ T U:TU R000 W 0 00U*00FX 0P\L@? 0R 00 p p꠮=`@|@ p-LS`P@/ 0 0S0 0Q  0S P0N0Q 00@@pP 0R 0000 6ph20Q  0S 0N0 00S00@@Ppph -LM` QPp@:0A @T;P5 \@ T=: U 0 T: 0U Q }  0 U: 0S)pbP000 0P T T0S*pe@@0 R000  #X@ 0- LRP00 @ @T0@ R000   00hf -LM>0 Xp>> p-LM@(@K`PX0K P  0 pKp=>> p-LM8(KP`@ 0  @K ` pKp=>> p-PL@X0`0 pph/>> p-LMX(@K`PK P X0P p@KpЮ=>> p-LP@`  X0PpX0Pp -LMRp0 S`( - S& S ZQP1@T (  ( T0S( T0S @0T 0S (KcZQP0z03Q0SPP P P dB50 R  dc d_c(j -L MX0` $@\pd  l0 *@T P\\@TP @@0S  0A@m  h $0d 0a $K`[ d $0T`@T   XP  0 AF @԰?t@,@@ p-@LTP` `@ @`T@T  @`T@T  @`Tp -L8M⼢ ( pWaWW "24 2`Vkt0Sd 80s 8Kd" d X P@_e$ @ @@@Od $ P@P_e  @@@Od  P@P_e  @@@Od  P@P_e<  @@@Od h P@P_e4 H @@@Od , @a W `V aWd X0 `V( 0R"$K L 0 g8K ( qx pDo @;@@ @(jL?@p?D@L@T@\@d@,@@@@@@@@@@@@@@@h@= p-L4M`QPa l0<M X0  @TY 0 0S0 ``` 00C 0L0 0CH L0h0Q @ H 5 \ @00C\ R000  R0@0@0 @Kp08 0S0 R000  R 0@0@0|tLK 0 (` @0>0S! ! P11"p"l00``0SS\60D D0D0D 0 0 C0doho>>(j@4jToTo@(4A(4B(A(@ P 0Qp21C c ,o -L MtptP`@F ` 0S 04:`V pPK?k,o@,?> 0P \| 2 1C cU,o -P1LH1\@1Pp  U00S`@! 1 Q X00S@Pp PVP$1 VV$W 0X0Q0S U   E PW \ 0U00U <000 R {iV$o oj`j@o -LlM  !OQ ,   pT T x p PX x%PP00oP h0  h@l0 0x P d0 `@ x t  x t@ 0DZSHe(d(d(4e(d(d(d(d(d(d(Le(hd(d(P`(a(d(a(`(`(`(`(`(`(`(`(`(d(d(d(d(d(d(d(d(d(d(@^(d(d(d(d(d(d(d(d(d(d(](d(d(d(d(d(](d(d(c(d(d(d(d(d(d(d(d(d(Tc(|d(L^(d(d(d(b(L^(d(d(0b(d(`b(^( d(Pd(d(b(d(](d(d(a(d(b(x0Z0x0  T@W00 S{  x$͟, 0R(K> kl00l0 l@ l P 0@@ P` `  $ll l l@ P0 P` ` ll l  l P0 PoV dP l00d@l0 00T00,Kp } R5 ,K2p 51`:R .Kd`Pp@ `0U  S\  \ l@\\ l| h\ @bTZ T W00 S 00  v @DT`Q Z T W00 S`@@ 0 b |P @eTvZ TW00 S000  N @Dh P0 bh x0l@@l@ 1>A Pp00  c`p0 l@ 0Rp p000b ap  bd`Pt@00Dx!0000@ Qx t h0 x*P 0@ \t d x@0P!0t 00A 0 \?d0 x x l00l0 l@ɟ X ^ PP `l0  00l@@  ` l@ ` !x0l@Ll@ bxl @ l \x0lPl@l @x0 l@ l Pl  P0P 0O 1P0P0p0 p7Qd0P Sp [ ,P] p@dPd UdP\ \ P@`@ `` l@7 X0 lk P 0@P`@ l { PL0 H@  ` 0S6 SL S`H@L0CK&@@CD R Z T W00 S   [ @Pl 0 P`l 0x@ X 0 t@ ` xl  l x+` PP0CKP p \P C0KP P0 `\PP `CP0P@00 `ctPx PCKp \P CK|` Rx0x@ ` xl  l P0P@0h0 h0\xP0 -Pu`` <  @D|T@W00 S   pp PU):p0Z h\ @bTuZ T W00 S000   @D0 @D`0 @Dl h \0@cTZ T W00 S 00   @DTP  @Dl2 ZW TW00 SB   $,Kp %2X> &BP p0`cp0  cJ` rV U-Kp ,K,K @ 0 0d 0ڇQP` @Dp@ p@00 d0 P000T0S  Rt @ ;  06t 1l  cl@` P0 8CXo dl Nl @K P@08#X` (lNl0@ P@0 尀lHl  P 0 L H zl l@ P08#X` l  l @ P@08#X` P0P` P 0@P`@ P0P` P@0Po P0 5P0 L H 4DoP@@4@<@,@=$@@ @8Q pL0H@0 `P  P@ l@2A \@QLK<@00`!0@^S!0@^S^<,Z9 TW00 S  j !0@^ST@W00 S  [ !0@^SZ QpI+/P\ dP?\0 H@L0CK!@b 7l@ P 0 8#8@L0 H@ HL0CK "Jl \P@0 P0 L H ^ Z TW00 S>00}  zPx 0?d0 P0x 0P0 -L@MQ  K" 0(@ K 0 K(90 --0 L M0CQ0  0( K  ! K0 K( 0 0-LM@TP# 0P40@ R 818Hj$o --LMP 0 ,0@ R KHj$o -@L? -LȂ@ --80LM Q0 Kܛj --LM 0 K --\0LM ,0 0 Q @@ 0  0@Kq p-LM`0@< 3PK0 0\ >3[P @ P >  0RKpDo@= -p-LM ` 0@PP PJJ00 R0PP >rKpX(((((4QT"(1 T0`!10 0 0c0C1 0S/0cd0Y:g0hs0hp0hl0 f@dA"Op[0 LS@@N8KhjBljBhB@B@d@@@p@@@ -LM40p,S0 @h, 0' 00 @(r 0 P (r @BVW 0Rp,eQ sQ dQ ,Y h00T 0 SW@@AhjtjBB@ p-LM0P S S` S S S S 0 S S S S S SPx@KP @ |x0 S S x@@ -LM R R00P R R P R R  08 R R# R R R R  P R 0S=8@ Cx`0 08 CHT#h$P0  p$8P#800 08 CHT#h0 8CHt Qs (K,`KOPs B?pjȀB@(@ -<3LM `R#$SP3 P8CxnTNT R@yTYTYTyTz (K(Ko 8C800 nTNT xR@lyTYTYTyTcD2 Rp @P( p Wp 0S$ QY` P0 sp p0ps PZ @ ",@ x0 8s dPCu08s<lY0 0%0(Ko[(KocvW@aA00c10I0 0c10 }:(KoiP! ,g"P,  ,pL(KofhjljB<@ı@p@BBȀB\@@d@d@B(@hB@L@ -L8cY(Cx2B  "0`S* @P 0PS# 0"P0 :#PW WQ W0 S0SSPc0ISF((؏(ȏ(PQ0SD@0@S #PWc0ISꌏ(t(\(<(cY0   0@004|00SS P@tjBBhB@lj@ -LM`p( @0 S SPP S@S(K,KP0, R ڜ?P QPqP |2p 0 "P,00aZ<uf 0@xohjd@@B@ -L0MLK(8B(` T CxY!#3 Q W ß0SأP @$0 @S !P0  B"$0PPS @U ,PKpa 0Pm,@t H# T0(i PKtKY,0sq aT,",p RP 2"PP@ PE *yU @D2 |B@T`Ÿ 8C8s S<2 P(2\ 8C8s S1 PP!001 R$ @p 0S# 0L!P0  !P0S S0WpT(KH@,@T0S @P 0S 0!P0  !P0S S0UP p0@S 0S 0 P0  j!P0S S1pTAhjljBH @l @BBdB\B( @@@ -LM0 S SPpp0 S S P S S{ Sy Sw  ` S S `0 S SPሆ0S @@0S P !P@0S@ T T`` TPz9 0 D B2R@((8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8(8( (,(((x((8((8(8(8(ؘ(8(8(8(8((8(((8(L(0 S0` 0$K`HF000 000 ğ$00s03S0000 TpD 000 T0@ qp000 T,0@ 000 T ,`K@P,?0@ T ,KvPo,  RR@@ Rt30 Tf ,`Kl@P,e s0@ TX ,`K^@P{,d e0@ TN ,`KF@Pv,@0@ |TW60@ vTG00@ p,`K.P'0S ,0B0 0B RS 0B RS Rtn R R R P,00(000 =0@ 9 0@ 50@ 1>000 ,,KP, 10 ",K& K(0K$@P,"[2[n0@ @P,,0@ & K(0K @Pf"[2[,f0@ @P#,0@ & K(0K@Pc"[2[,M0@ & K(0K@Pd"[2[,=0@ & K(0K@Pe"[2[,-0@ ꈵj @`!@j@!@pEBD!@B$!@dj @ @@!@ @ @xj -L8i4g(,xP P h[t!@!@(o!@N- 21Cj 32CljH0 $\,0 \ 0 1s,0jjj-l0 $ RP0\D0S   Q 1S0$<jjjE -LP@p`V `P@ LP -LMR,0 pP ' `0S` VP 0 S00űw@P 0 0 00 0 00CS 07x,0 -LLM0`3l l0PQ!p Uh d A T`Kt l0 KPd  t Q ㏒d(KU 0 1 0R0hq h 2h0La#!B !C31C010K,0 0 zP8K,04 8x"00P=9@ =C0 , 0 ,0 ,pH"@Wp0  ]p0SRhq% 8K800Pc  RE00K@0 <@ < 40@ cR=9 =`< <0 1@ A@ QGڔ!43C" cb 㶸,0@@ T!0S  @` Kl0t  GKPd nv@fW 0F d d0S @XWd#P Xp PTl  d M0,0 00 @Kt4 ,0R  ,@8W d 9l   P0d d0 /$BMb?BoQB!@o -LhM Qp@P  Tㄑ  Te 00CS 0 w (KT 0PK0 JP< 0TpHP D@ 0 4 ,0 8 p8p 0S3W00p8p 0S*W( RP0  H KP80c,P`pǏP D0`0@,P0`D0H@00S P80W pP  rP #P -LM`@Pp\vP 0 K 0 0 0P p] -LMpP` `f0@0៶g '``^#`\P000f#"@o 0-@P@L D@@@<@@P 0ⱸ04 0, 80($ 0 -LM`P@Ppp@P (K, ^,K8 Ku@P@,0 ,08 ,0$P,00K4 Ku@P)00 0 0000$p0 gfff0  ᔦoxoR  Rx0x0'' Q Qx0x088 RA⓶ -0@ 2L )0Q p00  (00H >1>1>1t00  |0S0 0 0l0$0(Qxoo p-QLM@`@00CS(T(`(l(x(000 Pˤ@Kp-@h0`0X0KH02 0 @嘇ꌦo|opooxo -` @0L0C0 R0 <00  0 (H>hvxoo 0->L@ C㝇0PT;:h0h0h (h Hh ~D00 8 P0$0 0P0oxo0( 0-LP 0NWP>T0 -@L`^íVpH 00RUV hp t0`0t000H0U 10 XH  qB"@ 0-@L㎭t0P0t00h p-LM@~P`H0St0t0$ 0  0S H0St t  0  0S 0t0H 0uPP ᩬxj p-`<X 40#"B LP:L0H 0b 0H@>T@@Ӌplj 0-@<` 40#"B LP R00 0S000hjlj 0-@<` 40#"B LP R00 0S000hKlj 4 0p-#Lp"B @`!r r p<0P80<`լ00@,p0P80ljjj -L0MpP(K$3 "  1ˌ3Š"10A0 0cN0S |0S \P \2 U+ 11 A0@QR  PS000S Sv S 0AS00 @R  R Rm R | |0R:,0x ,0`P\1 T@0BRS 0< 0K$0< 8 KTn,1N͌\40, N=L L0 , 0^8`4 =N` N8` 4 108`S40 S( t 1Z31C0!02 ;5,.ϠClF/<@nB 0 `@PL L0Rl:4 40R  Re PXL@,0TqqQ("@?B"@"@"@h"@8"@T"@t"@ -@Lit0 | h衱 -.H0LS@ t0hQ0t0H⏱⋱ p-@LPṫt0p@ @` 0t0t0N<t0p -t0L@@ 0  P H Pt0@0t00 0S Pt0@0t0 - L X_ X X X - X00"# 0@d 0 d HQ PL#0?0S 8(d(X(X(H(d(0(0r8#(.a0HS H0 `0HSq(p(p(p(p(p(p(p(p(p(p(p(p(p(p(p(p(p(p(p(p(p(p(p(p(p(p((((( 0 .0Pc0>pH  P``0O0@d  d P>V0 H>{  0@d 0 d  H P 0>eHb 08#(,!0 Q0A8#(|A0H\XSPP 0@d \ d H Pl =^P!P(P'P)X)P2 l 0@d 0 d  NH PJ>SD @|o=A p-LP@yt0`   U tũp0 p 0-t0L   % P"20# P0  @@T 0h0@T00 P0S P ^T @^? -LMPP (`$pKW @P $ ' @P`H @P $  @Pt0:t0T0>0> p-`QL@ Pg dP`Up -LM2@0 SP 50 ^ B?@0CS+1 ? R#  t0 ! X0N>O2n @ :t0\ 8CR㍩t0 :t0>%`(pKⰎ > PP ( PP0t 5*0t ƨ.8C8Ac Q.PPQJPUZ="@ -LM0P0 ,0 8" 4 p `Bt @0  82#3SረY  Gၨ\#0 R|  VR8 0H0XDVT V(ڠ0@ "?0E@V' 0>H .` . 0O0@d P d p`l?ʨ0H0X VR  ^NVP)0p`FH0X˨H0@X#82Tt0!0t01H R`1l#OK P@4Vpp4b ŚH0C㧨H0@X\,  |0P| 0y w$0!s1Fp0S7  㟚 0@P< T  4QK , 0 R(K ɧ 4 Q 02R#꽧 #}긧Lٻ4K   oDojq=|oj(oj = hj p-L@P9` (Q)Q#t0 >;.t0.?ph|q t0àLp <t0HQHP ڭ(Q HPlj Q-L@ t00t0t0 0t0 0) P P n -t L @0\%0 t0 0)P P JzQ  q, 3 2CHt 00t00 Q>|  00CS0 ttj0 㨀N@ᤦ  0@D  D 9@P ✠$ !,t 00S s PWP|@  =?= t {RyW  b @h0(PTh ?R](0Sڜ0  P HPt0@t0 0S Pt@tt  p [ t|  0S- 0S  0S 0SI 0SW~ XzY| ʘt h 0@$  $ i0 t@0  Xth0@t t    0R50,50t o pG0 #Y!   A0GS p0S P 0S 0SM @T T   }t@(0 h0S&  .H0Stn  0S 0SWt W W@ p p(0 S|PPPY T 0S 0S 0S >08#8S>>>t  ^0SpSn l >(B8CS@1@#Td@DpT]0p  x t  (Wt{pp !W|pl 'W`pi W Xn0|S W 050;|[(0 0S050,| ×tWctW   ^tɌt z Tx 0>(xW 0S tWW9 tl 0W tW   >Rq iQc0>t>tW  |@i P0 P p ^p P P 0 @POp0 P P W 0@0S tt/ W   t}\Wˌtxoq0̌#"B0t )W}p ^W~p}  R @>0S(| |ꄦoopo=lj p-LM4`K@P0t2Ɍ0t[Pt09t0Kp -4LM0p40 0P00 < @ 8p ,p 㨠埤@Z0 0S\ 㒤@w0$($?Aas P0S Pi8 R , R,0 8 0^t 0  @0#P30#pᷣ8\ 8 0#p  0S00SW#W00n㨠pD@ kᘣ0 0S, |0P 4 $0!41@0S  6|"2@=pPu =(0S( l` @P%0T: 0TT X<pP<0S X` T 0T 0T 0T  T` h1@/ b\)48 R r88}(KT =  S| ەV  !1pP 0PCʡ#W  ] 0%>0S8\, 8} 8 堲8P80S, 8G0p#ppߢpqBgfffjj(ojx( -0L@  (0 P0S0 p-`< 40#"BL PS@ ᨢ0 t0191p 0Splj 40 -LàL@`,ApP@ .H0SPUWTu nPʤ0  P vT t0 Plj -LTMPx0 U`$ G:U t:U J0U `:Uk CT:U H:U $:U 0U+ p(K:0S 0 S , |0^ $01F0S/ Ŕ )9@pP 9U'0CU*0CU`9U (0CU D9U# 0U㌢t @  5,0t ءp8U 8U , p8UD 8U$ 0U 8U0 R  㽁P|pP\P8US 7U v:80SrC8t 0S$0SVt呡pb'0Zp\ pZP W0S Z t0(0(SpL  @0h 'D0 @0CpKl0 p H@ @ x@pP=X \c 0 \ap \0c\ELW(t0@tq <àL&t0 iQ0CU 0Ut0p;t07 d6U 6Uӡ0St0t000t0t0KP6U H6Ul0p006U 0U}0 Q$,0! Pp 0Qp| p5@ p`Tp#*l0Sm 㚡l0U20x   pP   l0 ܠp@  PH  ^| ㅓp0 @T0S QQ 00CS0 0, 0p00 00 | 0 @w  ]pqA1! 蘠pi9t0p;t0叠apP Y `pUH0p0Q0 0S x0q 0 R,0 l0|#20 p6 p2@ Wp(x08x0 @8x0  x07x00@x08x00 x07x0b(0S0S  pP{t  0    00C 0 00003!0 !00l # B,0 000-0S 0x 0 QR BP0R 0P R00c!0R#<0Bk-H0P R 00c!0R#<0Bk p-@L㢟`Q@# 0 R00B0C 0 0 0A00P0Q  00b0<^,00\00S0 0@Ҟp 0-@LPn0S US 0S\ a aR QPb0bU00S0 00h覞000 0 -@L`?p^P V  0 PbU0Pbዞ 0 b PP 0eS0 1S00PS0eS0 0PS_ p-@L0`SP!  0P0Q  00b0<^,00\00 0S00000CS00 0.p -PL`ɞV@-Q@)pQ$ 0S`0`Q@@  P 0ay0 0S00`dd0Vp@hQ   -@LP >wP 0SB>w000 p-@`LP >xV`0 0 0P  pUB> w -pQLP@p1I Q( Q* `0Q! 0Q a a0RPP `P  0a 0 0S 00pe 0Wt R 0   p-LP@ `R4 R0S) 0 0 0P \  a 0 10 0 P000  05p0 #0 00  V0"p -LMpὝ0S" 0S 0R p$K@@KP@K $Km00  ,0 0 P ]q,0 0 0S ] p-LM`P, @T \Q Q 0 S ,*<Kp`c]at -Pp L,0` 0 @T  < _ 08] `c^` -Pp L,0` 0 @T  <^ 0] `@^` p- P,0L` 0 @T  <^0 \ `^p`p80 P0S0SPᜦo -L@PP*0S( BT 4P: P0-LP@0P QT 4Q R0S T0SR\ 0 -h0LPpU` @T * \4@0  ^PU蜦o p-`0LP`U @ T*$04@S  RPUphbꜦo p-`0LP`U @ T*(04@S  RPU}phEꜦo -LMQP@#P P EP U Q4Q0S0\ E 0 $K*A$Km 0-0 L 0P0S@ T* 04@S  RPU 0|S00p0 @h0@d@ T֪PP Ҫ0ガ40h~Ꜧo`jj0jjoo,Bkoo)Bk)$ 1S!P@j.R0>> S9>R0!03Q>  p-PL@`p21C0Nnpp@-L!La0P 0cS@(010,1  1 ^  >!R 30bS01\> ^21C0Pp0S5@ 21C 0Qҁ0S0 S*0>p, 0 0cS00dJoЯo$jooDBk"!B >0>\P 1 0 STQ X0\"!B >0C>T@-@P$ Qࠡ \00 a0 0l 0^Qʲ1 0 a0b0  R( 0 0 R`0 SQ1 a 00a01 a 0S*cPQ- ^0n\  S ^ 0n\S1  \0S   @00cc@ 0b1  \0S  0  b @ L0 0c 0-@PLtl1!dX H@@ 1 @L X PTDH ` \0(0 "": ,0 4#t<#d\;1 #@4#@#@#@#@#@%@%@&@&@<&@$@<$@h$@$@$@%@8%@d%@%@ -LpP`A @A1 00100 P1@001 @L@ -QLM`  p$R KPP VU 0 @@cV@1 `d0 0 VpP  &@&@&@l&@ p-L␙h0`PU @ T*,04@S  RPU 000phϘꜦoo @0- 00@ 1L,0<0 -\LQ@ `0`0` \1 01L 1 D0S H @L1 01L X @21C cx댩o&@ 0-1|00!L B!1@ P 8018U1:11ꤦoo 0-@PL PP@0hS0 0-L@P@F0 0-L@P@0SU 0 ? 00 0PP 1  \0S9 0S P00 p-@L`ᷘTPt@P h 101@0 001a ,0<0ppoo -L@pP`㇘W P1T% 21C! cUPP@# W 7 1@ 01 $ 0L H0X`TpD0`@\@P @ ᩗ ᦗ@Z = ៗ@ꌩo p-PLP@pv`PD  R 0 1 .p0V00 01  1@ v1 0@ ,@1  $ @@f1@ 01 `P\P@J@p p-@L`TP\0@P P 10100 a 100p%poo -LM@Pp `QP P R*P`bU1f0Z P 0j0!: @@@00厗\0!\01\\ 01`P`ݖ0 0 `0 P  vP&0!0g00,0 pZ 0j0 0 PPS,00< -LϠMϜp0 Q10 K0 p`P} W0,0 ,@K,n@@0@0 0 0\0!\01\P \0``1`Pj00W  pl 000 S0`00 WEVA @ PP> Z& 00 0bW1! & 0S  ;O RW1! 0  00b\! 0 aS  Pd0Wp00 PSW,(K, ʚ;0'@'@&@ -LM^ -LQӿRQ`pP PP 0 \@ @ 0S*@cTS5X V 0!0 00P0000f0xPP" 1 `000 0X0j 0    0S 0S00P 0PX 3 -LM Q-Lp@`8W 0 0g 0 1000+P% 1 Q PQA @@AQPQ100@00 0g0 `` p8`T'@0 0 囦dJooЯo -L@P  U -P@P`U^LpL P <0@T0hꌩo(B$jo -@ ML 0@0s0 0@rmp崐崀崠`0@ @P#5  0@PPYH`KVpDD y(Kop'@o,?>,Bx'@ooHBkj0B'@o-) -PLMp, Z ,  0Q`%,` P`U0@TpcWP @P0U U1Q  P P@U`0X#@gT@!  0X PU X`p0S P P0gX@cTPP P, 1 0YpP XPp 0 \1777 -L`RPp/Q+U" 0Q*U 0ScPPV`dVP U 0@`T@! P $  '@'@'@'@ -RLMp`@0,0 PP V@`C,K,0S PP; 젠 kR&,0S W0 gpZ @1@!S @  `dVP0Z0 c; 1 ,, 1:1,6o -1L`Qq 0,0Sl* 0Xcp`Q@@T P 0@ L0 S\:X0 ``X00VX 0 X@1@! d d 00dS 0000 X00VXS`` pP T)1 Q PQA @@AQPQ1@00X@@X 0Xpc`0 100 2022RP0S0SP00 -LQ@ 00 Q02o - LR0@0 0S008 R0 0 R8#82o 0-@QLP (T R(P P@00o(@ 0-@ LPP 0 -@Lp`@T PU00002 P02@T P -LMPp, 00 , K9@P P P \0PTP0 ,RX \ 0`h 0%`hW00S Z,00 0(KW#VcXc0PUSUU  0 `Q ,0 0P@, R  0 R0W4\fAW/PWPU& `0,  0 0f 0 00 00 0m00P0@,0 0 1t a@PP  fP0 XU( ,0S 00S VU 0S:0f 00,  00f 0@,P Z0 1i 00 \ 00 0C DbH(@ -40ML @   0Kq0S R$  0S$ 40$  0  191# 3S,0 00Q0Q40$# P 0-40@L$Pȑ R00 0S000S?0?0h 0-40@L$P孑 R00 0S000S;0;0h 0-!40r@L$ r 0P0P80㈑,  3,@03ܐ00P008080Lj,jK P6q\j`j -LM`P@ΐ p0 @K -@L<@ D0Sh; -LM^@P` 0S \ ` 0 *0 Up 0\ UY 5UV QUS *D2U0CU70"0_[ 0@L0K1 p1U\ U0U= 0U 0 RZ _- U O@U U 0 0000CU 0U 0U 0 U U0 00 0 0 0 ( 0S  R  R} \z `0 3 003 0  U  Uw09 YBB -LMXP`$0 p" 0S \ $0K0 0 @ K$3RO Rr R  R  R *@W  R8  R R U@R R RWT 0S%0 R00 0000 0S \ $0K0 0 @S5 0S00S S0@1n@PAR`1R 0S  R  R \ $0K 00 @R R R@W 0S0*B BQ@@R񟗦H)H)H)xH)0T@00T@00 XP 7@n0NPP@ 7@^P@x 7@VW 0S\KP!@L00Vh V e@Aq!z -@Lt 0S   -L0008 -0@0>L06,h+ -0@080L06h -L MP L32C0bC^ (K#0 0Rx JP 0A0 <C_,0 A@@0@@D0@D0@0C C< Qaq0 @P(0 0??;PXP ;  e0  @ 0PX 6z000 05 ^ -ꌩoQԯoq 0-0P; 00UL@0 GP6S0h "60h -pRLP` 10^ V@ @@ 0R 0 `0aR \^aP 0 0 T`pV`0   0 1SS 0001L00S 0 00!RR 0001L000$0S $ Q )@00 -LM @S 1 !@ PK  0-0@0LSP S TP 0@0007cP -L@`BP  0S 0& 0  0S -P;0SpL`p3*V@ ; 17p ` @pP U@0S0#S0` -LMp`$ K@P$0$P 0S  00CS 0$OB9@ K(K @P $  00CS 0 Qt  @p0@P(0@@$!B -LMp`$ KaPP  K(K PP $  00CS 0 X $0$@5  Pp0PP(0P$A p-L M0`@ K 0 !PP* 0S* $K PP0$ 0K/PP Q $ R 0S R $ PP   00CS 0 PKp$P A$K P -LMp@ KPP%0 SP 0S` 0`SV  =PP!0 0 0 $0P  00CS 0  bA7P; 1V 7Pg  00CS 0 p-LM`@ KPP x0$ P 00CS 0/Ax -L@M\ `, K4 0 lPp 0@ P0 L@ \0\X T D @ <0 H  0SH0 ~Q{H00SH0 v\  ,0R@$ @4K00KX KHPP@pPH0r 0c0Qp 0Pp8  08 R !pPJ80X0 8K pP@Q& X" 4PU  0X05! 0305  P0U @@X00P0Sp U0 cW,,0 0@,00@0,D0/0@D0H@p,  00CS 0 0P4P(K\,w@H0S wW #W -L(M0`Sp @K $P02(K `D < D K8 (@ $P 4 ,`  K@0 -L`MDKPp @P8 P(@P`K0P,0  0,P?Z,>Lj -LM@`4K p+PP (K8K "PP 4P , 00 0 0000008 $ <048@0 VPP$0S DK PP, (00(0, 00CS 0& 0 (00(00 00CS 0 NZ841PP @">0>080 D>,>040 0R>,N>Lj -LM0p@ K$0 PP $`0A?AS  00CS 0 0>%PK $K0PP 000  00CS 0 $P.uP$PP0A?AS  00CS 0 $$P > =@06F8  0\PP c~U0S3)@ -LM0pS`@   0KPP,K PP (K,~,08 $@ .  7 3S PL0,Y 4 KODP,YUH< 3SE,Y4Y=,>,vY0P8~ 00CS 0=3SP0 0F6!PP 8} 00CS 05 5#03P8} 00CS 06  0PB hF,0 , ,0  ,0<$PP  R 00<SPP ,3Y4<,=, Y<> #P5P, (00(0, 00CS 0 40@ 0,=v$)@Lj,)@ p-LM`@ KOPP x0$  P 00CS 0<x p-LM`@ K1PP Kp K09PP   00CS 0<0 $ P  -@PL' Q 1S 0 Sl0 R0S0 0C#qW P`Z0 ` 0WP@TP )P( 0S0 0  (0(ᤰoP 0  0C0 00C0<꠰o -L Rg r R@0T0  (0 ( @T@T ( e  ( 00C0( 0 S( I @T@T1 &V `R3 P  Q 0Q(0  00 0P pLW@P@T J P0S$P B@TZ@WPu<@TPZ&V00$Q d0 R0 D)@ Q 0Q@꘰oLooKoj̎)P 0S  0X Shj -L M`P0S t2R P(K Q 00\<2< 82 A0!/@!b0SPq4 1`k QV @H9; 1^ ` ;9 V  @l@T 4 0X0 O0@p0PK 0sD 0sA 0SSB , p 0X0 0,@D000  0  0 ;\,K , ` PW,pK‡@ , `F 0V0C 0,00C0  B sPqU7Pl` PPg`P$Bogfff -LM<  24 Q B 0A"q#Wk1 80 U400  0,0 0S Wj4@PW P0@S$00Sx S  =Pp W ,VWO40P@`0 `0W!@M 3>P @VJ0 1P5:@TZY(PM ,V,VU @, 0@0, /W,V00S (U(K4 , , VW0(P00 (P0 ,V8 ,0<88 P 04 0<  0X 0 W B A ,qVP '<Pqo00S S PP< - @LT 0 00S S S 10 0h,0S00 S  R  R 0S00  000 厶4)@ 0-@LP0S 00,0hT0 -@ 0LR ) 0S S S4b |z00tD)@ -LLMp0PS/@ (K iQ0@0̗jQ@h .P 0D H0 D 0 BpKp@ h0 l @P J@P\`00S&@ #@0 0:@PxX 0R)@ 0 2 0=@Pt t0P  0p00 0 0$0 040( 0 t[@ʚ; 0-0LSP @x@$@ 0S 6/P9 00b40 R xS0h0hS꠰o -LM0S@80C hR3PU/`,shP`* ^j0p 0 6 0 lK00@0 l0CdP h0 l DP < `PX@T TDK;TP "f$0`$K` Y$@K 00 0 ˠˠTXKD K y9`PX0px00P P0  0$04@P(@; -0LS@ 0S0S S Slh0h P < _SP @4ʁ$0$ 7T)@xj|jjj -LM Q@p`P3 V QV0u03Q0SQ<X)H)0)))))))0)))t))x)ԟ))))̟) 0S -V tXq x- 0Sf k)墴 I U8`HP9 P7 00 R2  8 40$ 04 00, (0  50S6 S S aZ *0(B8SY S) S' <N R 00H0 P 0 0 a000,0 0l ,f.Pa00,0 0" PI ZpIRN = 00 0c c 00, 0 b0b0 V,0Y0 3 0W 0S80 P @Q 0!P7WV0Y0 P90 P,``x)@oh)@p)@`)@hj -` ML Hp`@000 p@0h0P` @00P@ @0(0P  $Ko)@)@)@)@*@ - L^p( 00 8A/P`PU``0 0@`0d@P`^$0$0$00 $0 80dC6OQ  @ 0S 0S $Jp0Wpoo<*@o 0-@Lw00P 0P m~00  >w00  00<00000  4P0P*@ -LM`@PwKp`H@ DP 8@P 00 @wK0000000000000000000O9 -L M;!0 C6B6cO`p`VpЁQ 000S @d _,080AS00|1P&O0d P7XqP0?H! 008a&0@S(1(00 R 5 .0@*%0 @@0w@0@@D$Q  B!Ϡ@l0 0 l@ Kp 00?2c, dS0d00ŷ`jp,j4B8B,o\o8oofffX*@doogfffo(o x2 0PoPV@= Q t00 H0S 00  "0S  P=8KW, 400bS8 00Pc<0PE0<0 fuU!pW!0SR0t p!{0<0 Ut0S< R00S1p RG;u007004u`P`80C6O0@P `0@`Pd` 0$0 0pd 0sUot0Sk40p Rg8 0S 00zq`oooo(oHo4o0o@ 0-00LP 0E Q2 1C0Q 0  0 00<000h00000t@.t$ 0000hjjq - LRpe 00Sx0L0 P00S $0@PQ XC x0 0@x0|@,P `00 0@004@ $ 0@00<000tP0  0l  l s008006pP/X@ x@wWh0 0@h0l@c@00oq -LpL0PS` 8@<@ R @00 00;00` RM00 h:00800hy -1LM tP@@t`1@D\, ! ?@1cR c@1@ ,0pW@ $/P`V20S` 4pW' 0P`OV 00U@/R  y,o:sUQt0SP0p RUP` P`\o0#6` @P?U# t0S2 ?UEڰB"0y,rp` y00@;00000T@2L" ^7<"0OQPM "@0P ?UT1!0Q 1 Q xA!0) ND,Krpzt1 \ 0n !@0P ?UʌTUvT "PQ@T P `z0OQʗPyT0p RRt<0p R],rp10 Pdo!Cejjoo@o8BDo|*@0o,o0~pW (K4K 0H ,@K@2 PD,04 @r,@ T-P<  KPD < PR.JD 1`PU&J0O U 00HP`F<@T D1P @00;00c< TDJ0 <D0\ 1@ > D8 1P(`80 p0@80<@(,  /00xP`900040K  0t8p:00 @0 @8 0PB&@`?S RQo -LM||@P0@P0 07<(6@0@ 0 @x`|p8t 8odoo 0-8 LRP@H0at8@0q 0-PPQT0T x0T0 PT hp0 0@p0t@H@0H0L8R(c00 兡0Xooqdo p-H`0VLPH0 00D85LFt0SLVJ 00H` 00000 R  600500 RP P0P0T00PTp0 0@p0t@pP RT0T0T00P T0| 0p@ pt LH0 0@H0L@00^upqDooXo -H0LSP 0H@ pHL Pp p`T 0@P0p P0^0pt 00000p)u00000oXoDo -H0LS P @RT T01T0 P T0 1p0 pt l!H0\0 @H0L@DD1 Y$*(!p00 @p0t@80#6 vP`x0 t,3 8 Yq80CX:H`@圐XuPtp Uh 0 `U 0t\p^Xoo`o@oqqoDo*@`o00000z -0ML 0 0 `p@P0ʠ @ @)(PT0T` P'HH0P h@lP`p@tPKh/tjXo`o@oHoodo*@0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S R 0000@00 R P,  R/ 0\00 S 0  0S0S 0P@ 0S@@0  @0@000S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \   R00 \0S0  0S R( ^ 0Sm R 0S 0R00S00 S0 0S    R 00000 \0S0  0SR 0S@0T00 S @0  0 S 0R00S00 S0 0S    R R 0SP0U00 S P0@  0 S@ y -LXp5 PU?P0S`X`V 0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S p-` ML<@(Ko -L\MP p\ X0 T PL T 0@0@0 @0@ T0 \ P@d@ `P P`P`U P0<0h0 P < h LPL04l $l@\, 1h\ 0OS"U`U P ,KL 0*PPP@0sI ,T\ :P"T0p PPT00@(KhT 0O4 0 T SD @ "40\@D`U`H P H@@h D0Lp @PP X. WFʁ qp tq U<9 Xt0   0 0Su0000rtuXYTU0SVt0 TY t6 q: R Q W t0 00ȡR XY V qrruuXuVzrQ+@ p-L M0PK0%@ `K0S 0S  0`%PKp  -LpP01 0101 P`u 0P@`PU`P `400v0@0 @ -@L0BD00C0h荗po 0-L@P4DUT004A0P0T$0 0   R0po`8P@  00b R3 `?`loo0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S0-@0 S0 UTR p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P0 T- P  P 0S 0R P4o -LM 0 0p00 `R 0|040@4 Q0$0 $PK @$00$0 08P#8@$00KjBk4o 0LP  \ @0D0<0804000,0(0H0$0000 00L0S X R\0\0\0 QL0SX0 X0\0\80080@0D  D R80SPPPT0T D0T0 PT 0P0 PT 0D 0D00 \ T @TP P01Ps #X 10CR c. \P X@T (^$K @T 0Xe\"!10C c RP X@T\ \ L -@-@$.@X.@.@.@.@/@ 4000 {P@/ R, ( L0S30X@`Y6:P,K,pP T,@  L0S YX@$:` pP P M(K0` @F0T04 b80ph0 R \岍0` 0 40a8  p0+,0p " 8- 4ojd1@o -0LP@U. PU+ `ͷpP !,@p P 0$0 p0 00$0$(0$0 /00Y 0A@褹j 0-p0 ML@d@P@XX 0PP廆<<0< P0 P K0hIBo?4jDo -LHM@0p P80 dK0C\ `0 d < 4P P KPL@,`0 P$048,0 ! -`L@pT  P@$P @T@0$0A000 @$0@0$04o -LM80`S2 x K0 Pp1PU 0S PU @0S  00(P 0S  0 0PPU<@P    ~Uolo,2@ -$0@@0$0Lp`P 00$0 0 0PP4 0PUU  $00#X00S$m0 R0000 0P  0x0 00C0PU R }4o@2@ -LHMD0 p<0 hK0C` d0 h @ 8p @P0TP L`0P !@P$0   @ K40  P@ 0b@ -5LMM⬕0 S, Pp`q!@PK Z 0Y@P , 0RW(KD00  0CK@ 0 p Y@P̀ 40D@0QK 0@P20 81S 6!@P&1!P  2L `$0`0 0@P00S @P0xPPz%ULP H $ L! k-@g@P10 P  @P P  L``P_@PP8$$P$P!$"2 0P1 $P 00Kp @P2P  P!$0X P1$$PT$L$<P!0Sc P3PxgTH! 000P10P0 R0P! P10 KP$0 PP!P,0 P 0@P KP1PP000<K F@PF$10SH1 OH1 0SH1 J H!<K@ብPxPT  @@ !gP HP1  P0$ 48P$P! ΥP10PT!$L! 0 P1 ;꼻jDoX=^ j4oj -LM,0 0S K- -L M,0   <0S-K K -LM,   0 $0S-K K -LM,   0 @0S-K K -LM,   0 D0S-K K -LM,   0 0S-K K -LM,   0 0S-K K -LM,   0 ,0S-K K -LM,   0 |0S-K K -LM,   0 T0S-K K -LM,   0 0S-K K -LM, 0  0$  0  40S-$K K -L M,0   L0S-K K -LM,0  0S-K K -LM,0  p0S-K K -LM,   0 (0S-K K -L M,0   h0S-K K -L M,0   80S-K K -LM, 0  0$  0  l0S-$K K -LM,   0 t0S-K K -L M,0   x0S-K K -LM,0 0   0 0S- K K -LM, 0  0$  0  X0S-$K K -L M,0   \0S-K K -LM,0  0S-K K -LM,0  00S-K K -LM,0  d0S-K K -L M,0   0S-K K -L M,0   0S-K K -LM    ,0 0$ 0  0S-$K K -LM,0 P0S K- -L M,0   H0S-K K -LM,0 0   0 0S- K K -LM,0  `0S-K K -LM  ,00S K- -LM  ,00S K-40040 -@ ML̠ 0 @PK$h p-PL@`@P4< D 4  09PpX2@$9 -LtM0 @ K P ;t x0 000 0CS4*******@0K4;D@0D@pK8<  TLp |D@hPH`Pd`0\X  @$0 , (4HP0L`Pp(K  $ -LlM$P0p\`$  0`0@PW0 PP  ` Q X00S @@$K K D@P l00b0at f@ -$pP0 LR3 ``L0S $0 0 @ 0 @I 0 o `00c@  `  0S` ` -L M$p0 40 R0 0,0 !P`Q VP! , 0 @0 RP 40  P000c@ , (KUP -L(M`0 p0K@0 ,0 P L H0 D@ < P8p 4 @( W0 PKX@ Y@00 (K0 PKX@ Y@00@0 S T R@ h -@<0L0C<0P`p, X0 1@T -LM0` $p @PK 80K0@ ,P 8@ 4P K 0 K -`0L00Q00\0S  0@0U ppW 0S  .TR0` 0c0  b -L0L$  0 R02& 40)P -LdM0`0p@a 20 S] ,< D00( ,0YPP100S-PK S>PH K ` 00SP< PP8 0PP1  00Sb  0bPP%40 H<00<0(K  0,0@0,0(PP0S (0P# x 00l PoPSPPK 00 000 @ 0( PPk  09PP@;40  00 @KiP 0@p@ lP <PP -LMPp, @P t 000(K`H0 00 it @P00H00\ 00 0@P h00, @ q -SLM 0 `  0K0 @Pt0 PL 0C"(40 0΁Y000Q 0 010!La000 Ѝ8B oųE.(o,onmd=|=$ok_k0@-@PP0  U0   R 0U 0  P0` R.00  \@ R (0U 0  Q000蔲==E-@Mp 00 Q.Q00R.Q.0Wࠃࠓ0ЍSR J Q.Q 0 S.SQZ0.SR.0Wࠃࠓ00P^ J0 S .ST \ ^ZX \0d `h`cV 0 S  ^Q 0 0LV \00SQH\ᔡ&P0@ S  ^R 00A\00Q0S\ࠃQ 0S0C0^ Wࠃ\_00W @0'0!00c000l0Q0Q Tp:Sv  B0 S 00l bS0a  ~0 R0P 0 Q0I0 s R .R ꔱ=0@-@0 S0C R .RN21CP 0 0 R 0e0@ 0  @@  ^@%J 0p 0 ^ BJ0r0 ^J0 BR0000@000  E- @@  0S ~? 21C0 CPbUP U`p@PEupG8 0`P0@Sw@pPUpG&J 0`Pᐠ0@SwPU@J 0P0SU@ J 0P0S 0S ꔰ=p@-@?0|03\0SP`@ 2 1C 0 0q  ? >1C0 0C 0S0 00n 0C0p 0S p/SN 0S~0S0 00n0C000Bp/SN V:0S~0S0 00b0C0/S 0S0S0  /S 0S 00L 0 3A0qQ P@ R .RQ4 0?AcQ 0?AcON -PPLpPP!0S|0 <@Ph@d1 T!T10Q@0!81>@ Q  0P@ 00C0$#Bb2 0a༐ 0> 'b! 1  b0àD~ pLAD RlPEd31C 0 !000(k4o0o|=nmd=QBP3@0@- P$@ 2 001^   R 0\$0T0U00S 00` -RLMp<  @1 11T  B^T Ya<0IP 0S[Q `P00K, K40K8,8K 403@P0@#pC :CP80H 040 :0 80 H 00X 0@@0@ @0@ 40T*UH xl1PU` P80,H 80 H000@40@T0@ :8, uU.@(K80H 0 400 0280,H 00 80,H 00,̠ 80H 00 0@@0@ 8, C0h0Q 0S<@@8~ -LMQ`<0 pw W8  h@  i2iPP  94 0\ B 020C!0s 20C@ 0WFX4@ 5PP10\ B Z! ꎎ20C@ 0W,P4@ Z 02B!0C0s  ZX 8 R4  <0(K0K1,0 C8  -RLM`PP0R (K0U0K, K40K,8K 40PF8@ xpwC 8@0H0 2$W y  00 s00( x1\a |9 :C\H00 40  0:80 H 00 8@, C@0h08@ T ᅲ8傲8@0H 0 4 00, H00B 0  0$  " 80"H0080"H00",80H00 8@H 00" 8 0H008@"" -0L|MT00T0R1@01`  0K1P 0! !TATKV 00 -L Mt< @0 P4p g0 Zc4 4(K"000 r <0\ 04  t0,KS0,0  , 0K,< 0cP4 @0 Q,08 040@0 t0Sd, 4t 0 0A 0 B0 <8 Q< `X, Hl0B , d0 $PH<Z0@0P0 00As00 g0`` Xd0b ``` PX00b> c @SPQ0 `P20s H<֌Z0@0Po0sc, 40u@P0, Pg p@ X,0K@P4 O W0@0@4 , 4@ B4@o84@@o -LMP p 02@$p  0 !P  0P:0RT0P$pH0 L1$^A   !T00T01 01$pP0S2:0}lPlWP`W( K,0K ($K ,0PP$px~H 04 0 0, $pҰP K$̰ -LM4p`P4K(K 0:@P$,K(04KP,(0H R:S 0S Q0S$K虰Pꖰ,吰 -LMQ@`PdX 032`DnP6"\050@0 0 P墵pPX 0\ H `X H0N a 0P勵pP W00 -LM$@ 40   -LM04`<0  <0qPD p,K8 K0PP40K,08KSPP.0, H0P*0@SH0 @0S0S 0 TP 0, H0 @0Sp(KUP0<\PP0<00<0 -LM4p8K,K 0T@P80K,08KP30P,H0P *@,0PH0 @0S\ 0` \ P d P 0奯ᡯpᝯ(KT0唯L4@X4@ -LM00( 0C4Pp00 @4K,KX @D4 0`P1(K,04K墴`P-(\0H0 R (0S  @000 A @D\0 0S (僱`P 0\ 00T00S$KC(@ -L M, ( g0 g0 p`(0S$Ktt0\p \H 4`x0sA ,K`X H `0Ld0 @pP@,H0 @ 3  QP,0x 4qP0 40Xt0S( U$ q@0S (0, (0K,p pP(g0 t@0\p,p\ ЮW,,pd4@X4@ -L(M(PxL ^p4:dX0  a<à  0, `PX0x ,(#x X4K>< K,0K`P( ,0H S\00K H 40<K廳`P00(\ H @\ ݉d ىg0 0 h0 0& 6#40& 6#40& 6#40' 7#40' 7#40t  t0#40g xg0y000g0z000g0{00040x rv00040x rw000,0SKnD  @  D 0 @ 8P: ,0 @D0CS,03(0\ C(0B`P< K0 (4K A(X>`P0K40<K.`P00\ (H @x 0(K00`PL R g0 t, x0s P0H0  H L0,`@0P,` H -,LhM0,0  H x @00 T |  d 00 4| ` dg0t , 0tR-(K@ 0KPt | Pt @40p@ ( 7K0P P` P0t0 \ X  `\0 0R   S R\ o T `k 0Y 0R S .SY B0l0 D0 h0 p@KdhP K<0KP@`HK@0PKn@P2@PHHPH 0@ s 3SS9\0S`lp R PP p!hh b \ X V\ `lp V0fl2l Q 0\0"'t X |  ᴹ0t0 P\`\ 0\`S & P X0S@H` 0 0  =H@7K Pd(pd0,0`0x 4r` <0SPZ V<` PRH嵬 v 3`x0s00 @`Rw T 00R00SS  Q u  0IPt dt0S  Z Rt ` <D0KPt p D0R |0 0;0x t6\ X d\(p\ 0B,00.S  R R0.St`R <` T dt0S  Z R= e | 0  |  T0  u  0Pt ~dt0S  Z Rr A | o0 40@hQ`K0t0 cHt@ _P t [` <D0KPjp0S T x 060D0| T   d00S  0Pt 3\d 0A,0l0(0p0\;0t %x t0 6t 0x 0`60 <D0K@P!pQ T  &D0 |0 m` <D0KPt p0|SD0 x t060x \QP0t@ 6t@ 0x 0FP060 D0t ADo= 00  $00 0-L P @=P004  0 0 -LM0K@ SP00 0  -LM"0K@ BP0   -LM B`0$0 ,` (  h0PSp 0S\, KU L  0cP$  9$KK]*4@ p-00LSP@0 0< 0S  X`P  0<P 'ph0S 0S p-` Pd0,0d Q L0L@ 0@T  T0@0 @0@ ,00@$( Z Z [|  | 㷆p -L  p1`P Rx x0`@Z0Q 0`S<;$0 :$0 " -L8Mx0Pp .@P (K@Pp7 U@` %0` 0``S@ yT$0040  0@P(K@ H H :k@P x0, P3 4 0R   JV P<z;w , ;00k000,0 H@ 0 4 !0 4 !0 4 "0 4 "0 4080 0$02 0$02 4$ 40`^\8 2@SQP  0 400 0,0 0 @400 0002SL0 #PP80S 0 4s0 x0 0 40,0080 0$ 00020^t 8 0Bp \n:0L k0Qh 8^e 4@,0!< 80x D 0,<0r8<00 L< 2!?04 H @D000H0`T 80D 4t0LP QT  3R 0D 0 D x 2tQ0 08l0l00P S@CZP@l0 4p0卄0@4 C`\ d0ᄄd @0RX O@@0 40,0P 0 S,0,0 |QKP00B |P< P P@P$00104P0010h0 0 b删 x0m"0#4X0 <0! .X@ $ 0@,00@0H&0%40| e0  x0x40+H#13 @Px,0H@ P 0|0,00 +0 ,墨0,0 y\ PH P0 ܃P Do4@4@4@= -LMBK p | , P`P$ $ 0S    `P$ -` 0SPA/Kp`, 0R~(K@KZ 0㋳`PZ 0x:@0,0 0C(` 0@0፽`PP00S` ex0\" 0Q` uP $00 lm0 0 ` -V$0K 0S`9V R0 0  00 0 0ECx0s00> KP.  -`{ +P010r@2  0 0 p` V c 02`0吀PkPZZ nZZ g [| ;Doj=E0  B40R +$ +$ +, + +$ + + + 00 ;0 000   -|`| @!0@`$dP#r"XX 0' @(?0# O $ Y `@&0#@8^nCCX좙N 1s s s (080<00 080̽jܽj< R00 0S00@Q 0S!0?A01,0000@Q 0 S 1 91 0-L M Px @0 80镹K0 p-0L@`t $0D#XP4P%(,0(0%T"$Xp4@85@@D5@ -LM0 pR 040`V  PR00` X0@0b4` c SPQ 0P -LMp 00匀0CSD0P`S u*  x 0D0,  0S40@` X0b5 ` PVQ @P 0@0@H<屁P`0@0vC@" 0s0s{XX5@0<0< 0 < -L@- -L@- -00 LR@`Pp up0V 1 -LMPPpW!pP 0@ BpT5pP 0 p߰ p-LM80@SPP Kp `K$0 00 4 0 00 000rp g0 0g0h0lj 00n0 -0@,LM0 Y1訳o -LM0 ,0 @Pt0pS( x0R`# :M, 0Rb(KK 㞀d K`P 0 !0 04̀KY0K00  L` H` )$0 00 ,0 "0.00  K0L`P0  0  0TKV KX0Kq0PzM0NKP KfY0[ 0Y0K0 RK]0Z/Doo= -LM0 ,0 `t0S4p( x0R# :MM, 0R(K@K 0@:PK@K 00 p #0 00 0  000 `X 0H `0Cd0 PPPd@HH@  H 0#40%[ 5[#40%[ 5[#40X [ [5[#40$[ 4[#40%[ 5[#40x tr= !4 0 0 %[ 5[#40%[ 5[#40X [ [5[#40$[ 4[#40%[ 5[#40x r kP d KP)  b0#80 [ t0#80w  @0S 002y TKV KX0Kr0NKP KY0[ 0Y0Ke@ PK K 0H YKL @ P 6P0  0  0"8_.0 RKY0bLDooj= -LdM@0 P,0 H L h7`LL 0L^|0 p H0U HP}LƟ, 0 R(KP L0^\ | ^PL x g0` T  0S x0Q 0 0 x0@x @0` 0T d0Hp0 Ppt (0 d p,L | L tt0P TQ   \  Zt0SHpxPf0 N HK ᐶP]HPp Tt t   \ t R g0oT\atpP\H0 Ht 7 KPJ00 0 0 \QZ  LKTLPX x X \l (0h0 Z T\0Q@L L|    x 0@00L) | |D-0 .R=| tQ H00 \0 0 PB `0S ֭ | T R0S8x \p BK}7K }p0 ,0d 0( xp @P BK }0SLxl00h 0( 00lx@P 0S | L}|  L刭`\Xd x2p 0@P QLcpTx  0S\0d 0$0XPQN | a R@G X0tpW9 `X H `0Gd0PK V@P'P '4H0px0pst 40  0x0s ','8  0P5@P L@0S 0PL$4T 2T0TDoq=5@5@0W@p5@ 0-P@QL◾Q0h -LM@p0`SP40s0s 0s$0sH0sL0s (KP0s@0sDq L0$  0R  PD!88S(-g0 0g00 00 y L0$ y0  ,0 s 0,0 0S P0 S 0, Sp 00S~ S  0GP(0s L0$  0R P \0  0P00S 0  (0s 0(00n000s 0000rp 0g0 0 g0 0s L0$ d 0S P]00S 0 g0g000g0g0g0 0g0 0(Ko,g0 0g0dYx 0, S 0PsnL0$  -qvJP'DA0sMg00sz -LM0(@KP4p`0 004 0 0v 0000g tI Pg g0PL240 g0 0J004 @ 0 0400H@ x 40 N0 408 <0,0( Dg0@ 8D04 d0$04x \0 00@L0P@ 000 Kx0S 0S`X H a0C$0@2"@1<@00   / x0s@0! h0lj 0| (0h 80p 0rg04 0g00 0d0n0m -LM@| 0g4l00 0 <@00    0 0@@'Km -LXML T 0 SP 4 @0UP Pg00X0 Px0 0S P(KRX0L4c cb SUaQUs8` 4p L0P h d0 \@X`@ dPQ\P H xD u` X0@P0b# c8! S Q3P< @0   0V: X`d0 ` `6, P0K.QT忤PP80K0@0Ud @0jh@HD0cS0! d`PS0!\ lHS@1@!L  P0lUCL0ST> @0Wx0X@Pp@ lP L l8B \AQU<&`d0 ` `6, P@K.QdT0@K @GP,KP8 K0PP`0K,08K]PpPUX^OTL0$  JP 000EC -XLZM0 ,0 p!  pAl! g04   KK[zl `0S! T1 T 0@0NTlAPd h  T!20 d1 nAh 0 dp1t 2Rx1 Wc@ P L! @@tA l!P pt!x0b0a1 KV Sd00X\ 1 գPa8< l2| \Y1Q 0`! \1 0UP!X1 pR/KO?KNOK@P K81RKģP @儁@08!H| cX!X! 0S 0PSW Q S0x p40 40Ȍ \p@04 .1KXP KK Y-K-[00\%(@Kl0S/:MKl! P !hAT d 0L\d 0 @` \! @ hA X! H| 0 ` P @pR0S S@0`1 \A @XA @`q\!rKV 1 R0dA0d0l` p0T!00b0p1x P Qڌ0 0C, 0R(Kx0sy 0@t! P1 LA 0X!MKX 0@@@`a \q 0 4(00 s<1xSX `H a0C"0n2O@ a04 .1KXPQ-[(0K 01BR@0@`1 \A @XA m @坝KV ꗝl\} pt!x0b0a1 KV SX\ d0rPa80 `2| PY1Q U P!P{A0 0z@0RU RU*ږ0KK,-1K6y-1[!00(@Kl0SC:MKl!P % 0h!`@pR d10CSd1 `hA@hA PUlx0s@0041 41 0U.1K U0KK,-1Ky?@#KV K>KXnK?VB? @'@t 0OX DopA@ = -LPMd dP dX 00L dT 4SH P Sv OX  LTx0@0 @T0ReTPa 0@0@TZPTX ,0KVPSLTxD Z 0MJ TpǏ p X4 RHPd`0@X0@031@ a< QT>QD @PTA 0CL0PyP\ ] PXPV X8 UA D8 0L`T40l@Q  ,0T0\0(KY  L$P\ *L T0x D 01 HDd0X0C03>\ 0C` @ < X8 9^ 0nSZn< ^ZRQVp l0 T 0\0 4 ^d0 ` RLDx0S*d0 \ R X0P H` \0b@ 0l5 \ Qh0 |tTl0pP` P `5>VNP1V0hR3Q ʧ Lx0 0SXU H d0PpppU0 <H7w00@p00P`Sm 0s] HT\ dP`0iZ! /L x0Rp:LxP )P/00 HT 8\ Q,H0d 0S* 0埝L\0P00T \d H0XPRH 0Kd0 P幠P\ 0儛T0MQ0婝0@U];0so\0STT\ 20SH `0X c51 a0 QVP t P $h@0Sl0 l0p0p褷o0  0- LP X0$ 0X00H0j -@L   000 -QLMP P- K@K00, P0S0H@K00, PQ0 Qjj -1L@T6 W@1 0pS0pQ*ڴ 0SP#00S PU R |`0S l0S Sh 08 RW@0D0P꠷ojljA+o -pL@` PP <@p ` 0 0 0e0K렷o6@ -pRL PP` U @W@1 tpWP`K6@0 t0  0- L@p6PP@ A`@0S @s:0S 0S 0s $0S0 $ \vXdJo -0R,(SLpP ` VA  ᐢP K@TZ,@(P0Y 7CP Z,(@Y 0-80LS@P0S  R00Q0 0008_ P PP JJ 6@86@ p- L 0`S t0 PUPU 0S 0Sx@gqpp蠷o -0L@pTP) `0S0 tPV 0R`@TV 0S F0@S S1;.꠷o0  0- L@`1;0PS,6Tw 5T <5T, 5T 5T 5T p5T <5T b5T 0T 5TL0p0SP d5T :0CT .H5T @5T 85T p(5T o5T ;T 5T0S i54T0p;0 /4T 0T0p00 0CT0p04TQ4T $4TP gpH4T 0T 0CT@0p00CT 0T~0S{ 80@Sp  r0CT 0T 3Th pL 0 P0 0T0\0CT 0T 0CTR0p:0O0CT6*2T3 2T0 pDi0S< i0S52 0R 0R 00 p (H0p0$Q0pp 0 P 0p00@S0p@r @ 0pD00p0=00p0S0<0@Z p0 p 4001 @pu c1  i=0p0<0p0P1k<1  P 0S0p 0p i0p0S0@0 QpH0T :00Sp0T 91T p0dpP080kB @~fwBfB{BlB sB@f@nB@wt@|B@vB fB@hB yB}BzBjB@oB@pBxB@vtjBBqB@mB -@LGD0S HQ\U0\0L \U0\0 -LMS00 Sp p@`0\P, 00  R400404 0@0 @ @`0 h0 封 ,00:0`S$P d 00S* P 0 0 $  (Ko(KdJo -LMQ`/  P 0 PR@T% @T 00= 0 000 (pP Z0K P0 v<0S101@T(K0K 8D+ -LL̠Č.Č@!̌K M0(K.0 01K (@ 1[!0 !K -LM@ 0  $K1K$@ 1[!0 !K -LM@TPp4@ ' 040 @T 00= 000  0(p`P X0K T0   <0S40040 @T4(K0K \$50  00- Lh@X 0PS 00  0- LpN0PS`  0R` 3 X0 0rX0> $0S;1 $ ^!\C :0S \K | 0(X$@L\":@T* 0  0@  [  T` 0 @ 0  yJ 0$0npP` #P0Se6 `Q\- `V' 0 0 0 0 dJo\6@ Q-Lp`V Q CiQ Q `QE ?*00@ Tr 0iTP0 ;r17`r @P `P 0gT& 0Y#Y#  xP ` pw Q0 0Q Q000000` o 0 0i 0 -LCMq0  0 $ `B @R` P52` P`$ 0R& K,IK J/K0_`P(h 0Sr(`81(0@ R0#1K 0@ (`W yDo0=0@-00 \ PllP \@0 SP 000< 80P 000nS0 n00Q Q 00 84 004 <0-00 \ PllP \0 S P 00 000 00A S@-2*Qf 1@ 0S'\+\+H\+H\+[+X\+\+\+0@S 2S K S 0S0S Q0A0@S. )ڀS S) `S 0S0 S 0S @S00Q00Q`S pS SS SS S0S:00:PSS 10 S Rj -LDM@dKP@pknT@D` @0S񟗾hd+`d+Hd+0d+$d+d+ d+d+`+`+`+`+c+`+`+`+`+`+`+`+c+c+`+`+`+`+`+`+c+c+`+`+c+`+`+`+|c+dc+`+`+@c+`+`+`+8c+$c+`+`+b+`+`+`+b+b+`+`+`+`+`+`+b+b+`+`+X`+`+`+`+tb+Xb+`+`+b+`+`+`+b+a+`+`+a+`+`+`+a+`+`+`+`+`+`+`+a+`+`+`+la+Ta+`+`+Ha+`+`+`+`+`+`+`+@a+`+`+`+`+`+`+`+4a+`+`+`+`+`+`+`+,a+`+`+`+$a+a+`+`+a+`+`+ a+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+`+0 W*W$ KH$0S; K W0܇0a2W 0\ :0S b0 bS \* 00a``000 0 0 K10D`0 K10D00WW 0P :0S b0lS P*0 01@0 WG*W$ K$0S 001@0P:01V{ ;0P:012WeWj 0P:0Sc b0bS] RP010W:0 0P010|0S4 0< 8oP 01fh0S 010c_]`[01@U0R0 K10D`L0 K10DF`DB@0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R 0 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S0SP0SP0S  P 0S0SP0SP0S PQ00SQ00S,, 00S0000jo R000  B ᨷo -L$M@0Q0  %2 @00S@0<5  0RK@00CS@0ʼ%8005 5 2K4 K Doi <= -L$M␡0P(0 p8#(`HK503K5P @T@T 0S 0SY@T`00@T V 0 03K5!( 0R"$K0HK03Kx5 P :P P PDoi djH= 0-L`@PQ \0000  `00`0Q0h,j 0-LPP) @S& S凨?0 0?@T 0S X?0P 0?@TPP@0G?j@#AЃ@ -L`6piH0PU ,0S @A@PUhyꜦo 0-L,0P@T @T0hf$j 0P c Hi p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPPu@p0@ 0@@P -L M<@KP`p i81,` 0 P 0S@ 0S  @TKT00 ,6Q jo 0- PR0000 0@ L 5 P  0h0 -LpP@68!`0hP 0pq@P 0S@0S`L@h]ꬷoj 0- L0@SP 00  0@ 5 P  0h00S0 000000 p-`@P LP 0R^h ph7?`6@-Q 0P P P-@0 kH0 fD  p-0L@`T$@T ghP 0 RP U 81 SPUppp ji$ 0-H0L@PT $@T ;hP0000 j 0-<0L@PT@T 0$hP0$j -pL#W`P,PU) PU7 0SXQ 50@^)*0 0# 0 0#^ gP Q  gP PUP^ -1LM@ T$ P$@T gP0SP 00P$ 0R! K@`T SP4pK`Wg 0g P@T PEU] jDoT= -LMЀ 0R$0 Q   Q$ 0R  K@`T RP4pK`g g ѕP@T PEU Doh= -L(MP R0`,0 2Q  R ` 0 0S0C`R `QP `, 0 Rb(KP0@1XR5LK0  fpW7 VD0c`V  zP@" 0Y@p `FWVP0S <KԾ bY @ XVP0 0fP 0@ O<Kf  FP `FXV @P 0fP 0Do$jt= -LM܀0` 0V$ 0& P"PPP0@TU 4pK PU@00T00S `Gf f P $ 0R K PDooj|= p-@LT`P@@T= efP R000 0 0 PP 0S R000 0 0 00CS00$ R( (080(0 0$( pp jL 0L0 0- LP, P@ @ If 40$    0$ (0@ 0 j -0LSPp @T @T eP  `P"  P 'f@E0/S!f09S@P 0@T$@T eP000@p 00   00 ` j 0-81L0M0Q@ T $@T ePP @ T(@K6e0 (0K'K@P <Pi!@PD@K l!e @P <P@U @P 0RK0! jDo6@A>= -0LS@ S 0SQ 0S 0Sh< dPT 0S  dP @A> 0-0P@0PL P$ P$00 P( P(00 P, P,000;6@ - L@ R! !  110C0C11+g 10P RZ -LP`p@QT 0@SpW@0@Sp@0 0C@0 gH0T0H0P U -L@p0QQ 81\P 0 R P 0 R$j -L`0pPUPU 81W5 @T@T 0 R0S dP@$j p-L M8`KP@ d(P u PKpj Pp-LP` p@Q Q P @P 00 0@ 0S0C 0 @@\ $0\   p(+ p-L`cl0P@T %0B8R#8 S51S@T0ph$jB -@L\%(h -5@05L&K%`0/ hvc 0-5P0L5@T ~b@T  R! !  110C0C11e 10P RZ%0h p-L$M`00 0P@T@T 5 %d1S KH< K@T( 0RKpEDo$ji = -LMX, > 81`VH `VC 81, R@T@T 0SPU 0 pR*0 0# 0 0# WY  P P 40 P(0 Q 0 $jj jj -L0LS@  PL  $S 0L0ah+BQ -0LSp 00C SP@ 0S0 C RQP@T`U 0S U0S9 0`V`V  cP cP0gS \ 00L S0gP ^0P@@\00L SL0!l/@!b00RPXP0S jgfff p-L@`P FPP  R 5p@ p-ppp p-LMK`i@PP PP xPPP = -LxMPU, `p@ ;U ;Uc ;0S`P l;U ``, 0Rw(K(;UM 0UR ;UK P` :%U H:U pP0CU0CU*0CU] 0U  0CU \ @ 0 `5 0# "`05 $@&z~`PH```h`9U N0CUE u0CU 0U 0CU0`1=`d n`9U3 <0CU 0Uj 0CU~1`0 9U 60CU? 0U 0CU0`P]P~ȕ`W8U[ 0U 70CU|`PI1Sm  `yh8U \8Uf41`0nD8UD 0CU[`P(9`P# W7U 70SC`PLPK 0Kʐ`PA_O+:l0`06h0`02h@`P1S  h0`T qB`P5$  &q< 0 \%   `P&5Qd PUa 0S^0[d0S S S `S S S@ v`0 p` P`^`PPK@ 0KF`POO@ j`@ `G`P0l0 q`P k9`PfP P @T 81R  ᵀ`0@0T`0Y @ 0S0 R4 40t440 0 40 ( 0R 00B 0`P#8#Q ` D 0   `  08 C(` !E81`0Ad 㖎`;_?P` P`2 L@K @` 0KǏ`&`P `P &`!-`B@28#` N 5 ` ?8#*@5 @s5,2UZ $2UV2UN 7UJ2U@KO@ _@ 0Ke`01` ` [`n@D8#[> P0`81k`0@ ` `&V[` C PA`0@ ` `VF` /k@P  `2Doi$ii$zi i$xi Jii i =i i i i$i i$~i ?qji o6i(KiFi@i -ԁL@\g P 1S 1 RQ[ P ta%0S 0S 0R0P 0@P0A!R 1 1! R o\00RR  qP`P  ^  P PH`P  ^ }P$000$0S5 jj4jj?jo6@ -L@000  0@C^hj$j -L@v00S0 0000@hV$j p-1!S0#RL:5 `0 P0 00   `00`0p`0  p0`0 0 @0 l@f\0@P `0S ph000 0@@0,jxoto p-L0%LQ`U @ 02phpj -PLp5`";5!T2T"1!p,T~N,)& R 010  0 ` a aR0 10  0 @T 0 RM 5 Q 0 0R0B 0IQQ0  0 0S0C 04 %01$l(i,f0@T 0 R 010Q@Tgt0 !h=0 R404 H040 0 40 `+l+l+ooXq$jj,jo jo -LM2pS20 ]e00S P, h0C00 0(,0  B,0(@`(000 0 ]Pe0h 05U0d00H0 a0 p@B  @0PU0doOj(+ -L M<@< 04 PG,  rKhBk6@o܇+HH-0#" A0: 0 A  AQ0A0ABkH=0@-PR@ 0 0!\!""0"!0=@-pR` @P@@ 0 ,>#!^ """!1# 踴==   -"LR@ \0700s"R p-@LT`P5 T T a\ ]\p/p0S 0S0S @T J\ F\p3000 00   004\p@Tt ,\l (\p@0^  0@ 0000 0\pJjPj>jDj -L M@*PK0pK `P5BT+@T(  [P [P00CS0 R07004` 20C2 [P2 0C2 `$K  -L M@pT*K0K` DPP*0[P$K00[ BT@T  [P  [P0007 @P"  [ }[00 p2 S0"00+.B 2 02Y[P202W4PS7P -\ \:5S0d0\-P41P0h040\0\ (p2i 1i i i -0@2l D0C"2X 00/0020SL }Z @42ɍ@42Bklj 0-2L@41pSl0 P4e 1d hfP0e Z020D 0h P+ -PpL`J[81W(0 %g 0*   R P 0S  RP 0 ZPL  ZP11<<110 0@0@00@0@0@t04 !48#H) 1# 5 " $3TT # Td 3T00S 0Sj ]if ^ZP i\㎍㺔1 2T& 2Th㭔p2@P pY0Si AHB@ D0RW< 1 00Sa<`10`@  @ 51x5〔1@P p,0SV Atp|1@P p0S7 \A0S H1R0T4Z `_`P  ! kpyZH00H0y\L0Spm000 0@@0000 0@@0cTZ000 0@@08jxo5݆toXqoo -LMp@AAP`2@ V3\(KT 4 P:  dX 4   \Q 3 QXA@@@ R+괲+б++б+б+б+б+б+б+б+б+б+б+б+б+б+б+б+б+б+б+б+б+б++б+б+б+б+б+б++ ( PPv 804 0C@800K//@6K KY@0K  DY@BK ^PP @ *K 7Y  3YXH 6K -Y㲁@!1`RB[1017@v 00K -1P12K@f0K 0tP 1  5  ;@T? 02KP08!Pd 4 U XA@9<0!0 1SQ<P10Q!00@  !0@ 0 0@0@z@0< ^0P2Kl 0 ?e j6@ʚ;Q0X0ᬁ0 Qp-LP` 0CQ :R  R R /pt0Q p%0CQ5@@05lV (00p0h0pp2i i + -Lp`P DP 5AUp 4 20S00 0@0@0O   R R 04.Z/Q`@ D0RH00H0Z 7LQ`Z40 3A0 < 1 00S၁<10@  @ S0P` @0S |P`0@ | 0 OP`P`000 PP.6@Xqoxoto6@ -00L @P po p- L`@PP(  00e-0 h0%0 1!0 Td0f e ,cD 0p4@P3 p7@+x+po -@LhXj- 0  \  \ 00SP \`0S S S 0S 21C 0pj p-` LPP0#U T @u T0000 0  Tp QP-@L`Ppp m Tk 1R% 1R`  0S_0pS000000p 0S 0S P` P qP;   R08 PpP`PPp X`1`!  p @P@VP 01 @P@PV $eP00S`` `0P`5i 6i( -L@`p  PP 0` pP0  0Y-7@ 0-L @PP 0  Tb,0P P 0 P3-<7@d7@ -pRL` @PPU@ -L  0P -d+tox7@ 0-dPL@XT   @ T06txo 0  0S-0S  0 00Sp@- 0@PcUe\5*0   0`Q  ^ T 0SQ 0S p?R00S eQ 0SP 0S pr3p p@- `P0Q!U 0Q 1 !@ T0 0# 0 0 0#\pp0 PBk -LMp, ` 0  ``0S@ T00 R *0Q 0Q  R 0@0S`0#0S0SATg@1@0T 02 0Z@T`PU"0Z,PU 0 @P  @T 0SY 1 !]PPU,0S@ OP@@0\à@-0@    @ @0 -L` P@@Qp >* 0 RQ 3  \0R 000Q ^f 2 @@@ 0  PP0S:  0   @ 0 p pPP00 -pL0S`0S 0@T  0 0S@0SP U 0Pl P 0 -L@p`QT0 XpP0@@ 0 0 @P<0 40\ 0, ,0 0$ $0p 0BkBk++(+++ 0-0LS@P 0p J0P 00h0 0-0L R (0Q0 R0PS0h* $@P 0S 0X0X Q*00Q8P 0$* *뜦oo7@BkBkBk|o7@7@ p- L@PT0`0 S00 00 0P0`@p P@]*ꀸo7@ -0 LR* xSP -LMⴒ`0RPPP@@U%U〢xx2 EuS epSQk*0PSh 0RS BQ:`aU"0S`1 pqQM@!``07Vp9WX00S0 jPp \10@0/S .SH1, K0D,0pS: ^!Q Q\ 0d 100 0  RPpdR 0 00`0 R 0d1000<)0N SꄸoBkBkj|o\=7@ -LM `PpP @  RX@U TU @Tp R P 05 0S PU 0ES 0 Y Rp T 000S` 0 P 0SPP0 PP 0p0 00R ))  00CS 00 ^ڿ0S  \ R0S P P  0S|)  p P @ 0St @Tz  dRPf p \0SP 0S:0S   0SPX `  0`V  `| Q R 0S (p50S  Q0A 0 >\0P0\P Q  00CS 00S 0hd x(Tt(p0D0  ( 008@8@X8@8@8@,8@o -LMP < @ 0`Q40 8` 0` 0<, K,0SB Pp- p@Q V Q 8CRPP0pS @+PQ (K T00S p0 S <0 00 0 V 8 ` 0 0 8000, @R? V 0 0@S@ @R4 00T00Sp@T! H8S0P ,0 SPO 0UM P`Pp@T /P0UP08#x0S5 R 0AS0AS R0 040 DP8 l ` 08#800 5QS 0 00pSp0 S 00 0@SU} Q 0 S R 8CRQ; 0 Sg PR 0S 00 0 P@MP PEUp@T@ r@Q R#3p0pS 0$!'PA'9@8@ Qp-L@`ph0 P PPUp0U PhP 0R Qr r0R@QPr0SQ * 0Sr0S Q1 \  -L@@PA- 2\ \@pQŸ2 00l0a6# a c$"cb!0b0a!6# a c("cb!0b0`# ` a` P%"^0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b#b`! ` a%"^0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a"^0a 0` 7#0bc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a%"0a0b'#Q0 |0x00b0l6# bc! c a&"0a0b"6#bc! c a""0a0b1#bc! c a'"Bky7 p-L@L0`SPP P0  hpBk - LRp` <0S 40 P 40 0 R 0S 0 R 0S P@0H*$H`UT0D@`fPUV00S@ PU P80080jlj -@L `P pP 0 0 R NPPU 0 S 0:: S cNP0 Q 0S R 0 S PUX r0rS f@P@P T 000 RrNPr r0R Sr -Lp`@r00S *@P @V PW 0P 0 R8NP @PP PP -rXLPpr@`F PZ 0SJ Vn 0@S``@@ 0S T  0R0S @T r`Q; WX00S 00P 0PPP R 0 0S/ 0S Q 0`0P0SPV``@00PP0 0RXp`P pGW0T@$H9@ -@00L] R000 h0  p-@LTP` X0X 7bP P 0< a!0S00@@p7pjjo0 ሸo - QLp@`0P& S 0S-` XOU` T.,+P+h+h+h+h+p+++++`+++h+++h+?-` PG @ BM` @ 10 ` `r`$-` 0S* yc`~c`W @T8`0 0 0` @^R]ic``P`9` 0S  0`X9@ --`1LM@0 T, ` 00 A p@T3  0 P!0R!R 0SP 0 LP P  LPW  0RP 0 cP :Op@TW 0 cP +O(K4Y1Ypꈸoʚ;0 R0%3 %'joP (0 P0 Qjo 0-L@PP P0 A0蜸o - L,-00 R310 P0 joLo 0-L@P0P  00<0 R  R 2Sj -\L`pP@P 4 #P P%U0pS*j, -< LR@ g00CS 5 40 40 r040r040 -0L pR㐀` PP%U r@P P P #P4 #P 0`S*蔸oj + Ȱ-P2 S R 2 S,00CS,0 R0000 0 jp@-@` 0 PU1! \ *0 00\: Up lp@aK 0-L@0$PP "RK"0  0 K0 -0LSP' @T=@T yKP,00,0@Tp, "0R8@#xT0W0 N`P K,0T0r,0  @ 0``@00 ``pjP -`pL !PP# 0@T \ x0$ @TP0S 0Pl 0S 蘸ooLo 0-l@LTP#l@T  R 0 0 0 R 000 0 0  0S0C0 l@T0贸od9@ -`p44!L l@ T\ P@T 0S R 0 0 0 R 000 0 0  0S0C0!  LP7 pP `l R0 0l ` 00  000? jjo9@ P-L 0S 0C 0 h1!9@ -@PL0 80CQ840Q 0 $ Q00C0M@P 0S0C 0 [ Dh( 0 (h  댸oxo9@9@9@ 0-L MdP@TX0T$ @M@0@@ 8v,00K0 j:@ooBk@+9@ -p0L @R  P 0@ 00@ R 00jo P-LPP:0A ʾ`P0  ľ@P㎾ ̀Pp  p !}I  !wIsp`@P0P  80P($0 0oXꔸojo -LTM0P,0 pKt D @I@lP 0P @P 0 @TT!` 0p0`p 0 0S DI  0lP @ t ,(K,@ 40 800800 S 8 ,0K`P ,@ 80p080,@T 40  p DH 0l0  d 00h0 <0S 0 \ @0 X <04  ꠸o -LM,0 Q0A00S0C0`00`SP 0S0C000S9*  p@P9  @0 HW  H㣽dP 80S0C80$0d040, ;Pd T00X R XRX  0zHF -Lp`PS@T 0 R }P@@P @"@P P 804 0C80 0 R @@T 0-80LS@P 4P 8 R 0800P 0SP 080P P4P 8Q &44P30Q  R 004PPP 00 q4 -LHMǟPp, pd @z`P/`  000 0WQ W W, 0`0 dǟ, 0`R(KZ Q 40  @0 R4 @040  < 8 40 <0000D R0 00NK4,4X0`0 0 P y@P7`  00Y40 ~100l0r0Pr 7`   @PP .P  PF @0  @P= 40 = 0dP 80S0C80Ń0d0h R800C80 h P)40@ 0R40 0S  $Z000 ` @g80Sb080` ^` [` X  `P P40740 0RX0 f {P4,P  0 W0 0@ 0<0: r0 X0 0 PT d PG0S  Z@8008040 L  @y007 P dP 㺻` l @ 0Sh0 q l LLl80l0r 80r hX F  P cP P4040774040TX (P\ # 0S0C 0 40 hP>dP; g ` ,P` 4x840 r0 X0 0 T \ 80S\0C80>TQW3@0S h 0@ 0S0C 0 0@ 0<0 0 S l m  l e g00CS540040 r04 < <4 r0Doxooh= :@4:@ -<1LHM$1pW- PU' 0 0X" R 0 0 0 R000 0 0 `V 0S0C0PUpW  n(Kl@KDE0 0h  r jooh:@ -LHMpPU$  R 0 0 0 R000 0 0X  `V 0S0C0|pPU R000 i Kd@KDaE0 0`  r s괸o:@ -2LxMP 0T0 , 080 Qp` d @KD8E0V0h0 唀 dP  0_/NKl  T0K @Vpu 0, 0R(K _? NKl  T0K %pPT@T 80@ 0CR80 @0S  @ 0S0C 0< @P 0<0 0 S    T0Q'0S$ |HP7p @ B pP800C80 @0S| PZ VG0S3pApoPT@T 0 80S080lZv 8GsDo:@t= -LPM`PKpDd Dd@ d0K\ T 0 X 40 r <`p@0 0OTd 80SK080d4 -<0LS 4@P  # -40L h0S  - LR@ <0S 40  - LR@ <0S 40  -LXM p x `@Pt@ 3@& 0 t0 &30#P00S, 5 00 R' @PP 0t03 R00SI TU000!000pKDCxpK t0l hp d T (K CP,,@0T P,A@,P 0S 0S40 0A@P   040,  0P, `@qopKDC(0K#x`pK8 <@ l hp d @` @,PP 4`P0t03꠸ooo -L M@ 0t]%jCl0l Q  0S0 QPK3:@Loxooo:@ 0 000 p-@PL,`:CT*^1 @0 CS  @ Q00T0#Sp p-P`0LC00 p -L Mp 4  , 4  RJX 0 Z0 PP 0`@PD 0 10 0BR0U ` PB@ TXU00  S@2 ,0S/ 00S 0*0S' 0T Pɷ P @0 S,  4  R R000 ղR000 Z0 P P00PUP U 000004 @ (K 0B -LHMlKP DB1pWX5R pWR  R@T 0 X P_0S `V 0S?0X0 @T/ X6 0ST 0`0 0 L P?0`S P 0S  00$l0 0pP 000@TT@ L@ `@ pW(K 5d081 0Il0 0 pP0 00$j -L(MP@P`0AS`(KHK `A 0`T<0 H D 4 @ T pcP H0L 0CPS P,P,,$,,D@PPAL``L0Pʶ<0@ X < : 400hS `300  `L@`U @%T P0P U`P  ``0 pBK K ,0K21C0b ?A1c0꠸o,,qgfff -LpMⰁ0`S( @2 PKDiA< 00 D\0   @0|0 x 50p0 7S0 `;0pS PU 0S( 0R1$K 40JpK"1A"0J0KP  HKAdp 4 L r0(0 080<0< 0帠 0oP00000#Do|= -L M 0@0 SH,H,8,X,XP,P @CP00S@X/ , @@  @,Pp @Z `Q 0 70 0BR0`0 FPP$p W@00P0, 0 0(KP@,P P@,P P@,P ; C1@EC0C 0-40L@0PP X 0WP C8000a0h400400hMjBgfff -L`R@pP TU C@@TS S *@D0 0 80@0T@S# S U *@BC0 0 000U 0S @0`v P@ @8`U 0S @000 -LM`@pTPQ T< T  0p $K <%hQ@` 0S p@ >pP;0 Q080? Q 0001 0  V0@004 0 a `R \0p40 pU P Pd`00C0 00C 0㥴 (00C0000q, t URUT 0 Z  lKX ` L Pp > 5U0$00  l0 08! t R00 S W&  00tlK` d0 h fPp  504 000r x0  0 l0 08! X4 0 00p 0PU@t 0C!` @#2 40P 0CP$0PN=@ 0C! ̇ P P10"104 P PP10N  0\30S<000S \ -8LS@ 0CS8 05 8S05p@-@P`0#U@T$b0#PU0t0# ^# 0S0R  ^P0,0,P#pL=P0L0Q00P0S>S  f-R -,L-,D-, -,L-,D\ 1 Rp= p-0 0 p8LS@`) l8PS T.,`.,-,.,-,-,.,-,-,:0 00CS(.,.,.,-,0:0p080p080p080pl8S 000;08X 0\<0<0\8 8|"R f-41 \ Q= Q-L QQ20@S/,/,/,/,/,/,/,/,7P"  P P nP P,$`0 lH ;@ Q-L QQZ$P> 6P? P? PG 0@*SH1,P0,x1,P0,P0,P0,P0,P0,P0,1,P0,P0,P0,P0,P0,P0,P0,P0,P0,P0,1,P0,P0,P0,P0,P0,P0,P0,P0,P0,P0,P0,P0,P0,P0,P0,P0,P0,P0,P0,P0,P0,1,HP 0P   `P lP`@ 7n@0;@ -LHM@ğ0@P"}`,0 h. 0<K `9p h h0S]h  h #0S: 3 0`8 Z <0 "0Ql0 @l @0Sl0 P P 0 t`8 p<[\v;0[Sq< K0 R  P(K 0C< K0pQp <0[S%@<0[@S0Q w1rGrT@k8),0`Jd8=;@f0;@ 0-8L P& 08#QQ B0S108# Q t 0S1 0P0Q@@O0(00 @ C0fd -X@LQS QN Q` Q`  V`!0S6  &pP VK  *z  P<, P PP@1 R P48 Sl8娨4S UlX %00S\8<\8 %J4``V0 Q2 RP\8<\8P 0S8X p ``PdfJ -@LQJ9+"" R222 h8 -LMp ߎ2i 1 0u 6!P0`00` VP O0S 5IP? 0 `0`~  V P`AP1 R!  0@!0<)0TL1 Rd  d 10b 00 R" ?2p+II0~1R7 1R7 = Sd 000 0SH 000 0S, 000 >S 000$-dR;@fj4?0 0000  0@-1 @T^* T(0T^  T00S 0 000008S  0S00 000S8 0C8 @0 R 00 0S0 :[0(0CR 0 8080 0̫`8>-  0?/ 0 ? 0/? 0/? 0 2"0P,TO,@P&@,A,@,A,A,A,@,A,A,A,A,A,A,A,@,A,A,A,A,A,A,A,A,A,A,A,A,A,A,A,@,  \8 01S]="!B10b%=00 0 == p-OLTP`@@T 0R! 75P V /5Pp -LdMP,!@0|  ,0 p` 5P.xK  \ rKX 5P&lK N LKJ0XXL00 0C 0 x )0C| P, 0R(KxK  -@lK '`DoXK,DPK 9 oYDo;@H= -LMO`TPp@@T 0S 3PP L00l8S  ?H ?P @P 20@0/@D ?@/0o@ -LRM`V, h l p!  p2 K0!(KH@^K  `V$ 08 p#Hhl!H0(K@ p   YK VL@K ڊ, 0R(K Do`= p-\8L`P@9 0K 0 9 < 0R>:0 "#A10a%=0 00CS/0>3l080S* @4PK 0 1 X K0 80VKW0K#  PK JKIXK  BD@KG j0P  a1`p唀@@, 0 R (K\@ >0>U3Dop= -L(M0p,0 @0 @00P K080 PNKO0KԈ  HKЈ BK̈ PK  B 1P 94PH 0 0 L0P 0 0 B0  `!4 0<@K040 "880 "4<0   x0 ]  ႈ 0 0  00 0@0@<, 0 R(Kt> 0t>2PDo= -LP@-00 0-LP S@P e@0 0 -LXMBP h d0 ^, 0 WK` W0Kl p 0 SV K UK @$ OK  IK0 0S 0C KB0KApK{ 0 S 0 0S00000p 09K 8K90Kd h"$d@0x WKlt0 |0 *|*X*4x[@ <2K.0K倠[h0[ lLXtYKXK1K/PK-0K$$h0pK9@K/Y0 0 · J40` YPK 0 0# 0Q`   0 0# 0Q  `l00 㥇l000h@p `l, 0R(KAK 㒇;pK}0 SG0V0K`^^rDo= -LMF 0 ,0 P  0Rc0@0 @a  0SPP  0@0 @ 0@ $H,, #H8P`0@pL#D< P0 `0@D p4R  *02@P@ (  0P0Lk\ 0T@K 0P S  b K @DKd@K @ DK @0@00t K6PK5@KB0 0lS | 0 oڨx@ 儀@ | 0\ |  X< Pa 0| 0aUP!0Up`$@@U ( K L0Q 0#0, QY0#,0AڠTKT Kx08#̠DK#8t K@x0 6K50KU|eP |  @2Py 0kR 07 0R@ @ Y TKT KƨPT0Ed@E 0TEP0#U 04@K|0 0TK -PU0K0A, 0Ra(K; .11L0 0. >0>0 $ 0S0 10PP =11L0 000S 000010PP 0S: d>0d>y0w000 >0>m0k0 f0@ d>0d>]0Do= -LP@00 0-zLP @P  k@0 0 -LtM 0  ,0 00 G1P   4/P 0 iR 0 @ 0S p+0 奅P`0P`P`@P "4 <00 `3 00 "8 80 040PP "40  jLK0t> / / t>0t>/Doȸ=G-p#00`400$M400 0 0 0  Q0 @  "$""40  0 4,4 ! 0 0$ ""40  0 4,4!  0$ ""40  04 4! Ƞ,Ƞ0 0$ ""40  04 4! .0 $ ""40  0 4,4! X$Ѝ=8G-#p0 Q0 B ("( 0!0##4 "0 "  0 4,4 !0 $ ""40  0 4,4! 0 $ ""40  04 4! Ƞ,Ƞ0 $ ""40  0 4,4!  0 $ ""40  04 4! Ƞ,Ƞ 0 $ ""40  04 4!. 040# 0'  040# 0'!h0 08#X 87 ("H0('08# )Ġ87_   `P@0 4#0#00= -LM\8`p 0 xP 0 031C0SlY Y\85\8  0|倏x? 0|倏x?|O_,0P:0,: 0  ;@BdJoTl, 0-LM8@SP 88 R 1S00 08h+ -L(M@p`Q0>+| $X h00Sh000d`,XX.hE =X+1XL0 0ptd>0d>o+Xm+X V+lxE⠐2pp>t0>[+XY+ X 0S:tP+XN+p@>0>dKX A+X t<+X@ p@td>0d>2+Do= -LP@00 0- LP@I㼝P l8S0 0 1!1!0 0 -L,MP T p L ,0PH0  T *PH0 0 R H 0S TH < < {00 @0@H#4<<_  0 03 00 "880 040 @ 40L !R^ \ P`0@0LPCoS 8@K9 ? L~T< 0bY[H@0`pD @0 D@b 00gT@! @>D @   dL0Y@`p @D 0WpD  0VP+Pg PY P P U`` P   P L0CoP"88 KL0 1; *1LP P0H@0 ( PN+P3 0 0 0PLP!0<T @ @0L 0@P 0$$$$ P @  L0 H 0 0 0 T)H(KP Tt>0t>)H)0H0  =Ha*H1HH L0 0PTt>0t>) -L,MT pPP 0P,0 L T0` 0R<@K [ 9KW  LT *0PD0 T (PD0 0 BkR vD 0S D  3D0 @  fZTPITD@PH  0@a0h T@! L0~H - dZH +P@ 0X 0Up `|*Pp? kZ RPP`` B;)1L  H P@@K 0 {(0L ;@0S"T2), 0DR,(K =D)D1D L0 0zPTd>0d>)D)D PTh>0h>T )D P Td>0d>)Do= -LP@c00 - @LB㉛P  -L(MP `0P L ,0 0H0 )PD P 'PDD 0 jR 0 D 0S P@D P O~H0\ 3\H01D0, ,400<@K30 6~ 9K2~  HqP0eZHD@`P @  0@a0fT@! @3@   dH0vZ/P`@ 0V 0`Up {)PpN jZ RPP  B;(1L   Dp@ &P%@@ 0 ##Ƞ#\0PH00D 0 0 0 P#(, 0DR3(K00 Ši/)P 0p 0LPt>0t>(D(D =Dr(D1D L0 01X@L Pt>0t>' pDo= 0 S00RSS   -0.0RL > @0#200   N000N "" N04\0N\8 2S0S ,> 0,>0S ,> 0,> -LMl8@S 83 0S00 =$  0 p-LlȐ@\P p`8  8S 0S=0=p` '$P =0=p> Q 00S:` BV  1R0x 0| 0 0  C B  R  0 00<0!0 8Sh<`10hD( D(> 0-LM@KP | R$P P P K0@K \| ;$P00CSꄅ,,x,x,,,4=1= 0-LM@KP h| $P 0S,؆,,l,,І,K0@K |P| $P0S,؆,,l,,І,, :=7= -@pAPL,0 P0 Y 0 0帡i:P)0 Ya: 10YV:`A8s P#`A @8# P 1 PC0S@  Y:: $10Y /:`B(r00" P `B@#8#(P 1Y: 04Y1: 20Y :R0Y:;0(00*0~0\ ,>(0,> Ld0\ ,>(0,> W 0-\PL0@  0S0 -00S 0}0;00 - 0L S` "!@21C0d!P2Sp 2S? Xt022S  Q o02 - 0LSp00 $("8k". bSf@5S 21C0bAP2S2Sbi2SVㄅ d5S @d5@P\%0f T0@f@d×0d5 -@Lh赗@#A - 0LSP@ \>lȐ 0\p`\> \  8S 5h%!4 0<@ - 0LSP@ X>lȐ 0\p`X> \  8S 5h!4 0YH<@ -L,MPlP >0>(Kp8S ^ 0$P 0  L } 8 p0Y40 `: 0Y:0D < H @ 0 S@`  S| `pY: 0Y*,>0,>H0S 0SD0H  T>0T>PL 804$@0<0> @0Q>q @Pl"0002 R 3 \87\8 \87\81Q3#541 R\ \86\8 !000 o5 \1\TA@08 #8808 S808D>0D>UH` 2SD` | SyR,>0,>s+@K y o!PhPf0Sc0< S < ]< R pP @ 000t0\86\80D < H @ LfDB@|<@(= -LM@lPP p8S p 0 `P:0P:0S` 1:2S P*V 0SX 0 SS : R <>0<>,>0,>; P0S\88S 0 0  000P  pNPPIPP p-`LQP@ P   yp 0@S ϕ p -LXMlȐp\x |0  (Kp8S @P0"0S ' PH>0H> t 0QX0 PP "P 00`\ \0 VT  0X5:l d p h ` SpP  SlP 0P`X-: 0X%:00SdP  2ShP  SR,>0,>+@K x F P0` S ` l d p h ` ,>0,>l0S 0SpP 0 S: R <>0<>|; PPx(0BS @P! P 0L>0L>aR6 tX dP> 0P>00x0\ xJ`Pl h0xp\86x0= d0S ?` R ?E(Bx 0 :G P 0xndL KjPx0d04[SC +x0J wx R wD"x0<0| P0T x 0|0 c 8xp p \ L K+Px00`0\ 0xx0 x 7T>0T>nȗH0  4[S *d@0 <0Q)[<0@#[ #[  0@S  ^ H 80S\8 ^( Q& x cP7H @0xRR0 00#[< 20[0P0C0S20K}  x@PPg20[.+= -LM `QpP@D @>l(0R@> KČ4508 B#8  8  -LlM #R0 (K8 p !0&`0 " $PT #0P0 X :% 0X\ %p:\0x0 t0 ` |0 p0 l0 h0 d0 X0 0 S pP  S xP  5|P 5:S P`X: p0X*,>0,>xQ 0S| R 0p S`1r'R!0>00> p8S `\ Q4>04>`010 5. @ |0aPP `P l8TP S 3  p R  YpHT 0S :Q ;@:0 v|0 v 'v0@ 0  -wv5>0$0#ḃp0X tt0x @l8S  UR; 2S8  2R ` c0S hP _ *S[R 0X0 V2S tP R SOR,>0,>I+@K D1v P>0S dP : R7S50lSl /`8 YQ x t ` | p l h d X )l8S \8 hP ?TdQ ?600`p8SP8SMt0XS ,1 R \86\88Xt30( ; 0 Q(503l0S:  6 `P P\86\8 L KP00dPH00@  <008 < #[  hL KPh@ .=f -LMpW( F`(K(0S(  Q 0 ( 0@`W1(PU  @P,  PfkU; G 1L (0S 000C `b 0 @P  P (( -LMP\, ` |2S  @2R >0>ol(|00 @R|0@ pVZ D0P0W0SJ\8 1RG  o 1R 0@? P 8SV4 p`!1R8<0!0 1Sq<p10q!V ! 0 0@0@/00@0@U , o)t 0w!pP 1<100 @0@00 @0@ꈎʚ; -@L 04"48#hV1ھ 0R p  PP # 9g@ 0S#@P>0>0S0S +`F>0>mꪪ -LM` 0PSp :@00S 괧,ܧ,,,b#PP>0>#2K 01R0S= 0F0f8#8 $#$"Kv  t00 nPP  $K2K  t,K  s2K2K  s,K s2K  s,K s0SFK;ꪪ 0-@LBP6000h蕶 -LM`1pN#28 ,0 @P0L(K2>Q 0, S PU @0 0@0@`00 S0 00#  DP00  =P4 U 8 000 @4`{`@*0S00R0@Po,0ྟ ` -LMP p@@T0 T*   IP 0 $aD8Pp@e 00|  `P@ X 0P(K(Kop8Sl8S =@=<@, -LMlhpV80  PU=0= X P  U(KoX@=0= < 0R40  eU=5, %02=5:0S@@TP0P  40 S00P 0 <0S p8S T10#00"-40.   0S=0= p8S 80 0 08 lhVa < 40R  <\l \KR=0=Fl8Sl>0l> p8 S@ 6  TT T 5P  ٨1@ 80(Kop8S `' P98 SE >0SU0  0>0>0 0@X0@I(K`8  8S0 u0S0u0.000l8S.ꀯ,D,̫,,̫,̫,,,R =0=!Rp8S ' P =0=Rp8S `' P8 0!0 `0`S \8 ( 3 "0@. >0>>0> P P  \8P 0@L0@ >0 >w  P>0>n P  2 "% ,0 (KocTPT>0>00@  PPu0Su0.0C0 0S 0 BQ.0S*<0!0 8S<10D( D(0S 80 5 Y 0V  P>0>S L 1 0Rx |   00C00 3 2C 0%R &80  0 P* ,0 (Ko P 8 00 @@ P 00 02P8j -  jLMp 8#800  bp1*"*RX,  P`M @d20\`, 0 d%0200V0 j = 000d 0R 0, j dő "0h00 0 0dő*2 0R j  $0 00C:0(K -`rCLM gŞ8\P# &80 083 <   - 00c:#: Sʲ00h:#: S>0>@gV@8 00h:#: S  0$KmJ -0` L p# @T  048#  10T:0BPU @0 4#2""0EPU@ 04#2 h -LM̂P` p0 0 S-  0 9 280 c0@Č, 4 0Q00 l \8  <   %80  040 2(K!0S:1  &8 480 c1 Q051Հ5X8  S @bV>00V. x,0 #0E8@S`!0P 004 0C0- :0,40 0 㞌Pd PP2S  P(8  0b0 %,0V0 <   | 04 0b:#: S40 (KobD0Q5Ţd2%8dUw''Hs- 0S00\ \0S0S *)SS-P\2 ڰ\- ʀ\# \ `>0`> \ 0\ @\\ \\ \0U'0x -LM, 240 4P,08 eV>@0p!"0 H- 0 0cʠ,ʠ \Jʲ 0j:#: S6 0b8":#:SXP`M @d20\`  0 d%0200V084 b!00c0:#: c ʠ B0Რ,ʠ48P0n@ 0d00" R 0 0@0@,(Ko, "00  d50P00 d5" Q 0  Z84 b dő "0t0 00 0dő* 2  Q804P, e  0 00C:0(K 0-P@L !8n '4n0:0; B0 [0C\%#53c0t0d >u & 60 0&(0 l (p08t (780bd -`PpL! @n' m:0 0;pp0 0\4[BCR8-S0T 3535t0c0u >d 0l 6 d0&06(l 8p0(0t ȗ x0Px00x08Sx00x0bd -LM☟?\, p #x?\ =l?\ `?\/ T?\%\85`0& 000/[@P 00 n`>\ .>\ ]>\) >\ >\  0`, 0R(K>\z x>\ 0\J x>\`8@ d>`㳀ᴁT>\1 EH>\ @>\ 8>\= `P>P<  P1r'R!| 15>008<9p8Sl8SH 8p R 4`=\ 0\ =\<=ޏ`P80 H=\| @=\E 8=\<Ǐ`P= RT `8: \8 ;4`\8{<\ <\ <\l5+jC`k<\ <\ <\\M@K! p8S"9  LKM0Kl! LC`M<< @R`hF`D;{`P>\Ș  0S774`4`\8\82h;i`P,@ HP\8;\8l8S p8Si\8  % ' 5P4`:H`P `8 0S\8 <4`\8\8^<000=@00Pp0S `:'`P0SS0`021Cc B`PpW@P`\8 :0 0?00? 000?00?000?000?000?S S S S00 0?00?000?0`0` B`p8S' k`\8`900z\8`#500(00qp8S3l8S<c`e48圎`P_l8S\ 5A0AS2`WT( p8 T( ST(  08 20C(囵`<7s`P6MK! A`P0M0[ SN @ }M [)LKk4`  0"-C`7P`P`8@ 208S64``6>`Pl8!S \84`20\8p6+`P0S \85\8  Nk4`$6`P`8 W 0S\864`\85`P[@P 8T` 8S SU S` 0X5`P +`l8\S >`1 5ҍ`Pl8SK @# P7 PW x0 `~l(R \8KT % j`r4\) 0\dP# P@P 0{S`̠K|P 000O@PT 0|PSP:|`E  | CA`P CP  `:8pLK:0; M0Kj`-\85\8 {4`# u`00CS` PN R4 0S1 R b0a ! c%- Q R0S00000ac00 f@`P `P P R @ \8 B<4`\8-o00?0o??0?S0?0 /0// /0 /0 /R0? 0S S S S ?0?0?0?00?0?0?00??S 0?\84`6\8  i`{\8;\8%  iPi`n<0Qj 8p Q4`e0` 8Doii 6i(i8i4qi i8i$i4i i5i iiiiii|i  0i<@ p-LP`d%R @0@S d% Ts0d50`V0Pp 0-l8LSP@f> RP u0ST 0S 2\8Bh1 RP \1  A2S Π0 9t#92! !000 Rx |   000C0C00 10xP RZ•\ >  \8 080>  B uf<@ -pLP@ 0p1 -L@h -0P00p00 0`@ X1\A00x|L B `?0SS0 h J d0<0h -LM>Q` 'H1pW:tX!^3 9 S02 @">)t")"1110S'  2S 00 08\(0C1|200 0mml xf -PL@ p[`R  \[ adV @[0S  Vd[00[0 m > a0 >[@ -@L`Pᬧp# @P @Ph -LMhP08pᏧ# @PJ 8S9S7 ٦00 0tk>J0>X@, W(8R/0V 0S`lQ  q30 p8S 5Q !ۮ0 l%0W0"! 8 S 0 o舦W 8S S 8;SR 8S S P 8S S 8S 8;S=@8=@ -(8LR@`(8R p-PL#M`@}>P=Q phLp -LQ@ 08tP100P,` ^ hZ -LPp`q@P 㰦p0S  0S 3 #0S R@:0S  -LpPᕦ`㒦@@D@T8S h 0-LPs@P <0p0w000Υ 0d 20H00|=@ p-@LP! b02 8  PDY <UO`# 808ph蟥b-|u- p-L@`2PP8>08>   ''b8p p p p-L@`PP8>08>  p 0-@PL$ b0p1pP 0h|0  p-08@!@1L<(84!41(8 $1Q( 1@(0 1Q0`0 >BrPPt" `8 p0`B a0P0P2  | l弴h ph跴XXPLD Pp,t,x ,,j<,v-,t,=@==@ 0-H/0L000000/0P  \8 00000S /000000001`(  13` 00000000 WP  Ra 0<0 p-L`pPjp1rGeT@<)1@$R@ p0R@l8SFF \(t10S: :  F)@R :0RD @\ 7$ /0/0@@ @@)@@0SS S S@@/0< @@ 0 S@@`8   P@@p @@@@@ 0'%  ' P\\ @ ; P@ -LM\0p-4K , 80 Ra4PK`Y @'0' <0 P/ T \P , 0Ra(KX@8KP*\80\8  [@TN 8KqP/08 48KcP T1@!P@T P00P<0@   0`! '0 <!xXh @ P\忷8K"P <ѫ0 4Do@=@=@(>@L>@>@?>@=@X=d>@ -5LP@h\80\8p@ [`O08 !'p` `l8S\8 l'00'09 :0@ ;` @@- j10303\8 03\8     :/ ?0/ ?0/@ `8  00\800 L @p }0= :0: ` : `8  0|r00 㴴0r% `N@0= =X< 0\,d`<|: >@ -L$M☃5 p$  \8||# t0X8#]S\8P0\8l8@S P`GS08>U@ b8PSPV 0RU`@V(  Hp2\8 0108l(R9 0  1l8S\8  9S(PT(0S  ⸨0T8 0CT8ⰨX80X8b$ 0RV K T8  DKG`P p 0KQp$@U0@$@E`P\  r7 S1 0K $0RS1\ 5r{9\ 1r' R! P:Do>@>@>@fp= -8]p`LpP`V5n`1GT@ \8 0  8p RhxQGs8 p` -L@ hX p-LP3`# @P K0S8;S08P@yph8 -T(L@'l8 S\8>00T(.\8>5 . \8XX  P0\(0(00 (070X8hl>@>@>@f -0l( @RppTLP`> T3 T 00SX ʡ p@PU. 㾡0000PS S R  'PHRK 00S,,,,W 0S00l8SX FPPX X '^[[ ^2S  R RR 'p34 P'p3~ꓻ=8j -l8LS`p 0 XA000嘠9@P፠Ul8SSPP [[ ]2S  Q0l8SP 0.RP P PP 0.R 0.R 0.R`= R% 0S 0 $(, <4!4"<#Q#:Q@Q`Q Q0 0@S QQQl8S S \ p0  ˌ,40\00S 000C0@- 0000t 0l 2@ 0 0220 0 " 0\#40@f=*0 0 > \ R 0   .0 0.0C 0@-800p30C0"\"h"D@P` 0-`8L P@+  0 0S$> R 0  0S%<0!0 |0SxP<P10|P @0u0S 0 0S0 R>  0000  p--0P` 0 @ 0 #4L0 ! d\\\  0#40 ", 0#80 "$ 0 000p  0-20P0 @P@D@L ;\0 p-$1L R> 0C0S0S2Q` R 0S0qS R0Pf  00 0 00@0@0SX0 R00H0@ [p`0`   0-0P0@PT@#@L [0 0-0@0@ LP[0 p-8L`#Xo@P   ;0 B 0P [p -(Lp"hUPP @  K0 B  0`[  [ -(L"H8P  0 0 K -(L"H&P  0 0 K -LhHPP&$x 0 $L&  p@开 -LMSPp" +@Kp D[0 0  ;[00CSd -P -T -P -P -P -4 -P -P -P -P -P -P -P -X -.@K ![00P@ `6?J&40`P0`T]Z&40`|&40`  04"#400<00Pa`8 R(K00P @`  Z00@`  Z00 (@"h  Z08#h&4  0`@0P`  Z00`P  Z08  #hP00P00P{ Z? S0C0P ?0 0R  ZP |Z08  #hPw qZ00 (P"hi꺻==>@?@ -"0L@M+pK0`P 8SZ OZ00  0d0C0贻= 0-00@0PL00C0d0C00 p-@ TL`PP T000p; 1ph0?@ p-0L` P@P 00 P  0#40 b p -L hP @P&x . "(0T0+0C0@"4& 0p 00b0 0 -L H` PP$x 00$,0CW0@p p 0$$@ 00 00b0 0#4"B 03#05C40 -0Lp @S`P% P" l d00!0C0 ?@Ì,40O2 C40  0#40 b R0 R S * S 7S,4 0,ȠL,4 0,Ƞm -L[ R\8P P\L@`:V 0\8%1 -\8 0  00c0 0p0  k0   L0  z\0  p0  e 'X  -L`pP<0Ȁp 9QA0+ Q00 0 P@P ) 0 S0  00c0 0&0     0- @=00 8PLp0  80 -("x![@0T``DLW ;40T 1 #   P `P(  W'40p 0 0#4[@000,[0 S@W003 00c0 0p@  W003 /   g{  -0@L0pc0 -P\L:0[2` lRppQ@@\L&" 0< R 0  440\ 1 #       bpP pP @00 岀W ~W' zW 㶁`#" 3#4!0 )\8-  [@{ l8S50 R5 [0S*\( 0 00`0c0 0;: ` \( \(\(-f8j -t2堈 PlRL[``pP: \@@\LS 0<O ^I 0 E 4 40\      `P1 @ 8#  ȕ 3[#4 0: ;  l8SA 01 RD [0S5\!* 0 0c0 0(0 C\ %9(0 Q\ s\ @_ 0 R f -LMQp`x PX P @ @PP`0!P21   XV TV' PV`8  VV?0B 0@005l8S> <0!0 7S㴧<10ว'0 5'$Kl8S  PR 0"A!p`pP@t0 00d V 5 @0 @   7P b=@=\?@P?@ -LM@ P 0iSS2 0 S @Pt>0t>! 6K  U pPx>0x> \8! |2S3"[R>0> TW 00@(K00Sp(#-#-(#-#-08\(E0@0 P0`U  ```"[  @Pt>0t> @0PS00`3 < "!0< S2 < 21C0b10"R`< 0<<0021  ,2  "[2R P < @ 1 "!l8S񟗁#-#- -#- - -0#-pxPLpPM 08pyP00  !U' U0K U\8  1  0@00l8S pX00' U0K  T  T00  T0K  T' T !P0@0p/xI000堗Wڟ0 x>0x>ꈎb?@ -PLAAP@`p Q2 }P& 0iSS"`V0 p`8  0S 㲁 !1R1 01Y0]7 0m褢<p10!RA<@10A!00@  !0@ 0 0@0@5  $?@ -LMpQ@P 㻗000@UG ڰUJ PUz Ue |>P0|> U  U 0U("(`P U7 U((0 `Pt> P0t>U `P 0 PPX䈄X`P8((#8`P l8S ("(g`P 5 !0 0x("(B`P 5 !Ԟ0 00`P s?@@@P?@ -LMl8SS, 2l1S5  0@,Hp` 0@P DP`  0@  #Dp0>$K, d1S* 0$ ( >0>,0 8 P8  0@,Hp` 0@  PD`p 0@P #D p<P`0@!(#Lp4,0 (@dh! ,@0l1 8 R 1S>P0>F E0@$@Ap`D0@#D <P`C B0@!(#Lp4  $Kk -LMl8SS0S (K  0@pH,` P0@00 ,@ 0PK` 0@  D` 0@ P #D p< P`0@!(#LpX!4pR >0>\1SP>0>0   00C8#8S0 \ 00005 !⠝ ,00 a th@@4@@ -L,Ml8S8 $K  0@,Hp` 0@P D0P`  p 0@ L#D(0>8 X1S*80 H fP>H0>8@ H P4 QH(  04Pa b04P 044.J@"!Bb%=00.D 00 , D HI8 ,@0L9P@H0P9F E0@$@4`D0@Ap#DPC 4 p0> 0$ H L0 Pa b0cP4epX:d d`0X8 %< % *0PpX`): 0X%:0SR+@K P P0S0>{X1S:<Qt L <04  0Rk0>⛣1 S p ]O px }O P' 000l8Sx200Sx2 5 0S00KhT0|2!] L00@p 0Kht@@4@@ -LMTJ l8S, 0J, 0R(K`1S8  0@,Hp` 0@PD0P`p  0@ L#D <P`0@(!(D#L\!p4Rp: >0>X1S*(9   @B P0΃! lpKJ? pb P@P  @>0>T@ P NZP a b0cP4epX:d d`0X: S 0PpX*: `0X%:00S0S^ PP Ro@K N AP0SP  S83P pjQG R 0SA  Q 1S `@5 pQ  0R  00 0    P^  KP 0S  0S8[S ? !  0@p,H`P 0@pDP0  `p 0@ L#D <P`0@(!(D#Lp4 0X\!`1%  Tş0L 0 PPk   04P#  | P r@K M P0S0SP @@T@T@ PP K0Sp F E0@$@Ap`D0@ P #D<P`C B0@!(#Lp4p]O }1q刁x1PQ M  Pp3#  `VX 嘿  0R@@"!Bb%=00 0 L HI0P)L900P9F E0@$@`D0@ApPL #D<P`C B0@(!(pD#L4 X\) T)0@ &M  P@PUZ `0S9 D0D8S221Cqpc%=00 0 HI0P L9  0@`$P`P ` @P`0KP 0@L#D<P`  0@(!(D #L4P`  T)`~pL  P@h 000  L0  lQx200Sx2w0|2qDoڼ==t@@4@@׼= -LPMtPlPP, `@p00CS, 0R2(K!00 0BτlK/JP`P>0>w00`@ eLpQ 0 R 00 0`= P5a H$0 0 Do=t@@4@@ -LM P` 0@lHP 0@p PD0p ` 0@ P`80 4@ 4`L8!D<`P0@ H#H$8p!,X1S  >0>(K\1Sa b0cP4epY;:d d`0Y40%0>Ox t0Jo  Jt L00 <xx X1S>:庡Doݼ=t@@4@@= -P0o0@0@pL0P 0 0@0@WG i 0bS 0bS<0S>0>0S; S=  040\a0b $c Q00\0S 0D 0B8S0SS#R 0Q' 4'  4 8  $cpPd>0d>0S0S1S 0SRvpP   0S   y   | x t -"0LM'`K0p?0P0@ J  J 00 0C 0 "40040 "880 "4<0 !D  I= -"0LM@'pK070P0 `0I I00  I= -"0pLM0 0'PK00`@ \I I00 @  1S0000 I = p-@ TL`DPP T0 00p; c1ph5|@@ -L` pP @a @T2 0kI! gIP0 0 0S000 0RR$  1Su 0S q "40 0@ C Cq0CB#4Ac B a0b + ?P墌B!1RE<0!0 1Sq<p10q/00@[0@@0 ؋0S00#$ @ +0S  0 400 0  ҼP_ d_!1RJ17@01@ ꈎ M-LM0, 8 #X40 0@ (P( Z c @ ;8#(@#< 0 ,k1 0h!"8 0h!"4 0h hg14 0d!h"880d!h"4<0d! Y? 0@d1hA,@%,( ?$Kk400$D<@ #\#pT l#4<[@<8@ FEpDPCB040[A0!t0 9 $K@@ -LM` pPK Pc >_1 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D 0S0 c 0 5 ?$Km!( X00L 0#40  00:4#(#< $Kh@@@@ -L M0 0S` 02="!Bbo0%Sp 0 00  0 CP,  ,0Pc V?0 @X1\A$< 0\!c@"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X! 0S\  10, "4F0E04D0 "88C0 "4 `c _1 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D 0S c0  0 0% ? Kiz! @004 K @40t@@@@ -LM0 0S` 0pu0S^ S0 0S0    'P l Pc 1BS brFV?0 @X1\A$< 0\!"8 0\!"4 0\ \[14 0X!\"880X!\"4<0X!!D 峸 < 00cS3 ( 0e)$ 0 0%  ?(Ko"!B10b%=0!o0 00@ 0@(K(  "4F0E0 4D0 "88C0 "4:;8p0\@TUT5@0 @+\888%  5 0\8 080ES  Un-m-Lm-Lm-8m-U U 0w! l8S S w S SfP# @P 00 0v@Pᬅl8S 0 8 R' '  770C0C773 10P RZ 10P+  R( (  D8D80C0CD8D8W_ Wf00 0]5\!P808M RZ0 0<W:00 01l8u\8, 00@ $l8S<1Q  fx000 l8l000 0p8'H0 㨅@# PP > R >C0 0l8000 l888LA@XA@hA@@A@A@A@A@A@A@8jA@,A@T= -LMlX ȠU@p.h, :U p8VS/ p>0p>p8VS\8(Z4 5D8S808D>0D>p8VS8S< 000 508  Ȑ000(|8`]/  !⢌ȗ \000b▌ 00tZ PpP  ''A0 0  8p p pPh*@A@A@B@ -LM@480 0PpX 2S  21C0d1 0"iT2S  cR@eV@Cd5S @d5@P0e T0@e@d]0d5 -LMP@`兄V>4 @c4p  ' 0hЃꫪ -LMP@`k 0pS0C 0 S h軃*>( 0c  ' 0y꣋. -p21C0g1@LM _*>h t0P &h 2X80/:0O00 `Hp  81s- 0-LMT0@+;:0 ="  7P 8h p-@LP2`0S2,0,  * phF -=pS@bO% ``PL RHi8 P)L 傲N@T `8  =S1NO%  PP6 HY8N@0L P9T0   htH0P0 80B9a$!B30b03@L0H0耖C5010   [0 R!0S S01000 % !!00 p-0`00@L@HPᔎP 0S S 0 [0Q *0 QR 20a0#20p -RL pP@pPT @t&  P E` -LM4@ ,Kt 0@ @ PK\~-h= -L M0@ (KJ 0 @PKP~-$=D  tQ 0 S"0!B h=-<JQ !0 S0$=0@-@ !X 0lS  1\0}>EN-E8 BS(00"S: 2 1C00 2 1C00=GD  tQ 0 S"0!B h=qn P0 QF@ p-`PL @HHTP4B@T(ph= ;Pph6F@@??F@ -@PL D*8&,"$0 hF@F@F@G@ -L Mp` L@0\48 0`P 0<<Q 0l@d@XDdH D߻HK,ػ$G@0G@hG@pG@xG@G@G@G@G@G@G@ -LC@0ûT   幻G@t-G@ -LM0,0 XP2 p0@ 00@q:K p=2K00<0<Po:004K P_ [ W0 < K;0K1<1< K 0, 0R(KZDo8jt= -LM @ , D  P5 p 81@(0@":K !0P2K`00 4K P`  @ D 0 < K;0K1<1< K 0, 0R(K Do8j= -@< ?L0 <0 萑- -LRHM `p00 p@wPP 408 0B S800 RH TKQ `@KD 0\0 0 X 0T r `彜Bk 0-LHM@T# 80S0Q 0S XPKD 0T0  L <0r S80嗜K0   40040RG@ -p!LP`[ 8QE H@T UTM \ 0Rq Ÿ0Rm5BbcPNʠ2 R? BPG Q 0 SA 00C00Sp0 pp0004 ^00 000  00 819@PP" ź  00C0 P000\Q 40040 R 0Q0S R 00 \00S0040 040\00\0 0P0  00C0L P000@0  ?na"( ]E jto(B8H@8jjjH@ -L@M0,0 0p\0 04"48#( BR`0 ş, 0R(K 0DK X T0 wT@K sd5\ D 0 R  i 0CU 0CUlv @0PP' ZOku 0M W  0P, 0R+(K5P 0CU ^5U0 0U0- WR V  p{O`u@%000@4080`@00X0090HX0805h0H00I0 pu0P4U %4Ur 4Ui W 1S  Pp4Ux0S) H4UV1PH4UlZ0CUh4U= 0UXP3U 0U0P,0\0u< 0R 0`V 0S 0`5p juH@@0 Q Q H0(P 0QTP0L 8H00S 0S$0S(0S X0 Q0P 0L0,߄H0݉ p-@P` PL00P30800p -L` QpH P@ 408@80S0C80W00T 0 00@0壄P <0S 5@P 8@yoP1 P@0P 100 0\@<0SS PU l0@T 0@T 0U81P8100Z]po -LLMH@PT p``KHpDs40P 00 \ 00X0  T <04 E402Kr 0s p-L@` 0 \ P@ @D00@30(00pphh] -@@00L}PHPl0 # 8n R 0 0 0 R000  Q00000 Smh-no -@0L @Q0(0 Q803@0 h@A> -LM@p P@0`<\00 3 R 3SA80S>? 40 ^E 0PS5岐0S P 0 j Y0801 0 4)4 S*MPo1S@40 RP @0 00 080ᾓ9(K04  00#0l0F  tMP>hBϠd, B`PUPE,10C8#8S1y, Sv: 0ADP044$ 80P P0S P10  l1l!08#8,0 ,!XH,@^7PUPE108#8X1*, R': 0AP044$ 80Pq@ 0RPS @0!QN 0e긁긁(Ko]000 @Xo joojjjj -L M@0P 0` RG l0 J 0S&0S/"\! `1Q 0S<00 s 0%,80S/  p80@0@P0 K180S Q0 1P 0800(0`c-]L0S0hX@@ 0 KH@spP 80S 0 P1 oq J@ -LM@C^ , 9P7 3@ 3 3 2 2 0l,  0Z3 $#$("ȁ  10S!0 0 0 #@D"DH$H00 1 (Pcpw $<&$ 4(!4"H%<@ @@1S0 (@cSp^04%4, $&8,$#8!8$,000!(@cSpB04%4,& $8,$#8$,!8000(@sS`'04%4, $'8,$#8$,!80001``,k 0 Q<l0(KD0 003jojjjjqDJ@ 0-@LP 0`P  0_P  010CALJ@hJ@ -LMP`! \\ \ 0(K0S p04"48#8g00S03#!4@K,0  / ,08#8# 0@ 4KK.K-K@QP 70, 0 @CP( K2pP ,0@ @@0,0 c , 00b0!,0 $!$0 ȦJ@ p-LHMPP` 400S Kp\@KD 0 X0  P 00T0 4 0, r 夦J@ -L\M0`Pp(0 4 400S T00X0( 0R+$K|@KD 8Kx  Pp 00t0 4 L r 0P將T 21C0D 10\  0 b~Do0 02 02x  x , c,8#8 $#$<0 S  <0 HP 80Dl <00<0 00pĽW7050<00<0202x 0 x 'oo --:L0?@p0 , 80 F^ 400q  x0 0 Y Y 40 c("(04"40 Y `\0@0x 0 0 %(0)* @p 00 , 8 '+,p!< 0S;0H Po (jjj -LMQR@`p %02K R RP VPU00U0SRF R R @00`eV00S RU 0BP U 00 г<( 4"4!<0 ij <(4"4!<0 0 6S-t0Mlrl2, P RjT"0Q< @2* ! BR0 0R000@b !0?0]d1@0Sd!00da0㼀0  0,`1Q01 DH!`oOLX!W? 0<@P\1`A@0 rUX 7P@800# L 00j]/  @0t!x1L/@p [ 21C40P!@ TU@ppp0j p8j4j@jBphN. -LM`! D ! 0 P1 Up PQ ~0S%  0 , K\PP ca? 0@X1A Pqp0P0YPd @0 0@0d (K ~@P X 嵰 t 屰0 Z 娀!Q00 00:1Y!0l  lS0SD0Dp0P0P!= S` `0`SC 000  崐PP* pd @0 0@0d qOKfeH1| @1R  H P! (K 0 1 <Pc V0@cP !|0q [0 20   0 h0R0P000:0:TP!wX ṲSppjdj -|`崒LP@P |! p aX pʃd XXp I r0 S X Rm0!0bS70ODH0@)H0L@D᪤pP IX00S; ʤ1 0X0 0ƢX0X0x  00 0x 0S0 (p# (t00t0qpP HX00S 0X0 0X 0P0Px0S ~x0 0 |0 @B t0 1R B X40 <(4"4!<0p <4("4!<\0I 0`#P7P` 1Q!0\ aT7`2 S 0S0S"("(\0 04"400 cQ0ՠ0 & 0Q 1("(" 0 0|1S S S2p0 2 8#8 $#$("8S|0H 0PP0pt G0 p TKp 01 00 00t0/LNx 0OPAᎢ7t 1~@0S0KT@K 04 4TK(K 0`؟@9tP & T"R!<8(20! H|< C|1S' |8 ;|( 6Ks0 :0X! 0RKphXPT 00|, | NDpDoppp= p-LD@P`TP 40php -D@LPpT Pg 40 T0 00h0W0]fP 7S -L0Mp0<`K@ 0 娞4KPp= -L,M4pQ, @` , 0R(K0S PPQ 0@SŸ5P: PŸ0 P- U V) 001L0 @ L 0t Pn @0@S D^ < ,$ !$0,0cS10cS 01 RV @ 0@PH DY <,$!$0$L0cS10cS`F0l $#$("(RD }* Rh1DQ2*t05t0 p10dSmpA0^/t10 00bL0 R\ 3PAP @PV<@K͝ Ppp -LD@@6S S\06m>ᤩh蟩6S,0 R3QAQ @QN 0-@LTP R0000 0 qj@T00p 0-L@i8Pi7 0000Hpp p-|P@L@`t0pxPSt06t0 @HD@ ip0t0H p-6| SL@P@`` 000<U8#D00S8#ph06 00 0pN - LL\jPPpM @p41@P0.@7 Fa@@ FT  F 0-S00 t0|020 '"(8CQQ?&ڀQ0ü6p0 $1 1h!l!l  00|1|1 @0@0  w x DPHpj .$=ģ.jjB?tjj -L4MğPP,  @L0 P T X |!|0D @ H0H0 0`0lQ@ ʞPN \$0D\ \K TP0\  PT0\ 00@ 0P@ 0P 0 0LP0 ,<4P $!$P 4!,.

 : 0(P0 U . E("(04"40 ("(04"4(!00!00S, 0X@|@R&H  0@(Ko0H 0`S00D0 @ ( (P0\  < P*P% P  )P P40 0 0r 44 0Pr0 R 0S0S0S 0S R 0S0s Q PP > PU  P<P 0S  mPQ PP P 7PdjpBjL@ 0-L MQ@P K00S S *0 `@P.^D 40PK0h-$ 0PK0hx-jpo 0-LP/@/0h]. --LMP0p@Y,0 *Z| (08 S0 8` Xݕ(K(`. 4 m`Pj 㡘`P7`T P 3'"(04"4 0 80! 0(  310#181!0S1 202  ( 8"(#(,( .( 8#8"P @"@" ("(0xq4"40,00,0 ( @000:H  P`A`Z 0 8 ڿ4-(0S9` 4 4-jp - QLp`@P 0u03Q0S3Q񟗁L....<... .,. ..4.D.,.........l0   0m( 0 mɷPZ  XPl0L P-Pl0   0m舍PU .l@P]-UL2L PPl0 (2(2  w x l0Ll P-l0p P  P4-ꜨP-Pil0 T 0S 0S$0S(0S$ 8Pl0  0S  0S$0S(0S9P -l0@< ,80,0P00p-@gP,Ueb PᕾPW 0m{ֽPL(0St-@P,pjjtjjL@@A> -QLM 0S K0S0S P0@ SAP T \  0 0HP 0P @0S   0j-pH. -LlM(0@Qp,0  PU , 0R(K`VP0@Sp jPf P 2 R X 0| S 0x0 t { H0KHK0 SGPKH`K@K |   0 0HK 0P2p0 Zh |x 0R:l@K1d`K0 |x@\PK&0 c0KdKL| l  L 0/PWI [&[tHKp0@p d(p HKH K@0K0  @KHK0/P| t o @KHK0/P a?HK@ Kp  pp tHKp \0Pp 'I[@K&[0(SP;Do-jH.p@=A> -@0@L@J@hE --L tM00p0 ` 0, l0 h 0@#2S S4 hP, 0R(K0 G0K 0 S ):Xk 0S000 V04"48#X#8` 0 dR' U00U0S 0000` G0K 0 S` * p0KߘP< p 0R0% * "gbȐK00^  0S 0S0s 0S0S 0s R 00 0 "    (0 0(0 |000}\u S00d00dSP U "(00(0G[Ye YPH@K0HPKGK d@KK/׏dPKcK0 6K.\ 0Sp V 0Sj ( lPe\  d0FPUv 0S0h0 l 070S@0   h KUKV l 60S@0   hK 0\ l0  h0Sh@K @0S@ )0pV l0  h0Sh@K @0S! 0]@HK h0~P 00 0䕟P U l0  B@(BT P Ur @0 Ql0 #0R R) ,0S00S40S80S0S 0S$0S(0S^? $0p@P8 Q 0l 40S@0   h KJV x4l 0S@0   hK 0Zu @h0HKPphPm 00 00h0 @0 P P 0Sq \ 3l 0S@0   h KtJV t3l 0S@0    hK04 HK@h0 ¥PC 0@;0S 00 0 " G  (0 0(0 =@HK၎H@KGKdKK 0D0 xd@KcKK0`0 0, ^P#C0 + P000l000 DP #0R1@ 0 PO 000ː: $00"!Q$008 @p.PUw000! 000^+ 0 E(@  0@uPU8 R 0R( R 0R @喚( TӶPK00  0 0UpDoK@pʚ;P= -L(0Mjp-Q@P P*R 000P' 0`(pj -LMP)0Kp @n)0[ !#R)K R % (0/0(0(K%aVT l5,  , 001S %1S ,5,  , 0701S1S1S ,1S Q ( Pk$700001S41S81S 0SN S 0SD S00S S000(1S 1S  ᏒP @ @ 0 000 ("(04"4#0庐(1 0 ! D04 40)[Z Z ᒏP#(0/0(0l00S 00S0 0 0@`000(0C8#8 $#$"2 I 0 +B 0+)`[V V` Yl"(0/0(03 00S Sx) +0Kⅎ`0+ K*K*0K 0*[48( <"4!<#,## 0000 1S S0 R0 0(0C@0@0@0 R00C@  00C@0@0@ 1 00K(400,<$"*)0+ K00(0C@   00K00,<$"*)0+ K 0嶐0+ K*K*0KP*0[0 +0K0  000pj -LMl4 8  +0K`+ ["2S S (00(0城(K( 0P "2S S b 0PV`P + ["2S0 4* Kx0S000v 04 8<,<$"*4* K_0SY )Y( 0S:Y )Y p 0S 553 R1 (&?30 PU)PU& 810 R@T@T W 0S 0R Z 0S P$00$0w040`O0@Y0@ )YuPB8 R DP  05'@ D0pR< 1 00Sa<`10`@  @ 842@P `U)0Su =)9&4 t 04 8<̠<Č,ʠ*K) K)KP>  048<!$!0!̠ 0)0[p:("#! !4!(0 Kp*K 0)0K P  )0[R 0 0Q3Q`P)000 00 0zᕰPt@gH00H0i 00 0%000 @@%pL@j$jXqxotoo -\0LP1  0 ($ 00 0: jp --\0LM R1   00 0 d K 00 0jpG-@0 0P8< 0#40   0 ! 0 8<0# RM` ' s`BP0 .0.. " A1 "4 " "  " "0,`0 (V 0 Ѝ08 <0#40 (0, "V-00r`F0 0! #0 P0 .0.. "1 A "4 " " "0" 0 `# V  08 <0#40 (0, " V$$q001 !4 0# 0#(0# 0# # , 0 00 P.( 0. .A 1 ! 4 ( 0  .,00!80!$S!L`  [\=\= -LdM`AT0 2P 0P0 0000 0@DU 0 N0Q 4, 0@P.,4P l $( 4 #l!<` 8 < p !Lp @ L ,!T P T `!a$|,.X |` l ap#Xh P ` qp !8 #4P!01@P@,Ġ Q H0 .P0DP !XPd 1hQx !|$D@1\P `Qa@ 0#pq "t  D@\0  H0@dP!x0At0 Qt`p "`!0',p !0p  "0# W,p  0v0(K\=\=\=\=\=G-Mhp`@ h@$ P` L$`\,` , .\ p &`PX  ,$,X. .  lH$p th $d0i ̠x|P la !Q`#<`<4P, x0 ` *L#Ƞ0`!|@$0p $x@0P(@%P @,P0|`P#Tx0&D#d<0*!40 "0 #T4,  (8! pq "0. *@P 0p qS`A8` 0#!( !0  "0# l"p0tt唃l l@匓 la"< P !Q`p`T LDPp0`p!L##t0$`!t@0$X$d@ 0@l0@#D0*̠0 0T0l L0!D0, "0*Ƞ #夒  HP QP!$x`@P0Pp Lb@ "*0%PQ @@ a H儀 0# "X !  "0#x!| 0쁟쑟'x h@|P.<b0*( p `FA %40!!x!!,!P*? A10N@b@P, P0@ R?W@pG 0 ^?W@P0 W(K (KoÂ@, 徂 G,0!pc?WP -L,MT  1>?0@0c80 X1"0 @ D <0 08#8H L0 T^!\8 0!pT..l<@ #48 <, D[2K30KT80-KL[ C1PK4KP .KP /K0pKP4K  {U'DP  0#<0 "( 0#40  Q X, 0R(Kg1Do j=< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -LRM@ ` hKY```aD  h! \ DAhp\ 0"hQToD0#@ d0 `e[@̏J " 0%`0# ` flL i``  & 0$0#p苎dKp\ȅ0 0#X h 4D0`  n (T1 0,X0#pl1 fk{T1P  l1 'lˠPꪉ] 0. Th0#l1  `0 @  *g{ l1  @0<` !Pa n`PdL0%h` j0# 8nP 0 `ae[ #`L 0$` 0# X䝟0 hc;4p|0 Lq |Hp &ˎ }LdK0 p靊 0# pT PlP )fk` p|0, ,0# lˠ 'H |@PY 0.茊0#H@@|0nidIP0%0# l1  H0 g{ ( l1 a  !0`j` 8`|d`e[h0$ 0# АdKLa al͎ )0 0#  @0lc;`0 j0`p *` P X{` 0,pfi0#pH Plˠj[ &8@p 0 .gz "00'@  L0Z48y<0b-d1 LP0dLx n x0fk 0 ̀l1 d1l0g{P x雊0,0  X0 e[ 0  x lˠt a@ t艆X dʟ 00 @!@a@*L1idK 0L jȇ  ` 0 0t``al@qd n 0  h hYt  0P 0P P|g;@p <1  L1Xylˠ eZ @p  0 p T 0*fk jp g|ภ @P0 ਟ0 0 < e[꫎@   00 H1g{ 0 pmvmznܼNS @L❀fm 00@0#@D@H0g{  0  Pl PM舂0na0 P0#    P T0` 0fk00#̎00i$ 8Pl1 X0  P$0 PĐlq dK 0'b,p hQdp` P} 0P `p h 00lˠT1P $Z g{0q 隁 0ppfKXa0 $!@ 0 @@Pa018Ba  n @ 0@ a0g{ e[lp @  0@p`dI 00 0 nb)h0Hr `la p `0 01lip 0  la dKa pPcH0gy  `0`h P 0`l 0` P80hh  e[ 0P 0T P 0 g{XT˄  0 aP 0PP0a8@  0  hDL1fk e\ ᜐ@ 0@ 0h@ lˠ K Xp! `0 l! !0p l0e[p  ab*  pL0<` ༐  0` 0L!`dK 0}  Hࠕ00! b+ ! T1` ` 0e0i  0 `, 0``L0lʀg{Pp a  T P\vfl0   0p0p, pP0ig} @,1lA l1@Pn 1 @  Pfk @P@0H` 0Wl1 0P荁Pl1  00lˠP g{ 0 eZX0 pP `  %8Pj0$ 0#Wh0 PdKPHahnਐ0*0#  gT0 !P`Xj`@pì 0. 0#  (xT1 %`pmnpX` a0,0# @ @lL0 &pe[zlˠ dK 0  0# fk '88 h0  (` T j0$ 0#a`0g{dKHP0* 0# h )@Y@0 P i `LP !lɀ` Y0jfj 0. P 0# &PnPP ` 0,a0#@@ d0yflˠ ``dLp 0 0#]jX1 %pp`gz` `L꩎0$  'e[ 0#` H0d g{p dK0pin0* &0# P1h fk (  ሀ hpPj ̀ 0. 0# !0hq 0`[\b,0b;(! 0`Xq n0,lˠ@ a{  0#T@I`!  0P!` ꪎP$0 P% 0: HQ 0 (夀,`L;] 0p0Da % 0dc (K -0Q^q?`p@PfUpLpV@@Z* Q :@ @0Z* Q* ao@  @@Z`* -L,M01>?0@0c80 \1T 08<0 0!D @0 ^.L H0 T0#\pT<!!l##4<30K, 80D[@0-KL[80 .K2K8T N1PK4KP /K0pKP P4K  U'DP  0#<0 "( 0#40  Q\ y, 0R(K|)DoLj=< 0@-@0@ $0$ 0 0 0 #EgÉܺvT2 -/LaM0 @ lK,0 ?z1Ahp PaA ad`lnDi4 i80|/0%1  d0 ac 00#l1 p `0(p0 nd-c Hc1@l ` 0(T` 0\,@1 P\0P Q\clD0%X0H@aqbacT\Οc< Ȑ X0' &@0 P,1 T0Q T "aDc, 0% P0H͌@`lcTc< 0* (0X A1 L0 PLx  "d Qc,lDnad<͟H0% &@ H0  "aq@cTcQ? `P0`?SpP`0L`@  gos@@pb s y?0YP@p q?0Y@P 0 -L M0`P(0 p0K  !62 b1 R<0Q0^ ~?@ Q R W 1  !1Ps( 0R$K "Do@L@==G-*A) 0p"#l0P`00#@$0@\! "TX b?  CZ8@ D0 L)*0pT0P`P! "80)`*  j 圡dPZ=~1A^_`>q嬁ZbAa0@,00@bZP`P`$P(`.   p!f?p(P`P^?`0  - 818<,!$00 @! p$(P,`0Q004@ލ= -pRLP`& @D1>0A W@;@ RpG`@D  Q*H0 0@WH0L@W耀cW.:P o@1@ T@D 9 `phP oo@1 0S@DRH0 0@H0L@PUo@1 0S@DRH0 0@H0L@SH0 0@H0L@x -RL`p. @D1>?0A @c X2:PP o@1@ @D  pj?X@<@H@ ?X@D @pXP n@1@ @D Pn@1@ @D 0-PPL 0@ nPn@0@0D@H0L@0= -0L@$M80 4@ < @L H <HH8 4 @ p ` P8K 衟 80K @ 0!D#L"$4%T'\1t0 , &dp xAP H 0KL0` ੡@ 1L N@D@ 00K @ 0!H#HD8%X"('X<x&h0@ @DH0L@" 0 pPP0P<0PP <~Rn<H00@<@P`P`(KoPPp`@n<@pPP:n0P0< `PP2n -PLM, 0 . U00@P0` 0 @ $#4!,<p,0$Dh@d0dP`` 0@(#8!(8$HP`0^``0(Ko~m -PLM, 0 . 00@P0` 0 @ $#4!,<p,0$Dh@d0dP`` 0@(#8!(8$HP`@^``0(Ko$>$>$">G-0Pp8` <@ W0 tTᰕW< |0 0cr#E"805" "Ep1  .c80x .0n bs2<ş#A0# #$$ 0! @@$@b40t @$ b0$s2##̠#(0 Q4 .l0 p0p. 0c r#T"1"̠"|T 0#0l0P#, l0 e 0cr#8ğ"0A" "4$0  @@$@a(0h @$0$ bs2##̠#(0a3 a`%$0d `& b0s2S#|# #$tS 0! .a 0` .0n bs20ß#Q$# C#$ 0! PP%Pb0\ P%0% bs2##̠#(0 A2 l.0X .0 bs2Ÿ#Ax# #$l 0! @$@a@0T @$0d bs2,Ÿ#Q # #$ 0! PP%Pb0P P%0% bs2##̠#(0 1 l@$ 0L @$0 bs2#t# #$h 0!, a0H ,0l bs2(#Q# #$ 0!PP%Pb0D P%0% bs2###(0A0 n,0@, a0s1|@#( p #A#d 0! n < ( ,,H,T0 @P$">$>$>$> - RLxM0 00@X0Lp ^ p0XL< 0^P`X L 0 XL8 0^X L 0 XPL4 0^X`L 0XL0 0\@\p \0qL@(8< 0X0(PP(($.7  .%<!...Ff0.,A.40 %.( %4,F0!,,, ,40a,( !q, %8!\fA0!!!!08P!!4A0QT0 " "! "VA!< " ", H 8 D 4 @ 0 < \` ``` Vdꘅ/T/T/T//T/T/T//T/T/T//840P(pE($ 8 d, 0 l% (Ƞ 858% *|aq !40` 0`0 4ap %D q%ȠPQ` P T*d*  0儀 P0!P "0%P@ Tq|D`Ql Add " ` !0# ! "0#  ` XuЇ/[9[>[9[G[C[SDpa(8l 0@0XHP(($.H1  .%<!... Aa0.,A.40 %.( %4,@0!,,, ,40a,( !q, %8!`A0!!!!0hP!!4A0Q<0 " "! "@PA!< " ", X 8 T 4 P 0 L $ >$>$>$>G-M 0ß 0@R$2.  B$,,$ , 1, ..4 4<.ß0#. 0#p,㟠0Gt0} pd **l ? !  B1 ?Q,d0,'F0 ,ˠ0 0'000 ) ))l ? !  B1 ?Q,0d,'F0 ,ˠ 0 0'000 pW*!0  , "",$" !!1"! 8!8#8 !0##  2# " 0Ѝ|x **l ? !  B1 ?Q,d0,'F0 ,ˠ0 0'000t)p ))l ? !  B1 ?Q,0d,'F0  ,ˠ0 000'pG0W*3333UUUU$&> -LMP`@p TDXHL\0K 0P ,@ 00 0p, P`#@#"#8"Ġ"0 (KG-M R௠p㟠0G 0d p **l ? !  B1 ?Q,d0,'F0 ,ˠ0 0'000 ) ))l ? !  B1 ?Q,0d,'F0 ,ˠ 0 0'000 pW*00  Ѝ|x **l ? !  B1 ?Q,d0,'F0 ,ˠ0 0'000t)p ))l ? !  B1 ?Q,0d,'F0 ,ˠ 0 0'00pG0 W*$&>0 Qd6> 0-<@LP 6aP@ 0T00jj -2LM @Rp`0  @P0ČȌ̌X!2,P2! ) !0 #,# ,!$"0  ! ""4!4<$"0#"0#  ,8#Ё0 , , A)0*!S0 -ክ4 4 4  }*G}0@ N)Tf ;<?p8p , @^ 0 (KT 0SQ<PY jUUUUd.>$.>d6>C -L MP@`pP DHL.$ . . Ƞ,Ƞ  D,, ,4..D, @.$ @$.`0PK p@$,4  0 ,@  v 3 0,40!0 0##$ 4# ""# !"!!" ! 2!26:0#`p4 P!@!4 ! $ 0 (K3333UUUUp@-0` R" 0@Tڌ0 P 0 U 0S 00\P pp jj$jj -00ML@ d0 @ Kp -LM,00,0 < K <0  P p -L M T}P0@L 0D<@/0 ,80@/Kܦ?pdL@DplL@p -PPLD d0SA 1p\ a 10 ^ 0S 010  \00R P à L ` 0 0@0@ P6e-jj$j -H0LM0S  0T Kp/ -PL@Q\pp%`0S! 32C0e0 !   \P0@0଀ 0 000ഠ  @jj -0@LQPPppp`0S j32C0d0 !   \ 0  ฀jj -LM⸡00 SP@ D1p`^1 @0S% 0"0 V U 010 R010 R Qt 32C0d10 R @ ^t`VX `p(KV ^32C0d(K @ pP ,P0@`@00 000 9jj p-@LP0` R(pQ 0ES32C0dA1 R U 00  Q 0 S Q pP^U( 00  Pjj 0-@PL 8PQ 40,80+8Q +0h0pDp -Lpq+`P D]W P]80U408@ P+@PP8  Dpp -0L?q0SK RڌPPU 0S00S  0 0ਐx+>PU;32Cel `P2 0@#"B c!n]0@cc]10 㨐  lZ `K0 /l0P0P 0AcB] 5P 0Pjj -pP0LS`P @VP#:32C0f A 0S0C0000SP P0  0S \jj -LMpP_ <0S\ 8QW ^S 1P `U:4 R 0004 R8,K P,0K0@#0(0 $K32C0e 00C0 0,0S  0@/00@0 @  P p(W80(0 Q8jj 0-LMP0| 0@Q *#d0"B a! 000`@0P  (0  K0_jjp(/-0PjP0S0SP0S SQ 0S R0000 0 00 000 0-@LP$PL<PLL0 0-$@PLP R0000 0 PL$0 -L M4 0 , L PP ($ 1>< @040K0 @@P@  00$@ @,(K| p-0LMQ`P KpL 0@00 ,K K尼0P,U0  000\ $@  (00(0  00CS 0Lodc(j -LM 0S0,0 0Sܩ///|/ܩ/QR 0,0 ,QRL hz00  0 p101$2d0 0(00S {Q0S$@PP0S@p(00a L J$ Uء PP, P0S@pP,  X 0@0$0@S (Z$LTL,QR QR 0 P, 0S,0 A0T1 (0P` 0SP`0@0! yP, 0,0 \/xL@ -L -8 4(0L0(#Q 0,0hx -LMpH4Q P, 0S Q ᑱPm` yZ3#@0CX@@ 0C@kZ 00@*0 3PR{P 0,0 N RZ 8Q4H3  刈P, ;Z  ,0 00<  @010Y 0 S 0 000 0 00 000$  (0100"00`< 00@4PP Y 0 S 0,@ LP,   ,2 PF*, , ,0,0 0S 80 Y 0, 0 00S Z D0@0 0!,00S *32C0bt!10 @ 0S P,  (@0,0;X,0@0!, ,0 ,0S00S,0 ( R, Q 0 ZP, Q 0@ P, 0 S Y 00 0 00 0ct \ h X t/jjxL@x -LxMds\, ^@$2 @3^ 83^ , 0 R(K3^ 1C^ @P 6P  .0S̳/ij//////////////////////b0StPK$P@K Y$ YVJ  0t0 p 0R0R+*hP p0QXhLDP L0QuXDLLaHaDa@aQ@-@ \0Q  P 0 SQZP00Q0S @10  -LQ`.R.\V&  \* V  R b\`FPXVp`V @@lT@!d /XXp /// /L@L@L@L@ -LQp`-R-\V% 0\* V 0 S c\`FPWV`V @@lT@!pd WW... .@M@$M@L@M@ -L`RAQ=8 Rp.0^p.W& 0Sc^pV$ WQ `dV pRP 0 @nT@!  P 0}.(z.pt. q.M@M@pM@XM@ 0-LxMPP&@Kt|W 0 | x p l h d ` T P \ 4 0 ,  L H @ < 8 ( $ @K0:.Lj//̹/M@ -$2L Pr0S Q@0Tz P:  00CS+긻////////P/P//////////////////`P VlP Vll 0@0T0P Vll0@0T0P zVlP rVll0@0T0 S l0@0THjDj QP-L`@- vQ X0S X!00 lPP& 倦P  !VlP 1S  RTr 1`l PP> 0BS>@/`/X/P/4/H//////4//|/h/$/4///////ؾ/о/H/,//pu R0 ! P0pP @T2 `l tPP7tl a0P  0R &"( 0p P @TPtLtHtDt@tl 7P0S l .0S 0S 01S 060#0 R0 P 0R &"(  0!S0!B("(H 0S 01S 0j0#0 R0 P0 0R &"(  0!S0!B("( 0S 01S 0\0#0 R0 P0pP 4(ru$rs r20P ) rrhrrq10P ql 0P 0pP qqql P0S l0P r0S 0 S01 0 R0 ! .U0 0R &"(  0$0pP ppp0 00\0 S077P0DjHj(jjjjpjjj7>$8>|jTjjLjPjjjjtjjjjjljDj,jj -LM@`l P pP^ X^ 0 0J( KlPUJ P 0 0U2XH  (0WU(*XH e@A0?P00S 1\1C20A\,0@D0 0l/P  0CR0(l$K( K lPyU0@V(0 Z 0`0`T -LoM8@T0,0 0  pUq q q q ` 0!R 0S 0S  R`, 0R(K0CSd/l/l/l/d/P K &Tp 4@TWP ,0   <K T! 01S !<0K 0S ("(K<K 0 `K  P  0 S  `R1P 8#81  0!dfS!K  1 PR`@e0fT@Q 0~U0! 1 `A  0S !<K1 RTP! ("(K  P9   0&1 PU6@e T @\P 1  0O 0( "(K 1  WS! 0 U!  0{Y00CS =S <(4"4!<1 1(< 4!4 <1 "(K |@KK$\ @ S.\ 1 <0K 07Y<Kᛅ1<K  R!<0K T 0T <0KYDoDjt7> -LM@ \,  `G PK  RYA 0 pW  0 =0SY( 1lK@ RP, 0RM(K #,10S. 0S lK$ RlK  lK$Y  l0KXp 0 7Yp   0S   Q ("( lK$lK$vDo7> -L\M0ɟ| |@, `x p^PPxW 0l W x0 -LMPP] 8`V 00S 1 QQ*0AT ,0pp0 S0S @T0(00(00CS//////////////L/t////////////0 0P(0 04`V 0@T;(00 pP( 0 02P( HjDj0 0  (-"(L (-"(L7 (-"(L0 (-"(Lp (-"(L_ (-"(LF ->@LNl?00 -A@LNl200 -z@LNl%00 -@LNl00 -$@LNl 00H -@LNl00 -@LNl00 R@R-L`p l > Q @z p-L`@Pl z!Ppp , -LM 0pP@$0 4`K3 0#0P\)  0#0#0QA#0P0 Q3@R 3x 0#3N$ 0R K ODo8>   D 0-LMP K^N !4<"D\0 @  JN=z K0 -@L ?N9N00 -@L 1Nh*N R-L@p`l AO! BPP @ N p-LM`0P0 000S0A Q B,@K 00 0#0QuM 0RKpDo8> p-L@P`l  ]p  M p-L@`Pl X%(pH U  0- LP@ llP fP`P00 0- LP@lKP00 -@ML0,K - ML̀@0@K 0 0 -LMhK@P@KpLM 0  0S2"Wh@ @0 < 8 dP @l kP A "0@ xŸX  @ P TP GiP.@K`XP(d0ST0T0SEVSl `?P @ 0X 0 PTP WbAl )P 0 S  @l0 @SW`(KV(1!@0 X T@ @ UP0l 0 P W- V0S$ `pK0@ L000l`e0 pS 0PU :@L000l`_55j(O@ j -pLP 0   R`@0 0` 00Ⴃ@ T000@-pS`P @0 000   000 000  " @Tp@-`RP @0 000   00 0000  @Tp0@-PQ @  0 000 0@0PU0@-pR`% P 13 RP@0   "  80#440# ># b1#  @ 0@^ 0-@P LX 0#40 "( 00  0#40 "( 0008> -(0 $ , 08 40< 00K -@Lz K02 -LMD4PK0` p$0 K 4[  Z 0R300%0[0%0K–\@ 4[  V 0R300%0[0%0K 0Q1 0Q11 0#P1@1!@0#T1 zJ$ 0R. K1 0#P1  0R300% [x00#%0K  0R300% [x00#%0KDo8> -pLP`@~Vz_1 0#P1`F XV@  b0`R1!~ 20VS  21!0#P1z_ 0`h@ q -LDM⬀0dPK`$0 p@J!J@0\0#0@@Ts c _J$ 0R KDo8> -LDM܀0@R@$0 P`(Np = 01dPK@eJ!dJ@060#0@@T3 #I$ 0R KpJJA^Do8> -LDM⬀0dPK`$0 p@3J\ 2J@0\0#0@@T 9 5gI$ 0R K+Do9>$ -LDM܀0@R@$0 P`(\p D00dPK@I I@060#0@@T mI$ 0R K\pI@Do9> -LDM⬀0dPK`$0 p@IX I@0\0#0@@T0  4I$ 0R KDo$9> -LDM܀0@R@$0 P`( Xp 00dPK@I ~I@060#0@@T |H$ 0R KXpdI@xDo49>G- 0M0|l L\ ̠<Čh4x HX $'4%Č&'\(l * p$́  00Q >I?("(H -""LM 0`, 00 P" 000 @Pp 00#00  "  0p0#0 0  ,G,0@W0 (KoH -(LM|"X0`Kp U@T Kd H  dT T9> -H$H0p!`L BP@0D bH0 0h臿 -@LSHPH MHhIH -LDMBl0 l0PA`h  4K,0 g 8HlPE0D PL H  PP T l0S L@K0d@ `P PPX0 \P 4K DKJdKd`[\0@$L`Xd0K@0Lp#D <P`d0K@0D#L4p d0K0@#4<$D,d0K0@#<4($LP`d0K@$4$@pd0K@$<@P`DK<K0!@"\ D0 @@ hDKD KDK 4K<K \d0K0 @\Pd0 `@ X@PE@TX@ \P l`0F@LPK`PU`P`LP H` T``FvT` tDK+G 4K0(G$, 0PR(KDos9>d9> -L4MX \0  X0H T !HG< \妟H@P L <@ D @ D@XT @H 0Q@ < D0 8KF(K\ 8K↟< 0K₟T8K8 KPKP[\0@$L`XP0K@0Lp#D <P`P0K@0D#L4p P0K0@#4<$D,P0K0@#<4($LP`P0K@$4$@pP0K@$<@P`8K\0!@"8K 80 4@ ,0K <(PK0@ D0P L < 0 < D0 |s9>!᥿!᰿p@-(0"`P .`0 "  @0 . .0 0  .p|9> -0 1 0L@ty  Vy 0?,0 j -L 00#(H8H#X`p %  X   $`V Hp  %8Y H( ,0S T  j -0L@mF%yh - pL\P `rP  10PKt0 0OT?< XK ?ܟ@a,@U ?PΟTL20 R)02 0 \ PU L#0\0 \US*8 0 808 0  10P & - pL\P `P  100Qt0 0OT 80 O0] XF ?`@,@ٜ ?PRTL20 R802 0 P/\UL#0S 0 PQ0@0C 80O0@@10 0@?80 O<S -LM,   0P`,0S,@p,Q@T@a0  0p P`(K0S,pQ@,0S@S0  0p@P` G-M$PP`l00h 0P01>0  0$5@ 0p RT001Tx?>   cp i  0S0X d @JTb001^ pQ?>   cpG C  0`0CW^ Bb   R 01Q 0110l1X100`1$ő\ 1 0R 02S\0 P3Ѝ 1 >0   r  R 10 01 -L$MH L  p ?D0OO^P`1`>PL 0  BSLaeH L08`0?>   cpH 02ᠢ!0EPL0` p2RLH `08?>   c 02L!0DPP| 00`1ɯ D @ QL,0S PQH 08 bS180 1, !1!40 L00 0,<0 h1< PoQLL `0Oς  1>0PO>p@P` Q 804 \0 0S. 04  0 S ^,@ 0O QD  RH  0| ?(KLH,0p S0QJ 0H 0 |U j:>:>lO@O@0O@PO@ -LM ,  @_ 04  00  ?n40 0D @ <  ቚP<4p0@P400W D 0TALCB<4BaGT@!V`Z4 P80 tt80PQ, 000kP#, W<c,Q!, , R Y, L#20T 0V0ZH3,p WYULØ0T 0V0ZH3, QoUYL20 40S02 e04@ TUYUYL#40\R04 QGU<0<000D`u,@ؙ`TPL#2 P ^04pW00pWPT PL# Q04@T00pWPP (KC cB SV@QVS 4 0 0    B ? 0@3C L" 0p0C0\2Qj d08<S c>Q SPQC ` 0ᯛ 02R^ , 2P000 H0 0P; 0P L 娀 ?D @0 ޛ0PO`sPK&,D K `p \ \ 僛D K ` F.0PX T `K༛X X`T0,, @?eHp00C0 0,RT0T!00C000 0<K(KP00 X 0  H , Q?8 `p0ရ< 8 P`<8`8! a, QV.QV1 4P@p3#U T -LM0 @00_Bd @PR 0 b4Q0 RPQB  K =k@P  <H 0S 3SKe eU -LM `@,0 Sfb P, ? |1HP 0O0@ AT1 AR\0?00S:p* 1R\0?0: 0  00 W 0p5 p;0@4DL# 00* 0 R0 ,g(K 0l=S X  B ?>0S@3CL# 20C 2 0 jU O@O@O@ -LHM\ 8 0pSPo0@0T8Z8Po0LO P` 0OVʲ 8@<4 S?90 @8\00 P4 7H 0O0@ 8 ?l8`00p S 08'8S`0`0`QωX 0 !00`D  @0 @@40R<0 8 0=8PT0ZPp$P`p6^`0/ 1> R,6@^`0?0 0,p0P`W $ 0 $ 8 b4 D0@4 DL# 00 068Q`0 80/0cQD0@@< P088P`0%X3Q@_`08 0P+8@004(KofUJ\ 80 0LD} \P 0, 08 şR\p00p  0(K8p$8 `$80@_ P L×8 n     ? 0@3CL# 000\@4Q d0@Sі 4R 820PuWᩖ8`@ᤖ80ᶖ8 0P 80孖000 `3RT0T !000l84S}`06C cB SWAQWS3 P`080 P 2 8R`0 0 0 8"   8P ?0@3C0L" 000\`2Q- d0@_X@ TP S c6Q SPQCX K ᵘ 1R] 208p, 0PP0 Z8X K d ` 8娀 ?L H0 8@P0`OdKs&,L K lp h h 刘L K 8` F.lKPŘ `0', @?oP000 0,RT0T!000\p8 08X P , 0 P 8X Pu 0\8 0 ,( jU P@LP@dP@P@|P@TP@P@P@ -L,M D `DL@ pP(K D P4 H 0S 04/ GP00a0 S0X$Q\q\0/ Q C?P  4pR\0/ 7?PP 3 ^\0`ω1/p0@00 ,@ f 0p@WXl#hP ?0 , 83,@^\00 N1/0L@ 00 R!H \%2R> p2^ 0L1/0 H010  B ; 0@4D@@L#0 0 Q0C0p 4}dWa0D 00KLsbH0NL@ H 0x00K<0 x ? 0 SʲRt0\pD 0(080 ה P  oPOP`ఔ<Ɣ`0d/ , l1 \00.Q`8``f0pH=x H0R P4pPx `R\x00x0j   ?> 0@3CL#@000}0\ L10  ZD0 0L0 jU W@@Q@TQ@ Q@ -LM4 8 8PAP(K48 P, H 0 $h0Q 0 S 0S R BQ0N 0R P3,a02SQ0 Po 0 ጖8 0OP>  0l0p0^  0@0S  P 0  Q`10 0O0@ ``0`8 V@p 0@_4, 0.T/ Q8@ @d_0  `00 c SQ QQ0O@0 <@ < O>P@` ` PPU`%<0`ï^P`1>AU80pV,c D jdQ@ -L0M L `LLH PPT P0 00S  L PD H^U #0O0@00S T08U ZO 04 R40 p F0SFp W^ T K D@ < 8 Z?  `0 , 0 K 1>0 108\` 2Rψ0O0K` 0@1 >00S` 0@ <0 T Z p T K p|Q8 4 }Z8PK` 1ψR` 1> 0 #0P @` ^$  j$ 4 D0S@4 DH0L# 00j 040Z0C40  j! 400400L8@K0ADFb@@ 0 0 R#A4_ 0@ <0 S 0@ <0 @K(K80,@dYn \^ 1/X`0 0O0@1>0 AR!0 \ `! 400C40 i! 40040T0 RY3 1> 020$  B$ 4 D 0@4 D80L# 0 ^0C 0  0Rυ0O0` @1 >004,a0@ d! 400C4000 c! 400C40 jU -LM080 00 @P4P @ß 0x (Kj  V ,0P* 00 ,0 d V H#0S0C0ß0 K 0P`p40 8 L0 Pl0p 0 R RPn 0   R P 0P`04 H` 0 Rl 0  P  00d0X0 0 QN 0P R R QK 0P  P  Q9 0P  r 3R QM @lP 0 Q P0S su0P0r 00 ,0 |H#0S00~*k _ l0S sY0l0V0h R 0l  r 30l R 0l  l  0 Bh  0h Po}@Cll 0 0 (0| `dCm|:>Q@|P@Q@0Q@Q@Q@ -LM $5S. @pd`  02 f V@ SQS K @0@ P   10Pp7 K X\\Ғ\ (K^4KKx0KH!P0K Po0@@ 8K0K7!P4Q@K00(00 0K80`S 2 K Ze㼠 'Ÿ ?p^ Z 1P` OP`@0R P R80P0(0 Sn A0S] ,l_ P0S[ 0d_Z&`pQ d0 c> @SPQP#00d0  c6 0SQd " 80O`p X_000K n ebP' 0 S@P0(0SK ,(]H K@00,KMbP,0 H0@_0 ^,@_0]0:_00H00 f4@000Q 0!0j -LM $5S. @pd`  02 f V@ SQS K @0@ P 忑  10Pp7 K X\\\ (K^4KKx0K% P0K Po0@@ 8K0K P4Q@K00@ P p00 80S 2 K Zo㼠  @K0@ P?@hŸ0 ZPp_ Z1P` OP`0R` R80@P0p0Sp A0S_ ,E^ ^0S] 0=^Z&`pQ d0 c> @SPQP#00d0 c6 0SQd " 80O`p X[000K n >aP)  R @P0p0SG ,\D K@00,K&aP,0 H00  Z,^0[0^00H00 Z,@000Q 0!0j00 R 0  0S j M-L4M00P S@0,0 0P0 SH  `3Qt 0a0S QARQ< D?@Ğ@c.d 0P0@0S@TP 0 Ry P1 0ppe @T HP00,K  `P@ ,P j[0,0 P@(K,0 < b4ɯT L0 P  0(P@ H@ ?9 @P 0PPD@ .< 8 N P 0 R P0 0 0 @0@P@0\00 H8@d0<s c>rc, SqQP 0S P  0>(0 ! (pǏSvP0@0  @H @ß0  @ {H@<4 Sʯ H R|Hd <@D4@D_@Ĝ0e.H@ 40`S H00ßD P@Q4 0 P5 P 0; VP@ 0 R P 0 0 @0@P0Q00 H 0@d04# chR@lCm|:>R@|P@R@8%0R@R@R@LR@ M-LM`  0 00SS p0S `3Q 0a0S QARQ< D?@Ěc.d t@0d PÎ0@0S@TTD`  0&PP"<4 S<7 0 /@ Q> 0 R5 00@0@000 (K#3 P 0@ 0 0 P84S 0 ?iS h00h0P  0&8%0tCm|:>R@|P@R@ -LFM P 8%@  \?00R 0  P4 UR00 0a QUQY00 @QP Pb0b1re R1nQW@yY0g00Yu,K 0KP Q, 0 B1, 0 PP \K `p 㬠K 0+[ 000@K@!^P 0HP, 1P 0 R0 @&& @00S*@@5L 0`UP崠85@L 0 0p`V\ ^ 00 \P  0<`0PW \KPR < @0 0匎PU, U yZK 2 Yrd \ P l 0 A2 oSQS 00 0O$1 A 0@1 A  ȟ%,AP h @!_0@Pp@ PZ^4\^J$Y 0 @@@`[0 00 YPؠPEZP @^  @00PPPF[0 0000;000V00;000V\'0@   ,0PS 2K@00[0 00P;000V,0@S!Q"@P00\@KԠ00\PU To0 #00S@0@   0 0 㵍,1000 @ 30 0`@0p! 0S#Q d0300 H<100@@0RXP 1 @K0@PQ000ܠTK ؠ 0s Vp 0c P0@ 00 @XP E USB00P @ @b b3a R`Q R\H:D 0`( 00@_02qoS@ -RLMM@ D{ ,P05@S*P0MK0@ P0`Kpp@,0K P@0 0PP 0 R 0K @Q:>-8Pp) P P 0 R030P @0A#O1 g00S0P'1? 0@  `HAR-8Pp# P P 00 030 @0A#O1 g0000P'1? 0@ ` HA -8Pp P P 00 1>0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA` -L$M p4 P<0 7\ lQRl \@ R^Q V0 #4000400,K0 NPP<,0Q<4 ,85H 0 <0, (K,mI( 0 0S80 & 0H D 00@@,@^3*.D RH0Q84 Q0085@0L 0 U0H D  -LiS@\5XX SS 0 R@0Rh0 S8P0!RTTc jC-0 LS03Q% 5p00P5,5MS ڬ4S9Ӭ4հ4S@0Ӱ4Ѝ0t0/Oq,,REQ `PNo,P`PLH0` 0`O/0U4e85X< 8P 0` 4 @( X0<0 8P 0` 4 < K_<@$0#= ,K ,0P@S ~ 0S}P@ )~8@ =S P@(KI -0W@T@ p-00LS@P0 0h0S  9g`P p0  }P }gp -LM, 2 !\5SS0 74d 00  8@_d t,`p`p<@D_@,z`Vp` p, ,0C@$0(@[`4P8`,P0``0(KTTT@ -$0L Pp   ^@P`@0 S@`V ^@P  <~0 0| @l} -LM$0 bp PUMT500#0(PPP@ $KPHv0@x @ } 0@@b 0Q {PdLYVS$0 B:$0 -L@MRx0\ X 0\L0 0  < < ^P (KePT7 XD\ }@\0< @@a\ |ZX $0 0@0 \0B{PƟ(0K8 #H`0 0PxPR8@t8 I Y` 00:00,D, T`/:IP , 6H@ \%R  VWP x0@@,PnD\ .}@ \0R< {\ |P0S 㵔P㲔X Bw P 5-0RP5 @0SX$0! L5@s00!T  O P  Y㸔P h 㳔P0\%4RPP00 0 0P ,0Hh qh0 S, 00;00, DP0, 0P40  04A4= S54@ 4@ @~v4D $5S,0 1@wH DH 4PL#480 ,0H;,C4,@ 80D Q&D04 \40 i0p40 PodLDH4P`, l5. 0\`#Q0HH@P0 H0 4L 84 $Q,0HSP 4$H04 ,0SPX L  40S 0S0X 0 X004$ (5*(0$ LP@X  t0$0P0d 4( 80P@,0@x0X[@ R40HCL 4 X@!00KN0ua4P0S^`\Q`a004 S:O/ 04@ P  TQd 4 +4 0040 X$00445P*PL05S404%s@P 4, 㠓4HX<0@P440L_4H[Do =>T(T@T@PT@ -L,M$0PH ,P L  (K 20D0 {L0H DPP_L DzZu 2D0OO[/ P`$:,@K@GP],PHpPBL3P#L3P#h h0 S, 00;00,B(5 (0/ ,L  40@uP@ L080p ` ,0H ,~B80@`\ p@0\4 0f0PH4LD/d  `1, 0P#Q,@K0D@GP ,r5$%R ,0PS$% ,0SL0K << K80 4@ < 0 [RD  H0T@0 -L$M8@pTkb$K cP@ 0 _PZ, @ @t 04 0 4O  4$"0@<0 8@ @_@P< K @@PYtxet`0d  , l1. @\$Q00 (K G@P,0x?t,(0 H Su, , 0 R,,00000(AaT@ -LM `Kl , pDKP0$U5%0S' S  P 0SPT@ -L1LMDA@!00pcPP$1$abPP xP Za KcPP.  PP 0 0 R  0 0  2Y @0/K  ,- b0剷 0   B b B!aj,Foq`kDo㈶hP`U@6 0 1P0S00I X 0S0S 0S 00 X10S  P00700>G00600屵Y0SAP Xh 0S" 0 [ᚵP9h `R YIpvx00S $0 | 0S00 HoU@hU@ -LHM\ \T \ X  P@ 匐P X00S S S =T0@0 UP  45 S:05S*P(KXT@ 00K|yPP 0T R4 q 0d ` @  8  PD + 0H0 > 7Z 0jSXj ZXXRQ>VP 0,0T @H @a<L0T@PPu8PoPL0 0Sf85 R , 0S 0 $^L0t03U0S000T P PT850 p0L0 0cS0!S<0 PDD\D D 0D 0,0K  <0PP<0 T 0R) 00QRY 0 0 RN 0X御H |@ T @0D,;@,j@,0LH00 Uk 0 \ 0pP00P @@b b3a R`QVRUUS\0P0  85@0L 0H0pP600 @ 0 R 00T 0 @ 0 \t 08"X  R R \T@0{ 0 TE P,=6T40P*\ 0S 0S 0;0T4 R U @*T000T0X0 H\|0 T4Q8 R 0  T0PU P\ @80dK@ T04 0`@Q T0  0d d  R T0d ` 00o0 U@jU@ -L MD < @ @0 080 45Rp(K <Pp < , ^8 T^ @ 0p00@@ \3),XVS ,KD 40IBpW@$P(`,4@00cZS[ 0 H < RpPu,=<0,p ^p @ 0 @T? @0P`<0ppWX6885004 00 P41P `Y c PR\QZ!R` ?ST@0pW@$0  S(0S,KD 40Ap0P` ,pP<DL0$   @0` @ 00\RkW@@ 000O8 05RNpH,p -LMLD @  œP0< 0@ DPK`?O# $Q R<` @$0@PPQ0@ ,P ʅ 0@K0`0@TPpW0@ ,P ZP8P @\D K X8P0O0 K 80 S0c0 jD@Xd 4 <0$@P 0q`p 0K0q 8@0@8@ [q00T0O4PP4P $" 0@XDP@  R\ 4  $ 0@K0@TP7"0@ ,P 0pW`P8P  (K Qp0@VPwP`p8P V{@PY`4` D0Ky -LM L0 p @ T`P @  0004"n@ Vl`KU,PK 0PP vPUP ,P t @ 0 R 0 10АAQ, S x` ?U Pz;x00 40 ? 00   0 R x ,0H0 1@ɯT   00 R 0$ 0pǏ0S" x0@S,0 x x@ 0P` X:P R /;@(0c c9b SaQSP``(K@ 0 R( 1 0pP`( B b5A R@Q2  Q   00St p0  R 0@ T |  PK | \ t@ 0 R @0 0ppp ,0P`P`WX tK0t p | @Q00( dß2 b91 R2Q0@( "0 P(`80 0@(, 80<@!s"0009PP :P dV RPQx0@H, 1 0R00 @  ( R% 0$ 0pǏ0SR @\ ,0!P` P`Q 0S1 0@0$ p@0SR\ 0@H ,0P` P`Q0SR @PP 0 0,0 S1R U 0@H, 0 0Q @PP0$ p@0Sʮ0@0! (Po010X ɯY1 !0 ((pǏoq -L M P0  000S P K-\0\ 00P P 0 S0S pp R0S  0 -hpP L`@ 0 01 R R 0S0S 0S00PP pp -0儐倠L`@p0 0PP 0S0SP ZPPq pp - 0L0  0B pp 0-PL@ND 0P_Z\0 -LM@PQ 0Sp 3qQ 0SZ0S00S L $0@ p0  0P! 0 00 0p R0(@ 0@p0t@0 000   -L@M 0H QL I 0YIDpKP`(1@L,K 0 @`rP+,0S(\% P 0L (Q  R0.SR 0.SH0P 0@P`Y X0P(K0YXq -L8M0P( @= P@: (p0\@ K07@`P0 `pNr@P(L0( R-0[.0[S"[0R4 0R R W(04L( K 0@P ( T (QW$K@d(@q..U@ -L0L(\;; -LMPp@0 0"&!R0 :R4, 0 R00(p IR`P 0 00, 0QWQP`0$KS40040X\$ \` 2 1C0 00 \` PKR-Hjܻj p-L M0 0S 0P`@P dP@ CKp0P` -LM0p,KK0 R 000  0 * 00 0S00p00 0 0 R00t000 0 R00(0p0H0 0 R 0  0 0 R000 0(0 0 R000D0,0 0 R000(000 0 R000@040 0 R00 00080 0 R00$0H0<0 0 R00d0X0D0 0 R00l0P0@000S;$0 SL084 $0$  0 Rb 0 dkTLPP`0 \0T0X@$K00 0 R^ ,0 O 0$@0 0 RN ,0 O(0,@\0 0@\0`@0 0 R4 !0O004@000B0? 00,0 00 ,  \0 0@\0`@0 t 0 0 h0OdkT0 @0 0 0 ,00 ,00 j 0-LM08 PR9KB0 R6 00 00 0 RU 0 O 0$@0 0 RE 0 O(0,@\0 0@\0`@0 0 R+ 0O004@000K00 000 00   \0 0@\0`@0 H 0 00 0 0 00 00 j p-LM0`8 PR9 K̭0 R7 00 00 0 RV 0 O 0$@0 0 RF 0 O(0,@\0 0@\0`@0 0 R, 0O004@000nmKp0 00 0 00  \0 0@\0`@0 H 0 00 0 0 00 00 j0   _o0   yn -LMPp00匀0CSB0S q$ 0`x0 D ,0 K0S@0@Vf`P0s0s<Ho @`r@.X`004`;00@.K5V@0h^|0h _|0 hY|@-@ 0 \00L0(0Q S\  0 p @\(h0S  @d -L -LEM@0p,0 0 PR` L L0R %bJ, 0R(Kb場V  bPH!0  QQ8PD 0l!X  R R70 000000@00 8  0P8. 0 0C000C0000nhhV  baaa0X d  R MOK   0P8 Do8=>o -LNMp `0,0 8 < L L0RP @a81V _I8P\I {aJ<J , 0R(KP L0R 0 R 0,X R 0 R 0,X R\  (b@P<@T 0 \ T!0@,QQ\ T!0 ,X R 0 R 0+X R\) T 0: S00SH1 D1 h8 PL! P T0 00 RT  000000T!000T 0@P < .aP!R P1HLH:JH!RT 000<aPTT!0 0C0 RT1T  000C0C00T0000<HHJ;0 *d RW @+0P@' `H8H<I00 0 0] 00OK <@P"I <`@ Tl)0d RV `@0@)d R) @ `@0)Q20(d R@0 <-_ @<`L1D Pr H@! Q\ RQX  T[P!R8'HATL @P0  NK ;@POI80PL1 P PP P1L 0RT0RN t 0^8!0p03R0S;P30S T!T 0 0 0@T0DA 0H T1 0: S000 .R <)`@`<W@V@V@W@,W@j -LMq@`P 0 vy \00 p00R] |P 0 \w 0, 4 0 ,QppYp=P (K 04Kp6  6= 0 R00t`` 0 R00p@@PO ) 0 R00t 0 R,00,pP4KJ 0@  \00p00S\00t00S  {P\00t`` 0 \00p@@u0h tp0,0 4 0 4K 0pP  P 4K 0pP, YR0000Q 0S 0;0Pb 0S_ 0;0ZHW@ -@P 0` R00p00LQp {P+Q 00S  ( 0 R00t{P  0:0*0000004  040#0SញO -L MPp0 S`0s0s0s $0sH0sL0s@0s @(KD0sW L0$ % 0 Q00p00R M{@P 0 RQ 0X 00S 3 R@L0$ \ @Q 0X D 8#8RQ  d0X0#8#888d0X0 0 R$d0$X000d0X00#00D0 R@ 0 R 0"X  R R q L0$  0F@Pp 0 R 000 ,@ 00S@v S S  0@Ph 0,@Se:` (0sv L0$   0S00p00Q z@P \0J  0Z@PC00s000(0s L0$  0 0 00(0 0@P(q@ L0$ P 0@ c0d J @0d 00.Q D0 D0d0X0W00 S*0X d  R ] 000 ,@ tqi0sV`00s[o -LM`@ 0 P00tp  00AK0 R 0 P 0p X  R R 02& L0$ P 0 d  R  0-L^ P 00S \ R 1S1  01S  RZ(@U@ 0@@"00000 -L` pPQ @PQ @T@a 0PP QUP@6S@S  0PP@ -L M @p0S Q#0 HPA(U,6倢 0& 0,K6 F(P2(}U,0aHPQ8 8000 ,  00* 0 R0,& 10C1,$(K ;<@,0S$," ;W@W@\W@ -LM;  |P@ -LM @`0PQ $0:  Kb,U,6r& 0 K6 'P$` U 0H \1 100 1 , 000 $ "; W@P@W@P@ -L`M` @P Pp, !`(K: S1 (@T (0P  0P ,  L0 `P30PQ !R/0 0S00505 0d0 TY ,&0Qp0 0^  \   0˄ \@Q@Q@%1$p jX@,X@ -LM @p ` RP  Q 0R 0W p!:(@PTl6 `Pڰ6 $ 000W $`6TR@R@"1 -LM @偂,Ɣ 0PQ(K 6 6,K &PW,60 RR 4 $0`a00 ,0HpTY P _ 00ab P 0S =  0S7  \P 0S P0 0S'  RU 400cSQ`e PJ 00` PO 0\HD,B!1P!000 , B 0 0C0&,)#$0"}U 0S1S101P!P P 4a0{S ` OPP ;4W0;\ 02 P!HW@hX@0O@HX@ -LM P,剢@P40 (K6 6,K &P0 Y,0@TH% (7S!\1@0! 0,0C040* 0C R0,& 101,"( 0(0T0 0d qa P 00`A@ 0Thdp P0`  ;40,v 10W@X@X@X@ -LMRP`0 0 0V0 8K 0KP 8 0 B18 0XpW/ HK  㘐K 9  ,K6]%P ,80H QAB T  0~4K  0P  4pp40 06w$0 63O0@0 <HR00 @ 0 "P  2Q(K 0 h  q< ,"T0 <4K 0 P x4@ @80( K20h4  PA0 ,!6 PPP*$0 6 3O0@000(K,!h UGA0( R 6,K $P w,00(0 4K 0 P  4 P(0006 # 0, &402O0@ ,0<H,0@,TH0K S`# *@` 6Q` R0 `0P80SK 2@6#, 00P;00,%80@SVv 04C0 00 0m,j  0q4K  0 P [40K0H0 6m#, &402O0@, <HG,0 @ ,!P 3 D0K0 H0Kp "(K@6pD,K$PM, h0H  ,   0K6 #@P100 0 , q4 X 0 0 0D0K 0 a 6  #0 63O0@, 00<H00@P0@ ,TS@ -LdM \0  00 R x X 00 L Zt 錐 P|  00t04P@| ,K/l0KPx :,\:! (0( 1S@ Z* @ T'P|0S#ڰ10$ ,( P0p`e | ^ ,(0 ( 0P 0e 0@ Rx(Kd0 L10\X, Z L0Kxpp0 p Y@[ TN Wp 00t 40/e"00p M p0H`,\00Y0S( Z& $0PU"*@| R0 ,0 S1 |0T H, 0 0Q@@$0PS,p 0L S,0 p W(0 30@O/P(00 3)O0@0 "V`0`  (0 0@(0,@@P x@ j0@fqo@-0 : Sl0@@0@- : S R Q0 0Q@l L0S d  0 6d 0p0p -L4MH L HP T0 D PF D 0F$!0 S T^T OHL0/!00D}8@ $2ŸP0`00(80 0@80<@(, 00<8 9Q00P0O0@pU @PT0HS࠳@ 0 < D `mD0< &@VPD@&0"!h! B6 0 <@ DL6 #`@ Xࠣpc4 *1@@4 PU  RD0&L0,K"HcP0,040 4 H48 4 `FX p@DT 0?^00S <^( l40@(K@1S D F DN 0B,KH %00P0400 <,0^4 00 ;00L I pqoX@ -LM@LP$  @(K4`K,0 00 T@ 0 0M!0 000 00P(` 0PEpuN$N@}N,6 6@C,K6 %!@P10,00L RHP@$e`RN0P : 10:7_OY ,@UP \0 0@\0`@0,, j -LMpRP }00 0BRSvRv (  W(   X 40 6` 6PP7 c SXQ,K/ 0PPN 0 F~,0fH,0<@2 ,V W0``1 aN0 ` PRQ0G0/,K0 `P  ~ ,e000  0(K  L0( 0OT R~0Sz(s   f0O0 @030@ `2 PT1Q&  PCl n(K< d4 -LRMl! #lA0  ,0 4! .KL0S㌀ `0<0l-1K KKHl 0R 00h1 X@pIl!_Ÿ 0\A XQ (@K⼐h`@ QKd hYK MOK DA Pa H T `a La KL0@ "00YP lŸ, 0R(K 0#60C S񟗻W1W1T1W1T1W1T1X1T1X1T1W1b0O Po 0FL5!,@ b@P000NK/O?K@PM0@P00PU  ?Q.l1 /0@<0S0@ 0`p@ 0d PpH0S0D0B0@0>0<0:08(ڞiPgDo`=>$Z@@0,0 0C(P 0@0S"PP`00SP +.4 PP x0" 0QP 4cP $0 \]E0 0 }CP DU$0J 0SP-U 20 p ,L0S`9Z ZZ q 0S 3VS-0 0 t  JE0 0 2CP DUP _` Pꈠ @` @ ;庽Doj jp=> [@ -x1LMl1l`*/P\1\A#/P H儾DD K0pP7  pP' 0 0 R  0 00 000 2PK 0 VL0S  , .0孃 0   B . e\D-@@[ ? 01jq,Fo`kDoL[@t[@,@4o p-@ MLTPT` 0DP嫶8 40P@墶KphJ4j|[@(p[@p0  0 0 0S 0-PL@ 0P,Q300p(p -@QLV( 0S00 hR -LM @`0P0Y (0KpPK(0@ 000,1P!( 00 ! 0 & 0!pP $+ 000( 0(+ pP0   +(00 aP aP 0;0$崳*孳Hjo- 0ꈺj p-L M0@P`P dP`Kp p-PL@`L0(0S S0S  phA (ph9v -LM 0P@  0I`P  KL0p( P@ ()/^`P000*0@0 0,0 @ 0`@D`q -@L00PS` 0 0 pU a*_*0  pP0! B!+G* -LMP`V+7*p0!R BpT,*** P 0 0 0 p QpP10C1   k*@10C1 0zp[ -L8M"P0 Qp 0 ;;I,0KpP H嗲 )(K,0 `0 0 0@,00 0  @ 101 0pPNDpKA0 D0 0> K4K L0S `0=@K.0<0K8 62K 0C3K L0S `01K0@ 0 0. 00 K/ K@  ,0@CpP L0  00Q!/;pP 0! B! 01000,[)z000  EpP ,00m oq[@ -`@00LSP\Ap7)L L0R PA,)pU  BpP.0!R# 00 7ApU  mA !0 00 0pP 0! B!H峱ApA  pP o -LhMP @, 0 L L0pR` @,0T (,P(@8*06* (K\ L0R0 0 %*0   P\  AP08h t !R| 00tt 0 o0: S\ X  ),0P`0 hd 0h! !h h0 0iPP Y 0 @Pd0S d@e(`b(\ Rh@ 0000TAPh0! B!h 0K(00S$ f@B(,@()0)00 0 0N 000K  0?i0 .Rd 0@M  |@H  w@C0 0>P 0k@`X 0R^ \T0 Qp SQl  Zd R,'`h HP0 ; ,K rP,0P`0 d dQ d `0Rh0R> G 0>, 0p03R0S+P#0S t0hS 0 0 0t h 0X  0\ 0)\P0Ql0 p T0  0?  0>d0h 0R ` 0   0 R `0R d0Rd0 0: S p0S `h [Pp0TQ00S ` 0! B!`0Z'd@p Q10C1 10C8#8S1k d 0d 000,<'00 0 0N 0K 0PI h@0YL0 e p R`L R"'Y0'([`0h 0RBl R `02!R !`` 000` 0Ph PH l0S `@0! B! 0[pQV(pR` d P d0!R\ Rc +V=B\t9l0SP 010C100000(%&oL@HK! B!00 00 0 0 @0 0@@P60[S#[0R  j  0T  0X 0C0< @ 0 0@@W@[@[@W@ \@[@q..,\@ -LM@ 0PS, `p0s0s0s $0sH0sL0s@0s (KD0s! L0$  0R \P 000 0D0   0000 00l#00D0 R0 0 x L0$ x娀 0 y㬐SX \P0 S R 0000R㨀 0S 0;0Q 0S 0;0p 00S Sq So  0pIP(0s L0$ d 0R ]\P \0y ,0 <Pr00s000(0s L0$  0 0 00(0 0PY`v0 L0$ 2@ 0R *\PI R 00S  O@[P 8  0:0000   40 0L #L0$   jq{0 S [PRMꨀ0j0s6f00sz -LMp0`$KP{0 00$0 00T|!0 000  00 0:#:0 10 00 (0H0 0 ,( 0 40 0 <8 0  D  0000D0 d0@000S;$0 SL084 $0$  0@+P L0  \0T0X@K$  \0 0@\0`@0 j -LM 000 #K p- Px0 @L0 B`P 000Hq0($00`%`p舺jP  ,0S !5%PA-RpP `$(@#00 bR:  Q3a0 R R0d0e S:0e0d  S: R:  aS* 0P-L0 0a00P00a00P0a0 p-LM@P`P  0H 00S  Kp `\@H\@ -LM @T`p5 pP Q*Z  $0( ,@ TP ,Zp Px($0,  \( $0 , 4  $K\@\@\@\@0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S R 0000@00 R P,  R/ 0\00 S 0  0S0S 0P@ 0S@@0  @0@000S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \   R00 \0S0  0S R( ^ 0Sm R 0S 0R00S00 S0 0S    R 00000 \0S0  0SR 0S@0T00 S @0  0 S 0R00S00 S0 0S    R R 0SP0U00 S P0@  0 S@ y -LXp5 PU?P0S`X`V 0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP+ ,,0S "\" R ,0S 0R:\ R0P 0  \/ 00!-P,P ,0 S 0SP 0 S00:S P 0S0SP0SP0S  -L$M`  PZ 4 80  @P,K0pK $ 0@P P @P (K40@$0(0,0l, 00f0eaQ80  P 0S0SP0SP0S PQ00SQ00S -L`p@PPU@V4 0S2 `P, $0(,  0a@PPU@ Q 0( S$0 AP:,00P* DPU@:`P]@D]@h]@<]@ 0-@PLi @ P0pD>> 0-@PLZ0 0 0000Dp>> p-P`L@I @` pp=> 0-@PL : 000 00 0tp=> 0-@PL( @ P0p=> -L(M`eP@H8 <0 6vG @PTS `0K$  0X ! W01,K P@ 0 4 `,@P `@PTV* 40 S 4 j  0L <0`8 ` 8000 D08 0(K80   0800  -L@@@DT@d@ -L(M8 `P (Kyp@4 P* 2P@T% 0S" 0S0$ ,(00 S ! 140,K0K mP ,  @0 0C"0" 8 4 0+$  04S0!0K,K >P0  @0"0C0 p-LP`0((0@ `0 3pp,>> 0- LP@$P .P 0Q0 0P0]@\>> 0-LM @PVP(0$ ΄, P R 0S B^R P5 P8 0ϱ]@p>> - L@P]@>> 0-LM @PP8 0嬱]@>>pDpptpܧp -LM Pp P  t$0(,@ \`,K 0` `P P  (Koq -L$M@  p `nQ4 80  ":RE 0i^ ! \ʠ3hQ1!0l 0PP1Q: K@P `0S:`0V @T (K@ R 0S@(0$ ,00U: R `0V@@0ST PP!@ vP$( ,0  0 R 1S0!,K0KP, 40U@:00U8P80 -LMPQ`p4 0^ 0^,:0^)* 00000 0000@P  K@ 0<P 0@@地 @4^@ -L$Mp4 W80 `PSXppx a@P3 $ (0 U.:,00V,K0K ']@T# ( $0 U:,00VR 1 S0!  $e P X@T (K,40W@:00W8pX080WxpW*Xp -LHMpH L0  D 00 ,P(@4 0dP4`K004`K@K@KࠁS0%5R 0 UP0T@%5 P@ `0f S* P0KU (K@j  DH L0`@ @P -L4MPpU@80 { 0$%Q01Sr:0a bU,0 50 R 10 >0   ``  0, 80P` P(Kf4   40 ,80 PP   0 ,80`P P  4800P, P -L$M` p@ PZf ^ 3: @g `@ PpK 0-@ MLP  0P嬧 0P大 0P圧xx 0P唧` 0TP@勧DD0*0<0 K04j^@p^@p^@Dp^@p^@tp8p=>P,,0 S 0 SP 0 S00:S -L !Q 1S 01 0AS 10 ! 10A0嫮婮0_@P_@ -L !Q0嚮l_@ p-@L !ƌ\`"S  QP P 0 , `p Q0S  0  0 00`pj hf_@_@_@ -@`$0 L0b#6<@ SpTQ&0@ P P+TP\P<@0!PR00R0S0 !P +\ -LP@!ƌ0C  0S0 !hb/_@ -`LVP`PV@p$4 0SPP 00 0A S 10  ! 1 A 00CS0 UX01SZP `FPU -@Lb LP  0R000 00 0 p-"fL@P  00b0fS 0S 000  p嘭喭 `@0`@ -LM@p, ,P0, a@T; 0S"4PU(0 ( 0x,P ,P(K 60A0C0 ( Q 6,00,0 PP  0o7PC, B`@`@X`@R -PL@=PP) $F%6@L0p0!a @ ppf blKPP@ 0 0!E< R$0(0$ (GPpTp -b@LK 0@sbKh2p 0-0L@1$ R(0(0(0  R 0 P 0S P 0PS0!P 0S 0CS0=0PS0000h峬0`@ -P1LXM@`TPpF pTK0K‐K( 0@ , (0$Q\ $ \0K((0$0^X0 $ ^0 !0SU000 0Rp0 P ^0\Q,0@(0,0\QX0(00P0W0X S(KmTp 0-

>8c@c@,c@qhc@\c@Dc@(oPc@ c@PK`P`YP@TJ4(0 i4'4(@<L 0<cP V  PK0ho'(0  !(0 Q-L`pP#*@JV  0P T   @- 6@004@ 5@80<@ 3@ 0$@ 1@(0,@ 06@P0T@p -LM KLkH0#&R*0R*0a"!B10bqqq -0L@TP" Pp` :S0| Q *Q@T ,0" 10Sx0SP@pTV T0 RZ 0 0mT 0`OU 0Uojp 0-@L P0 PL*,LQ0tj -RLP@ = LX  0mk0 0.  . Q! ; -L΂n^P`Up*S N@X Pe"z 0,0 h  hqtj.  . Q : -L(M@ .  ^P U< p#: (K  P e!fV8  @,K , 0S0R*@VX 0 pPP  @TF (18P  14@K0@ 4 0@ `w(P)4 R @Q00000 0J8 4 R|< e<@ >P 808 0$8 E 00`jtjq -@dPN`@ RL @pp .0  @ tj -0LM R' 0+ KK)  : B/8HX0@$ -H 80@$ $H Kvpqqtjjtc@ -L$MD @ Xa 0H#Y*qZp1H`00X80 N J$J>00>0Sp1x# Z00 W0~Sp8  Wz3X@3 8 ,0K @P 0d,S0!D <0 :U`  ,4PK@ 04@ 0P @X l 6Z<0cX@ (Ktj -L M0`SpP6 0SA0SR4KP40 0 $*@,Kd 5P P,!&R*<ܛ0R*0`"!B1 b 0 00  000 JU   6'0 T0S(K06f@b 0`S00b "f ,b$0 ,0S qqqc@dp>00   -L(M@  pDL 4KT4 0 < 0 SRS@ 0 S: 0R  48 \= \: f`,K < 80,  00o0P!4@,pT 8 `,:,0 @T @ `\ 0 8(,:,0 @Th94K&(KHA:b0S 001@ g0S 0Sb4Ks&0C! S, 0 0 0Q @ T00 gea@ 0@ `S  @0RV< "f @0 4K` >&PS c@qdpxpw@q -LPp눀` 0t@a 0R 10 P a#)a*/)tjdp -LPM ra 0RZf 1   a Pqa 0R1   |ahK@h`Kt!p *\0@P0 p{P`1XsaP1 Q 0 hK!PR UdMaZ dEaU1h K@U@PQ x0*1(K0@p  P0 f00 @` P@aVdptj# xpc@ 06`2oqc@ -̡LM a Q 1 R R AR   Q;* 0 1 S0P1* p X00W0S1 $1 hWp 0`$K0!&0@P0 `P?pX(10 0 Q *0h6 0(0  X00W0S X H 10  0 R0 0, S0, S5$Kdp,jtj# 2 -LMP$ Nl@T`p(KT,K, Lh0   P, 0 d p'c@ 0 p-LMP h`K! ̃.' 0@P0 ]PKpp 6 0 -LM\ ~h(K!p@ 00  0@P0 9P4 1W , 0( 0cP`8 0:P@zG`W h 0 #@P(p0x D0pS @/W 00S,(K, ` ,,  afp'tjqc@ -LMp@ `.` $PK @ 0$@ P @-c K -.L M  8  0(Ǩ0!Y# 0@P(0 P0 ,(KZ1P ,0 `0ap`p T1ph  a(RP4K@  0 4@ #P7,P0U/88 ,,0Z0S$ :@`p4@ P00000 0 !(Z0 8$,0Z0S$7 ,8 tjpq -P`pWL @P( (0 o0 1c|0@P`:P@`XW%&* /d&% ( Pp00Cp0c@p -LM>0`~0^p@0P 0` `P @P 0002 T 0 00 0>P  K0 @P唗咗吗''(d@c@Td@ p-LM1P0 @|`|0 h0y  `0R0 P b 0K@P0 P 0`Kp^Cmpq'tjd@ p-PLMP*@`Kp P \0#&R*HA0R*0a"!B10b %JUxqqqd@ 0Q-L@ 00SD00D0p@-x|0@\ !1Q# \ 1!^`#`3P P00Q030" aS P\  Q0#02SQ0#03PQ1!1%ppP 0 S(0$ ,00\1P -L`$@0@PS:0b V@cp V:E f@U>0e S 0SR F@U0P@0F\2 lU" R!0e S9A U R0ST0l0U 0SS1:Q0P@U 00b S9R R0e SYD0S0e SI9@0S,  `0R 1P `0R 1 -@PL`@T `0P 0Q-L@ 00SD00D0h0@-D0DQ 0$@ 0TT0ST0SH H0RL L0RP P0RX X0R 0 00R 040c@P4@PP80S@Q 0S@ R 0S00 0- L@PP D0 0U:$0U#300 0 0 P00P0 Q-&:0@2 8P 0Q:0Q4(0Q*00Q:40Q:<P 0 R 0Q:0Q4^,0Q*LP0Q:0Q4 0 Q:oq$0(0@-@ T0#03 R0SP @1 T#3PQ8Q 0T # 3P R0T # 3S RLQ T0#03P0S T0#03R0S<Q 0T # 3P R0T # 3S R\004T # 3P R0T#3S(P T # 3 Q R,T0#03\0S 0 0oq-$ (,(0 R:,0\3400R:40\34000 -LpPU/ 0S,`@T1 T R& @TP @0 Q 0` {0S0@  0S@@@`mP iPU 0 00p 0 0  R P; X> P@0T 0` @H0S0P  0SPPP`:P 60SP0/0S0p  0SppP@!P0Pp0p 0 0 z0S@00S0p  0TppPP@p -Lp` R 0SPU 0SY0 0`R 0S0S @TP R0 0@ T`@0S0P  0SPP`PP@@ PRi Q 0S R 0S 0R 00  S`00S0@  0S@@@`9R 0S0Q 0@ ~0S0P  0SPPP@pPm@ 0R 00  S`0_0S0@  0S@@@`QPN R 0 00 0@ T`@?0S0P  0SPP`P1P.@y R 0S0P 0@ P0S0P  0SPPP@ P @ ` -pLWP8 @TD@0Sp`W`V p 0Spp U`P@ 0U@@ 0R@@V @@TX  p`W `Vp 0Spp` 0-PLP@" #3Q R  0 S R0P 0  Q@@000 0@0P  SP 0S0#03 P P 0S0SP0SP0S  0- LP@P'$ Q00R03SQ PD0$ T(0, 00\ H00SP 0T00 -PL@p` 0!S8@ T- P $ (0,0 0S*:@@P` $ 0S X:W WP 80P L0P sV@ 5P@ A,P @oq P 0S0SP0SP0S PQ00SQ00S p- P$` UZ3@L<uLp000X\0Z1 -0L @P1h\100 -0@L  @0p3P 000000H1 M-LM4 040` P @xh 10 Sp!z3S0CD  , , K00K0 PPFY`+,PU (0$ 0TI*,Q $ (0g (0R,T:00R4T*P* 0@P@T :,P,  ` h(K0g00T0@ , K00K0 PP  P40`@y z`, ,P `$0T* , ėq 0-0L@P )0P 0  000 .\00000?> -QL M8 <0 4  0Q:$0R, ,(K /4 8 0PZD0 D0$Z(0, 00Q 0ZU Z , D0@000 00 Xk < h P2 Rd $08`Z p1p!Q`!V< @ ( l@@P PU < 00CS0202020202020S]40S0QO jW j$0 Z p1p!0 R <0 L0 D08pl ^0l 0l04P`@p0< 0A, P , P Z 4 _[$0Z p1p!4 U, O4 N0,0 H(0  00S @aB00CS00,0 jd@ - L@T0000Эd@ -L` PP1 .@Y T #pN U $0R P@T,(0, 00,000  0@@ 0-L M 0@RPP x娏0S PK0$0( ,0 0 $ (,@ @勏Эe@4f@df@f@f@g@f@pg@g@g@g@4g@h@pTg@g@ -L M蒟p`$0 , (, 04 0 $0@"Z78\ 0@P4K0<"/P< 0U@ 0L, 0Rr(KP`d pt x| Z )PP 0 $04@ <@\@H0D0L  P0FT0T  XF T F0T0o(0$D @,FTTF T `D0FT T  0lPPmLfDo,h@Dh@hh@h@h@XAHj@Pj@h@i@i@8i@Xi@i@i@j@j@4j@?> 0- L M0 \0\0\ 0d R@P 0xP-h 0`dP@$L 0Dd@(;K0h[pDm4j\j@Ppqdj@oqlj@qq -Z%ZULp`e   @ < @$0X+*@0(PS$@d,P  << D05 0P004 48 ,0S      o(P$$ bP!  b `h0@,408@0 dPtuLe }T$0 -\0L@  Dh8h轁.P((\ P1\@0CP1hOqqoqpp p-0L1PU P`P\@T P10P1\_O0\0T0000p0 P F@P \P 0 @Pd0. d0d0S0>?>>>njj@qqj@ -LMPQ`p,P  t, V3 0@U@2 $(0, 00Q[ TO ,0S(0 S$ :(0` Z, R00S 0@$1 V ,000f,0 `YU , T , wO@ P f0,408@@ `$`( 0 D L H P T X < ,  0Q 0f S :j(0(0oq 0-LM@P P $ ,0PgP8 -L@P`r (P,`0p4m -L Mt@|0(x`Pp!p1PP1P!\  0`K,0 S00S40S -PL@pᤀ=0 0JS`!`1 6PhP ,0T$0( $ R 11S63bS$uioq -LM$0  p-L*"*R@` 0|0 P 0 080<0@0D0H0L00,0(04000 $`l(@d0H00@(P 0 pph( 徉k@8pk@ -L`p PP'` 0@ -@QLP`p @0S@0A0 0P0@ -LMp ,@Pጀ 0`0 KPpq -L MPpU0@`0 U (0$ ,0 0S HPP / $(000 ,,  "H  00\ 0@0 U   0 , 0 0 $(K $ X00R0S@ -LP`p  < @  U O  0i| p-PL`@ 0phn S-LpQ 0$ Q`!`1\ P1P!V: @P $0V* 0V  0  X@P 0U$0U*  S-LpQ 0$ Q`!`1\ P1P!V: $0@V$* 0VTP@P 0U $0U* xP@P  E@ -LM$P\@`p:\: 0Q:R*@ > K]P@   0T$0V :Q 0S @  /   $0S00S@0SD0 0D0 @0p  48 000 -. ^NP@LMU`P@O 0U@3K:$0TG0P $pU@*D0=P 0T C 0TAD0;$T,0( 00S1 P$0T'Z, T0S 0UHT0S $0T<: 0@S@@$K@  @ T0S 0U T0S $0T : 0u@ } x O J -QLM` 0$ Q!1\ P1P!Z#:  D ]$0@ZlTv 0U  U$0R D0[L00S^vP 0U Y10SX Z:U?:0SH   L`H H`R D0T0ST0 $ 0 T p00V00S4A@P) U&$R D00HpSW Z $U* !@ - L0S $ 0P  -L M`$ Rp1 p!Q@!@1T00 :(K $0PS  Y RO 0TO0U,0 : 0W7y3'D0 0S,P  0@ 00S$ D0$0  0a c , K00X 0PW $ R 00S W* ayD0 $ h@3@`h@P ' -LM<0 $`8 ( 4 ,0\p 00 ^ <0P 0,0 @0408@ DPTPq -LMRP4 0 `P p 0@00 S P(K@ :#:S (, d  Q 00S Pt00@T Uf,&nj,  0, 0 4 0 PPCX 0 _00W P2 H40#&Rz\ 004 4 60Rn:40 0@PP 400 4  RT#00,0@7`p ,0 40 Ƞ, T 0,@Ȍ, `p0& 0 z0@0 O000 dc 0Px4 0  M@P0r Ux40   <0@_ 00SP P> 0:400 v P30,@ >0>009p -LM ʠ,ʠ\ 0R lR >0. R 0^  0P  0-LM@ʠ,ʠ\ 0^+ @l^ >0^ 0T.Ơ0 H R P 4d 6R0  0iP 88`0S*#8p -L & -LQ 0 0 ` P P0#00@-@ʠ,ʠ\  0R lR >0. R 0^ T~2~2~24~2<~2}2~2  0@6  0@+  0@(-0 " 0S  ʠS,ʠ\ 0R lR >0. R 0Q  0 0@-@ʠ,ʠ\  0R lR >0. R 0^  0@ -LM ^0 ʠ,ʠ\ 0R lR >0. R 0Q  06 -LM@ ʠ,ʠ\ 0R @lR >0. R 0T`V0TK p l 0P $PK0@ $@ P @ ~ -LM00  0 0 , SpP 0 ed`Va0`0S0 Z > SW UU )YN>0^PUK  i:#:SD0QA0S>x3Q;,  C r  p0 h0 6@ Q 0@T; p@@0 `,K0.@P,000 R  JZ x 0U@(K 0@pW P P @  0S  @S @$ 00SS@@ S R1S``/ 0 5  @ S S x0 P:00 z 0u  S0`  XʽW@ k 0K0 @P 0L 0S 0 @ kj 0CZ p@ 똠 p0 S -L,MH T H P :#:S0D >0 Z< * p0 8 40 \8 dP L 4 S TD8 0P4 H4 P`P , KPq ,P. 0< R*L90,<$ QS` 0R]:D0<Y!0000 ( 0 0 0 R" Y0 Y0,P,  0<Q PH T8 'LD8 L4(K@ Y@  Y@ 0R0 , < aP 0S0000S 0S,00 @4` @dP aP00 PH T8  040 4 -LM`@00 SpP (K 00Q, KPP00@0S 0 0K PP000, R 00CS 0,0,0 00@SP 0 0 00 M-LM0Z,  (KYzpP` ,:p@ Q P`ZY M-LlM00S@#vzD0 | x0 p XKl`Kt p 0]0@ ,0 0  0 0 0, K0 tK0 Px F,Q *@@R (0 (G , @RRP@ZP  000000  ,@Q, 0OpW0 6OtK Xt p 0ʡWp@t0 K@Qx(K0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0- @0 S0 UTR p-@LTP `P`@ @T@p 0-@LPT P@ @T0 p-@LT`P@P  R0T 0@ PP P@p0@0@ @P -LTM@ < `K Kp@-d0 P0U#F"``@ 0T !P01Rb`0^pjqq 0-00LS@(0P PR0 00 0  (p00C0(0 00 0000000  R 000( W00C0 R 0  0 pp 0-@PL(<0h -@L(1h -(0L@ & R4 000(  00C000S(0 R0000 0| 00  0@@ RH0 0 ($ $00000 pp -00L0CS00@008@0 (000 00C 0pp 0-L@\ $0X(P 0hQ(PA (P A000A 0-(0L@ R 000  0( 00C0(0&0   @@(Po`0   v(0 D0 0hn00  @ @pp -L$MŸ`@0@VPU8 4 <0 /<0@PPOTF` 1@ ?S,) Z 0s ,0 S(0 SH1H!D0QBP`0@K  0 @0 ,@ PP @(KR0D0Q Po0RO 0@VU?0@< 8 K (P$IV 00 QS\opoqp8po -prL@T]`2$ RXX0S ^> 0\  \*RA 60 0 0 R0 < \*Q0C"!B60 0A0C Q0 T: `D^` 21C@PDP LV@4Q 0 Sࠃ$  $0 \:^tT `DV` 21C@PDP #V@ʮtA 60 0S00T `D^`"<0!B@PDP V@jpqqqq$l@Pl@ -LhP \0*0  0P 0@ 0P tptl@ -LM08 40  0P, 0 <0 @  2 b pǏ 0Q R @_<0@TPOTM>(0\ʰqQ D0R A0R @0 U D0R 0R d  (0RPA :#:S @ Ks441Z L`*fR40,#V00 C PN[<@@$F 8!"&0P(Ko 0@ ?SʭRD0Q pǏ0RO 0@XʚW(KS\opo8pqpol@l@ -LM0.`p,@K 0@(@  , =,@T P000(H3 R000(0  0  0 f,@PT$K`j - LM r 0S0x,0 @ `0 PpT0 `pr0 0,  S, r(Korjl@qq(m@Lm@Xm@ -LM,a0PS  A* pW$ >0n`0gV@P0U,>0 N@ U $`KP% $J GU]0>0 0U #s!sjn noqq`m@m@m@ -"LMŸ0 @0, 嬒 0 @@:R^ pt 0b\0L"6!v21C!@cw P0SR  0`cW@"#s:21CcT E V P0& PƠʌ008 , @00D  H00L  P 0^:0^H! 00 0PUT0  c21CclH0S 0pf`cV@* P 0, >0>00 00>0090| 0P0X0 $  0, @ (00`\0T(XL(Kg0dr,brpjqq5qqpnHp nj n@m@ -LMt4 \80 P 4Z*L"`Vm V80S (0 SQ21C  4 80 0000(K 4 pj21C! c0 0 @P4 W,@ W ` VZ%&0RP08P@0D0H0L0 :8RYE (m000`VT@Y) 021C, T B 4 80 0,p4  (Kopp40@P 00pt(Kop j21Cc, 80hf<q8q,qpjqqtjo@Ho@|n@n@n@\n@4n@do@ -@LPP`p k(00C0, 0 0, U ,00,0 `$pP'( 000 p-(L`P4@ Th (@:00C0, 0 0, pTG(`A AR0 10 0  00C0( I RN 000 00C000S 0  00C 0 R 000 $0S0 (p0S (0``p(`00C0, ( @, R 0  0 ppy@j -QL&P`  pW& o(0T`VP @0Ds(0 E;(0 (`@VP !(2) -LMP0KS4 0P , :  .0 P0@T( 6P` P ` 4T000pH( R000,0  0  04"0@T(K_po@ 0-L0LP@L0}70 0P Ed0 $0dE@d:0h\7ȹ2Hp -L`\p@PP P W, (0(0  R (cP\@(: (0x R(0(0   0p  !   -LM00 pP@, 0 \     0 ,0  , 00 Vz 0 A,0p0 0X1 0,@0t03TT/ 00w03 R0S ̠PxP3`W`, 00X (0T 0' T.UV(K0 ,@0t03TTS   00 0w03R0S , 00' 0$# tT U 0  ,0p0 0 00  -L(MH L0 80K@0L0p 00K@ ,0 PS0 , 40 Sʔ 0K80K 0S @PoD#Q {x L 0 0S @#6:1Y<   *0D @0 L@DK P`P`Y ,0S<Y< 1@D0 @@ 40SE < R p(K5 H @P (    Q (pC( (p< 0S ZY0@*A0DKP0`0D0 (p200S 80SPL`0`0j00`Sf*a80@SfP`8P 4` a -`LPp@T6U#:0`V @@d5$H04$ 00 F$080S |h{5@l0w5TX0&h<50d#8 # 8V rq,rqrqtj 0-,P& L@W0hq -LDM008 ;pBf 40S0l0 00V70#4@hKH0@THl P0)R@(0@l  R00 S (r@(}PU@ Z0 ( dHhKY 00 P* d(Kdo -0@Ltj -LMp 4aP U 0P 0S U@ P4# @TPU@$  09`P0S U@`0` D0@Q@P404$04 84rq rqo@qp -LM`@P V 0p @ZUJ 08 L0pGP  ,#$v o q 0-PLqDX4@0` 8Pd `@0@0S T0 rqrqpj0@-dd ,\O 0C2dS03S<0<<0!R?CQ@00@0,0dH00pVUUU - LM p0X0XW 4 5 S; 6&0PQ0 P`@ R 00R0SE 10 1D `(0 R  010010X0XW(KW  X_ 4 0S0S0K,0 000 \褟`p4@, K00KP @P4p@T X* (06(P(0 #T`^ TV (00`8!00 0X8!0 (0 ```@@ @`604 S0K,0 000 c!40(0C40(0u$1 0$1(@00  p00p01Y0100`,10,1Q0@ 0SRJ+ h p0Si l0RO (00 000Y| PlW0@Y Y1( K0 00' @ 0(10(1(c0004AtK@P`, , K00K4A0 P``@.00  0$#0 @  0P:)(00 .P0F0T0   4K4 pP  @`00 0$#(@ 0$#~L0  (@\oop -LM肟0rPo!0PU` V0P!@ 0eSB101T1Q d0Sop>P1L2d R@D0^`@ ",0 lh0Qr 2PU> 0O Q ,R0jaZ``X@@0 *W( Z``X@@P ( p0S; T  0P( V <1W0J<1 0$# P (lHPP 00(Y( H40(0C40A( p0Q  \ Rno\opoppp -0LMp ԀL `1``V  06``V 0I`0d1008 0B6C0 PD/@.U`<1,04@Z04(D1qppHp@p@p8pp -3LM D . P.. 0K?Wi @1 ,0R0S4W 0T00000 0R0T000<0 0 44H14P(X1"8p@Wm 0 00, 0 71 AQ4 0!@?CSD00D0W0 #0/Q R 0O0S@PoV0l0a0KսW,!,0 ȟ00X@T@0@PoPU`Q- D0Po0Q RO 0@Vm@mUi@iU`0l0a@\0 p518p0W1800 ,@ PNqpppVUUU\ooo@xj 0-d0LM\ D0@QP D0@400/0P58$h 0 Qqpp8ppo@B( 0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R 00000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S0SP0SP 0S  P 0S 0SP 0SP0S PQ0 0SQ0 0S0@-P@< R( @0S%<4\ ) \ @^ 4\@ 804@0\<<0 S@ 8<0 < 40S48<< 4R 0@000@@0@0@8 R @P, 8 R/ 80\<@0<0 S@ 4<0 < 40S48<880S< <40P<@ <40S4@8@0<8  @0@@0@0@40S<80<0S<0@ <40\4@8@4<  @40@-4 R @0S8^ @0Sk<0 @0R @0SI0SD 4\  @ R0@08@ \<<04S<0 < 40S484<88@ R( 4^ @0Sm8 R @0S @0R@040@@S<80<0 S<0 <40S4 8 < 4 R 0@000@04@ \<<08S<0 < 40S488<4R @0S4@0T<@0<0 S@ 8@<0 < 40 S484<44 @0R@080@@S<40<0 S<0 <40S4 8 < 8 R8 R @0S8P0U<@0<0 S@ 4P<0@ < 40 S488<@88 y -4LXp5 8PU?P40S8<`X<`V@ 40S4844<@< W`RP 40W4P8P8 40RTP! @TV p80 #R 0Q:p '88 880 a0lS`1@P11TV@808 V0b#6P  Q00,000Q KpG0C0C+2@P+06D0GKL4  0C@PD p$ t4 xt Hd 3@P0d0CS(3333333@00Sx0! @\ `DPPV  gIP@ 0B@@P\ @$\P 00@00Sx00 0000S1  :0\  $0ᬮP@P 00Sh \\@P-\@8U0 cDojrqpdkx@> v@ p-`QLP@@Tp -LMp`0@,P@f{TK0$@K0@ $ @ `PV@P$(⾸P R000 0  U @pp`j -70#L0`M)x0 000p  t P| D W0X$80 S+:S %0 80 S :SQx t`Q$ LPU$X |lKi@ lK ptQ  PS|@(K@P3P#D0Qx0S,#t0  0OF*p#J 6|Z0 2"`,0 Hp``d뼂@` 6Q<080 t0SM d2d"D0h2\@0`"000 @  Pp |; @0`1 l00l0x0S0 k |Pp@`*`(׷VZJ|(0Kp#  p倀| K 00x;@@P00 6|ZpW$`Yj Z *v|0`S0S PfX\J(8Z p|lK|Z `jdoqpHo!Ce,Fo@ (2 -L`@Mt0q0 t0  p<09L KpPPp0 0p0p00  -L M0 S0d @\0!@@@t@0P  0x@=Lh d0@5LKhD0<P 0S,S,ForqpPv@rq|v@0rqv@rqj v@Xv@0@- x0Sl061cQ*0!a"400@_#& U l0T -LM pP `i@P; @1R @P3 <` H0 ,0 ( D0-H0 0 R 0R 8 $0r40 $000 S100 x0R :l061cR80 58 00R*0(0  < KP $K#SPjv@ -LHMH T0 D L P 㴀p(`@P00pH @1R @@T D@ D0H0 0 R 2R `$vD P#x0Và3:D@l061cV`1P T @f<,4R <̠(Č"Č!̌04 ,@ P@HL4 K0`  @PP@T,0@0@p<0 8@ 0OpH101,<@K0Z `h@P0  0 P@H L0@cP fZ,00D p<KTp000@@Tt (KoRPjv@ -LM0 p>0nt`Q70 a@P$0S, d060>0. V  b 0 K@P0 eP  ahQ K f 0d 0f#&Bd 0S* 0d 0c#&d v@ P-0L R.  . hRv@ 00 0 -L,M0T P ` Zf @<0x"0%0S[ R@@ T\ p 3ZPJ 0R00}T0 0@0@T0 B? 0!@00KP0 0 H` Dp < , L 80 @ 4 V 0S.0 PK0 O0@@. T@ 0X0X0Sb@( TN0 0C0 S/ T(K" Sf0 PK0 10@@0 Y Z00R0S ` z0S| 4@P  T{w@q -LM> -L M@H \?pP` 0 \p:@P`0s P,  (0  X 0  0\00 p0\P P(K(p,000P0\`p \:@`pPUY   U  R(,  (0 ;0!,PU (*,PP 0 P R, PPU ,K 0PPP ,@(,!,000, (0  , (,w@ w@ -0LS0S\pPxpD0 0@`,PXW w@ M-LM 0  0 0U@` | x t 0 |t\7zx0KpP` P(㨳:@p Q P`|@T 0x@K0`@ P P,0 P ` KP a ( a  D0(@i( { @V 0Ql :PK`@P|`\P ` \ Q 0S @0000$ 0S0 =0(KS`p00 @P`@P |` VPK`P`0xP t` ڀ0 |@ 0q|tP  (  0 S0@0   (0"PK`2@P`P ` PsX 0 S0pK p`K, K0 ,` 0 xPK``PK` P`gP   Բ`Vm 0^\ ,0Pq (0S(@ᾲ㬲G @ 0Q# 000^0 =ڐ,0Pq0 S@ 0R01 R00 ( 0(@ㆲ \0Ux QQ`VBq0!yj TMPM@   M0pKj x@R,w@Dw@Pw@w@ -LM0`p @0U `p KT0 Z 0-LM0@. 00H00 0 PE0S P0000| 0S 0 Sj00    Q$0$0$000 K0K0hqNw@w@ 0-LM 0@C^ 940 0P405  0   0 S 0 " P0  0 0S    R$0$0$0  0 0K0h+K00 K0hw@ p-LMP8414a@0TH=L0S @T U0 0S3 0 0 R(0( 0@ @T@T|(@T 01 P 0S0  Q$0$0$ 0<0`(@TKphEᱴ 0sqsqsq -0LpWP  `0V0 蚴 04@0 0 6 (q -LpMp 008"00\{  0SQ 0 0 0  0S 0  0$0p0$<0@60\0< !0K  P"pPK`t !000P`@P0 80S 0  0$0p0$<0,  0 0@0 K 0x0  40  L( K0 P$0P0( @(`0 @Qd&x , 21C0Q@xx@sqqjjhd0 sqsqx@ RQ-L P P00S00S0P00Lx@ RQ-L P00 P00S00L@x@ p-`PL@ Pu00P30@ p p-`PL@ Pu00P30,@ p -L0M`PV, pX 0S , 0 R(K0S P HK0FVSD0  T L0 (8#"xuT2@0P0 Z l0` ' T R ,0S00SD 0L00^00S @0S p0:0S\  3uP@0S W 3S @@0S<0S80S40SX 3SXQ PX @,@K uP @40S80SH0S 40X tP 0Sz0S0Stg@Kt0XVpX },@K tP -A>@> -LM@`= 0 7, l09 r P eAq喏ყ`PUPEY10C8#8S1USS:A 0ᆜP04,$D X,0@IP C78 0,0 l0 1!08!x#W4@X)PUPE 108#8W1X*qA 0LP04,$D p,0@P UPE1(Kq,0, @W sqjjjj -LM@`d2P< P,0 E 3SD,0SA00S>40S;80S89 0 Qy 0@S.0S/+p 0P" R㲀 0S0s 0S! R 0SI  0 P 0 1(K 0 000  0, X,  (Ko04(4 S:0 0ApP @0 ,00 ,较U0S0S P ,ꨒqsq -L4M⠢ 0 ( L H S@"0S/0Sr 0S 0S0si ,0,`Sg DKDPKqQ- 0`SࠑQ R0  R 0SQ0S0 P0S0 P Q 0S 0S Q1@-0\\ 0S Q @ 0 0R 0 0^@0 0n\ \ R 0S0S 00S0 \ A-000`00#"B@Pp0W60S3V:00:00p`V@ W 0TS 0T#"` 0T0  0TV#"P 0T@0 :0 000E0TSpV:0000  :PjnA>0  2  0 2P0 0  %d0S A0AS-0Qx"R 5Ph  h P01:0S S*S P P1:0S RࠁQ^$00Q$jj -@LI   h 0-|PL @R 0S0S R 60 0@0 S00 00n 0- LP @  "S00 00 -LM@5@0T0 @T 0 R0 KNW@T p-L M`0@P$K 0 bT  0R& KphG%qT00  \a00 PQ K0 S  0RKp"  DoA>hx@@>@> R-L@p`pGR00Q pP /.00 S 0bS1 RSx@ -0LS@ 0P P S T pPP P0P P PPA> -@L@Pԑ -LM`pV 43PU,P  0 , PUD 81S@T@T@T 0S,0S 0iSk PJj \2 R ,0  0\0 P0Sjd V;0 0n,@ ,0S3 ,  0S9  0@hl*P hl* Z 0@hl+P hl+, 0 0@+P +,(K 0@*P *1@P ) 0@)P ) PZ,0 E,` \PmʗPV 0 0bSPPYXVV Q y$jjqx@ 0-@LTP@T Q 0S oP0 -L M0@PK8a@p$0 o8K0 @0K?K@&P 4 00S 80S0C80$ 0R K<0S80S0C80F%C%Do@> -LIMp0P 0  0`0CS 0 M  0R(KD R000 P 0S0C 0 K>o@0 JK01K/!K-K,6/$CDo2i @> -@LP6 -h0L@T@T 0S P R0600 hn -LJMpH0,0  0P 0P 0S 0S+ P,6 Pq 0 0@PT 0S `V% @T6P 100Pl, 0RN(KPUPU  nP 00 0P @ 0 0 0R 0OK0⠀0nqMKW0<1K0C;aK0 S/KP R0600 z 0S0C 0 Pg P/$D P[ P700Do1i @> p-P`L@ 6 0PP700  POP@ p6CP - L@T 0S 0S( @T1PU<PU9 0R@T p 00 R 0@V @p@ ` 0S0C 0#PU p 00 0@0S00PVPpP ` 0S0C 0#Dny@ p-PL@} ` U00 0S! U000S @ Q @ \00CS\0 00 0S0C 0 pht#(C\ aDꨒq(y@Ty@ -1LM 0HK, h0 QmAdKm@K\K⬐K`p DG`KHpKc`KdpKm \1X  |0 0dK 8  h0K%PP 1X0A@ 0PDX h0S  .X h 800C80, 0R"(Kh0S @ Q 0S0C 0 0h 0 0@h 80S080h#" h.DDoA>PA>y@y@y@@> p-0L@`T P0 mPPUʜ@TU p #P 40 <0% 800C80phPꨒq p-LM@ PlO0 `0S R Q000 Rxh z'`P000 0f 00`{Cy@ 0- 0LP8!e#@P 40 800C800<0% 800C8000h -@LP1 pR 0S 0S RQd0S `vl0$0P X5S1S  `P \`005Sa0S &`P000 i 4 -LMtP0UPp, 0 `z 5`0H0SqVSm HPHPgH@K,I-0S p t0SVRm8 RVN H0S |0SM|HG0[S hq@(00000q (00000 GP 4d00d 7 0 @Z@fG0[S@0[S?0[0S[P %04"48#P , 0R~(KP 07 Ru00 Z V  000(0 6()  5 p0`000|00 `R 0S` hSEFzP005S3rP d0 gQ-0S S /  B<@Kh %04"43KWDoj jqz@A>z@A>pA> [o [o`A>(z@{@@{@xz@ -LlM`S, p@ 7#QP 7Q 47Q 7QUB  DP, 0R(K7Q0CQ*0CQ d7T,0CT*P7T 0T&8L@-P,7Q $7Q7Q 0Q7T 0T/Z !6R/PU&P6T 6T5 1CT4 1CT/ 6Tb0CTC*U1CT@ x6T< ,0T9 X6TI0CTX:Z @6T 46T 6T 1S  P-PU  0Py|Pq5T :50SQ 0S0S 00S GD"@5T $0CT 5T0CT*"0CTM1CT n4Ts 4TP74T 0TUm ZO p 4  R:p |4  R:qL$00000q,$00P0P00 4T . 0CTS 0Tj r 10aR001#050%p9 10bP001#P3P#050%1P,3Tn 0Tk 0CT.gD3T~ 0T;@yhx2.P3T 0T*5`=P o$P(10P0d0lh@ P@UP K`P?h ` YP4K` Kd@K|KK0P 00 P@0[d 0@0K@["tp0  K@ KT0 P JTP + 0S00 \00\0 V$>O@gx2 &PDP %04"48#P R 5R00K K|WP0S>P$$ %04"40DoliHLi0Ni0WiHPi iildiH{@Ji(KiUii eiHi"i ix%i i Mi > A>Ii i Qi jRi Si !i |@ -LMM$0YZ,0 0T X1  4Q 1CQ 1CQ -d, 0R(K0  0Sq0Sn1SSj1SSf Rc3Xb 1CX_ 1CX0I P P@QN@0`SI0SFpKxWg  Vg KRg@T00   1FSK00KTp X 0_ p\`K /g\P<0X@P80T@40P00  \P X@ T P gPP  ~<@Kg0)P2X  \Kg P! pWIpWF 0SP1S L`K fLP<0H@P80D@40@00 \K LP H@ D @ fP|1X3 S_Kxf  f(OK( f5 NK`` f|| fT X 01!KfT00   `NKf(( f5 `F` f00`m=FfpKx`f  fK |f.Doiixii ,A>,|@ -LhM蒟0,0 FPT @0ShT`V`W p0S0S 00S, `W*HPKF>f5,@@KD#D8!0H0KGKCKPP <`VU , 0Rp(K R000 P0&5 0S0C 0 p V00 0S0C 0 0S> V00 0S0C 0( 8!@P PKDe40\0 r@|00 儠 删 8 0@KDe40\0 0 0  8r 00 R  0 n<DopA>qjT|@B> -LMq q3Q^$ `$ 0R^ K\_0S\ .SZ ^ 0  PM .PK P 0   0 a?R0a 0tPK0Kf0[ K T At [R A0BS 00 R@KX\e Kd [4PK_Ke00 <0 %04"4  0 =eQ 0 a0DoB> -LlMp@K0`X 0 #eh0 `0PK)f e0 000#0 QK !Do [o [o$B> -LM 0夐K0 x,0 d eT@KpPK`K@p0   pK哀K\pK[KxpKwK40 00 @ PL, 0R (K<0 R 0  z;DoPA>A>j||@ -L@\\ 0SQ  R dPGPp P %P P P UP#P P GPUU` rdP  ldP U U00 0  00  0 00  00#0  Zd  DdPjj -LM@pPPa0S4$KT P X1@T T tP08@TP;`0S 0 :`0S 000 :0 :0S 0 @ P `p tP@ P`p:8`0S 0004 :0$9j$jP}@|@|@}@$}@}@ -"LM0PAK @0x,0 c  rd5%#00KH2 >K4 KK 0 _ r`K 0 0K K唀 吀 ;@  MZX @P 5d0S 0 000匀K`}cP d@KKK4K0 0Q0@0[A0@0K@ [ @ KP T OP , 0 R&(K KP 0 R t9 R/Z80 R 0 $9DDoA>j}@}@TB> p-LM4ad 0R@0 P *h0 S*1 R 0 9 0R&Kp0BSh0 S:^d0S 58J0 R 0 9|0 R fP LH,KPP DojP~@~@jlB>PA> -@L`0000#0 -LM`\@pe:,Kb<,$!$P(,, %pK0SpA SK 0p 000 00 00Rp' R/ 1p"[2[[0[0!0000 0!00VTP 0T* 0S @T`00V00S 0 0dS1!Q00Spa @Q"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0`0W0VWx \ p  W 1 1Q00Spb 8#8%P @ @0TA @Q"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0 8#8%XU\EPEJ0PPZX( 8#8%8S*1 P9  P 05 00S S R P RM ("(04"4 8#PAe Q <@ 1^P R <0S@00y100Do jj|B> -LM`@ 0R0% ::PH 0 0QR0%p A:W= PEU@ R0 U00UR   bp% 0PcU@0@P  r` (0KnfP ( 0R:0PD (0K\fP ( 0R0%p *4qK@0 sq -PLU%@׵ ӵ0 ~PU `\0 00 pW `PUPQ0 D00  0 00b0v 00C0sqsqsq 0- 0RL@ * 6aPP ] `070 V] 0 0C 0 0 -|pL0Sd`004P LP 0 0@ 0$@|P00hnsqq -LT0DqS00 PU 90P0C0S90a(0 0@(0,@JUԀP 0R*0S`0 R 00 0@004@ 0- 0R:\Pv00P 80S0C8000 onsqqjsqq -LTMt | x 0tx ,0 P 0` Sp A:W) P@K0$|0 \0| @KG0KHKʹ n PP`  @0S 0`0  80S0C80P0P0  0$0b`@Tx2 0 0@0@d[\ , 0R(K T0KdP T 0R0%p * A3pP-l P(l,0 P00S0U\0 @X@ 000PC\l @  hl0 cX@\0D U  \P  04 8<0 h$,!d Q   048l@ <,<$"* <4#:Q  0q03R0S l@\ b @0T 0TPQ 0 00dS R000 a^l@TlH00 O0@ 0$@l ȟQl@00p00l0 l@00 0b08(00C0`P x" 00@0@ 00@' 0$@^G"00zW `0 0A00@`d'Q0@ x2@0x x| 0,("(04"48#8p0 * (h0 0@` h0l@R x2@0  x@P"4e  0`P x2P0SD&0086Q6 Qy 60Sl0 ClPl >  0l@484 <S  ZP| ZPh p Rl@00J,0 8 l0 p@,$8 j#8Qd0 (K0 0S0J v 00T^ 4 Rğğ0R&0<0 0PP lP 00Sl@l 00@@ P 048jQ@-; Q! Q `0 0@`0d@Q" Q(0 0@(0,@X0 0@X0\@R^ RS R@0 0@@0D@R갲33h3D3 3R00 0@004@R80 0@80<@ 0 0@ 0$@0 0@0@0 0@0@0 0@0 @ 0@P0 0@P0T@H0 0@H0L@} -L MQ@ KP 0@S P*0P P@0 @Kh00 KhS@ALaL 0RS00L S0SA Na0NRS00N ST` ALaL0QS0L P`0 P-\QPNN0`@T Z0.SP P00S U* , , 00 Rl,0S 00,0 S`00c 0aY] -L -QLM@PpU UTP0 SRL00SSHDXE,p LYA@> ;` ?T4?R2T0HP4 R0I\/ T& R$ T"0X0Y`P KUP,0pcXj Y X`Y@   /UP X0j S -L M0(  @ $(,L<4,4"| W@P( 0Ri$K1T+ 10SPD@KU0 C0KD K<`K0S7 (nP 4080S0C80?1@T @T00ST0X0W*< x20Sh  h S*S0@P Xp00S0 $!$#KS0S S:0{ Do8j0jj4jqB> -LM@P5`2p/$@0 pF*Knt@ -&LM0`,0 0 @@H@@$@@@jjس3h@' -LtMş/R 0 , pU 00 S0% :Pe   ` P 3V *+Vk ,V V& 0R0% :PN 3V000011`PP 0@S0% :P; 0$4 R`P<V 0Z0#X( dKhR0 S0d0Kc K \@K L dK0P 4 RT 0 l0KZPp3@P $(ß, 0R(K 0R0%@ ,:T 0 0Ra`P|0S 0S0% :P 0 @2  0 l0KZP l 00R6:0S l0KZP l 0R':0@ l0KZP l 0R:0_ l0KpZP l 0R :0=l 00R0% \*(@@KHKQ0 H0KGK 0 HK 0~@P_ 048<:Q0  D0 0HKSp 删 P x  匀 p`K 0 21C0 !100SR dK KK;(2\@K  B⩩0 $(, <4!4" -L@M0'T,0  t9 RSX, 0RP(K(Tu 0/Sn :0 000 (0(0 0@XK QP` PKW`KXPK3 XK) 0XKt@KPlKs`KtPK  0@8@T 0 PP0N @T<0[SA @K$P0K (0XK s@P 80S0C80T17 R PKX 0n'~PK0( R(D8Q 0/S0XPq ( Px ǟG(0@P'`;0[0S1@ @ 巨` 0: 0000@Sx26   ( (0A@:@ 401K<1 0@ P 0S) x" 00@0@0S x2 0B0 @0@\ $333|3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3L3D3 333d3,3333L30WP0S| x" 00@0@q0Sn x" 00@0@c0S` x" 00@0@U0SR x" 00@0@G0SD x" 00@0@90S6 x" B?0@1 A+0S( x" <0@1A0S x" 00@0@0S x" 00@0@0S x" 00@0@0S x" 00@0@0S x" 00@0@0S x" 00@0@0S x" 00@0@0S0S x" 00@0@ Dojql@L@@tjB> -0#L0M0,0 P0T0 0L0 R0% :Zy HKNT0 H0KG KbX HK @T p@TH l0  v0:S,0S00S_ T , NP0S 0Sk X {NPQ 0"0 # Wd !0SP] l 10Sf N@HK L0ePI PLPF PDWF l h10S L K N@HK L0jePPLPP, 0R8(K40S80S @Z P0KVP P 0R0% d*%$0S(0S @Z0L0 pjPT0@PP PT  L K Dotqʚ;K@qC> -LMR8 <0  08$0 P 4 p`U @T@T 0 R0&0   @WpTYL 0&W00SX P`S00S0 @ P@= P7 P0  0 0  < R1Q0,0  !0Q0,0   b <4!4"<,0  ,K M  M00S <040C<0 4 P00  0   8 04<#$ 04(K100S  0 4 00 0Po4 j$j -L M4 000 0SJPH 0 ,1`VC @T= p,p @T 0 RZ0P RP& P' P  0   @pT,0S`V p(K000P BLP0,0 +P    pp40`$j -L,MPş 0  S0, L0 @P` D:X( @T@ HK@@KL0 TG0KHKLHK(P| 0 $(f"pAZ X3X3330S* Sp JO@l, 0R(K0SWp`ZO Z* Z y333<3 P0K0UP P 0R:0R W0  YN@0[S S T qLPH`Kp |3  0L K28` VkDO@Py  NPVD V:NN@2  <`@0[S?0[0Sz2 P@P 0S 0S 0R0%0"` :V  0P Np~p<`8` ;%O1 ` `( L0(` LZ 333p300 00880!000 P 0S0 00s00|N18 00 L0L 8 0000PK4 P0 K0000W`p 4?0[0S:17 0S%04"43K/?0[0S S)  P0KDoj [o [oC>K@ -L M@ ,  `0Rpf x" 0@,W8-P>`0@ 8$H0S x2  ,M (K 0 S4`  K:XY @,: 0<@ PP. ̟! !=0@@8DH@Ti JTe T TL,P x2@0  <@T^3333$3; R+P(8,H`0@(8,H,0S 00KSP 0 0R0% *d !, L;@P $(T5 Ty 3:T T ; R, 0#Px@0,Ks,00S x2@08 8< <@T l 8H 0@8H<\W0 >0@*084HTV T,P x2@0( (, <@T[ :T,,,0SO x2 00@0@, ,, @ 0$*!PT,00S x2@0  W}T :0DSivT:WT ,0S x2@0x x| ,\(0O@P X,00S x" @00@@0D@<0S]F,0S; x2@00 04 ,.,00S x2@0h hl <@T9'WF,X'0ZOP s,00S x2@0` `d <@TW),&0=OP  z0,00S x2@0H HL <@T,t&0!OPM  >,00S x2@0P PT <@TW,%0OPZ  <50S W W,%0NP PP x5 8X,#0NpP 1 0Y 8p SKP8 8 Q PQA80 @@AQPQ8@1<@008( @ PH H80 0 0f(00 nI80( 4 p~0(0<@@"p8X`0@84 4$D8X 0@ 8$H$sqj@K@ 0-PL @R 0S0S R  ?P @0$ S00 00j @ -L$0,0 '0j8jj@j -QLM# @P`p, ( @P 5", K  pf`0, K $K -`Ly4ly0@!0c48fy0!0c4<ay0P 0c4DZy0 0c4C@@D0@ 00Q0 00Q DXyP@10 R d0H, 00 S0 L 0C # 0 wpPPqP@ꫪ j -, 0LRP"* L0Sy, 0S*4@pD`@` Q@X4<0,0 H8@K00 sx, 0S:j, j -LDj(Q0( ,S  3S001 001 R0P 0-L MQ090L+S+404044444444444484444T4444444444444444444444444t41\0 0K0-0 K0ht0 K0hX0 K0hT,,0 PK0hj@@B>sqqx -L8Mlr@PP$ ` 1$ 0R KQ<R444444444444444444444444444444444444444444444444444@44444444440Q:N0K FVN0[0M0[ 01PڢQ: V0KF%[00SVV0[0(Q:L0K( FVF0[00Q:N0K FVN0[0M0[ 01Prp Do(C>P@ p-PSLMPK0C`@0%T  @0FPx@x -LM p0@4(`bV`!3T (P  1T +T (KZP*0V':.0K vF,0[S! -0[.@[01PY3T0V:*0K aF3T)0[)0[1001*@[PP<T000 -LM"0K@ pBF3T!0[!0[00QQHPU@; gG1` T ` `eEU* 0 F PF@ -L(M0@,0  Ply /  DK)0D XPll 0 R 0 0( P @3T 0T6 P PP p3T0000aa 0V 3T T#P00P0 @FF2@P  t, 0R(K<T<T nF+T+Tl0 3  l0 2  )0WP0P0P0 @NF@@K C@0[S` SS ZZ 0SV l0.  )00 WPllfL@K* ,1WPW 048< ̠<Č,ʠDK= )0D tWPllT (@P  00Qwl0 1  )0[W0SEl??0[0S SK?0[0S fDoq4C> 0-0L0@SP ڀS S E0S00 0@0@ 0S 1  E0T@00@ P @P00 0q -LM`Rp"@3 1:S? S VM*  hp  `bV @0SV;0 `bV(KV0PU:0 =0K B00 <4("4!<^00 >SM: 0V R*KB"[04"48#8 00@P  *E+00h n`*0p@0@P0h @P],0T0h `@0p@P@PL,00h q -LM@` 0)S0p(P 0 0Q( Q0%(":P*0@P  (K( ,0KJP , 0R:0( ,0KJP , 0R0% *80 EP00@qK@ -0LM40 < ! 0S 0/9I 0@/9I0S @ > > #=0@8H<0S x" 0@<.P`0@ d~'RP00`S1 D.P0`0@0@0S x2  < AD(K (IP< 00@X0@ x2  0x-10`p  H-Pd Q0SW Pl 0Si0Sf0Sc0%d,P0`0@0@0S x2  $ <0P t,10@#P (bD,#= 0@(,8HW,'= 0@+9IL+8H 0@+8HA 0S$0S00@0@0Sd x2  $ <ZQ0SR 0SG P 0SQ Q0S 0s ,K %P' *P0`0@0@<0S x28 8< <0S x2  <  ,00S 0S0S0S<0@p0@0 0 $(00 ,0 P`> <0 (0BS^:(R 0S 00< (00<0S T  0S 0S0s 0S0S 0s <)P00 @WP0T@ x2@ @D 8V X@@0V00S8 <K21C010  8`P 0S @S<,0 RP(P0`0@0 @0S x20 04 <0S0S 0S$0Si <5x Q Q ^ ^ p5 ^ :00@@0 S^ lg0S 40J8'> 0@'pP#0S !hP @T< 0'S  0R ( 80KGP 8 0R0% *F00Sx}< 0 0@ 0 @t 9I 0@<T 9IPh0 R< @  0<<qpojqjqqqdjK@jh@ 0-PL 1@hT0 R*0h \  @00C@0@00C@0Xq -,@L= hq|4 p-L <PC AnA#!B30b0020aA00 S0P\!* n4\4*0 R0S 8ChV N#!B30b0020a4A\4:00,D 0 phjq0jXq@ -LM1 Pp0S 0S 0S0C0 MRM.0BU, 'PU 40`?80S0C80ůڴǟ00Gh=ǟ007  ⌕pǟ0D 0)Y3  @<T ,P@`0 0@0@@D <0S x28 8< 6Ɵ 0 R, R  0?6 R `6P 40 80S0C80p0Ɵ00(K 0Sz0Sw0St6fV ş@00 @P@0D@(Ko|?00@00 XY 40 0Sx 80S0C80'%00 00 4Yf4@,P \  0 0(Ko4 0<td0`QU00B %0S S 0S S <@x2 Rh h R: R/ \-Rg*P 0@P  ,\H <x2 0Sh hS:0S P0, 33h30S 0@ % 0 0P<@000@ @ ` !<PŸ0S "P`2@,P P %  0  0PK <0S x" X00@X0\@1@@P @D , R 7^+ ^[ (^& , 000SU000Q 00SH0 0 0D 00S S>00S S<,P ,R>MP80`0@80<@<0S x2H HL Z H00@H0L@ qo%㉠ XP <剠%Z, Zj,0Se 0 __ꬒqqqjj jlj@pj؃@ВqВq - 0L(S``=>pP=7Q PQA @@AQPQ100@000 00 (A(  ( ` 7;` 0-0L@P @P 1 0'S 0S S% 0S S  00h(lBP000S000 00S0 0 000S S 00S Sʚ; -@PLQ000 R5hٯ p-PL`@{> U  U U -p0V 0 00p0V 0  Q 50p0V 0 00p00p 0 pxj -pL@:0h00d0 p-q``q.QLP@P{00/U00S00=U00S0d00U00S P 80S0C80@0 0P{b001U00S 0P{W000#U00S 4P{L0403U00S 8P{A<0P80 80S0C80 0<02U00S `P{,0`0p -L @`Pph \0DS=^\^ #0DS/0D+S10424,24341414/4/4/4/4/4/4/4/4/4/414/4/4/4/4/4/4|34/4/4/40424,24341414/4/4/4/4/4/4/4/4/434d04 #450S * 0S 0S 0S0S0S PU 0S!P 0S0S0S 0S  U0S 0S l0 0l0U.T @4 Q*Q (4 Q Q{ 㻮P  9 P U U00⃁U#T 2T TP { 㘮P  a9 U U 0U0SR @0S3{ vP8n  ?9 ePd U U U0S/ WRz0Su 0St S 0So0{ KPC 9 :/TQ4UX0 S -Q0S+ UE UJ00UF1b{ "P0  8 U40PS  h+U)0 S d" 7 l0 0l080S `PW 4PS3, ' 1" 0S0S0S 0 00SzH0 R80 Q,<$!$ , l  j j -LM@0pSP` @  @LK{ p㝭0 -@PL {h] -`0LdlSpdl {{PP" @ 000S { iP  2800S 0{0A XPX07 0840S 0{0A APX4  4 8`0S 0{0A /PX`  `78P 0{0A PXPP8 8 7 -QPLMPp@ K2T<0S @` T P RT:00S000@TP" T `0 R0RS0)S B 0 uP000@TP 0P -LM@0TpP+ `U` 0S{qPX eP  00 |PP@ {Tp{ @q -PL@p` Pk 40P280S0C80d00$/70 0 \(W A x20Qh  Q Q: 0X h Q* P 6P\ W4-0T0 0S$0S 0S@T5㒫@T, 0R(KT R 0T0 T R`K{6` 0 Sr3   T RXKi6X0S0ǕT 0SP0S0S0S Q 0SPk L3 Pb*@3 aV] 5S10T0 T 0S`0S0S0S Qq 0SQP 2 Q:*2 QU5 0SL @T@T U, 0S 5P R000 W\K5\Q  1 Q *1 !R 5S @0T0 =P@K$50 H0KG K@KPP <`V00S("(04"40ṰPl 0T0 ᲰP 0S% S- @T@T 0S 5P00T0 T K5P 0S0 000000S%04"4000S SDoqxjj jDC> -L$MВ0,0 #A0D L0 QB4B4B4B4B4B4B4B4B4B4B4B4B4C4C44C4\C4B4B4B4B4B4B4B4B4B4tC4C4*, 0R(KPH 4PE 0P0a V(p8W@V   $5PpphPLPK``8W@ ;8P PpP`@@K4pP`P `P`PpP 8PP d0SpdP`pDPK`P l0p0HPK`H0 P PP`P 0Pp0HPK`H0 DoTC> 0-L@)R P\ J7@0@0S*@ P00\0S 87P 0 :RPP88 0@ 0PP@\ 0S @0@ 0 :RP@ -L4Mଟ`P( LP p@ )R@ 0 P P( 0R $KX 6PP@D<QI4J4J4J4J4pI4pI4pI4pI4pI4I4J4J4J4J4HI4HI4J4HI4HI4HI4(I4J4I4J4I4J4J4J4J4J4I4I4I4I4I4I4I4I4I4H4J4I4J4I4I4I4I4J4TH4TH4TH4E4I4J4I4TH4I4I4(H4I4PDp@X<QJ48K48K48K48K48L48L48L48L48L4K48K48K48K48K4K4K48K4K4K4K4K48K4J48K4J48K48K48K48K48K4@K4J4J4J4J4J4J4J4J48K48K4@K4J4@K4@K4@K4@K48K4J4J4J4J4J48K4J4J4J4J4K4J4l0   L f70 0 L0P0Y[7 0P 0 N0P 9PH PK0H PNPP?)P0H@KS P 3P0,0 77 0 3* P$&70P 00DS񟗳M4pM4(H4M4H4\M4 P <Q񟗤tN4(H4(H4(H4(H4(H4(H4(H4(H4(H4LN4(H4(H4(H4(H4(H4(H4(H4(H4(H4(H4(H4(H44N4(H4 N4(H4(H4(H4(H4(H4(H4M4pM4\M4M4 N4M4(H4M4(H4(H4(H4(H4(H4(H4(H4(H4(H4(H4(H4(H4(H4M4(H4M4(H4(H4(H4(H4M4*PPX 5WP X 0Sa PX R0LK0PL p{PX 0S P00*Pl0X  0S 0Pp\P UPX 0S0D L QPO4 O4O4N4N4N4Xp 0S0PL  P| Pl0P00l0 P0L <QQ4O4O4O4O4O4O4O4O4O4O4O4O4O4O4O4O4O4O4O4O4O4O4Q4O4lQ4O4O4O4O4O4O4@Q4Q4P4P4P4dP4O44P4O4O4O4P4O4O4O4O4O4O4O4O4O4O4O4O4O4O4O4O4O4l0#:0L0 l080L0 l0#80L0 l0#90L0 l040L0 l0;0L0 l0#;0L0 l0?L0 l0:0L0 l090L0 l0=0L0 |$$00S0L0 vl0L0 q 00L0 L0 l0L0 il01l0LP66PPl0l0W l01l0LP 7 7PPl0l0W l01l0LP77PPl0l0l01l0LP88PPl0l0l01l0LP88PPl0l0P\l0l0<<P Pl0l0\l0l055P Pl0l0l0\55P Pl0l0l00/LK Pp2PPj \l0l011P Pl0l0l0\66P Pl0l0l0\77P Pl0l0wl0\77P Pl0l0ll0t\66P Pl0l0al0i\88P Pl0l0Vl0^\88P Pl0l0K\l0l033P Pl0l0A3SI,0SF00SC40S@80S=0 R \7 P*0 SPP$T\l0P0 0l0l0P 00l0P\PDoB>dC>  R-L@p`4PP T V @  1P; 41377 (R-LPp( B(0X6P @@0S1` 4P  0 0 71P 000 0 0 0 -LMP`Uo4P1 @0 0P <(4"4!< $K= 0 0 0001P @ ZH4pP ; 31!377 0 @0 0 000  {00@3Pp -LM @4 8 4<,$@a8#$@D  X00(@0 pR@m4p+3PP@e P  1@P`1 (@`` j @ 4 ,0K0@PN40,("Ƞ0l08#80 #0R!$ ,000 g4<0#$ 0L08#8 $#$"  0i5P!  R4 000,0) , )<)00p,08 Q 2@PP7@(Ko -LMHϟ2 Q 0S hΟ, 0R(K4Q  K !i`P8Q  K !_`P`Q  K !U`P0Q S 00 S 0  0 S 0@@TP00(@CT081#81 2$1#$1"15 5:U  `P ꨀP y`P`` R U 00  0 <000S U 0 0   000S U 0< 0   000S( U 0+ 0 0  P P0S|K`P G@  " B.  L#0S  0S0S0S, P0@ |0K-`0  |P 80S0C80ʑ0S)  X00@ ʟR|KX0\@  j W 80S<    d \0 $(<:0S    R *8#4"<# #$# 00s 0X@KPy.0 PKW0K塆0X0K K0K ( 0`PP L0 0@L0P@ 0S x" P00@P0T@ R 0S W 0S 1<10 SK<0K@K@`P Qٕ PW h0SK ^C  5 \ \ ^ ^ \F \\ ^: ^_ R 1@0100 K! 0KPP`C1 @01 W l0 0Sx20Sh  h S:0SB R@ S:0 0T P`|P O`PnPUAV  00@&0@0S) x2PX0 0@X0\@00 0S\$ 0 00@ |K-`P  P0S<1<<1P x" 00@0@5Sp0 0 @P0@P3` x2P 3`X0 0 @X0\@400 0P|@K$;-@ @ 0S\\ Qn: 04j 4Q0 0S  ,00 (0`P0S x" `00@`0d@P00/U ß`x0p0@Px0|@ x2p pt  0o `XP 0V0 l/W h0S  P(`00S000 00S0 0 00S x2Ph0 0@(`h0l@ 00S S00S SP 0S 0SN P0S 50SN00SJ/P 00Sj! 041 S  c1  00S[!041 00S SJV @!p000 @p0t@P00S S9@T@T  .,P0S 0S  (V  `00@l `0d@0S x" h00@h0l@ 0S0S,00DoqtC>@ jxj p-LM@P 0`R :P" 0S* 0 @0@P0f @Px 0Ko4P  0R0% *TD0@P0  x0 01 xqK@ -LMP8 `/Py 0.pPq O/P 8!( @@0( 0@0 0`0Y0 0* BⱃVw  㫃`0 0@80P0PPPPPPP 㙃0S7 ( :04K 40  \+80Pp1`00@ X0@0 K4  x2  80S S) S Y00 P(K 00S P PX x2 !X x2  X x2B  !` 2  -z-sqn@A> -pL0S0 @` T& `@V P`P( R  BR0( 0 UT` `@VTVi0$0VPnq 0-0@%x04"40 dPL04!40$ R 0 *P 00S 0htjj -LM 0R0%@`P .:U:  0S - 00S0S6 S1@0S 00S P 0S 0S P 00S0C 0 0 (0K2P ( 0R0%P *,2@P $(50S 0S0S0S0S P 0S 0S P0S 00S5 $#$"   4Ă,4! C\5 $#$ `V.0S$0S!Z? (0S S \41 ( `V p )P 00S0S 0S  )P0SFg`Vb`V  )P0$0(00S1R 0$0(5 $#$"  60K@sqMbtjn 0-L@/0%P04"4  0z)P 00S 2P\00 ($ 0$0(00hetjn 0-P0P@LMKP0`0 00P[) 00@8nnnd0GS S S SS 5S S S p-`@L(P1)0V00@ 0`p -LM< D @ 4 <P@ <0000 20 pW,p  0,0 <P 00< S8 $*T R<0  08R#21C<0,Z, pW< Rs D0,@ S @3@#4(K <( @  PPL00X 80$0< ( 0538 r0,0 H10aR001#,05,0%\040P !0 T`V ) 8`V! 8#X"B0 08P#(:8 00@   `08V#(21C<0#$ 5,@0<@j8@ -LM`, V0P0@PTp* p@U(PT(p" V(0 X:(N(0 0  j0U01(p10 0 %"@(PTVp@ ,0pS @3@# q S-PLp@P`Q`R00SPRV  =P P U U*P X  0p03X0SP V  VP | -P!Ll@p dP P a*T 00S U*3000  00  00@T M0 4:*0  '\@@ -L0St0   00PH0@ <<0@$h5h1j$nq qPy4@ -L p0`V x2P@T 0>CS0`VhF@0$E D Z0( #5#3 0Py4 q$jjMb P-L \  R @T 0 S *01 0 S00@ 0(' @@ 0-@PL` 0S[ 0SQ P d1 RMX1P U 0SCP0 Q -6L M6, \H @| 6\( 6\ 6\Z Ph, 0R(K\6\, AP6\ H6\x2H P$ 0C\ 0\pPU# 0`S 5P 0@@ 0S TVPP 0@S00S TBPX5\ 0\D5P H0 H~;% 5D ZS H@  [}L0 0X $ 80(0< , 053@ 0 TPU0- @ `1"0Hr 0@880S900S # H0 80 P`U VP`U8#830%0@0Z0 Q0S@ ȀDԿPCv00SgtH0 -0LS6 1\"\ 0SP0 0 ( "0 , "0 0 " 0 4 "0 Rx0 R  rP 00S0 $#$("Q 5Sjdjq8q -LP`+VpP0H0@z0 0$hs0 00$B j -LMp0SP@ P` 0@  0@TF 40`0 YV?  = H@VT? "0 00@0@% 18SS C8Ss 01P%0 S `VN @( `P 80< 0CR80= A@X %`P@x2 ╰0 `@0 P   `P@PdP 40 `40@00x"0 0Ba&0 `@Z`0( _Pd40 `c01h \00  18o8C0,04 0 18cj@BMbjj -L,Mȕ0P,0 P`0HjІ@ nn4jjjpoC>j@@ -LP@) 4 00 S H^ 00S 0S1ST0p 00S0 S! <0D x 0h:Q  PjB -1L\M℡P P( 8@KpH`,M <p P; \ 1S  W R !0\00 aሻ`< 01G}|@KD` 0 <x0 p 8r 0( 0R$K1S <r (0 {djDo jBjC> -LMpP@ Q 0S0S  `PL 4 ;00 20 SHX 0PU 0S h`(K0S 0S`0Z0S0 ,0 80 4 <@Y00S&,0!H $2$"0 o @T P P 0 ` 0T]   `P 4 0 Z0 100CS(x44l40440 e P r@  00 @4 R T 0S 0Q01R 1S 0 R0 R| iz00S 00S8  01+" Pe0 0 e uY 0 jhBj@dj|j<@\@ p-haPLP $0@S 0SG TP $0@S 0S9 T1P S, T 5S. 0 R0 R$@0S0Q S P 0 R 0S 5Rh0Qp0\0bZX qj8qdj|jj -LM@㭺 0S riPU <`V} Hx2Q p Q|Ww 10Sꜜ4̛4̛4$444؛4l41 Q>001 1BaA0 iŹP 000010!$10 %1 Q `V p p<00 0 P9! p0S 0S 00l0 d0Ba  04d0b(_ \jBMbjj@@@܇@ -d0@Sh0L0 l0Q QX0 R :00 @00 R*hih 0R 0j @vx2 0-|LP 8m00T0@  0@P0< #5: /#3 00 000uMbd0GS S S S S 5SS 80 P0S0SP@n / -L Mp`P> 0P @剫00@ 0000 @t0@0  0  R0 p00  0| 忒 0S0C 0 @ 00C0Kr Khdꐈ@؈@@@nsq`@ -@PL P000hx(@ -@PL P 0Sh000cH@ 0-0L PR0k@P y R0 P00  0| g 0S0C 0 00C00 j@nsq 0- @P L0h4 -LM  PK$,  7e@ P d 00 @00S81(0 R @00 0 pp    0: 0`000 0HKd`K \PKPHKGKdKcKQR S ,04!45K4%KT P0 X @ uK @0K0@( 0K倽P @K  t(`w0(0@0 t0Sj S 0S ^ 0S~ ˠ@,* *4*(:0 0( @@ 40K K0@@Y x"P`00@0@x"00@0@2@X\$P PX\$ 80S0C80 ڼ, 0Rg(K; n191 <1 KK嘐 5 00S0 0 0"<1 R9P 80S0C80? 00S Sw e0R| 000 Ru e@ 0 @@ 0P 0 1 0 e @("(04"ă[᭩@ 0 Doosqjh@C> -LM(PK$0 , 0S e@P d 00 @00S008!U( 0S @00 0 pp    0: 0`0@0d`K HK@0 UG0KH Kc0Kd K \@K sQ R R 0 (SK 0K ( 0K7P @@K s(` x0(0     0 s0S S 0Sk +@"40 0( :@@᧸ 40K0^0 K@@sZ x"P`00@0@x"00@0@\2@EP PPT$ 80S0C80y, 0R~(K1 <10 K0K嘠 M; $1=Px MPs @@K 8s@@Kz P e@ 0 @@ 0P 01 0 e @("(04"$t 00Sk0 0 0g% 04"4P ,5KP@K4\@K%KXP T0  00S SRp0 R P 80S0C80ŌIQ( 0gDoosqj@C> -LM0 005  @0000 0 -PLUpV u`PY -B 0S5 0RQ0 0S0R0SY0!00SV R0 l10  0| X 0S0C 0* Ќ@@Bj@dj -LM@0 s 3X R7 Hd0S L^LK@< W4 R \K6 My/@,0 0?0Si <K 6_c0S[ .L [ \K 媦Pp`P`6 lK@+X e0 00S b0S8 \K Ae0<K 7P P <0S 80S40S00S !@K-K( 00KK@P 40  00 Rs a0S [0[0S%04"45K71 R H0SD0S@0[S <0RPP@S@ !80S40S00ST0%% P00 Ġ"Č0 <K\ KK~@ 0<K @a0%  `@R000 <K\ Kdv<KH _o "PP 0po` `0DodjjqK@sqt@(@@@<@̎@@d@Ѝ@C>@pA>@TP0S0SPp4 0000 0p 00000 jP|0 PP h0 Q X 0S P<0 8000   j j8qHn p-P0L@`TP @T 0S Ppq -LHM0P\p 0S K P40 d@KD`4 0P0@ 4 ` \P X` p -L@Ppㆰ0`S hۯ00S 04!40 4 -L<8 Q l0 R  0T~q@ 00D00D0|$ 00 0@0@0j@ j -LM\#X@0p<K,0 ] PP` 㵡TW00Kx0   K90K 0K00K0 <80 4`0X@  @ 堀 >0 0000 4 0000 8 0000 < 0000 0 |0K<K0tK{0KW<08 P0 T `0@0`0 K@ P9UW Kz1 R], 0R`(K`0L@K0 `0 , ]<L08H 4P0`D0P@ P`0`@00 0@tK |0K<K0{0K@ <08 P0 RT 0P T RF #310" cb ` P `0 R K₡0 PP`0 0,Doj: QN@h@C> 0-\0L@PT@T 0SX X0RⰢP 0j -T@LT  bP HP 1S@T|\000厈 -0L@pT"V@ HS0S P0T0SPU P0S0@ 0Sm00Sj p-LLM\`K@DPO< 00 \X0 T P   @0H0 D 4 0Kp -LM┢P0 , L Pp p2 R X0 T, 0RS(K,2@T@T T P0 X0X RP {`PS HK@K(0H0K @PL@ L@ @KD 00 0`0 0儀 0 8 L0KPLQ rLP00P0Q800C800 RL Y@XPT` Q0 0` `L`V 0 R `V80 R 3X0 0$GnDoj؏@jD>`@@ -LMLP0 0, h0 (2 R X0 %P, 0R(K|0HK0 @[` @KdpKG`KH@KVPPK (\Kc`Kd@KLDFH0K0 p 8 h0KYPP#P0h0QP0(1@T T P0X0X R @Th R 80S080h0 R @K⯟X0 0P`P pP D0 R ᖟ0X0 0$pDoj̐@D>jP@@ p-LMS@T @T L0 &P @@2 R T5L0 P0J PP00P0@T 0S00S@T@TL0 P0PUG L01@T 0S00S@TQ@T 0@ 0S P2@T R 0@00 RxPP0P00P0 3PP 01 R X0 P`P 0 RP0@T 0@ 0S P000000@TxٞX0 t`P0T L0 P00P0@Tv 0S00Sjqqj@ -PL㭬 `0@#10#T`p7 p@T 0 R0@ X0P 0P 00Sp`0WV`\00C\0iЫ)PP\0`0\0PP\0p0\0 -LMP0 xbP< 8 \0SK.@P 0 R JX0 0@\: pR000 TP @|㔅T 00CS 0~|㇅Kh 0 7jؑ@@ 0- L@P |㣅P PT0S0T0T@0h0 -LMhQ0pS@xb ?R70S2`| ~PP, ` thTP@XT@(0( @0T0ϫ0S0 00P L0X  00 0 K @P @0 R ⬝X0 0@jjj@@ -L4MP@p含T1;@@ @0 $`P L0L00L0L0L00L0L0 80< D@H80< D@HL0 P0 W EP L0k @TD@ \ pDp @TO 0 R0ΜX0P 0⨞P 0@ D  <0KL0 L0 84 pQ*<00^*r X200`RP0 @2% 30%`  ` 02QR:R40 @ R 4 <K0 H LH!00Y `00p 80S `0D#10#^0@ K(K\0@0\00X!@ٽP\00C\0 @Pp ,1 Rl ؜X0 0@`80,` S L0 , K@P 0 R ⻜,X0 0E,P L0`>8@,0<@,,,`64 8<4 8<e j 4j@ؒ@ -$LM0ȠK DHpK,0 d`K℀ PKx@K0  @H0KG K0Kd0K Kc Kh p P ` @ 8  0KQ \ 80S04$0, 0R(K080x彽Do(D> -$0L@T @Tq -,LM0pHKdK,0 `Kp ȠK| Dyx@KP0H KHKGPK0 KdKPKcPKhp ` 开 0 8P8 0Kx@Q  800C80T0$0B, 0R(K^Do -Lש1pQD1 R@ @T: `P@T V? $00S0U  RPU00S @TV7 U  P HP 1S{@xTV Ubi0 R  h0l P HP 1S``ӱU `V`dj|jqp@j(@ -0  LRPxb0 R)$0Sp! R 000  0 @T %P@TW_00CS0 |h蚂p 0 Fdj|jqj@ - 0PLxr@ <`PL ATd $0 S A5 @T6 R0000 0p @T P@T P @ 0``000600  0``@T"1S 0 R0R(| OP `LA`00 R$0 R  qjdj|j -LM40P,0 x™<0K 0 @p<K e6 R 0mƟ, 0R(K`V 6 R 6@P V`@]0 0Tp<0[S 06 R <KK$ b;0[0S 0R0%P :Us @KG [P 0 4 d`K8( L u\K0TL0K 0$0H0 $KD  <(4"4@%$LT0T @!?0$%#5$  %#3 000 0 4 8  <,$!$ , P`P% @ P 01@\:0SQE 44 R  <0B,4@P $(AQ 0S \; 0 A9 e0 00T4 3 R9 <K⤙e0 D/ 0KP  0R0%P Q*TPU3 R  ,2 R   @ 0<K@ @s0Sz St 0 S PK` 0 K0KKc0x [0  #x K0x [2 00x0KlK0 $(, <4!4"<0 0 $(, <4!4"<| 0 PF @0 $(, <4!4"\ U *(1 RT   0DL Rh0 h0R@1*T:0PU> o<@00S0 R  p0 R& ۘ 0@@Un 40 R ̘ 0\Do|jjЄqГ@@ j6Mbj\@PD>sq@K@@0@d@@@ @ -LHMP`@0p,0 <K .cX2 RL2 R ,, 0R(KX 2 R 2@P q {@x0 0<0S80S* 0R0% =:P1 h@KJ P d\? 0 A= e0 00T8 1 R <KFe0 DZ40S00S 0 R K0@P $( @0KP @ 0R0% *XY @ 0@ <K@r(儹Do|jdjjȄq0@@h@sqK@`D>-Q P-R 8PMsq -L0M\ Q, L @P`0 8#8^[44@4P44P444P444x444P4P4<4L4P4-0L0 X L, 0R(KV P _|004 0@S 0L0 }90L0 _T 0SHK @G0[S_ /0L0 0@S2 R 0S 10L0 V 0L0  㸢2p PL h`5PL bP0 v@0 6|P { 00 P:~0 |T80L0 tHK 0@K G0KHK 0L d`000Y,1 R 0SL0K,p 0pH0`P+ <ŵឡ70S 0S 0ss S0S,$Pd 0aPlL0S10L0 8eE3 0L0 Do$j@jjtq@A>|D>@Ԗ@ -LM0PS`@ $K0SP0@S'P% P 0 R Tp  0R0V0Sp  t0.P vP Z0p@, 0P荐jA>tq- -L0Mğ0堔,0 Pp`0@`L 0P ST  0S 0S0S HK0 X H0KG KHKX PU TS PUC @0 l0  v0S,0S00ST , P0S 0S$0S X P0s\ 00@0 @P0 T0b P"I 00@0@Zm l 20S4P0*@HK L0P&LP#(0 0@(0,@40S80S @, 0R(K 0sm0sa L K!Z& !0 @P l 10S[P @HK L0qPILP(0 0@(0,@0L0 L(0Sq jP0`0@0@!  00@ 0$@T;\" P0S x2( (, 0 0c l0@PP PT @ L KDoo4tq -LMßPp, S0@0 3@0 `K3 0P `  [X K3T8, 0R(K T 0S 00 0S/00 0S 0S 0S$0S(@T| 800 0S 0Sb ,  0 pP700  Z0 (1"(1(`0241"4101 #0 !0p0@  0# #$#8`00 0HQ 40< \ |\ 0( ፡ PH, l0 , 2(0H PO e$0S(0S900 [ 0SW100 T9HKH`K[0@K ۢP[@ ,KH0@嬤P 3S@ K n )P@0K 0 f &DoqpD> -`0@ 1 !0L  ^0$1C* 1A00 P  10!R A 00!00>0^P peW0^*"!B0  0pP  >0> 0 c/!oUUU\&X\& -p`q @ !0>0#6610  !0^L$1Q*2h1C P 10!R ,A 0 0 p0^;*21C P 10!R A0 00p0!0>0^ P`eV0^*"!Bh0  0p`P pp muUZUVURU\&X\& -0`1@L  ! 001 $!0Sa <0S[H` 0RN*2h1C   P 10!R @: p0 p 0R/*21C   P 10!R @0:0p 0R*21C   0  p  ppmTT T T 0S ]&X\&@-@\   0 S  0 \T 0As0 -LWMP  w0`0S0@+  @0S00f+cYU ,0K<2pW0/Sp Fw(K\2 ,00 SPC/R 0u/S @0 tKL H0  0Cp0 l D t` *<P/00%Y0`, ,0 0@fP?p  0P 0p@0H0 0CtKLp l p0 t` D <P p,0K1pv`G\G@ 0LKP 0 p 匠 ;PP0`K 0@]PP 0 aK7]PP !p1R!l1RPG`Gpu -LM  4 0 , 0 P  0$00 00S (K ŸK0]P0UX# R 1  vp2 l ^Py0LŸ0 @ P< P< KH0 8 \ X0 DP L T P  rv0P 04K \K0K,0K]PpL0 pcW]0PP`\ 4Q0 0 S+ 40 0C40 phW*`U 40SG XDE0S U0 0-  P1U0O 0ApbW40 `P0,0S X Pv|0 ] vb R ? 00 ` Q000q -L`p0 P@ P! P9 T00PU0S+ 0 P@00P P P00W l`FpGW@ L@T0gG F`p(p@ @0@ı@@?0tq@-@ tϠ0Cl$ !B l10b1 0!0c"0 0cb# a10` bP@tq_ No@-@R 0 0#\P0S SS0S0S  S 0SQQQQQ!Q1Q!Q1R 0S  R@R  0R\ P0Qc-R 0R^ ! !&X8#8S    2  0D>-R0 0c BSR48 R p-@P`x BRpR0 BRRR P0 P 0Qc R-L" 0S 0S \ @`R 0S  ^00NSa00@R  R 0S0  R000Sa@R P0SbR 0PP  R0QcR0S0  RR B0 0Q0 0QQ 0S0S QbQ- * 0 0 QaR *0\ 0 S Rb` `!  R0@-P@! A0L\aL  S00`P0S 0zP ^00@P0S ZP\\  R0 `0ȠR@-,Ƞp` Q R2RHV}GR0pG@00 0 0  0 0 0  0 0 0 0 0  0  0 0 0 PU @"Vm> 7("B 1@W b`0`WK W300 0 0  0 0 0  0 0 0 0 0 0  0 0 pG0 W `W 0 R 0,8(2C"B0 cbR  0 R p0\d0LL'82C00c08 P @@ R,B B[q p-@PL 0W("( 0$H,8L2C! @\` 0%H c@`R,B BR,B B,0QA>A0AQAApqD>0@-Q@; R,P0 0,0,! ! 1!4##!#$" " 1"4##!#$""1"4# # !@D#$""1T"#T (P0@T0,0!," 00D>Q  0 " p-L`P@@Tp -PLM0@`. 0IK$1  0K0R0pK Pd@0 Pd@0  Pd@0` `&$K` S-L@P`0 @R1SVPQ00QppW(,0\h0p(S\0 p,00L  P  %9$0( 4`,p$P0p@550% -@PL$Q ,0S 00$0 -L@MPX \ `0 (K$pW 0 0,  P, P`4`< (0  0AS_\%5%5$5%5$5%5%5%5%5%5%5%5%5%5%5%5%5 U, `F0P U, V\,KX0`P@,` ,0H0PU8s, `F0PU, kV\,KX0`P0S0 8P U, `F0PU, V\,KX `P( 0Q1:=0VPT0 # BL !0@UᲠ:,0`F,0 T 020CL01 @PT粠V\,KX `P a4`0P =("((8#R  < 0 K0̃"(<  \`d \(PERQh U, `F0PU, V\,KX `PH << 0 h(̟0 \ 0 Q7h威PEP 0 000Php0P0 S.l0TL T l L T0H H/D DP L0 Pv  X; 0 < 0  ,0H,0(8S0b0X@@VI>H>ė@@@t@@@G-0l0 $0 #4M4$p@0,0% -$PL4p^@F (\ 0@c T#*0 ``T*:d M@T*00(0S, 00000R00#3,05$ 02,0(00@c T: lM (0,00 d M`4d M(0,00@$`0 (P4 -pPL`@$PU 0S0 S P#( T b4WM(0,00 04d KM,@0 S E B0P 00 -LDMPT  8 8(K$X PH QL  \ 0 @D@ P0P 8p<`<@ 8 SR5(D5G5lG5S5S5lR5`R5V5E5XE5E5K5Q5N5xD5P5@O58U5K5K5N5LM5S5S5Q5R5R5xR5V_ L`F0zL Z0Sp6 ? 0 0VK L `F0zL  Z0\"'X?P  Ud 'w\`Pd JRh ? 0 0V# L`F0zL Z'4,<'<$00 0 p80 0Sv  8T\aH  D00L@P(08pS<0S X@@@BL@@ė@@Q>|Q>`@@@t@@VM L`F0zL Z<D b 0@  0\ 00 0S^ H0 l80S'4<,'<$0 0 R DP1 l@L0T l0 T/^p0P(P8 7 0 07 0 0`l0pPX0Xd 0P P8 < 8 0 0G-|M00\`0 S\ 0 |0  2R0 Q2B@P0 RPU0@ @@@ |ЍU p0 RpW@0 00SJQS03<X 000Q\ 0|0 Q@ 4T $D@0 ^U010!W0!P808 0200@(0@L @$0, 840p  0@ , `Tp$(ń0@p@`p0 4 01# 1 l!c0  ll 0S@BpB @0 D4  4Q40A0 0440|0 2R0C8#(@Ts 000|08"C^B4 0@ T< P`0U |0S (aR  00 cRU  0( 0 [S 3 "R8 080 0  0bC1 @00@@0@d0U0P0S PV pp$(,80>P 0[SP# 0C 0;4^)  P0 4 @0S80 0  04L0#04 0 @!@00 4P @0 !0084 0@00400@̠$0(@,Y>X>zX>P$ R 0SP-$^ 01 0C$ 0 B0P- $P | 0  !400  0-@PL0$Q P*UEU IU[U(0S 0,$D0S 0,$@0S 0,$80S 0,$0,qU0$00gUqU 0UG-p,l A?@0CR0Mx8|P0A?00`0`0, \0 00@ R 40 0 0t%Q!\!  00 RY*PUW  0 ^@ 0@ST@ 0R 0R`  0R' 0R" 0R 0R 0R 0R 0R  0R ` R 0l#PD 0@H08XT0 H4."D H @ H0D 0@@U*0*S -PPL@$`Q00V0SQ0Sn 0Sh  :TRpp Wb0S *R(0P(@ ES\ IS [S gS. Q TRZ:Q Rt0ST 9QN )21C00@S90PPpp,P~0(0,0Sq00 0S x8 0 80 #4 0 8q000S 8 P T  06 T XP ZB0SiS= 8080 #4 080 #8 0; 0  0  "4< 0 "88 0 04 0BL0S0c00s3Y& 00S#l 6;CRP' q c0#2cVl0S 8!OL `800SS@SP  BR# 6 0S   0p W p  0 S,0S ^* n8-8 0 \p,0S ^:W0[0 p0$0S   0$ p0 0W p  0 S,0S ^b:x 0 \p,0S ^|:W0g000Se 1 R !"* 0   1S 0 S,0S \#@ 0 \ ,0S ^* n880 R I00 0_U n88 n888!nk 0SF~[00hg00nI00+ n8s8R n8k8z b8 000C 0 }0 0^a , 0R  S $0QPS 000 0 0  0#4 0 0#8 0 0   R  0S[   0 0S  0  0#4 0,0S6 E0 0 r 0   0   0  R 0 0S!0 00 q00L0D 00pCL   BD8 8RʟR0Z>p[>B -LP@P$`V q@0 T00?Uʄp吐"!B 0h 0 P  0 T h 0 @ |P pZ> -`tL\EPPUl8 H 0XT 1#D04 H00 @ H0D 0`p0Xd0x` 0\*,0lpA?C0ChQ 0BSZ``0Sxlp\`0 SdTTT4aLD4A  !t@(4, 0! 0A9!0P933;ӗӅ@! 0@D00tx0l#3LPlptxpTlp:8 H 0XT 1#D04 H00 @ H0D 0lpxLQx0NUp0`0hlp= tBPPXbtPUZB UPh0S 28l  @RP 0C!@ 909hP\l P80 `Z008 l0\00 RtZ\ R80 b0$ l0\00 Rh0S( ||18  0@R0`1  @9H!0900CQ lptp@ lpt0Slpt0 @hl0t \l P80 `0 l0\0R0 R S xp00c Sx0`0 lpQ`Z]>[>  -LPptDQQl8 H 0XT 1#D04 H00 @ H0D 0pWl` ,0l`A?C0CgQ 0BSl```\spDCD3a83L  !3, 0! 0A9!P0922;ӗӅ! 0002 t`0 BQl\t\PZ0L`0l08 `l` 0HX T2#D04 H00@  H0&D0 ` p BR` l``l`^j \ R80 b0 l0\00 RYxx1 8 0@0`1  @9H!090tl` 0CA`Rtl`l`8 `0`0l` H0XT 1#0H0tQX Q!\l P80 `X00l0\00 R XR5Q3l``-X]>[>  p- 0!PCUQL@`tP7l0\0 Stl0 P0`Qt08000 al0vl0\0E0 R l \,0 aA?C0CR:Q800_l0\0.0 RpRt0p03VQS \l P80 `V00>l0\0 0 RVpVp 01P? "# $P 00S P0S p-PPLp$`V (0S ,0S 0@0 @0@040  0R b R0q0*0R0,  ;@8(@)L0D, 00 < @CL   BD`21C 0 0|` H@l@\@t@x h@p Z> -L M P\p` (K0@R1S  P(0 S0082(0,0S,2,0qV`f, V , `F, 0HSUV00V0S Y00é?Z00ê?40 0[-(V `@P@ 0Πh10 €0 $@B, 0A 4 TP 0`,40Xp00 L00(8, 0(@L 0(0#`D 0 (80!S  @0S D0S P 0`\ 00$P儐删(Ko404 00 0R_55p[> -LM@ 0 0=K(O@0`p[> X 9X 0Q09  d0xQxA H0LQ40 , ,0 0 | \0p@-P0P ;L0`&N,;<0 @P` B[$0K8;`p@$j8jLjG-X1p0\;^M0100110\[`1@ 0T'+ 0 P\[3P`1!0 \[\1!@0T:`P@0 R P0`T 0\+Ѝ0<0 R0 P\[PXA-\p10  W@? `P! 0 00P`  ^`  P0EW#10\^ \^ V P! 000< 000 \( +-Ӳ0Ѳ000²0Ѳ0| G- M0@SR 0 0`1V0ಐ Z < VCP 008#800 "$ 0 c\ 0C0PU0:0. $e0nPuʰ 0PU00*Y   Z  0000C^ Zb \" 10. ppP0gU\058#800 "$ 0 c\ 0C00`F3pP0gUo#058#800 "$ 0 c\ 0C00tsPUJhF058#80 0 0"$ 0`!Q@ V?3pP0gU+= 0%r0P UڬF058#80 0 0"$ 0`!Q @U Ѝ<F0 5 0KŸ 2 % 2pP0gU-1 %qP U>ڬ F058#80 0 0"$ 0`!Q @D0 5 0I$4!058#800 "$ 0 c\ 0C0p0P Uʰ F0 5 0+-058#800 "$ 0 c\ 0C04p0P U[F0 5 0 0@-0@P 0CU0 0 ! 9090 0@S0p p 0<010)EQ )<0803ӗӅ1(0  ]>[> G-4@ MP %!0t`P0fUl058#800 "$ 0 c\ 0C004 Q*03 0CⲐ Yp 3+ 0ण` P0fUڐ058#800 "$ 0 c\ 0C0 0<3QU ,3  e^`aß0>8#800 0"$ (0a"(R#A IX223pӗqӅ!0p` P0fUw\058#800 "$ 0 c\ 0C0 02QUw 衟2  e^`a\0>8#800 0"$ (0a"(R#Al1  QV:0L{`P0fUD4058#800 "$ 0 c\ 0C00 0 Ѝ0 5 0[00 5 00x0 5 0X 0 >0 < 0 >0` 0 5 0]>c>d>[>d>e> -LDMh 0& p`W6@d <d @0 SU 0 5 d  \ˁ\@ 0S0#d0Yd1!0Lşd \ @ ,5 B,UX 00b0 0S0d0h 00?@T  @TQ=0! ğ`K 10\ B ` Xğ` 0Q0CC!10 \K \  000@  0S 8#8  2 P 0 0 `{3p Rʠ`   B10 \ h pP T  X 0\0 \3 \㳐43 ! \ಐ0PU1> 0 L` A010 W`` 0 P0S0\0Yil 0Tl X0@pװ 0#!T R 00" PU`QO G@2 R 0> 0 0 Q0CRA 00 B 000`0 0C BS`0 W> 00L0 # L R 1> 00P!Q@@PE 0Sc0 N!! p^L Y BL pI H K 008#\d0S P@ 0^ `(K 0S08#x 0 ` 0R(K0 rC dPU@(KP=TX< 0@-P@0S S t0 0"$0C0 0< 0 #40  0 -bLP@ Utx058#800 0"$ 0a\à A 2RpgPL+0Რ08#800 "$ 0 cZ"0C0 0!a0P 00eS% U8h0 %PQ XH<0>8#800 "$ 0 cZ"0C0 0g0  ;㳠 0 0 0 % 058#800 0"$ @P0a\à AX 0 >0^>@-0@0Sڀ  0#4 0 L L000S00 0 0000 -0L@ ^pP`=0>8#800 0"$ 8 a#8S2 A0 0!< 0 ! !0U0 0 \  0 >0 -LM`pPP00 @2RU+&(+뤅@010> 0 R@DT0pş  d5 0 ^ !0S  W R0QS3 U@ T000 4 0$00S (Ko40S 9 S Q<S Q Q00408#800 0"$  8 a#8S2 A0 S@ TJ048#80 0 0"$ 0`!Q @Z㈂P10 10> 0 ("(  0#40 P0b\à B U  B p P0 10> 0P U ,0P&M C@   00u00S%(K00H048#80 0 0"$ 0`!Q @00058#80 0 0"$ 0`!Q @tJ0 4 0mT0H . H4A0 5 0# Qc>^>c>0 ## p-L@MXPKX T0 H `l @0D ( 0 , F@P Kp,P@ T@D@00{@(O@ -LMO- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPbհin4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  ^e> o( - -LP긱55ȱ5б5ر555555555 5(505:  $(,04@DH@@( (0 -L0A hLn5pj -h0L0S P q00P0S Dp3 >p3qq -2LMS`p2P:W) @P0@0PU P P(KQ 8 P< ,, K00KP ,  ZG Z ̮A@$;01%J 466cRJ40 [188 4\! l\8   0 R0PZ4 Z&  188 R0@0 :#:N:cR@40 0<0 00 R 0 P,00 R ,h P00<P0 R 04 P, P $ZBx@qT@qܗq -L@` PPT T pT *p00 p@P0T0P@iNPPx@ 0- <LM00CP@ S ܷ5555555050555,1??3 0 008 0  0   00#2+!  R 55(55h00 K0"8\81 00  Kt8 0A100 0L0 ꐙ@UU33 p-L`p P 0 RxoL l/ ;s`@P000t00C0rL /o@qlj 0-PSL@2~s 00H00H00 R-L@+ R-L@+ R-L@+ -L M4  @,  R uRu B,  tR RQX10P 400C`s0 40 * U( @ C x  :`  00 Ep6S 8 Q q U:*P400Cs40 (Ku, RPE` @04 @D 00` tU: PP p GNP L1T,P @ 4 ꐓqh@@ı@@@/@Ț@D@`@@T@ -QLM@|hجpլhҬ`άPɬ$@ĬH4,徬D h躬@@ @,@T@|@@̛@ Q-L xt@ p-LM0PK  % @`P  0嘊x5 0- L@PV 0h4ı@45 -0Lp3 0-@PL|> `S  X0$$  H000 # $00<@m>@@@ -L,M`ʟPQ 0S @0S @Q9% (K @2S% %.9!  p@A0DS, +4 3D 4 P0 @9L 8),9 < 9)TH 8 0 @ w #0DWS񟗣55555555555555555555555555555555555<555555$555555555555x5555555555555,555555555555555p55 55\555 P0slA0AS Q ,Q, 2 8@TL%40S %%vD T |h4%0%(0 0@%$%%( 0 4 D1?3  ?#%| v%pdk`@pT 04 Z DW p@T w04p@TD @%:0!2 H+%t%%\O8OSp<#B %$40S 3  Z p%p1?3?3t3t#0JS$Jt %L30St 2t  W <%60S %08| thKA; @@ l DW!p `@,   dc_LHZkV\THy<%(as5e'e>0m>@4?pm>m>m>m>m>@@ı@p@@@@@$@N@/@@?@x@@P@<@ę@ @4@8@@@D@?L@H@@,@/@#A0^@BBd@$A`@HAH?X@A=@Ah@ 1e>uP@000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A Rbs_notimpl_%s: args at %p-(O i@mmap@r_1@r_2@r_4@r_8@w_1@w_2@w_4@w_8@rm_1@rm_2@rm_4@rm_8@wm_1@wm_2@wm_4@wm_8@rr_1@rr_2@rr_4@rr_8@wr_1@wr_2@wr_4@wr_8@sm_1@sm_2@sm_4@sm_8@sr_1@sr_2@sr_4@sr_8@|c_1@yc_2@vc_4@sc_8 -pL`@PL L 8P$1( <0D $00HL!0C00wwww -tt0 @ ,0L H0 R!h],0 DH!0H1pqq|j2-@@Pr?0RW` 5h5t55` B`p Bp` B`RE0C`R9`$555555 55` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `5555` B`p Bp` B`p RpPP2-B@P00O0RW` 5`5l5x5` B`p Bp` B`RE0C`R9`55555555` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `5555` B`p Bp` B`p RpP2-D@P?O0RL` p5L5X5d5` B`p Bp` B`R:08`R/`55555555` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR `5555` B`p Bp` B`p RpP% $0000% $00000& $0000|j0-2P? @P4@54?3P0p-2`? h@@PPP`5P65?3`pp-2`? @@P 0Pj{ip '1PP0OxPa2 7@0L!0*4 0 40L0C0$KȔqHoؔqqԔqܝqq=,jtj@Xj\j|jp@ -t L@Q00  h;g8h0  "!  xj@؟@@-@Q >0^ 00\R 00$0(000Mp@-`R0 0@PU ^ 0P@PU T0p@ЍT -LPᠠZp` @ (0@Z -LP Zp` @ ,@Z -LPᠠZp` @ 0@ XZ -LP Zp` @1@ \Z p-LM ` 0  @K P`P@ ,P% :8 ^  @ ^ 8: S@21C* "!B 0 :0^ 0 Kp -LM@`Tp*  R $ PR @0PS L   0 P  @R(K @ x -LM< \ 0P 00c80 0匢Xpw `tŸ Zy0 K40K 0 0S 40 Ro >*"*0L,  080< P @,T> 0\:00Q^ (KP 00b, :#: :cS1!\, ,8  000`Q!0S P 0pW@21C0,0,0X ` 21C0 0@T\ 8,0 0 S0@ p 0 , Kz p 8("(8Q, "*46*, (00S 0p q  -L$M$( 8 R`4 080 0 VR"PpPP%4V@1,K080K  `V 00pR00SP 00 4 $00( 0(K -LM`$(p Q,0W80,  PP p 3U00S 0S  @,K(K QR , 0 00$( p0$K -LM\@P$(`3*KpȌ$  K$K pP$0 0 $P(0`p0. . tj -LK(@ ->0LMd1@ 4 P0 @A 4 0R0  800` p,0 P00U:& Z0SjzGW2 3 0@P! @H`z $ Z0SjzG,04 0S,0 <@(K$  0 a tjqqP@ -LM0(KpR(0 $ '`00^*P0.Ơ\|@ : c21C!\ c050:00$00$  $ 0S`V &* Kqq -LpP 00S 0 Q Q 555H5`2`埝僞偞 0GS,5T5d5h5@5@TU W: WE Pf@TU 0Sc0` S`1`!WP0U@ $W W PfU @0Sc0` S`1`!WPHH 0L 0L` 0 8H$LPzq@Р@@tql@00$0(000< -Lp@@`  ,P9<P `00  000$0(0  P0@-@P# T!00Q:P  RR*> 00 0 bR !. .0  00 >00 >a 0Q00> 000 -LM@dPQ $3\ b  S] 2"S0"Sp厜ዜp1E兜p1@8 倜p1 8{2XRR0S Z$ t"10@T ``"$KmdP2 RJ D2D R ,, A0B%@MZ$KGp1  B? 0!!dpPP,L)Z2 : Zp18lp1 0\T$KmH1 1R0 \a0@PLŠB%0P @`p1c`] $KmܛAm>@`q@@t@@ı@pqhq q>$@=Xq`qxqpq>q@@@@@<@X@@qdq@@,@h@L@P@@ 0-<@L`40P 0h1ld!0hqq-0 .!  !!-0 .!  !!qqq|jqq̗q@@-``60`d`6 !!@@- 1 xpxp`L! 0 p?`L0 !@Ј! P :PP/ U  Q U  - Tp!W R \!P Zt h U W( Q U0  !@Й! p? pG!@- ?` !iDЍn՛Reset vector called, LR = 0x%08x-DMO- @0lP @!1 ! ,OiDЍN  0O   ! -- -i@̨@@ @<@d@@@ԩ@@@@@@ @ -x!LM0@00 0.!0 S=41HpPwL1@  0pPhO W&: `N @03 P 0P P040S! 0S0 F/ xV  0pPX0 RH  0?  0pP0pq@ܓq -LML@\ 00 H   -LM \`Pp@  0 `0!L1 -L(MDpH #D 000 0, !D3#P`3UPQ\LXpH0H0XN@ :S6? ` 0 PP X N(K ĘDH 0HN@t T*2 R0S H 0R6BS 0"0SHD0C 80 4 0 , 08, 40PH0&R P20S 6S 828"0S`` 0B P 2 R)0@  0 0@0P< 0$X E80K0DH 0 PX 080 DH0 4 00 , 0SL0 ; 00 H {X@\ <0H0q<  03DH 0(< Q 080 <0 SHD4 0 , 040S 0S0 F/ t 080 ` LDH 00qpqpt>Ho4@ܓqtjn@@p@ 88#4 S #00S - - 88L#Đ<0 40@ Q: <P@q,j - 8LM8#tP`pB` 0P0V0S @Qv W6D6 66666666666\^!0c`P `0S a0S^  Q# sQ`0S`` `Q@1H#R) PG  VQ`0AS .00 O 0 `Q! 7Q`* = 00~0 0CS xPW8@0Sbp U6``qd@dqЗqq@-@ 0 @@00D| 0^D@ L0H000L0H0 0404550055 0404q-@P@0S 0S0S00 40C4P0 Q L0H00C0CL0H0550C0C55q@-@@\,\) 0Q0RD0 0D0 0@0 @"  4400C44 0Q  L H0 0CH0L H L0 0CL0H  %5 0C5%%5 0C5%q@-x@Q0000  00 0 0S00  0n- 0S Q000000 0 B 0S H Q 000000  0n - :8LP#  Pp#$ 2C 0S0 0*"%`Q000 0000x 00S `0P0*"%`Q 0@H8qqܗqq@-0$,@0S!*4*6 ,<10P  21C0P : #P 0S ( 8. :(#8 #:T000 -,0LQ  0@qq 0-08 L  0 RP@8 h0 Q X1S 0,PPH0踗qԗqܗqqnq0 0 xqq 0-PL,:8#*! #P! 2C 0S0  ! 00+0L 00S<@ 4@P80ܓqqܗqq-  0 0 0 2 100s00#:$ 1  !!:10!\ 2C 0S0 0 0200 020ܓq@-`Pp !:H$$X 00S | $:1 0P  21C0P :#500C0 -LM !Q:0Q*0b"!B10b0 @ R  R 0S0P 0`0 0 K0K@P4 0L000S 0P Kqqqܗqq p-@LP`LT pphP$ !:1  T0 R 0S0S R: #:j -L\  \X0> 0+ 0!04 00S 0P0ꘗqܗqq|q -0!>00@ +.  0L;>00 <0+. R 0P 00@ܗqqj0ᄗq@-X0@P R 0S \ R脗q@-X0@P R 0S \ R脗q0-0L 0 00 0A0/ B 0 0 0 x0x p0p p0?00?X0 䬗qq qlqqqpqȗqqb6q*6qqؗqqqtq|qܗq 0 R 0a B0ėq -0L0Όn`VPp@ZJ%:P %6;#;K jV! /0?0000?jjl@ -LMP< 0 S S 4 8 0 X2X"0 80 L20 040 >0>0S,0 T 8>0 + 00*< 01 <0RWHX; @46XS#PP <*: R[PS 8#8XS#&0*5 p ?=@`PU@ VU>0001 R 1PPU@HX,(K 40 *5   0 SHt0P`0PX0X 0 80 L00 040 x 8n 0k,i똗qtqqܗqq|qqq@Ь@@ p-``LM^P @ 00040@^Kp脗q -L@\pP \`0`$: RP  d$5  P0 R 80P,0`  묗qܗqqq0@\@ p-`SL@P .:8#*l! #8\ 0"!B Q 00S:#50 600pޒq@ p-!:@L P0S P9 :#0L R@" L00 00S`Hp 0 0S : 00p 00Sd` Hpp<`P$`P厒묗qܗqqq @ -L 0 nq00 R$0 Q! 00 ꨗqjj -0LM0S | 0@T00 KKhL00.*@ @@@0@ꨗqjtjj 0-0@0 0LP$0   R00 Rt tP ` `000@0  0@0$0)$Z 먗qqnn@ -L 5 -L + 0-L\80[0P 00SDP 8PP,@80hEԗqܗqqn p-0L0b8#^@(0P% `0P$0 2 0S 0 R 0R 0 R%1?00CS0 p0\ph߇H0 R <0P 0Pq̗qܗq,ndnq -!!:LM1@!T, $ ,0Pr`j0S 0j0(Kl 0  000S 0 A000,00PUP @0S000ႇ0,nqdn - 0Lap@L90 R ?= ?0R% UP 00#! @R00  00#!H0S  S 0 0iU0Sqq̗q - PLPD*%!*41! %::6 Sp1 p!P!8 2C 0S0/ :U# @! #* @`ZU@*0S 0H0Z80U0`@:8#(00b0L0 RY00j  0Pqqܗq -qL0PS* N@$:8#*! #P, 2C 0S0# :#Š0L R` L000 Rx`8+㘹0S 80P`Pܗqqqq - PL` %7*&!*0! &::6 Sp1 p!P!) 2C 0S0 :W#@@PL0HS H800jV@:D 0SYhPqqܗq -L$M} (z2 " BϠ01l! 40 5.4Qj 1< 8 P_ 1  0K@ B0P @0 , @@PQ0PiUX5*PPPq@8PJUV(8 $*(": 1 0"P 2C 0S0 *"%0L000Q P8  <8 H408 S <@0(< NP<w(K0s,ndnBtjq؝qqܗqqq@ @ -3sLMP00L 0, P U3 0So`@P %1?^ 0"!B  APP0 " !B 000 Q GP P8 UYZ @: JT * 4P \J%T:LbLRDDB$ :#5p^8 Q8>0( &#&R+:0R(*0a"!B10b @\\ 0T0U 0 D  D 00C D#&R:0R: q 0h0$  0S 0 R-(0a"!B10b @\\ 0T0UD  D 00 0@0 R  pPPqqqܗqP-0 R0P  0S 0S  R00L00 08   0 000nqn -@LPP @ `$4Q 0 `R Q 0\` @R^\RT PJ @3\ @TB \ 0``` *(":1 ` 0 p^" 2C 0S0 0*"% PL X 0S 2 R 2Q 2 R 0R 2P@T2p2U  \ R V TJ*PH @ `A ^ 2V^:`p(*(":1 p0"\2 2C 0S0)  ! 0L0 0SB  0S x18d1 R H1Q* D1 R& 0R# @T0*"% PLy Uw} 0S $0Lp0So 08k 0P0S t0( 0S 0SW L0(S80Hp0Xpqܗq̗qqq -@PpUL`  0S 0` RH  \Q% R U @T ^  \ 0h0hS 5S 0h PPU\  i - 0LS@ 0T0000q 0-0LS@P 0SP2000T( 00S 0 T 00 R 0S 0S  R00p00 0\   0 0 00P$00qqqnn -LM@08 S:(K BP084 Q8#:8#*a$#8@00 T9 0 Par0f0 R 0f0P4@T @T 0$"*>!00Q `$P@T086Q00$D$444TOp:#:S,3#$PQ,KPt '*(":10"P 2C 0S0 ,00*"%0X0Q*C P*:#:"*S3*3#$@Q  0P: 80,0 %*(":10"P 2C 0S0 ,00*"%0h0Q*8@0PpP<2 PB2$"$Q,KkP PJ 0P 8, )*(":10,1\"Q 2C 0S0H : #5 L Q? *0S 1P  0 21Cf  000 0+ ;0 0P 80,0 ,,K PdPX P@24 Pe Plꐗqqnܗqq(npqnqn -L,M0PSpT $6P~ 6 Rz 0Rw 0S 0L L 0TW* H '!*! '::T6 S1\! 0"!B P 0P W0#D0 %*:#eD @L RpL 1(K0L L  `DzD Y`u Rz 40C4"&R:0R*0a"!B10b@  %R55SSH0SL L R0R01$$0XD0`0óD0D0` 3U  DD0`00D0Z @ 0S@ 0 0S@@ L RL R{ 0ST 0S00D3 R 03PL RTH0R0H0 C <`K0S 0S0Sx00 R 2UA 2 R= 0R: L X` @Tp2 0S 0SG 0S 0@0S 0Se0S 28H0SL  0Si000L0 PD 6TQ(K1P p 0S80S/<040, H!0S 0L 0$1T@Xm 0Sj 08e0( 60P0$0T00p0HX0X[D0(80L0 (0T q̗qqqt>nܗqqjq -`PL 0S 0Sw000pCWp 1VV 10S 0 V0 謡0s1!VLG 10S 0 V? *.X0  0 ( 0R10m~1 R 0S 0S  R0000 0   0 0 0@00#! 0lP0  00#!80$00qqܓqHo|j̗qqnnnq -LM@4 ` 04 SPa40 U3#T0` %*0` $!*! $::4p6Sp1\!m 0"!B Pf 00Sb Wa:#e\V T ,&Rk:0Rh*0a"!B10bPp"000SbU , 4  0  , %R55SSH0SL L R0R01!0XD0`0óD0D0` 1ZF   -D0`00D0Y-00, 000 JW`@4 R~Y 0 0S> 0  0S 14  (K0 00PS 0P, 0S ,0 0S 08  0S `0((Ko@0P10S 0$00qqܗqt>qq -LM` PP "&R :0R*0a"!B10b080 8 p@@@@V  iY I (K**(":10"P 2C 0S0 Y : #50P0 40  0>0S8 #&R:0R *0a"!B10b8 R D08 d7\ ,  \x < <p%R5 SH0SL  0R01&0QUD0`0óD0hD0`e P0`00Q00S8 0@rxV x6 Z,  , 00S000$ $,0P &VW $6 RS 0RP ,04 00S 8 Rr %Rh85S8 SH0SYL R0R01|%0ATR \5V  888D0`00D00 Vo  < <D0`00D0W@\ 8D0V @S40,D0SJ4, ZQ *:$  0S 0S P4P80L 858 D0`L R<<5S000S K 0SH  3L@0Sk 38f4|3P  < j<T囅0SR 83(MW 0P,0 ,P V 2 Z2, , \ P < <p%R55SSH0SL L R0R01X"0ATD0`0óD0D0` "Vu  < <D0`00D0 P0`00P00S 0SU  0S ^ 1Ls{88D0`0D0?|< +|<Pp P I 0!V0   @ + 8 0S 0X08 @^ 0PS `00 W 0P 0Hs 0S d0X  < < 00H,τ먗qqqqqt>ܓq̗qܗqq8@nd@ 0-LM\{P0 04PT@b80q,0 08nܓq̝q P-LPF 10S 0Aq@p`T P 0S ` U  Q`PV Q 0 S- 0S0 S 0S 10#U@T% 0LT# 0D0 0 0S t0X 0S T0T0000H0Pqqq -08PL@8@{K@ p@0S0[ ` @P88hp@`P0[0 0Q Pꤗqܗqԗqqnn -LM@PUq 0!L0P0H0 R 0!0, ,0 1p㴑02C 0S0`< 40C4 :#%4 0C40  0 pR 41T( 01 R$ 0R!  @yTP X@,0T 0T.*(":10"P` PX@@ 0S , 0S X04, @D0, 0S $0$, @qqܗq̗qnq -LM< D 0@@0 TD n 4 <0< 0,0 0 4 * `(p":1 0\"X 2C 0S0O :#5,Q080 P `E <0P |"`0 0Ph2ZG  L0H 0C L0H 0Q 0`,0SQ 0Sj  0S 1HPU 81P R'0S,  0S.@T(K 0SL 5<0P H1Z 5%0C 5%18P0S0S 0(08 0S  0S 0LP 0S 0Q l0H 0S H0XP 0S $0X0P긗qqqܗq -D0L0 -D0L0AQDi6 0-LM0PS KM@P K0S@00` @  0@@q p-00L ` HP`N@^P@@eN@ 0,0 L 0L0H p嵀q\jH@ -LM00 ( H >~p@g00^0L PMU@`H@ $@K,0  $ 40oZUzj K\jqT@ -`1LM0800 0(0K OpP (KK>pP@0(4 P 4 Kp0p , 0 "pP0@@ 0_  Kp0 pP0 00GH- 0-LM  $ (0 L!\ + 0.Lh 0L!.@ L1:40  4PL1L@E@0L!L Q$Q( 0800` E`0(0004 K00q6|jA- QQQQQQQQ RA- 0@P`pQQQQ R@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  Rp@-@P`R p0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0lRQ@P0QP: p-QLM@P` S 0V pxpS`@rP`&0-@P0R0-@P \, 0L 0l4 @P0R0-@P \4, 0L 0l51@P0 p-QL M@P`S K 0V Kp  Kp K@rPp`(Ƞ 8!"(,Ƞp@- @PpS`b `c0#3 Q. a l^#(8.(030# 80 (3#0"P@p.8BA Q ! C2Q -L@P-S'pU#`S PW0#03d g0U f  e00#2 S06"l P@X t@P` r0(@pP@-` a@ \B@-@0@-@QP a0 120^0 0100 -L\M@P`p d5v`^0p(KS P  0W p#83K8#8ẃ[0 X$,8`K("X&3KK0<AZ0@L0"[[[2[x h[[$[3[xhjp@-c@bP`T !L2pQ:P: -LMz -L MKrK K0-@"P#040 $ R ((0"4Sj40 $ R ((0"4Sj 0j 0  /Do -l LM0S 00LH0H@ @@@0GP ,0 $ez n8u>0>0 a"&2 !A  $ t1!1XLa4T X!X1X T1T!P1 Wm !0 4 " 1 00 :0 @|0 (Kwww@(jȰ@qq q,jq؝q@qq̝qqqqȔqqܝq qqB?q#j" q ܓq8u>PjqUUUUؔqHo 6j6j6jqDo0@@@ -0L @R  @ 00  "!  vvhv@C[ R<B? S J<B? Si@vljбj@@ȱ@d@ 0-LM@P |v)Y+8`P:-P0c 0KXP$0$yv @j@(jر@ -L'U 0 hy;؛@lj -LM$@K0P(0$pf0DP `_P@ V 00;000  $K(P(TY0 @0@,((P0 009000u><@@@l@@@̲@@@@ -LM80,$ Q0 t @(@ p-40P@L qT4`  0 tp0DS 3S@p 0t9t6098078:<9 0 \1PX!X t;0S=0<8?<> 01@,P&BQ  @"P pht 0ph|tzt60 @ ptmtxitpfthct60,X^t LZt60,8@@t@@M@B@@`@h@@ı@H@4@@@г@@ -0L0S S S@ 0TLH @DU@P 41Cc:(o@ 0-40L0p0CS Pࠃ @^   00060 ^$6$6`6666H66@666H6@6T6$0( R0@(0 @@@@X0SC @0A P$RFD1R;B0CS0h@0A $R2 1R:BSV@@ A04R SV@@ *@0A $R@@@ A04)0h:;"t븴@ 0-@LB;(0S08āPP%;0 0-P@L.;Q :Qs R0 000 0 (0 B("(( R>000h: R0000 0 ܴ@ 0-LP@: @=0h: p-`L@: P:PUPp p-`PL: @T R0000 0  :p p- P@`L:0S  R0000 0  ph: 0-LMP0 K@0  : R0000 0  0R Q v: R P0000 0 RK0耣6 p-`LPm:@@D@U:t3p p-`LP_:@@@G:Tp -`pL@P PP a0P KPP  0-@PLP 0 :P:0(0S|Q(0S|Q 08 R0000 0 0  0 0  0 9 -@L98 0C8#88 S 9h< 0-PL0@ 090S000 0@@090h} -@LhL p- P@`L90S000 0@@0{9ph4 0-LM0@ PK00l0t0pPw9p0S H0 R>p0SU9p K0`>6@ -L Mp0`$ K@$0 R9  lR0000 0  0R00|Q P P 0S0SP00000PP P 8P0C8 8S P0 =8S8$ R P000 0 0$ RK|6@ -LM@80S ,0 =0S h8@ -L,Mp00PK@` 0 pP KH@K$ 0$ꀉ>6 0- Px@Lg0hq -LPpX  `|h@P @G0 ` P 0xpq' -L4M0 8PK( @`p $KXK  0@p P @P    a,@Tfl>|6 -LpP`@P P 000 00 P$00Cp0Pu -LPp`@P P 00 00 P$`@0V01#Z 0 pzPM -LPp`o@P P 00 00 P$`ߙV010# 0 pSP& 0-PLM@P P D0U<00 0 P07P 00u' 0-2P LP+@P P 00000 0 P0P0 -LMP `pP0 @P P 8 00 0 pP' 0-LM@PP@ 0$ :^  s  o  k$  g@8 0-PL@P P 00$0 P0 P0' - L@P  oh^@-  7 -PLu@@zpp\`+fT W 0m  < q -PLpu@@x``Lf T V i7  q -LMp`H@PfP  `@P 0FKq̲6 p-LM`P@@fP  P@ 0@FKpqd6 -L Mx@T K\ 0T|@@g@g8 4 0@gKhgn,@q4@q -RL(M000 `  L0 \hpP  PP D# 000 p$0@T08 <0$@ Y0H D0  08 <040ph>0"0H@Qt0@uL  R  hpPm  PPe 42 0a0  p$0 @ @ @}P OP\s0@,0  Y0 040  8 0<0 P 0 8 <040P "h 0@,H, P`0@D00P `  p4 0@ P#D p<P80` !(< 0@p#L4P` P`  g@0s PH K `P`(KY0P`0P`gP`gP`g N> -L M0S` Rp 0@ 0SZ" S <00SO >0"0Q] 0+PP7 04SP1Z00 00S= ;<00S9  R00 0S 0 480 00S$ 08 <04@P(K  0PPP"GP0 SP R00 0S 0 480 00S 0 480@Pꦊ> N -LPp`P@P P 000$ 0"U0 P$  05P -LpP`,@P P 0000$P `圖 %%%Ġ_0 P0pP -LM0*S$ SD AS S08 <04@  (0, $  S (S S |>m08 <04@ 0$ $K0 480 @ P``0S<0S P` 0@,P (` ,H`P,0Kp0@PD0` p0@ L#D <P`0@(!(D#Lp4  0  8 <040@@ -0LS@`LtPP `G ^00 R00 @ ` 00  0#40   0 0`P=00;000` P`70:0 0p0p700, R00 R 0( Pe0 00 0 000000C2Cp fP 0$0  `P ?` -0LSPpF 0SpB`P p=  00 P600;000p PpP0:0 00 @ @[@F Z ,0S66$6$66660[0 R 06 P we eP p 0$00[0( $00b $0[ |k Y 4(0[0 Y 4( 0[00[0 BpP pA 0-Ld\P P1\ H1\0 Q@ 0- LP|@ 0\ 0| 0\004PP 0S0SP40044\040 R00R@-@  R R R R R\000QA S S S S SL\00\ R*R Q 00\  R\R R R 0B_S Ĕ\00 "#0  0@801000  0  0  @00000C0S0 -P@L `  Pp@ 0@`p0P n -LM Kd A`  0+pP 0pc(K  1d, , 0pP , c@ DP L ,0 @ 0xj -LM cA`  0pP V c(K0 $Pc  0pP8@0dS,K 6{)[0` S @/+0[0 A RY, [4 00 < 8 YUYp00P P P 4 <0AQ8 0xX _cpj p-LMx@PT x $c>0 0`Q" 0$ eP 0ă \ #\  @0S@ S Q PT $xh!cUP ꦊ>j -LM0R pO , 4 P`,  VP- 0`S0SH8 ⡒P ?4 ☒P60 0  ⏒84000P 0R ,P ,(K Q-LhA -LM< 0p,0 @P= 8`P XßX ^`KD PK=@KL \  0 P@Vh2 s Qh"20 Ghx@T \ 0SY 0CS16666Px20  P Xvx666686@6H6P6X6`6060606h6p6060606060606060606060606060606066 hx 02 0SP U0S gx 0PS@ QQ 0A_S3|gx P0@S0, 0RF(K>0@!08g0h,h0SPgx0P @Rgx gx gx gx ĠGE꼠C긠A괠?갠=ꬠ;ꨠ9ꤠ7ꠠ5꜠3꘠1ꔠ/h@Do@A A,AHA<APAAtA`@A>4AA A@dA\AlA??|AtAAAAAAALATA`AhAA> Q-L@mg@#A -LMp`P`& PP` 0@00@0@H4| (0|`庠p000 0S P W``;(K0S 2W02 : a@P 3  <` :  :aaV W`2 {000 Q <0 @R xRy R   0w03WP@80  2  xQ xP Q R 0S ! 0,K >0"0Q_C 202202  202,04@KS!2$022003 S2ձ02ű0 4P DpPX 80S 2 7?1 -Y 1Da2 `  X1 -E]`Rr0Sn$ P 1!\2:2B2<2  P 0S:`P 000   뼠 :`xOfxP8 X60 Re8P`< : $P` Xꄞ6j>>68666@@-Q@0 2^2S00? 0R@ -LQp`0P/2\,2 S00?& 0R#@P 2`,A`P2 00 0SxP`; -PQL`0p2U2S 0S @ KP 0@ PP 0S  -0`L2SpP P@ "PP@PR -L M P`0p[P  P 2 L 0S@ 0S CP@(K>0 !0Q_P 0 0P)08 <041S,0  p @,0@S 0pS Z   x_ s_ꦊ>j' p-0PL2`S@2@Sp0Q 0Qq0s q0sK r  r 0Z Q 0-LP@ἦ0h4 0-L@hP T,P T0 @0(?0 -00 LQP`p p@ 000P @pR -3LSP`p p@ 3P@pS0@-qr@P\^  0@00@0@0 p-0LM` Q08`000 2S020 23 0S0 0]d03S0 @00hNd040T:P HCdxh4>d00$P8dljjAı@6AAA 0"640 0p0CS0S 0@ @0A $$R0A00 -L`Pp@P P 000 0P0$P0VB000%$00@0P0p gP: 0-L`@P P }>0UP(0 0-PLN@P P  00}.A0 P0=P0 -LpP`4@P P P 00 00G0P0p`0000P N -Lp`P @  0L 0'̠''D;0(T @0pP@@  p-L`P@P P  0, 0f0C P0`Pp@  -pL@` ]PP p @P p  0 0_0C$p P0  $0#$ 0 pW 4u] 0$ R p%0u -L@` ]PP p# @P p" 0$000 R0 P0  $0#$ 0 |pOW 0 $ BQ p/]0u -pL@` _]PP p Z@P p  0| 0_0C$p P0  03 0$ "4 0?pW \+㵌0u -L@` *]PP p# %@P p 0$0p00 R0 P0  $!40 00 pW00  \0u -@Lp \P @2 PP @) p$00 0` S$60666\6 6 666666[ 0  00$;0@T0#30\@@\0 @00 30 0  B.0$@:0@wT00 [0 0030 0 $+ @bT [0 0030 0 $+ w@JT @\0 @00 30 0  B0$@:0Y@,T0000[00 0""Ġ " 030 0 $+ 9@ Tr03 0 "#  0 #200婋b[0 0030 0 $+ @TO000K[00 \0#?  0@= [0 00$ ;0@T-0#30 !  000  00\00    0$:0@ 0u -L@PT [`P e @P \ T0$0x10 R0 `0  $!40 00{XDP@hp0T00 T"" 0T00 T"" 0T00 T""  0T200 T  0T#20 TT T(0T, $ 0T T T8 T<040 TTT(0T, $ 0T@3T 0PT#[0u0S66666p -Lp P`C@P P l 00 P$`峊 C0W0000&4 0`#P p-ML@`0 PPP0\3 : c 0PKp -L M`S@P VP K Zp PP% T%J 0S0a0a010 @ B Q0B RJ 0 @PZP0D@T ;J 0-0@0@PK@2L  0 0 S:;;S @0S 0@0@00cS -LMPp@`$@ {ZP   $0K `@@@@kP $Q 00  00   Z K -L MP $ 2pL@1IZ`P @+ (K $0K@@@ p8@P$ R@ 00$000$ 0S (0S T0 @Y K0 O@ N -L,M@`,@ pZPP @I ,KN 0@@@@ p@P7,\: 4 0 < 8  0K@@@ p@P, R" 00 0<0 ,  08,0 040  ,0 0Q t 0 _@xY(K@qY(0 @eY N -L M@`,@ pYPP @( 0K ,0K@@@ p@P,0S@ ,0 ,   ,0 0 R T0 @)Y(K0 @ N -`LepPˈ d0( 008,d 0U40" O P d 00 <^,0 '7<.>  Y@ P0 0bQ 00  0  1R0XX'88# ,408 0i[  00A?WEV6A 0-DL!88#P!X?@P 0 <( 40bS<0 000h90j -LM  066 -LM) 066 p- 0, LP,@p` R6666p6666660S0C00 <+0400 @0 ()a0B#@q"phDp0000Cs0 phB<00 ()a0BB*0<0ph 4040( <@ P4(0<@0 -LM p,0@L2K 0,0 *PB `(PD@$0;@B@ <0E@20  Pi1 0V* (  $$$Ġ% P@ V :;0 0 H00 0< 0$ t00p`B0 ! <0o2 46S0S V 000$$0P@0,P o0u6 p-DL!88#P!=`P 0@ 04000< ;00@ "@ᡬ"V phy80"040 <p  Mphf8p"@ၬ!j 8 8-#TL%`=@P 0@ K80pA ~=PU A98.%0" "2 3   2<2j Q- L Q 0 @000S A  - 88LM#DP$b=`P 0@ 7p0 wApP@0T X,@ @@S 2Tp 0, <pP202Q TA72T0-.2 Pp W T .2 02 .pP2T02P 2p02 .ip0 \j 0-PL@sA0A0|6 p-`@`0 S00Ɓ0,( L0LP2  0\ 0Q000L@[4 " (000X0phA`6>ı@66 -LMK 0  Kȍ> -P L d M@, &<pP 0@ "7@$K 9T ,9Tz K0CT 0CT 9T 0S@: 79T '|9T Xd9T :c6T/ `ZU0FSPCU@'H6T:6x6T3 p6T3/ @ @Q QU @@P @%UP ` 0@@P&0"  04"400S@  ኄT@T @ TP @@0@@P0"  <(4"4!<0 2  04"400 S0S00Tu@P 0@ @g@`0F,S0T 0P`@P 0 $ R !޲@0aTq4@me/?@g <@b 7@] v@W 3T D3TM@PL@ 0@/@? Q0@82T 0T.  0@( 0 @t20S @ 0P>@P `B@> (2T 1T 4@ 0@1T 1T@@ 0@P00S 0"  04"40  BR !2@S 0p@00 0S!Q0RPZ!  00002  <4("4!<0^LZjc@c Q Q@c ccedA c@qdQ ccc cmhdpd dc c c cQ`dc c k~rdA@-0Q0 ""D0@ 0p@-0Q""H"T *(,d @P` pA-0Q#l#x# 0""H"T 0@P `p0G-,MLQ.#L$@( #H#@@. 0@@ "$"h"DL h`@ ##x#T0. 0 @0 @0,ЍR \ \ 0L_S BR00 0-PL2  0@P  5000 +0C0 P0 000h꠆0  -LM@PP<0 r,8 8#)"Re0!R8 ` `( gP@ Z ?0 20 Q, Y4 9p00 B [@0@P4`0@P/` R.+ Y#8 `P+ ,0@ 0ʌP P@@<@$ P 0@@[T 8 00(KQ nj' p-LM@`  iRPP @  0`I@ Rx p-LMP  `@OR@P P @ 0P/PP @Rx 04<S-P08 <04 1 (0, $! -LMP  RP=  0@P`P 0tQZ   RP& 0 @P`P  Q0S`W S Q 0S QP-` ` 0-L@PP 0qP0hQ -L M0   ,0 LQP * pP  <`K'@ a0 P<0K0 K2 K1 K;@K/PK Gp1@0$P @ c@\ @ NQ@ , 0 RA(K 0@,Hp`0@ PD`p0@ P #D p<P`0@!(p#L4P ` ! 0 8 <041 #000000/Do N,> -L M0  pL0Q`P  +PP  *@K 㠀%0*0K  000 $ 0 `X P K08 <04@0 @1A 0(,0 $00! N 0-0L> h0 @\PP 0P1S1S0h0hꦊ> -L0M0P<0 ,0 00 40 80 pPE0EPP Pp`' @@K P 80K @@@PP @0S 0S 202" ` 0SYPp` JP@ 0 0S<0S< 0 S  S  S (KP000fPP Pp` S  S  SR0D#P<3 0 0 0ZP0@00 W00U ? V0 `0S<00S S_ 20"S  -L M0,0 `[p-@ (K 0P@NP @D D@ 0K ,0K @PPP}@P,\@  1X ! 0X  -N^% ^00000S, , 00000000S 0` 0 @08 0 @0Qjvdud@ N p-LM@P $.N`}D K@L F\ A$ 0P  4$Mx  }$Mx(A -P L D$`(64pP 0@ .@  2V -2Vh <2Vm 0Vp R @.2V 2V 2V @ @ 0@@P2V H2VR42V8 2V_ 2V0"0 @1VW 1V e/>@1V! :10S @0 7@P  ;@Pt1V@ 7  @0S<@2 e@ 00e/|@~ 0"@w Q@p 0 P@i @d4,0H C@jrdAud@pd Q Q@qdQ`vdhdtd@AedAmk~gd)7 -LM  0/ 7)7 -LM) 0" 7)7 p- 0, LP,@p` Rp&7&7%7%7&7x%7&7%7%7$&70SH0C040<S04000@;000 ()a0S7@ˡBphp04000Cs0 ph<00 ()a0570F00ph{(040( <@ GP4(0<@0p00 -LM p,`0@a2a , ~P0 V 0 0D(040 P @0@<0 8@ 40@$0<@K0z0P4< 0L 20  YC 0@Q Z  0 U0$!:0 0 0H0 000< l1$ t00@0@p@60 00 000. (K (Ko ;0 00H0 0< 0$ t00p62 0@Q  R0S0  W,P (Ko R 8#8 S  0 f0  K`$%7 p-DL!88#P!2`P 0@ 04000< ;00@ @ὠ4V ph,02004040p1p %dph},@ᙠj 8 8-#DL$`1PP 0@ c,0p5 1@T0 !22 022  F"'5?,  2<2.$5j A-L@Ql,7 ,7T,7,7$,70 "0 \0   H 8 0@00yDo - 88@#tLMP'Y1`P 0@ +P 2 + P0 f5PP p0W Z,p ppS 2WP , 00PQ0"22 02 ?5+0" W-.{202.PP W2"02P 2P02.y.u0 {Pj - 8 8LM#T%0Pp 0@ p b+ P0" 0" p\  * 0P 20 Rp(PT00` @u(  0 *, 6P,j 0-P@L(,5Q$  0X50,7бj -LM`2`x2t"0 S2p<24XS2֡(92ơ ^,p 0,"0Q000NO" F($0" X 2P 6P@C 2;T@aAO0 00 d0`^O0@G8XOL(@K ky %P(0S!  0P' 0D5 K  @ { X0 t(0 \X 0PDO<O@j7>ı@&764Aud@бj$ 7vdhA`A -LMK 0$ KL> p-2 1C`L P hR0000 0  000 @Tphꤢqp p-P@ `L0S R0000 0  ph 0@p-LP`S47474747474747\O@ P 28 1C0P `0p@@@Aq 0-0@LP 0 oPPU@0褢qnnN  0O   ! -- -i@0IPP HaP P% P `NAP GP #P` AP Pg HP }U JxPl -Ux .U ,0E@Tl9i* (0ES-0ES-U| TTxpW ~0S V9 P a#P AP.U,U`` /U ,0E@TJ.Uf =;'P =7'P VLU" .U* =-3P =)4P- T|0,S 0Pn .UM V/U?P}@dmy wUP \Ps,0ESp?iP4ml ?`P mf ?P m` ?PZlYPV,0ES|0,SPHPL?P ?PD@l@ >?P:GP6@`l2 0JUHU KU0MP MP MP$GPl#LU MU&P"?PkUPN P: MP0E)US+U*UKP L0ESH0ES+PkO|\P/ OxPU@tNpJ kOjP<f Xb1P V E[yPWQPS\P OP@KkEAP*@A@PTj :P 6@ 2.{Pl@*P@%\P !P@kHW 0(S% HP  )`P00NPP@PV@\PTiN`P@PV@\P i@~NpPu$@P @sOP OPzF@vX1Pphx j8P x8P( MP  TP  TP TPX (8Pj 8Po 8Pz 7P! 7P| P;7P6OPg15;P/@`+@|T$ x@uT!q@nT"j@gTcPg H0ESZPVR Pf00LUIP@EA=951-)(fLU"?PfLUU MUm LU!P@* PeL0EpW0E)US@@+U*U T+U*U0Pa Wc?_ Pe00XPv]PrE4Pn&PjXPderPd@P P\PXTPL8dQ F,0ES ?iP| ?lP"Pc?Pc.U,U /U?P@c HzP@v|0,Stc?m P hAdB`,c |0,S?W P'SpIOPb@H MULU NUMULUD NUPA7`P ?3jP|b=-pPlbMULU7 NU5 9X!1Py F!P4b v0@SabP ?jPaxV@ \Pa @@XPaH E10 Sa'YP +ZV P0La0VN)> P> @%L10Saz   10S`o 00 S 00S`a qAAAAAAAA\A|AA,AAAA1J )AAAA4A,ALAA$AA AA(AAAA0AAAAA4AtA<ADALAXADAdAAlAxAAA8AAA@ATAA$AdAAHA`AA<AxAAlAAPAXAhA AAAAAApAAAAAAAA ! P! @ ` K?UGP0a0M P @P(a4A@T-P }/Phawt10 S~qoPayk10 S|ePav? sP ?rP ?hPan ?`P ?bPbd`=vP,b[HPPHP5@Ptb [Pb =uPb=PH?DPb?AP P 1P* P,c& 4P!1@* Ppc@Pc-@?P0c0=vbP@#@rPd; lPd=fP0d [`QP]N@\PXX PddS=R0P =N1P&J" FpBp>pd ?8 P ?3P @.e V@(<$P(e6G@P~ zPv@le| p= fP'@Peq=hP)@pPef Pe`>@/P+fb %*% P!4fT rP@f 3@PLf| qPmXfx?P@|f/ /@l phpf! b yAuBf ofO0P@fKzPgH P9 gD\@B g>\@j 4g8 0,0onnn -B7672P-- -L|M0pH0 @2D@ `{~G@` pG< "8 D`H0@4 C<`N8`ᒦ1!oHafAL 僁!P \ 儁!Qd 偀 ጀ ` 兀 ጡp 匀L X 兡t 僠ᔠ 匀 唀P 匠 \ X厐`d 0h t p0 x 倀H0 匀 hD0 0hT0 <@0ijh800hl0 x40  0h|0 0 pcT 2l|@PBRb0 0 P @`0K/0K.K,K-@K+PK*`K4 (0K`(00K`c"(P@ P @P 000MC(K00gfff(A -L!H L P 4 L P 8 @P < H@@D LPp PP` 0 00 XA p-LM00 KP@4 `0K(0c K"(@P @P 00 BKp00A p-xLP@B0`00 X04 @0P P0D H0H H08L 8@P`  phAe7Te7_7_7Ħq 0-LMP@KဴdPK0 p-LM@ PK `ml P@ 0 Kp -LM@0K 0K @dK 0-L@KM000dP0  `0K v0K 08 -LM@0K 0K @2K -LM00p娡P`%K @ 0PQx0p1x Rh7`h7`h7`h7,h7,h7g7g70x0`VDP00& K0P,% [R- R&0[-&0[S*0@d0h@%[ $!B30b 03dh% [31C03Od0h@% [31C03Od0h@x00x0&0[S dh|j0G` p-LM0P00 #\ K0b`P6[  !nA 0 600@ &kl@ <k08A@@|aaH22 fP@o 38@TL=Ax\@9A00x.AxAAg7ı@(AA -L gkp3A -QLM0P@)0KQ0)0K)4 `()K0"(*Kp 0@` p/P &2*[0 Œ4 0("( 0*K`` p00(K Q0 0)0K)0K p-LM00P`V000K0K4 (0K"(@0K @00[0PKp -LM0@`SP  K0 `K0 P0f"pK0P P P0 0!Kp PPP -LM0`004@P%K&KU0L00C0HP%0K%0K4 (0"( p 0 pP P&0[US20T0@808 <040@ D08`(E@00$Kk7j7j7HA 0- PL @cP0> 0- PL0@X(0( 0$0 0P 00>o7o7p7 p7o7o70  0-LM@TP(Q*0R840D d00 8 -L@lA -L@A -L@A -L@A 0-N@0@@P@@eLᝯ宴0 0hqtj -LM`\DVA*0Q`= 0`0 . ~N0@pd>PP + :#: 0T0!*`JWZ ZV$ K(0Kd啪P(X 0L000S <0JPWZZ Ktjqܗqq p-LP`zP pN@@N^P@@e(0 ph莤tj -LMp@AP;>00>N0 @`dҦPP * 0d 0V0! pjVJZ  W$ K(0K|*P(p 0L000S T0PjVJZ0 K 00b 00tjqܗqq -@L pP,` , ,<0?c `p0p x3l0L#H3d d0T#P3\ \0\#X3T T0d#`3L L0l#h3D D0@p3t#<h55555`5t55L555@5x5 -4L`MT04@0c?0<@ \4<D P0\4@< L0\4< H0\d04@0c?0<P \4< \0\4@< X0\t04@0c?0<T \4<X p0\4@< l0\4<$ h0\04@0c?0< \4< 0\4@< |0\4< x0\4@< 2\4<\ 0\4@<` 0\4<d 0\4@<h 0\4<l 0\4@0< \40< ,4Q? <0 \U? 0  p l0|"0!20 2"p1p!2"h1h! 2$"`1`!(2,"X1X!024"P1P!t82<"D1D!@2D" (1`V pϏ@K048  0@` < 8 0@ ,P 4 s `V40 <,`KLP T@$D@g o d 0| x tp p` T@ X M(Kq5555t5`5L5555x5@5h5> t7,q A808 040 0, ,0 0$ $00 {7z7y7z7z7 {7{7 R!800P500\!400 -LMP@ p 0`40< , P0 S 000P 0# Հ%$    0-LM(0K@P K00P  "!4 (0<\40< K⟢P 0!!40< ,40< \00 -LMp,0K`P0@  "!4<,0 \4P0< \@0  "!K 0S00j0@-tQt@QU 0R PQPI R0ĠC00P0 R 04! 00 Q0@ TP 0R 000R000R000R0 00 RT0 , !160 !!04qȣqqq06@0 - -L@@00S0  "!4q -0L  "!d0@S s0 S #0 000 R㼓ʀ0  "!᠓ 060  "! 0!!0!!  !@160 !!0 R "0 000 Rؒʀ0  "!ἒ 060  "! 0!!0!!  !@160 !!0 R " 000 RO 0!!0!!  !@160 !!0 lQ d! 000 RP7 0!!a0!!  !@160 !! 1 6 0 !!0  "!ᘐ 060  "!0  "!T 060  "! 0!!jqqqȣq0!!H H160  !! 0 1qȣqqq -0L@q-0  "!H0C  0  ! 0!괦qqq -0L@  "! R"10L 000 0 4 R% 0!!4q - PL@`p.8 PP& 2! 0W` `4p@  "&  0@!! B 0@0 PP0  "!I;4q0AP-0P !!,160 !!qȣq -鐑Lp?o`s>J"1d!Z0 !!@160 !! 0 !PU PP 0@  PU0!! & ?o`sZ|0  , !T 160 !$ 00, 1oq4qȣqpqq -X0LM RK@Kb000S  P 9 jĦqhA p-(1LMP@`;Q0S4  KP 0 &S  R0 @ 0 ,9Kp Q  (K31C01( $0 ; V | 0d#@Ph0 T`0 XB(`P}9 @ 0 <w98@`0r9>ĦqAE.AAAA>A 0-L@ `0P|?0d0D!s "Q 0 b 0h>긦qئqԦq(1@- @Ơ3 1C 0!02@$!Bb  @130` 0Na3QM0 RT d00 R00C0 R@TЍ&60cQ*d00 R00C0 R00C0 RYѭhЦq -0L6f 0bSQ0@l  I 0bSp0 VZP帀6b00C 0@ c0 ` 0 VJ0L0cR01 S 0 S$0`` 06 06$0`輦qnqȦqئqnԦq̦q -1L Mq1d 㬡 1\0. 0`K P'0  "!0P00@T V 00T 0!eÁ0`S0c!S0 0!!0@0u # # 0  0 06 &06&0C68 l0@ 0@(T0 (KDJoĦqHJoq MbqB,Ajnn4AjH7qȦqjЦq06 &0C6 B&0600 0 S  -@LP  -@LP 00 p-LM@P7400  `P  xh7`p0@0h04 0\040 \0@ 4h0\xhDAXAA -00 LR 0ap3 p-0LM| @0x0D L0p p0P T0h h0@`(PKX \0H`<a@<@00 ( $@ UKp777X7p77t7A`67 -Lh0040 \d -Lh0040 \d -L`{dPPU 004 ,@ 0;P0 410*0`PRhA0S 0P  ?0 :K 0$$L04 P T0*4\@dplpt`0 H`X``h`|`x``` $3 d0l "3*pt`0 L`H`P`T`\X```L6D6<545,5qq<AܦqjAAAATA -40LQ 0=_p3q 0- @LP P 0  4     4P@0 -RL M@0 , 40 OPDpp W? 0  P0("(R R ! Z` % `Z0  Ph0 P` P  ,4000S(KV 0 p-LM@ `$0KP K0 0K$% P$0 F4Kp|A -L(M` @0  P (0340 5|*0P<0 QWÙ0 ,0 10 40PUO 0@   00 cp08 #0R00 <0 cp, WÙ ,K80  p@ 0<00<0 80\  ,0p30 40PU< \|30|30 <0\3(K8#8@ 0P 4 ~ 83|30|3 4 uhjAA+AAAAA p-<0`LP@ ,0 phFhjl7 p-<0`LP@ 0 ph1hj7 p-<0`LP@ 0 phhj7 -L@ `TpP  R T 0L P `0  0 8#8ST %3hjA -L@ `TpP  R T  0 P `0  0 8#8ST2hjA -LM`PV@p  0SPV0Q: 0L0S:1  20S $K0 @ PP`0 0 0P  0H20 ,2 2hjA@AdA,A -L M3#@P `D0@@@ #0 @@@q08O0 0 0&30S 0S30S 0S00|3 x0n\0 K|PKh*2DD'2|,#2,$2|AAhj@777@ApAA,A 0 000$00 ( ,077H77@ 0] -@0L  1nA -LM Pp 0 4<L`, L,0K T0(0K$ K$D@$0S 0L< P@((@1 KPP ( @ @P 0S P0S 0L<   00L< Aq -0L`PVp# 0S @1@S 0   08P `V\k10P @T 8`14 0$T0 0 jAq Ajj -\0LM 0 K00   00 0 0 s00 0 0 K(j@7 -@L+1q '1 AA00  -$ L@1 hqı@̩7 -40LQ 0J[p3q0  -L1(A -L1HA p-LP`P pN@@N^P@@eƠ0 ph,tj -LMp@ߜP:>00nN0`@dqPP * 0d 0V0!pJVZ ㎚W$ K(0K|ɛP(p 0L000S T0JPVZ0厥 K 00b 00tjqܗqq00s0j p-LM@4P 0 0   P TxhZ0-g`04 `,0P x xhG0 lAhZ!AR 0S p 0P p0 P p-L M8`K@P #ZT080K@ 002K2K0 K1 K\0,,0 -P D 02[2[   0Kp/0uA AA p-L M,!@0PSKp8`K Y43@  U002K2K0K1K8 KX0,,0 P @/2[2[  //0u8 A Ad A -L`,P P@ P P00pW MP ,YY( 6HJZ@00;00000Evv,!00 A6 A -Le Y<(00谇>((< 0@ 0@ R-T % 0>0>@>00>00 > 0><01H $q!Y,PPP 4C.5mS/q !A -,!L80Pd(qV 0 @)0?zh/ 0-01LS@ڼP01 0C01L#h01SᠭP0 -LCM⤁1 (a$ @0!0P$1KR7`77777>@L3SD,<00 @)a0u|01001$ 0R: K Q  IOK,  p-DP!88#L!e `P040 4304000< ;00@ '@|}V phg p 0<(嘭P040q @3aphp@{Vj 0-L@P5៭ᰭ00茵7 Q-L@ Q ,18,H`,C,18D0M/j -$0   ' BDo -LlM0MO01 x ,x ( V ,0 40,!0 03 ;PZωQK0 R0 S 00 0C(P R00L+,,y10S00x +> 3 4 44 @4@@ 2k/@H_8C -LP`0>@>0>400( ^01<$q,P P 1S777$707S , 0R7(KK+I+E+41 (010AS0!0cS01 $<S0!,@P`< 0,1KKOK , <x@*t>*h:*`7*X4*HM000jDoj4j8j"A"AD#A8#Aı@#A$#A"A>8 00000S0C00000 000 0003 4 0  <040 0 @00 p-L `@PK$0 000 0 B4 p8ph p-0L @` P 0(0000 8 phK -L$M# 200l1 0(K@,0 ?PLŸR00 y00! (Ÿ0 +'00 c &'0008 < 00i10 > A00H 3@E 8^B4@ 0  @ @Sd'@ ,0P 00 00! (\ 40S 0  0&<8@00i10 0 >@0400:@e3&3 0004 \XPH}<,(ȯ7t$A$A$A8$A$A$A$AX$Ah$A`$A -LMp 200l>@ TP 04 @`=Up20 P( 00  Z0@6 0T R P0000r P 0 ^&000U@ 0@H&0@000h$KP 0  00 00/&000R000I0$ P` 0 0@  0@$ 000$ bQڰ0?\{P000  0 @%&ȯ#AH%A%Al%A$A$A 0- L0P@Kx0hȯ p-PL@8` P+ 00 00000 0 (0 S0$0@00 @ ,00( 40 ,0, ,00 40 0pp77H7 -LMP \`Qp @p @T V4 0`D @5% PT(  +%\j; S Q Q Q K 0<0 0PUQ W \P\ 0l@L00Tq@P ;; S" 0 @0E8 U:S00P 2UP 30E8S0E8#X8UP 00Q108#XQ0 *@K VO ;q0 9a0 0[0 0U0 0O0 0I0 0C0 0=0 @070 010 <+  0pC p>0Sa00 RLPhWD0W@ ;g80Q= 0Q1<  p-0LM R3 00S 0S, @P`0S0C00  0AoQ*0 R>;  S0S0C00K K 4 0 Kpn njnnPH 0P 0Q \0SX0S  |j-00 Ƞ Ƞ,1XP |j -LD M\`@ %(4\ :40S P 4\# 43\i B3\ 3\ 0p0  0lP K3\ 3\ 3\ t3\@< S0< S< 0S@hP43\= 3\ 0\s 3\0SJP2\ 0\x 2\2\ 2\M 2\|0P       00  0P0 0       0 00p 00lP!0p  xPPB 㺿q0P0m 0R 1  hyP`PP8Z0P     00 M   0P0  Bp0| 0|zPP{ 2  垢h Hh0(K 0 (0 $@ PP3 W W WW @W W@WWW@ W @jW WWj -LM\ 0\ 0\ XP, 0 P0\ 0p XQ 00S00XP 0 r 04 Q}f~fvt|f 0-LMP@@0@0CS08X8@- @.@|j -h0L Ƞ Ƞ,A0S 0400=00CS0/|j 0-0 (("ALXPU 0 X0 q\0S 0 0 P P |j&A Q-L&A - (L(" PP#0AT PP 0SP \0S X`VP 4p90H0PP X`#P|j p-X@LT` 0 ! PaU  2`Pf-0S0Sp0 ph, ph000S &A p-\0LSPx0SH1  X@T% 0S" 0`0CS0000 R00'-0S/0S&0 31C P0Q!ژ 0 S00 S P0 )pP0 002 nB&Ajlj7&A -l1` 00x 0P SpLpW900S3 1h0h0 P hl 0 p0 0 Bt 0 @P/h0 |0@00 RWP lhs $㥽h00 hI000Pc$Fj&Anjjı@('A n'A'A0Q 0`c 4S @08#<@8oS: S>; SP 00S> -L@Q 7777p7000000<000000000000000000 -<00000@ L  pW`V 0S \ R P0 U*\  (0- @L ?h< qq p-Lj`P@T @T' Q0000 00001P 00S0@T{ ;P0   qqt(A p-L+`P@T @T' R0000 0 0000P 00S0@T`<\ P(@T0  vqqq|(A -HL@ @03P0 000,P 8Ljt(AHj 8(A(A(A0@-D0P <<<@P880@P 0@ӯqqqq!8 q -LMP@~0@DR00}/#`B1T0 0=2$KTKʸ봁p0`S0 <20<20 @20@210@X0\P`pd`00 0d0d2S: 4 0@ P(@T0S: 008 R 0 +0 <20C<200="Rh=00`"R 000008$KmuT 00=r0S d00=r00T 8004=r$KmPj(A(Aı@lj8q@)A)A )A0S0="R00 00 0\40  40 -80 @00L< PD0< 0D0 @0 -D0008D0 L<00D0 <0@  -D0L0@80 00@-00D 00 00@  4@ 0D@ 0-L  P 000  P @% ,D04P0D000@-D@P @  4Q D@00 0Q0-0R00\00^00L80 R2 1C -L00 00L0S0000L0S0S40"00- 04 P#*0 \*0S \0S  -@0 PL(0  00P0P -0L 00 -Q  <2<200C<2<2 L<2S 00-0^  0S 0S  ^ 0@- 8 ȠPQ@#,Ƞ R 0 S0^ ^00 -L@? 04 - 0SL*@T 0S0P $ )A)At)A -@LP 00P 00)Am|j 0-@LPf0H0 @H0P00@0@0 0-L@OP/@0 -P@L0(` -LXeפ\0I 0\0 R0X0R \0 S08 40 L0 T XK 0P @P \\e ߤPX| \X0 AX0\0!m` d0XgWe@Ta "P@e㋤Uqg8J8+A -L M`QP I0S@)pK$0[S I0@S P K 30 -#0LMAD(0K0CP(K #@K'K&0K%K$K"K!K`@P  K p2 @P0 0pW@W  @ -#0LM`AD$0K0CP$K #K"0K@K!K `KKKpgP K @2 P0 0@TT -LM4 @P0 `e `PPs ,0 00-0 X3,  0 P0? @./12 00 `Q 0XS _ 0S[  R00 !  0 PP98pd@ 0pP5 2@[T0 1 00, K.@D 0pP 2@DTP@D1P0@, K}7 0pxPP  (KX! 90S%  PT0 ^0 0 S  Q 0 S > P?0@S@0?080S? B4100 PP0PP   P 0 1 0 <`P 0 0`"R 00d014 00PP ,@K  >@+Ap+A -LMB4( @pT TD+A P-L 00 H>@8n -LM0K0K⠠P.KBD/K -KNL`(pK0,PK+@K*K)KPP(0S @ 0DĠ)K*@KP(0 0$K -LBMPpQ@P` P(K!rJKI8 ,K 0P,0pVp?0@CVT JK 04("8  00X00S" ! 01 R101 01XQY QP@S G [-0+1X P@0Q0U0SU2G? P0U0T R 1\\ T 0\0  0S 0 4 \\T 01[Oe,H 0KhP!  -LCMXJOKP@D`K p0,P 0  !@,W@ p = p<0d ,@;E0:PD`d  Td,@ d ,Pep ,@ d,` 08 , 0R(KDo+A+A+A+A+A8> p- L@`  P ;p -`LPVp $@T-x Qq TqHV ,qt@+A,A+AP5@0@- @ 0 XPX ăP Q0 S $0R ^0 0蘑>X>R R0J4J -00LT`V( 44j pW0P0@0 PR@ 0WPfb8Pf^0PfZfW0 0T0 -00QLT X Zp`000 PU XP P @KX0@PpZ` -LMT p4 000 P 50 @0S0 0S ,4  0S'`T00 @B P P0  DPZ P T0S 4 ` 0S(K V 0S 0' L  M K mP> P 04  0 00  0`PP6 T0S  !0S00 0  ,  0S00, x0 l 00 P{00 <u~00 (o -A<-A-A`-A,A-A -LLM`0`,0 P 0P,P8 0S;_0`KTpK`0K_K0 ]0KZKYK^K\K[KR@[0p03T0SbPT00TT+8Pf+X 0Pf%f"0T0, 0RR(K 44f BP @f ;P 0\ 2TH0S 00S 0SX K8PXpP< 00S T0B 0Q1 0CĠ YKZ0K) B<f P8 <X 40 `P y f㦞qb00>0S Sf ĞPa T>p00  P0S}?d0 00  00>0S0 S1 C00 ^pT p 0pT  P u0 hU0 R0@0/T 00Do.A-Atj8.A.AX.A >h8.At.A.A -@Lf 0S 0 S Q0 j0   @   ,D  -t0L \ |0x  -t0L \ |0x  0-t0L@\P 0x|  0 00h p-@0@0LQP`' Q 0CQ Q  t0V  ph0 000000p000ltmt 0- p0@0L0 S*$0S (S 0(090S PPt00S |xPl0< 20000 S0jĶj -L~ 00s ^ 0 Q-L@>q :.A/A -LM@@Q LDH04  DMP Kv8 -L MP@l81 RR` 0S @  KR @P (pK$K 0 t0\  0x| |p$00Cs$0 (0(0 p$ ,P  Ķj/A$/A 0-LMR@P 0S Pt00t0K0@^$ R0K h0  c ;t @0t00t0 l0P 20SH# 0KĶj -LM`!p00Q@ R K t0pa`V \'H0S HP`#P t00t0d0P 0 t0\ 0Kx|` 00 X@T |@\`0  @ \_` ^ \p`0 @ j x8 p-LMt0P`\ x| 0@  0 @!xxl0 20xĶj -LMpPW@` (Kl `P 0q`Pt0 \ 0x| 0 0 P`Z(1@X1 1X1 0CX ``0X& ;1X`0X! 0X`00S `0`0`{`P00e`Ķj]t@yt \tzt  0-LMTQ@@i0@0CS088j 0-p0LA0SP 0000l40  0P0CS0jĶj 0-p0LA0SP 0000l40 0P0CS0jĶj -0L @  0 hB|j 0-P@PL@P 4@@PXP -XXPDP 40S DP\P 40S 0\00\ -`@LPp XP ]0@0CS0 W t0 0B)t0  K0Q ڈ 0SP00S PU@ 0@i 0iW 00Pjlj8 0- 0LSP@ us$ 0 (080 T 0<0 4 0L0 P 0d0 h ,0t00 x 0|0000 00 000hD$PQ0H<0 R< H@\  D0%< %0 0b 0l00l  3 05 0% # 0-1L."0  R@ 41020!0D0 1s s 0 P00S S Sd080 00SPD080< 00@c00800jHjkj 0-@ p-h0L   QT@0 j0`0CS0pzpjD -IMLPM@T, pQp 20!00Co 0P P PpB H, 0R(KJp0S 0#0 0L0" "#3 0"0 00pS` p ᅻ R@0T0W0S T@#T@!PK E kpP pH@P-p 0"0 0L0" !#3} 0!0 00pS( H@p@`T@! >pPKHD0PH<%@H%PA  0R0W0S: P:D0@`T@!#PC P #P@ P H@0;P pg 0 SP1[#U# T JNK@DL0D @D @P pP4U D A #p=pPp Pp p-h0L   QT@0 0`0CS0pZpjD -1LM 2, 41 2#0pZ, 00 D0` P  00S S@<P f㈔0<0Zp 040P@TP:U@j -L0M 0"  \ }0 QUy 3 RuD 4Q\P040X 3" 1 <  D00_ 0S\  < 0C?V 0SS 1"0<0X00 = D0p `L 00S2ꈛ88@88XA  0D9 f F8 <8 3p< hŸ@0@ @"P <f8(K0 JPXȐD0401L0X  0.P 0$, ,0!C@b@A@ f @<@HD@ 0P/0 `Pp0P@4 . T@,P8#004!2 \0P  0 X@L@0 4 0 00`S<fビ00 0PQ0U 1Q "Q0PP0R@PJ5PU@DZ tjH`8Ѝ8 -LM0@P 50S QP 0S P1 R  @@E K P!K@PD`,M!0[S4p!0[pS.0P( KsP("K_P"0[S(@ D0"[ 3à1"0  0(0@ ^PIt/A> -L1 g2S p-P`L@ @d0Pp -L` $Rp |R60h t44p0S* QG ^!1P!B00^ꈩ880888p0S:0 $ (U **0DS;Ȫ888T8 8 0U T񟗾`8l8t8|8888Ы8ث88880 @0PU Op T;808h8888Ъ88ȫ888<pX0 0C\ X0 d bs0t4 4S 0t4x4#ptX0 0X0\ Te  Is0t4  p[^ 0 ^8 #8t$,R10 tt$H^0 x40 ^8 #80:^ 0 ^8 #84.D,<*@(8&L$P"H d0(l0h hh @rpp@ p@lPh rlP㶏plp8 0 $@\0`/ h x4$S 0|4h 04Q t4! St0t4P0x4t40CP0110t |, h rl0d 0 l0d 0,0h rlhd0d@"tDl xDV/A<0A 0A,0A0A 0-PpLP d@KTp@0hD -LhM ` dPPpK l@P <0S SZp0S$KD0SlV@P -LhMp t 4`KP?@P @0S<p0 St0 SX80K 0SX@(K -LhMp Pp@`KP p0S<0SW,p,4 00*Pig0P$K - 0Lq 0Q 0s00 00 0\00` -LML0S  $@T0K@4KP0A -LM40@4 00 -LlMp4P^ `@ cS 0RKK Kq4@K004 0@fDo> -LM`4Pp00 40pPP c40@ 0Xq004 4 0PP! -|1LMQP d1Q& 1CQ KD1Q400Q* Q< Q@0 0 & 0$K KX 0$ S;#0 0 qQ Q Q@0 0  D0 0  0P D0 0 4@ 0@T@p0 KT` VH0 0 H0 0  pUDUU@ 0-50L0@ 050l PBUlPPPjTPgLP LLP8P 88PDP f㒍DP0 -LM50`0P@050l  Rl  @KHP f㧍40D@PH@ 80@ @P@0xP< @ Xq  4L0P@ 0gPP 0bPTL8 @85DfA50p050PlpP8pLp PpTP Tpd8 0-LM@P0K  ;T Td0DS Q020C0 !1*h0\ 50K08  < \0A Q-L@Q x0A0A -P8LP&\Pfߌd\ p p`@h0!R h 01dp@\` Qp-L@` pdQ` `P h0!R Pdd` QP0p0p p-LhM0 d0 @P`Kd0T@P:Kp -LBM P0004P`p  @ X 0S@00SX 0@SP~   00S~@ 0@S@0s 2R~ (K$ Kf0( \Po($\`< @P_P0d 7TP2TL"L .@<+f ]Ph~ 0Td@H0uCKp H0($ 6PpH0PHWH0PT08` H0 1<K!4P h0P180PW @0 $(P0 $( P0$ (P 0p0 K0p00p00S S Sm0@$0 v$f P( $ nt0p0 p0  _`@0$0 0T0H0@j1A@H?,1Aı@@8480A0A0A$k0ABkk@1A - LP@ P 0S 0 PPQ<0P R 0-0 ((L"!@0S1s s 0D0pP80< 00@C00pP800Hk\klk 0-@  0`p 0RCK,1Q $1Q 1QQx xP0x0000 xP 0 Q000 0KP Q 4 @0R0 K%P|0-0|00|00|0Do}fpUAUvtnU~f> 0-LM` @.Q@@v0@0CS088Hk 0-0LS@D0PU 0 LTP 00L P0 0-\0L Ƞ Ƞ,A0000P0CS000Hk -LMp|0@`, p 4 @0@R@PK 0PP@ P, 0R6(K㫰PP0S0-| P |  "0PS&P |00|0 P R@0T0U0S T@#T@!PK P ӤPP $ ϯ#PPDoX1A̖> 0-\0L Ƞ Ƞ,A0000P0CS00Q0Hk 0-D0 (("ALPPLf㧉xP0Hk 0- 88 #PL*0AT 0S P0PPP Df 㱉|0L0|0xP0Hk 0-PP@L |0 lxP  0h臠0|0µl~xP0 0-50L@0Q!ڌ 0 S00 S P0 X0ѯ0P0CS0P┵ jlj8 p-0LM<00P00@4 K Kw`0 *@0 $D0 D 0H@ Kp<8`1A`1S`-T1S0T0 cB80K1 0 !p0@ 0 1SWpp# 0P@Iφ  0 pΆ  0 pOφ  0 pRφ 0p p(K80S00 1S480K^Eφ0 1 ᆕ1A p-L?L`@P€ j 00@0@p -LM0`S qWDq $ D  H PH!2@  D 0(KP0RFC Q<00D 0W@ !mPA \> R \ 0S0S  QD(K0 0F?C, D \\ P \ 0S 0 S  QD( K00F?CD \ ojD1S BT\1S ѭ`DP ]K0 \  D@T(KK KjD_W - 1LSPp @`1 1S`@ !*jb1S 2S a1S 2S h+_ jYh6_ jYh} 0-a1LS@P \PPP͆0X 0 1Aq 0-DPLMXa@ $K 0$ P  \K0|k7 -@Lp`PP DW30, Xb10Ya1P &@q8 0 qQ Q 0S 0-@LPnP h1l!PP @  P@T0> -`hl1pPQL @ ,P@T i> 0l 0-LM00P@K4uU 㾬p8p8 p-T2@SLPP`004T2S0L P2ph) 0-LMt3@S 8PKL P  0x8 -L|M Q@pP` - Q `p 00L 0` KiW@ p-PQL@ t3S` L`PU ph#p p-1LS@`P 3SL php 0-@LL50P0 Q-L@ P0t3 -02LM<00`00p4,K( KP(@0 ,@0( ,D0( ,yH0L0@,(0 $@ P@P h1 R8 \1R #Q@:1LS 500. l K0 S j#Q0At 1S 0 @HP0$K,(x @P $0 X0X UUP03H03 \8Sı@>T>|k>\88 -LM@K K= 0PK R00 1p@-QA 1CQ 1Q p00S0C0p@T)^&Q# R `VPU1T^QRT Q V U 0SS0SSp! 10! 1 0! 10! 10pA !01 !01 !01 !%W A W@00 -LM P `p 0S`r "30,0 0,0 H$0 D0@@<<0di1`SS1S Q qAW 0!0llFf0 !0dd@f0Spp@AH P0D S00 d24p0@S0  000 0S 0 pS リ,@0 0+(Koҩ 00CS(K1S0000 P 0-LM0@S P 0 0S S S \K L 0P  K00( H?@1Aı@T81A1A1A -LM` ! 0@000p000 00P,K l#0P[PPi(K, 00@00$ #0PDP RS K, 0000 S >0 P "0 PP p ,0< 0S0000#000 P 8"0 P ,00S0 -LM@K KM 0PKY0S 0r0Ss 0Rr0 ZR R0S0w000S 0{ z0 0$S$0w00 p-LM8P00 K^X`!KED`!K K0@KK`K`K`KPK`K`P[Kp -0@SL  1S01 1S P 01P P1 0C110C1 M2A -LM@P  K8#T0 0 @0700 <Q Pk p-LM8`0@ FTN!0L0QPSM@N@O@P`RL0@Kp0S0 00 0 B 0 R00 -LQPp` 0 1 s@N=00 00 00 00 00r`  dr 0@P00 <Q A p-LM`PV800@0NĠL0MQN`O`PR`S` L0@`NKp -LMP@U`p10@0<0NĠL0MQNPOPPRPSP L0+K -LM@P  K0 08#T0 0 K00 <Q P -L M0`S@- 0BS*`888H8x8888  0K@i RY0S 0S00S S S 00 b0K\T T 0R0 R LcD 0@@P  RTXpWd  00 b0T T00 =T1  XT%  ,T[00 TK0Q0  0T700 @ 0  0T5 T 00Q q 0@0  PH 0PP_ i[  ~ w0Si bd00 05@ 0@H:S 1S t3A2A2A3AH3A 3A p-LM0PS@E 0BSd8808L8L8L8$8L8t80S `bT00@0CS0000 0PP KphB R 0PR 0($ 0,0Kp 4RC@ 0T\ @`840# <S  j i(h0$k0V 7O 00+`@ES0U B`@ 009 0($ 00,0 ($0 ,D 4EB @3AUSBUUSBS3A3At3A4A4A4A 4A04AP4A -LMpY 00 4  1M HĠN=0S 0e U0 Bd0g 0C!f00 CR  , C h0C$P0HHLjki Pmno@, s`p 00q0lrp4 ` 0Ԁ0 0ؐ000䐊D d 0@P00 <Q A(K k p-L`@P0PS D00 U@@@0@S h0@0T`pQ1 S P { -LP@`@`P@V0p0CS00S Q @@0 @2aVp @T #p0}0W1 '}pA - 0LS@  !P  6P 0S00CSPPP  -p P0 0L40 8  !n@P 0X0 Y 0\0 ` 0S4`P X0S 0S 03X05:S PS 0X0YP XQ Q #3Q0@S񟗒8888800CS888888T#0LT 0S P0S@ #0P=  X0S 0@S4P|  Z0P<  X0SQP> 0@S<0S =Q X0S| S~ 004 D0PS4< @0PLX0St 00`@YP`@> VX 0BSP2 X RW .:R,1T0Y 0BS788888d!`!}@!{T!yP!w0Y0R0Y0N0Y0J0Y0FP< iniX@Y@\@`@Y0PX0.BiYi>0S=}`0T04> H0'P 4A5A?4A$5A(5Ah>5A5A5A,A5A0A\5A@5A\> -@L0 0 4JS00X0ĵX0ĥ -L@40S 0 0$ R 0R  R0Y00Y0 0-L M8P?00ED0KB0K KK@K0KKKKPKK04 -8LMȠ,Ƞ#83 2t> -@L00hQ -@L0S00@ES010,0RR00,0,00 ,0S P, P0,0 f0,0 -LM@Q` ( pSJp88882 %㼠 +00 " 0>40 01 0@0 T0%(KQ, 0 R*$0Q'0,00 ,0S P, P0,0 (KoFf`0,00(Koh0e0 0 !0,00,085A<0S8<0R| -LM @P4`0S3$pW00 0=0 0 ! $T@  0 P0(Ko"0+ R  RW\s0,0(Koe T@$ 0AP(K\85A p-L!M` 4 0PS  0RKp0 "K@KS PK1Q K1@K L4 0 AqxFDo5A> p-PL Sz@`@ @0k02408P40012` 902`p88k p-LM`2 <2PK0@!2 00004  Ĺ00CS0xxx6 p-LM`022 < ;PK@ 200004  噹00CS0xMx6 -L(Mb@T=0KKP4KKK. K0@KP@K@K@K@KK -LM6`pI $K=004K40K3KC0 & K00K.K-K2K1K/K=0P4K4K@D0,K.K-@K3PK2@K1@K0@K/@KP08 R06=04KP.K\@ 03K-@K2@K1@K0@K/@KP64K,KP6L -\ LR`p@P<0PS 0\ <0R@ Q-L`p \ Rpp@P<0S P\ \ pPR@0b0 -LM 0S  0 Ƞ8,Ƞ#8 P 0> -LMP@` P d0b0(K, KpP 4 08 Ƞ,Ƞ#8 6 8 2 ,,;0P4帀K\0 2@>K ` Xp PP L H0 d D` P6 = [>0[4S\00\0  >0K 0S/ 9 9 9 9 9x0[S\0w0\0@PtpK [10ERt0 T  !B200 p0 l p0 l !15\ <R@Pʃ1T0 P0p0 tP lP 0S;p@0@S,oP  0S00S0@pSWXtK 0< \0 S0 00 I0T0 0T0 0T0 0T0 p 0l T,S+Sj(5A$6A0>kH6AJAu8u8?6A6A6A6A6Ap6A@-@0 , 00\#^? 0-@LPl30# 0 0-PLD<P 3hS CT zn0@Tk0 0-LM@PH ?P  K0HT 6>P  HX \? @PP  Tv̠\34/ P?6A7A907A9 -2AML@`x3Pp0 #|Sx 0x#C40tx3`7N``  tcP N 4/DK303'\9P7A p-@LPDPh3S 5  `0  BQr0Cp P0`FQ0S*DP 5 ;%55;5p 10R!!  10C1 -@PL DWP Dhg p-L@DJP_ e`jh3S 3 30S 2 Sh#oph訜p0 -PLD`p @P <8W;H8 WW" 0 0@0@ hW iz0 0@0@  p 2S0Pih`7h7A p-LMP0 0@0@`XZ0 K@tn7t 1S&?Kp? -LD`PP 8@ U UUpp#R 00@`0@ 00@0@3 03CPU\hC' 0s7A 0-t3P@SLpS|S DPt Px 070 -@RLp` @ ; 0 0Pj PPPP7; 1 W7; 007A -LM`DpP.P 8@ U UU(K3 03P(Ua ̠A\0L  @d 00KP 00 X00S0 0@0@C 0k븣+KA X)0[PU)PK00 0C00 0 00 0@00@4  [7P tP  ͎  [42\0 0@0@97A 0-@PLS 47P 3S D4P P 070 Q-LD -LM 0S  0 Ƞ8,Ƞ#8F P 费> -@L Hv30CS3hy3 0 3Vv -L M@Dp`KP K@0FD@*0K>0CGT*K" K)K(@K'K%PK$0K#K"@K!K&pKP -L M`D@$pP K@0DND)0K?0CHT)K! K(K&@K$PK#0K"pK!K'K%KP -@L {  h p-L M@D`PP Kp?0DF"0KB0"K K!KK0KPK PKPK`KP [0[ p-L M0PD`0K@P Kp?0DF!0KA0!K K KK0K@K@K@K`KP[ 0-LP z@@T T ;>  ~$ f& ~b;> (0h˛~ V'7A 0-8P=@L8 XC ?(\P 0P=\PB\S`P %PA`PF0`3dP PDdP0d3P Z03P 03|P N0|3tP z0t30h30  \P  p \`P  < (dyP 8A8A(8AH8Ah8A8A p-@3LP%D♾D▾ 8`@O g,00S 0@ڡ~30CS3Hp⇪G -8LLp3 @@ TP, ` P`=QP@@0$gX  P` 8<8 iQ8<8 -LPDuP8@@ ⎙po @6T8 1 *7P. 7P0 H q j f\3S 8@0;8᭘hmT @h蛘,h蕘P h莘8A8A -PL`D@pP@ !x1T 0CT'  00@4T- j,1T $1T0/R@% = S" @S+ @X 5l3@505O0 R0`@5@ 4@D@ 9l3  ~l3   si 5i 6i( -@LpP`: &< %_ ([@@T ( T h9A -LPD@`mpP   %5@ (1@@T ( T &W@H$9A 0-@Lg  30S7 \ 36S$ Q J DPP;> 0 08#8 0hg, $  0- L P# @@T #  T !0hZ9A p-L`@PP@4U0@p -LMP`pDS @P 6 K2"3#CCCC ccr$ Kw@P4 08 Ƞ,Ƞ#8F `$;>H!b0C p/p90PS00ST#0@S$-Pf   0PP# PX#P3SP T3SM X3SJ {*@K} P H 414!8!,1,!1!0` `;1! 3 1_0p@$#(3 A 0s> 0ee#R  ,8ᓠ 9᎖]|Y lT"0"49A99T9A>\9A9A 99\9(#9"9#9 9 999A9A2S -@PL ,߾P ,h -\3 @SLd#Xl# ,iP\ P` \ 7 -t3 @SL|#p# ,NPt ȾPx t7 0-L@P ; $1P ; 000@ -LM`4 ,P@|P08@ U UU(K PsUx $ H04  屾44 ,0KP,p 0 0@0@  ppRZ@tP  C џᨕ,Q /08, #x Q @ 0KR[2[ :,: 0#AS, Qp0 :08#x0c, ^PP0 0@0@ sH:*99A Q-L, -LM P  0 Ƞ8,Ƞ#8! P t> -L,ŽP h p-PL8`=8hrHP zP>H$PDHcLP oPDLPJ0L3PP cPIP P0P3|P 0|3tP н0t3dP 0d3\P Ľ0\303pTC TC  H߿P TC |TC dLοP TC @TC (P彿P :A9A:A@:Ad:A:A -LM?`PB 0,8#8႒Ⴁ @ j"K2KT,K `@@LQ`30 o0pPP j@dS \`3L/  p[\寿P ;(K0K2K`,K QpꂒႡ j `3 =p303't29 0-@L3S 5  P0  BQr0C0 P0 5;50PEQ 0S*DP Ň5 ;%5 10R!!  10C1 -pL,P`ᚼP ⶔV VV& 0 0@0@TS" V i8h;8 ` 2S 0 0@0@i0L宿:A p-LM0 0@0@P`TXm0 K@\\ 1S^ᶓKp:A p-3LP4LPHPPP,и,=͸@3`0CS3:8@O b]00S 0@ ᯚ30CS3!yp⸤6 0-@LPa30# 0 0-PL3S CT &d0@Tya0 -LM`,Pp̻P @0?0(0K(0K:,CJGĠHC6 (K%K#K"0K!@K'PK&pK$K嘿P K 0-LMP@0( P,(4S  0P,  H0P,  08 0CP,  0P,< H0P, 0P (0P" 0-@MLP 0@xK 0q 0@k0h @e,(1[#4S>  <00@X,x 0 @O,Ko <0@@E,e 0@<,\ H0@3,S 0|@*, J 0@!K0 04@,9  0  " -LM`0PpT3,c @P  08 Ƞ,Ƞ #8!3ί3SCC5m3S3CC3.⊻P |1$K!l30 p/pW0`< 40S@00S@#0@S0EP   0P<# PD#,# 0S;9 4㙒 υ0~p O0pr _ *@K@0@ 0υ(|?0T]M  0P`81!81!1!1! 3!1o0p@$#(3 A!1s3 0Z`#R*  !-ማ ,. ბW R*@K0@${x0>0m"0ڟ"pq8[xY04it>D9;A.9\9A6 `0@;A?TB91939tF9E9C9X59(59d)9;A`x;A`;Al;A(;A -LMDq0,K@8 $0 ^N,娹P $ 0R? K 0.K-[.0[ 4   2S< `8` 0 0`P PPm 0K Q 0 U ADoP> l> p-LM@s_`0b7Pi l7P 0P=3( Pc3 P]3 EPWt 0KN? [0[ [ 0<0< ?P TC XတKp3#4"0@ ?ӽPP TC ne τ0 !7PT]T Hx3t7. P%ty8@0;S8>,3 RT,90 ;A;Aa;A*9;A -PL@`p<1T% 0CT-  00⾙@4T  0T 0T0/@4T5@ @ @ @50@5 0 R0@@ @@i 5i 6i( -p0pLM@   8@ 3#0S 0S S" S036?0 A0S  S 0 8BP (h?   -@PL 0KP 0h[ 0-@L/P \ 30# 0 0-PL3S CT u^0@T/0h[ p-L M@0 !DP_`$K0 K$0K<0C@K#K0KK"K!K PK@P  Kp\ -L M?0!DP^`p0(K(0K KD0#@K'K"0K!K&K%K$PKl@P   00KA=A(>A=A0P>A>A>A -LMP` 0P2@P3TcXC\Ctf2pcl3tCxC/ɴP hp K4圴00P R;J<330S@VP 4`d2"91!1 0O!03 BdB( KP4pL v ;1!$31/^(# @,3#t!t1 s廘 0Y#R=  㩙ᵑ 嶚 00S#0@S4:P   0P|# P# A$ KP(0$#!$##Ġ"2"0O"gQ9 ?AX9\9A_9[99Aa9 a9O9L9K9K9;A -L@0AP hz 0-@L9P=9XP P<垵PASP P@哵PE03P ݴPC凵P03P 03P J03P 03P >0300 n h\P ~ p_x \YMP o <Pi (J>P 8A8A(8AH8Ah8A8A -LM0r:: @KqG:P0$` ]G0 ::$0 TG30 @ c3XP @ @8P J K303'[9 0-@L4 5  P0  BQr0C0 P0 5;50PEQ 0S*DP b}5;5 10R!!  10C1 -`L0@P9P UUp UU% 0 0@0@ U h藉9X;9 - P2S 0 0@0@h肉4Nh7A p-3LP4PP㽳P㺳0☮06╮@3`0CS@39@/N W%40S 4@ӑw@30CS@3Ap‚ p-LM@׉Pyib7P% y7P( 4| ?₶P = Kph4 ?r`P - KphKphKph3\/ `DZ9@0;9㢚Kphڈ6A7A8A8AH9 -PL@`pq<1T% 0CT-  04m@4T Ẉ0T 0T0/.⢖@4T5@ @ᤈ @ 3ᙈ@50@5 0 R4@@ @FC@i 5i 6i( -0SLU@p` wE P F%# EVE P hX hT0?A?A p-LM0@0 P`KE P |?[x%#EE PF K  [x 'F K?AP?A 0-LM@ ?qP , K0 2>bPP  L̠3,/ Pǰ6A7Alh9 -2QMLP`x3@p0 |Cx#0x#C40tx3 7^``  嚰tP پ 4=KK303'e9x?A p-`L@"P 5  P0  BQr0Cp P0 5;5pPEQ 0S*DP {5 ;%5 10R!!  10C1 -@PL P h -PL`p֯@P 8W;H8 WW" 0 0@0@[ h<W i00 0@0@ p 2S0{i h7A -LMP`喯pP K0 0@0@\ 㦇0 K @t7t 1SG? -t3 @SL|#p# Pt zPx t堯7 -@RLp` @ ; 0 0PV PPPP7; 1 C7; 007A -LMP0,0 @p`P 8@ V VV(K303嵰P-V[ ̠A0 L @N墱 ,0K`匯 0, C 0 4 S,0 0 0@0@Cp 0P먃0 0 @0@,00@0 0@چ0  _7P tP  y K0"0 0 @0@lh97A - @L#;7P 3S 'P 㡮P 7Ů7 Q-L| -LM 0S  0 Ƞ8,Ƞ#8 宯P Hk 0-LM?0@ PK0KF0K0K@K@K@K@K@K&PK0?A -L MPp@S /P K!1 @/@1!3#ss K@P 0PS00S#0@S 嵮P9   0P# P#q&@K`ឍP b d0 8!0 1!0@ 0p`D H? 0A49Ao9q9\9A9A,w9Xd9f9Le9;A p-LMQP` ?0@0 0K 0K0@EĠF K@K0KKK0KPK`KzPKp -LM`pክPP KG@0HD (K(0K'K%K#@K&pK$K"PK!PKXP p-L M@`iPP Kp?0F"0KB0"K K!KK0KPK PKPK`K7P [0[ -LHP i@0``pk`p@_@P@Pm@P@PoP 0 0@0@ p-L M0P`0K@P Kp?0F!0KA0!K K KK0K@K@K@K`K߰P[ -LM@P K@0  K0KKKKKKKK°P&Y7A 0-8P=@L8` X4⃕P P<5PAS P P@ *PE0 3$P tPC$P0$3P 03P 03|P 0|3tP լ0t300$  P  p \ P  < ($ծP 8A8A(8AH8Ah8A8A 0-3L@=e8P@00S 0@>ᲃ0Z p-LM`<  <8 0@\(3  ?bx0@Q(3 P P@ nP@++!(0U(Ph00 8 @D ?4x,܋;;1(# (#8j -LPΫP8@@ p" +ogd @%T8`   >7P( 7P w$ #  "  3S 8@0;8 hɔ@ h,hP h8A8A -PL`@pkP@ ㅃd1T# 0T  00₌4P@ ς5@(@ ǂ% = S2 @S# @ 5@h3505b0 R @ ᬂ@ V0@@Jh3  ` `h3 ` i Qh 0-@8=PPL8X ¬P<lPASP P@aPE03 P PC UP0 3PP 0P3HP 0H3<P 0<34P 04300[ 7P H3S 'PH 㡨PL 070 p-i3LSPp㓀`,P fY0,38@ 00S 0@e 0i3pR -LM 0S  0 Ƞ8,Ƞ#8! 哩P м> -L@ 7P/.P ⭺ hr7A p-LMQ8#H`@0?0 0K 0KP$4& KPK0KKK@KK`KKp -L$MpBK娮@P/50[6 [$Rx(K,K0 KP,P i ̠8Č#Č"̌ 0P s  T,VYX!0\J <̠ČL8 ČD"̌#D!L  0@P K ,,.YP,<4("!4l̠ <($Č"Č%̌ 0aP " L ,Y ƲW8?A?A(@AP@A?Ax@A@A -L MpB]P K K3@P  0PS00S#0@S P   0P # P#`庹 3S 3S<尹 ,嫹 0P 圹3f1C XP,& *O@`ᾆP 傹 |0| 8!t0t 1!0@ 0p` d0i3a~,d~@A\9A9A;A@A9A@9|9~9AA p-`PL@ ͳP b!P0 @/D0@ R phM(ph: 0phrDo49AرjH9 -@0L"MK K0KKKKK K K| K -LMP&/00P00 `@p3 488S  P @,#;Vp `0 0   Ki0!B!O0,0,Õ(0 0P"  Ki -LM8P@` KV~@υ 0p@8/  00 00 s@ o7P {7P z3S 8@0;8Kh}L凸Kh|}4倸Khu}lP Khm}8A8A -P@hsLW`@ ~l1T# 0T  004P@ K}5@(@ C}% = S1 @S# @ 5@$3505q0 R @ (}@ 0?@@Y$3  0D   $3 ?   i Q, -RLM R R K0K 巨@-,3S 0 0@0@ٷ? 0-P3P@SLL`SXS PP `PT 070 -@RLp` @ ; 0 0P= PPPP壷7; 1 嗷*7; 007A -LMP, ,3` S@(8@% R2 RR t3 S% TI t3@!-~t3 S0t3ʜA 0  @2冧(K`T0,3j <KtÅ ,0Kc? ,,L, \ p h9,  R 0 0@0@ 0 0 @00@ |0 V7P tP  o )0|0 0 @0@А9XAAP$ ?`P β (寶Kph{Ų 妶Kph{埶Kph{嘶Kph{<38 / `_8峦8@0;8Kphw{τd ? @喨P  ,iKph^{7A6A8A8AА99xAA 0-@8 =PPL8X P< BPA S(P P@(7PE0(3P PC+P02@P 0@38P 083XP 0X3PP 0P3001 + P " p \(P  <  (P AA8A(8AH8Ah8AAA -`@,sLWP@ r{0T 0T  00o4P@ z @ @ z5050 R@0@@ F@ i -邡ႂLM0j`@PT3p e/00 T\  @00 0! Q " $K0j 0T y@j@Xc0"!B PT3(/LL  4P別P $Kl30l3̽>'Ě9 0-@L,3S 5  P0  BQr0C0 P0 5;50PEQ 0S*DP m5 ;%5 10R!!  10C1 -LMPp,C`T Kz8V;H8 VV. 0 0@0@  V) y$K 0 P p `$0S 0 0@0@ 2S0~y0 0@0@(凥h7A p-z3LSPpNz8`@ 00S 0@'ˀ0z3yp> 0-LM @P ¢PP  0 Ƞ8,Ƞ#8D  SP 8P 80 SS8h> -LMp`r P团 08 Ƞ#8,Ƞ -P?8@K@JP pS AP 0$S0S? 0Sp0Pw ,0S@,0@SP(0VP 0S(0!#媡,0@S3S B02 `R@0S2s5P  @ 00S0"30S @PP0pi@P #$#0`S0@0S$#0SPg   0@0S#0S3s $3spW3s $3s NyZ` O?K0K0C үPOKX 2$KO0` @KN< $8 #44"<,K ,0 032῀@ 僳1!8!1!1!0@ 0P`i0z3fx Z0Sp `$K233SCU PLJ0 $00B SAB Qa0B7 BSW B? 2"0 P2O T)H%<!h>*9A|9ؙ9X9|BABA BA԰?AAPBABABA -@L7lS30CS3h蝥3 073zSP0劝 p-@LP0`kP 5@00"00p3,F`30\# p 0-PL0UPX3xS TCT H0@T30hE0 -qLM0P3@0` C;QA40+ @/033H   q303¢3@0CS3T ᦮ d凲0 K< a<0>3039BA p-@LP0Px3S 5  `0  BQr0Cp P0`FQ0S*DP j5 ;%55;5p 10R!!  10C1 p-@PL 0壟P3^ w`UEx3S \3 `30S P2 Sx#PȈphwpt -PL0`py@P w=W;L= WW" B? 0@1 A ߱W iv< 0@1A e pP2St]iv3H03卢30CS3Xh7A p-LMP0 0@0@`X婱Ew0 K@彟 1S)vKp? -3 @SL#|# 0堡P $P @7 -@RLp` @ ; 0 0P P?PPP[7; `1 O7; 007A -LM`0pPṞP&U& UU h0l0h0[PCUK 0Ÿ0BD0  @303E30CS3'(K,0K P),0S 04 C, 0  > 0@1A R"0 0@0@ᅣh@ 0h3D03壡30CS3n꿠0R P200 @0@, t@ @Wv =7P P  :i   uz0 0@0@97A - @L#97P 3S 0夠P ,P 7B7 0-LM@0PP K034038 D0P { \P30CS34< H0⫢PP f HGP<D3,9. Pd6A7A9 Q-L0 p-LM@PP` 0坝P Kp@ĠF@0  KK 0KK`KKKK3 030 Kg3P0CS3ᚢ -LM@P`P 0npP KLN@0 ' K#K(0K%pK!K&pK$K"K3 030(K73P0CS3j -LM@P`pP 0>P K@$L?0 KK$0K!K#K"K KK3 030$K3P0CS3; -0PLM @ K@b0P[ -LM@PP`p 0PU x @ JGĠ0 K KpKp  >   7O p-LM@PP` 0ҜPU xK @      K0 k% [0[x -L M\a0@0 0 奜PP 0RJK(pK  0=   -,3S<=h =  0W !0[$<<P!0K PP[| K?0 Q0 U ADo> 0-LP0I@P 0( ! xuT @ 0hlu' 0-5@=P5LUPڄDP P1D匞P6DPHP םP5H偞P0H0P 03P D03P 03P 8030x30膪 hgꀪ TaDUP w 4Xq RHFP h8A8A(8AH8At p-L@Ps`0/9 0 7P  sp7P spn f ^ 3AH0S D0S 5@0;5rP㤄pjP rp8A8A -`LP0@pOP@ is,1T 0CT!  0te|@4T$ r0T 0T03.⚀@5 @ p@50@5 0 R @5@@@ @A@t@8i 5i 6i( -d0LPt`$0♗0▗ s3p0CS3=@3N @&t0S zyyIrP∃ -LM 0S  0 Ƞ8,Ƞ#8  P > -LM`Pp#0` ᝧ@P 0垚$K2C3C7SM2CCS3( KY@PL(0 40 0 Ƞ8,Ƞ #8tě?>4!080@0<0 `R>S4 0@S4P/ 00S@8<0S80s$ <0s! @0s dr.@K 0pP 幬 qШh岬@L媬D姬y0塬  tP1!=1!!20" d303Nh#t` l3P# 0Lc  0p8@T#R   xf{P | aqN"0"԰?89AT9 CA9>?AxCACA9A0PAT99 99ذ9Ģ99099QM -PL@pq!1`R101+q7<0!0 1SA<@10A/00@ 0@  q 0-@8=PPL8X HP<PAS P =P@ PE0 3P 1PCۛP034P r043,P 0,3 P f0 3P 0300 «ۧ 弫尛P ҧ p峫̧ \孫 塛P ç <夫꽧 (垫咛P 8A8A(8AH8Ah8A8A -M3LSP` 8@ R RRpp\30\3娚PVh>PC匧 0l\s7A 0-LMP ?⼝P w XK0 ?⭝P h I@ 1>@ P_@P Q T2ˠ,034/ @,O6A7A907At9 -2AML@`Pp 3 S3 O\\  Ԙ(P  0KD30D3X9CA 0-@LM3S 5  P0  BQr0C0 P0 5;50PEQ 0S*DP Lc5 ;%5 10R!!  10C1 -PLMC`Tp >p8W;H8 WW" 0 0@0@᧦ h刪W i|o0 0@0@  p 2S0ijo 9h7A -3 @SL #$# {P P 7 -@RLp` @ ; 0 0P PPPP:7; ?1 .7; 007A -LMP0,0 pM`Q 8@ R RR(KP30P35P=VL ˠ4A0 L @Η",0K  , ,0 0 @0@, 0@ @zo0  7P tP  ]b x0nPC 04P0 0 @0@t97A - @L(8#V7P ,3S 彙P, 7P0 7,[7 0-M3LS@8@ 0#oP7P 7P 3S 8@0;80hkn@o0hen,i0h_nP 0hXn8A8A p-PLM3`S p0 0@0@(I91S phW? -p@MSLU`@ n0T o0T s0CT@ n505 @n  Rh @@ n@ @@ @@ ni 0-N3LS@0n8P@ 00S0u0N3m0 -LMP` WP ӨR!1 `/`$ KPP$0`S00S#0PS$PA   0P" P#壨2S+ 3S( 3S% 5n; 00! 1>p!80 ` 00P`@!0@`tKuNcmm8p (k49A\9A9l9999A;A -LM 0S  0 Ƞ8,Ƞ#8 P k -@L7H30CS3hӚ3 073H -@PL 0姕P 0h跒 p-@LP0`ᘕP 5@00"00p3Y;`30\# p 0-PL0傕PX3xS TCT =0@T30h;0 -qLM0@P `3C ;R' @3H /  妕3033@0CS3T ۣ T弧0M K<b<J30398CA p-@LP0Px3S 5  `0  BQr0Cp P0`FQ0S*DP  `5 ;%55;5p 10R!!  10C1 p-@PL 0ܔP3^ l`:x3S \3 `30S P2 Sx#P~ph:lpt -PL0`pᲔ@P l=W;L= WW" B? 0@1 A7 W i l< 0@1A pP2St]ik3H03Ɨ30CS3ᑙh7A p-LMP0 0@0@`X~l0 K@ 1S)kKp? -3 @SL#|# 0ٖP SP y7 -@RLp` @ ; 0 0P/ PyPPP啦7; 1 剦7; 007A -LM`0pPP&U& UU h0l0h0啕P4Uk ̠AD0 L @.30330CS3(K 00KPc 00 q(00S0 0@0@Θh@I 0 )h*KA R()0[ 0 0@0@00 @0Ct00 0 0k V7P P  ^  u j3D03彖30CS3መ0 0@0@97A - @L#9&7P 3S 0P eP 7剓7 0-LM@06PP K034038 D0P á 夥P30CS384< H0PP  H句P̠D3(9. PX嬕6A7A9 Q-L0 -LM@PP`p# 0PU?0@0(0K(0K FH0%K# K$ K'0K!K&`K"K3 030(K⮖3P0CS3 Kݗ 0-@LMDĠ DKD\0KKPK@KPK0 -LM@ NĠ0KKK@PK -LM 0K c P K -`PLP@p 0|PU T T Qt0T 0d dThT T4 $ 7L>PCABF -LM @0K@K@KMP [0[K p-LMP00P Kp@@ K=  ,3S< `=` S |O a$`P @@q P 00 @  01 0 0 T&* -LM@0K @c P[K p-`PLP@ 0ӑPU @pT T Q0T 0|x ?@T@pT T<_ H( H7PCAd>BF 0-LP0啑@P 0L@ jT @ 0hj.' 0-5@=P5LUP-zDP 5P1DߓP6DPHP *P5HԓP0H0P k03P 03P _03P 030x30ٟ h庣ӟ T崣D娓P ʟ 4嫣ğ 奣H噓P h8A8A(8AH8At -pLP0io@ @nT  e L7Ppgh7Pe\h ?3t6H0S D0S 5@0;5ChPzP 8h/8A8A. -`LP0@p᭐P@ h,1T 0CT!  0tq@4T$ h0T 0T03.u@5 @ F@50@5 0 R @5@@@ @L@t@Ci 5i 6i( -d0LPt`$00gh3p0CS3a=@3N A6ut0S 3pngPx -LM 0S  0 Ƞ8,Ƞ#8 _P |> -LM`Pp0` @P  z0$K2C3C7SdB2CCS3( K⹐@PO(0 40 0 Ƞ8,Ƞ#8$?>4偐080@0<0 `RCS8 0@S4sP3 00S@8<0S80s) <0s& @0s# g.@K`.0`pP  g- t@ TH5o 0  tPn1!=1!2 0"d3 03Nt`h#l3PH 0Lcjt  0p5T#R  WucmpP xdv fF"0-u"Eu49Ap9lCA9|>?AtCACA9A9Ap9$9<99999|9D9R00Q00]Q(0R 1RH00U@XPy}Q X0]S | -L M4!00PpABdHD*0K*K!0C" K'K%@K$K#0K!`K)K(PK&K"pK K -LMD0 Q!00K# "0C KK0K400@@C K@KK0KKK塒K -LMTS0^4pS@0NTGd!0" $K$0K#K!PK`K"K pK@K@K傒KT0STS0SSR R R -LMLp@` P@ K4P0ED!0 (K #@K(0K'K!K&K%K$PK"KI@P # -LM(0KC̠C$C0K00K@K: KKK0K  000K0K< S00K  S00K  S KPKS00K00K]0SR RRdoh0Si0 So n0$R H◠p @000 000X<<0hCA -@dLP ŏPdoP 0d0莜 (odcP  fCA DA -LM`@q d0S Kh80Ld0 @mPH9 -LM@0@,PK00`p$P 0S T$S0S00 S00 S00  P$K@T 0 S0S0s@ -L+8#+ -L Mp0 P`(K 0  K 0 SGT 0T@ T80 0RK9#9 L`P`"1tP8iwDo>ظ@> -LMRL0L`i@0pATF@0 $K$0K#K!KPK"`K pK@K@K匏K -L MpHPg80Sv f*( K R xʖR KRd, ,`@FT0N@0 4K40K3K/K2`K1PK0K.@K-@K^PC ;PZ   \\< SP ASPLP0J@0ED ` 4K40K1@K/K3K2PK0`K.K-K9P0@1K2K 0< 0 @20K1 K20K10K@00@4K 4K3K0`K/@K.0K-0KP (KS(,K%p SP  SP(,Kp R ʖ R K R0,0 0,0 0,0 |0,0 yKR R0,0 r R 40R 0,0 j0,0 g0,0 d0,0 a -RLM` R R KSppt0@0NFT@0 $K$0K#K"pK!KPK `K@K@K宎 Spp 0 -L8M萟H0\`,0 @`K0A4p @[0K`K_K^K]K\pKZKYK兎PP , 0R(K=̠X K00 P 00_0K 0C`K\pK[0K^PK]PKZPKYPKfPvDo> 0-L<P\@010< < 0000 0-L@ @QP @AD弟 00C00A0` `0S -@DLP x0D0 Q-L@ DPw0H0 -L8M @TpP(@ t (Պ`(040 S0 80< P X T 0S@ qX 0 @4S@0L0 0S(⸊PD 0 0S00Q00S= T 0 <4S@00aD0 0@SX0sC T0sJ 0LS00\0 ^Re00Qf00d0SH0R RRD}f e 0f0f f0f0 0 0f0f0f0f0<`<0f0f0} 0-dPLU@ DP ؊PD傋PHf:DP0蟗 ,倛ꙗ zDnP AAAA -LMd0@S?@0s D0Sf L:LH<@ D0 @xP$hPU30$`K0D @p"K K$pK#PK!0K0K0K0K圌P0 0!K KKKK"0K$pK#PK卌P K0 0 $pK#PK"0K!K KKKK{P: -LMh@^0Aa@0 K0KKK@K@K@K@K@K_K -QL!0M# 0K"0C KK0K800@@C K@KK0KKKCK -LMX\0~Xs ^S  8p@0NTGd!0" $K$0K#K!PK`K"K pK@K@KK0^ \0\0s  0Q0\0Q X r 0q03R0#S0Q0X0R R R 0-LM8P@0E@0 K0KKK@K@KPK@K@KދPK0 -LMPp@` UP@ K8P0ED!0 (K #@K(0K'K!K&K%K$PK"K嶋@P  p-LM(0KC̠C0K`C$00K@K: KKKP0K  000K0K< S00K  S00K  S K@P 0\0s X0s KpS00K.00K Q-L@ `Pu0d0 0-@DLPP 9DHf80D0`P u0`00 -L4MpP0@00pD T0 X0 娒@P  ʙ0d0(K0P9 0P 0S 0@S?0Ch0 h@4 @P4܇0`80 R)0S&4ӇP  @ 00S@ 0 4L0ꪕ 務0d0 兙0d0 ~0d0@0sZ 4<0SF 0`80 R@00ST 0@S 4哇P   00SX X0sG T0s> 0\0X04\0 1,H 8p 4 00 < L D @ ,P P" T 50d0i/0d0c |P4 ? 0d0Tx0d0N\K` `0w`GP 0d0A<0d0;4EAEAhEAlDA<k8FAEAFAEAu8u8DADA -LM 0S  0 Ƞ8,Ƞ#8( 屇P >Ra00Qb00`0SH0R RRD啉b a \  0b0b0<<b0 0-`PLU@ DP PD奈PHf7DP0” ,壘꼔 坘D呈P AAAA -L M#1@R#R1K Qp ` 0 3 Q p ` 0 G Qp ` 0 K Q- p ` 08P00K@0EDK(0K<0C(K K pK`K'K#@K"0K!K&K%K$PK弉Kz 4 (` RR00QS00 -\0SL@H P PPSR0XV0 0R0R00R0 S00S0S0 0S0S0<<S0h7o PDhFA -LM0&K(K!hP 0@p%K'K(pK$0K#0K"0K!0K啇@P&0 &̠0$@K#@K"@K!@K(pK'0K&K%K儇@P K9 FA 0-@( LK RPT ږ RM %ʖ RF K RB 0RF #KR? R;       < S$ SP00 R 0R R KR S  S EP 0    0-LM@K! @0PK0@K@K@K@K0KKK@P  圕K0FAQ@Q0SQ550055QP0SQ550055PR R R 0-LM0@P 0KKK0K0K0K0K0K0K庆@P r SK0FA 0-\PLU@ 0DP PD4P Hf>4DP0Q (2D&P H )AAAA 0-L M?0@/PK0 K0KB0@K@K@K@K@KK0Kq@P ) K0 GA -LM\0@S @0s D0SV00P KV0.pP `K0 aV0PUf L 0 4LH4@` dD0 @P @ 0ŔU BTGA:(GA Q-L@ XPo0\0 0-@DLPP D善Hf30D0XP p0X00 -L4Mp@0@00pD L0 P0 YPP  ${0\0 K0壂PZ 4 ÂPP  h0\04哂0`80 R0P0s[ L0s^ @0sO 0504QPT0 h1̠@ < @ 0p , (0 4 D 8 $@ P0 V 70\000SL 0PS4]P   00SP  S@ 0 4L00\0 0\0TKl l0rX\0\0H0\0~40\0x4EAtCAk8FAhEAlDAu8u8EADADA -LM 0S  0 Ƞ8,Ƞ#8 塂P t>RN00QO00 -LMT0PSD@R 0Sp` PN 0O0 Ki萖RR K@ Kiop塓0 `p@ 吓0 S0 $0冓dGAGA HA 0-TPLU@ @P P@iPDfs2@P0膏 ,gꀏ a@UP AAAA -LMT0@S<0s @0S Kf Hz2HD4<< d@0 @[P < /:(GA p-LM8PK K"ED@0` 0 K@K 0KKPKKKuPP@ + Kp -@8LP }m080 Q-L@ 8Pl0@0 p-QL!0M# 0K"0C K0K 0 `K K0K0K0K0K@ PK0 㽂P @TKp p-QLMP !0"  0K K3 #4K0K K K K K@ `K0 㘂P @TKp !0"  0K K p-QLMP !0"  0K K3 #4K0K K K K K@ `K0 hP @TKp !0"  0K KR- R R mHA -LM 0S  0 Ƞ8,Ƞ#8 P > -LP ׌幐0@0 K$ KPO 0 Ƞ8,Ƞ#8 Xs$~@1p k6Au8u8$6AlDAHART00QU00 -L8M U0$ S C0KB K0C BA0K@ K60 `?0K> KD0CD B@P4K=0K< K6@K5PK$4S ) Sc  SF  S07@K40K3PK4A~0PSF@  00Sp0@S941~P @$ 0R K SP @S S040K3@K;@K:@K9@K8@K7@K 0 30K 02 K10KN n08@K7K4PK0 K/0K;K:@K9@K?0;0K070K` 08@K4 K30K:@K9@K4 H0K@P0PP*H@ 0 ;0K0C70K5 K0 8@K40K0 K+K:@K9@K3K2K1K/K.K-K,K 070K4 K3@K; K:@K9@K8@K040K0C3@K00K(}`P@ 0 CKL0 0D@LKH @@q@Hp(}=}zhDoIA> -@0L@M 0K ?0CKK0K@K@K@K@K@K彀PK -0L@M0K 0CKK0K@K@K@K@K@K奀PK -RLM R KV0SV WV0^8pS@0NTGd!0" $K$0K#K!PK`K"K pK@K@KxW0S W 0-LM@0@SLR RR"K00S PL@ 0 0 S *S<K0h‘HK0h 04SUT >0U0U0 0U0 U0< -L8MTK@p40x00  4 08 Ƞ,Ƞ#8|4 |PPH 0SE 0 80D L P P 0S@00SL 0@S4|PB   00S5 SP 0@SP0sB L0s? 0@4`W@V@0 P!1@ ,` ( 4P T@ D < 8P $p l< K$ 0S%  0SUD 0 4P0 t⋍0@00SH倍@|0@0 t,>@ku8u8IAIA9AIAQ Q  Q0 D/H(0$ 0,B$ X..-08 ?0R<  C480X.. 0-@LRL P0CQ 0S0hR/ =8X8/ 0-@LR4 ,0RP / 0mX0hQ4/0/ 0-PLR( 0S Q0@@Q00/ 0-D0 L@R0P 0000SCX0hQ'D/ 0-@0L@lR0P 0000S-X0hQ'D/ p-t0 LP@TR`P H 0000SphQ X0 'D/B p-PL@2RL`0 S RphQ0/<  W. -`LR0pW ͠ @/\8P^xp 0 XpW<0  0 oOQ0  oGQ8/qhJAB|JA -|LM kl1lA ` P 0{P  4儉@!00CS0K| + ;0 {P  i@0 ;0\ P|{pP n pO@d@d %͠0 +L0  pwiy@D(('6A7A(0D:07A4(8(E: 0-P0| Sx0@0L \08yP %v@0P 0,0S70 (((('$(JA 0-|P| 0@S=L X0yP %v<0P 0(0S704(0('8(JA p-0P@ LR pnNT` TT  ĈT phMᎎ 2S0phM<@< 000vy00CS0A{H(h7AD(( -L d  C0?`% V Pm%-{b$K0S2*@KP0RK"K2K2R4 0R0SN2K?2K*@K02K00C SBO:O:O:N:O:O:O:N:N:N:O:0,"02K0"K*@K2K 20S` 10SV S*@KK!PK0`20pLK&+W?F K4K"xP`V000000 R  B h1! K 0@] 0P `u 0@P @ h0 RQ 0*@K2K0"K2KE      '$$(JA'($ $ (('D:. -2LM ?Rp` 2RS 0RD Bv2"p 0 00@0ᏱT2T"@ [0P8B8Ÿ   @Ru-0 0@? S+ 1 R 1R4 -d0CRD 0RI T1 @1 D$K0S@? *pK2K"Kl1 *pK2K"KT1PH!0S01R 0R0ASS:S:R:R:R:R:R:R:R:R:R:R:R:R:R:0 00 00p p <8# $ $(.. ((D:'(' -QLM0`(!($K1p 0 ?% X00DP\Z,0@ /, ǰeὰP 0 +  tvP 0( H堆 4%=㙆>JA/.$( (('K:JAJA -LM?p`0 \`,0 M \@1Q  A1(A(Q0 t%0 10Q @>0 p0pᴠᶐ,0@000U0 [@0P}@ 8p  @t i\0@P@(K(Ko>'//$(. (('D:. -2L PRh x R 00 0000ScKuP400,AP uP%uP00J嫅JQBK@p0긁 噅겁 哅ꬁ |卅ꦁ h凅ꠁ T偅ꚁ @{I(D/D(//(((KA8A(8A8Ah8AH8A8A -LM@P` P Z KspP8 1!@! 0 `p0C `d!(0CP\1p p pks0`S @00S ; 0@S ]sP   0P0  P0 0   P   PbP `TL0  @!49A''0/4/((\9A/8A9A4KA8AI(8A: -LM 0S  0 Ƞ8,Ƞ#8' sP >- 0S @Q 0 S  0S k?#=?c1P20`<Pr0` -|LEMpp, rP #<, 0RI(K(1^ L0p 0 ̇ p00@0 1  -LM%PA0AS`0  IŸ pW}  0 00S0N I. 0@ BT0S*8S 0A BT>0S*I  0p0C 0H 1R0' '  $8$80C0C$8$80 $0  0$ =P05 uI  0p0C 0H$Q ʢ5;5 1R0! !  11D0C0C11P  =<$ K@P P  1K ptp01S 0 0$ BL 0! xL! 01H 0 0HLD 0 0@0@G@  s7PB D0S <pp 0 p0 !0G@00 1 ,K -`0P| @pULpG?CqP HZoD0P F( 7P 76  Q-L 0*o -QL`@pPp8 Q Q  |0yw ,P0P A`0lphS A00 0lhlq -L M@pH`#T'Ġ$$H0K/ K+K)K.0K-PK,pK*@K(` F|p jq 0K P \0 @`.o'r (0K@`Won.F$K  -0LMp Q@  0R,K01g _K3 0PP  H`K(3 T0`PP +yK %ZDo  @> -2L`o0PS@0@0St2 0S\2oP   0@0S02 0SPP~Mp 帀1G P㵪1 0 0!001!@XXH80` 058 P@?*. *hoPd1U@=08 0``414!801!1(!(10@!0Ls1!" q0  B0G ` X0,5G 0@W0  @00@0M0 @000hmx=9A$kŵ=4^:D:a:hh:L:Xi::|42TKA -p1LMh!p`A$ p0S@ R K$ KP;$0 SP@! `$0`0dS$0   S@ȠK8#蠑ࠁ,Ƞ@ 0PP|PP K8 #H@ h0@fPP0  0,V?Cyx$ktKAKA -L M@03 @?K -LM 0 @K@.P[K -4LM,2 (B`( $ p 0S@Q$K( KPP  0w1l K$p P0R0O R3 R? R= 1d'x 0R0O$Y.K0 PP 0A P 0  @x5/j 0.@K@P (0 S@181#1K#8!#8! PpP T(00dpPP(0 $ $ktKAKAKA -L M <#83  K p-LMP0`@C-0P ZyP ~x1YlKpB- !mPXπ L~ P0S00!0000 P P 0S PKP0[SSS0 # > R K 0P 0 R l0 R g0L L74 0(749Ak\9ADop:رjn: -L M0 @" @K -LM@`P&pKUPD0w P!0[S S X0 K -L`M|K`@P  P, pF0@A$|0KV0Cy Kx@KvPKu0KzKw`K *@ 0@@ P, 0R (KG4s0KtpKV tK ,WDoT> -L M@Ƞ,Ƞ0@ }K -L8M0TpKP`0 $0 @,0' PKRKT0KQ@KS@K;: JK3: 00*0K*0K& Kp0o0 /0)K(0K0'K%0KP $ 0R  KU KKPU0[SVDod> -0LM @RP `Ktp 㩧0 S K U0 0KP [PP -@LP C5p=`5uP lTmp\@P lLmpF( HC Ci>B 0-8L@@0P`0A0_gP0PzlD0Pvl00S \pNI0 -L|MȂ0PKp (0 Bχ 0@P ( 0R$K蔠Kl X2X" 0Q0Kh D2 K@K@K @K K K@K21Cc!0 0K#0P+ K0KKKK@KPK|9S@K SPK00K&MK@``KP21CcP U `% H)KHIdPE 0*KK,@K)PK+PK l @P  =@P@PP 0PP@P 0G@Px| 0>@Po 0P6@Pg 50P.@_UDo>* + p> -LMpPA5@%dP)vP!818ABm8` 0nP" 6A5@0;5.AA@ 0$A K%|!|IP B=<0 rnPp@p p0F-\( ` `i/lP @8A8A6 d: -PL@`pA10&S6ꘀ:\:\:\::\:\:\:\:\:\:\:\:\:\:\:\:\:\:\:\:\:\:\:\:\:\:\:\:\:\:\:\:\:\:\:\:H:H:@(@3%1 @@ $4P@5A0AS?4@D50580 R0= S @S @ ' 00  0   -L@n4P 5A0AS 4@ -L8M0XpK`4 $0 l%H)@P00 NKX0KVKO@KT@KS@KR@KQ@KP@KWPKUPKn0H)|0& KQt0.PK d0@-K- K*0K4 0C7%0K(K'@K,@K+@K)@K,$ 0R K9TDo> 0-0LPhPp00S S 0P P@@0%0h?0hl0@ 00CSЃ:؃:::ȃ:::: P P@7P,@nPX@l`0 $H0AhSw::::::::ԅ::::::ԅ::::::ȅ::::::::::::ȅ:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::0 0 Rf Q Q0-L@P f  0@^T  08#0`08#0@jPjT:L:\:L:L:L:L:L:L:d:l:L:L:L:L:L:t:L:L:L:|:L::L:L:L:L:L:L:L:L:L:L:L::L:L:L:L:L:L:L:L:L:L:L::L:L:L:L:L:L:L:L:L:L:L:L:L:L:L:L:L:L:L:L:L:L:L::L:L:L:L:L:L:L:L:L:L:L:L:L:L:L:L:L:L:L:L:L:L:L::L:L:L:L:L:L:L:L:L:L:L::      -(L`P@""4"̠00S0p a0V V 0  04Ƞ8,Ƞ< *;"*#"#? ## 000 0 000000BFV Ƞ ,4V 0 8000L0Ba21C0aT  Q  R ,{0 0 颋.Pꨊ::::Ȋ:Њ:::::::::::؊:840,($ ???? ?(?0??08 Q-L 0}fl R0-LP 0hx0 @0C 00h @B B-0@4< l40GfP 0F 0hOMAl -LM⨐ 2fP# :fM>`? p0K ,K0KFMX T0P/K@N+K0.K-K*PK)Kfh= zh(Kl8: 0-CML,@P0PS Ef000U00 -LM!T K\@Cd@p$K$K#K!@KPK`K"@K0KiP yt ZxKlLMA p-p0LM@ KK!"T`  K@0 0KKPKK@K@KiP Wt 8xKplLMA 0-0 @L$8P0 $ 0 $0h 0-0 @L$8P0 $ 0 $0h   0 R   V p-X0(  Q@P PL0@`[o  ph -d@L x8#H,"(q(R -(j(R  hbfdh -LM!T K\@Cd?p$K$K#K!@KPK`K"@K0KiP s wKltMA F-0- PL@0NB B4<mk[@Q \00HS 0\ 0R B0HSQ$0dP 0F 0h%Nl 0-|0L MKP?0@!0KB0K KKK0K@K@K@KhP[K0es FwltMA -,L@8    hD -,L@8   hT -LPp`@x  @T`h wT @46%CA("(0$(1 0p8? -@0L @R ,0 )0 @ h, !0-"(LXP}@Mh @T(v0T Y0MA -LPp`@MK @T$hvT $hLt? 0-@LPT T 00CS 0h p-`LPV@ V@@x0 AQR@ P@  ("(0(  ("(ph p-LP@@=dT nP dT8Dvp,`@0 @|@Tp? > -L@0g3`PPO P@l3l#0Pp1p#S,:T:::ܘ::(#$3!3yDp V ""2! "8S 8S F V  F#Nv<iD2!\ (""2!#)D !!1!#@ !1!#)D }VP! -wT!rP1!m#@  f$1!a#)D [0V  T O K0!F#)D @ k -:8 6<0!1 - -X>@>>>`>>>x> -LM!T K\@Cd? p$K$K#K!@KPK`K"@K0KfP ;q uKlMA p-LMPK 0@![B=  0[0K[!Š  !!R0!aP P` 0 `/0G-  0G- <0x 0-0h 50LSP0CS005 0hc(t00 @0@0? 0-PP#C C-0 ß  Pa dPࠁehß, 0R(Kp3 PʌX 4!R Rڬ8S S0 x q#H0820 003\mX 4l4@D d@D \@H$H@H$(D8 < 81S'`s 74D(? 0@0'PS@ @ GŸ0 0/.000b0 q @B `P8HCM0 @00P8H!080 "<8\p '.0 8Pԟ! X 0 P PaZcP@ ὟJ 44@D^ @@H$D{ p-LM5`=@SP x 10R''  $8 0C$800  P  ]+ gPo1  050(AR?@q8S q B 1AS T1 RL0A@T;0S*DP  ++ Kٞ@P P  + )P Q00 0@0@x0 Rʁ. 0@ BT0S*0 0  P 10R!!  10C15;5xx` 0-0CMLP00 @0PbbPt _E=P 0@ T0<5r 0$.r 0d`l MAMA -$1LM`p@)pK4bPP  00 _P_ (KȐ  )0K p_bpP _ 0ĝ0+S < 0 p_b@_l -RL@ ZZ m qZ& 0 0@0@T70`p lP屐 0@H0 @ m60abNA` 0-0@ La0P _P ]PP ;ぞ 1  d0 0Tjq 0<cq0_q$[qlSdT[  "PP@ $K8p0(OpF-0 NXH M~c 0/21C! c.  P0vU1a1P@, !ԡB= 0  9c@P l pp@1B}p  0$c@Pl@P Xpl Dp8pP p @A!ˠ0C- u^`P@ (R B 5RN n   550;@05(R  @] B@WTupP>"VSlxpNANAtOANANA0OA:DPOA -QpL`@]P@ ]51PT- |10Sp1TI 04>@4T@ H1T# @1T  ᫄4P@# "50`505 0S035@ @@ @ ኄ4P@8S 5A0AS@@ Y04>@5A0AS @li ϖ1i i i -LMȢ0R,0 P` \\ \? "ˠB0L  @]_, 0R(K >K]0!#R0 0@0@0@ TD D H! pPo ;H!奜1 o'1X` p00p0pD0T 48<#8:#:0 05@A@ 0S) 01  D 1p 0 K p0C 0D< 0 $1 1 0H! 1 \? -@TB]PLp`=YE (MEF KE 0 p`Yl -1L@y\P*10P 8R괴::г:г::ၛ 8S  (R8sA@1D (0C8p8p0?\PE (`E8p8hS }'8SSpP  xP .ThnS< 8  4 hnl(tOAfl? 0-DPL@[P 0[8S 0hX^0⋑l -L@ a4P 5A0AS 4@ p-PL30` /0 2@BX`00S 0@na`:@P [00@P u]!^p@P n]^l3pE (UD0  F OD|l -L MPS hP 4(KomAM0@ I\`P!\3#0PS@0@0S2 0Sڸ2 \P   0@0S|2 0Sh2 r 0 r TT2T"0 E (0 VB(2("  F LB ?R0,0  1B-`mp@:0 ,pm158 㠨嘈圈6 @X\t1/XN>0@T1T!8!L1L!1!,0@ 0`9`1!1#2!]  X0|" 0 D0C @<0D BD0(K(Ko - 00 LR s  0 0-$@0 TLP,00  0@T P0 P 00 0-$@LTP P0 0@T0 0-$@0 TLP,00  P0 0@T0 0-$@LTP P0 0@T0 -LMQ@ 0?.C""0l |lDPAlPA -PPppL* 0 $P `U 80S T V0@T404040@GHTW H0 ST404040@7H&mtPA -LM`sx@V spp0$ 0QH< P$ R 800 QPR 40PP  X00 S P<0W)< < 4<8  4   4 @Kd d0, @@ 0 JP $000S$ 0040$0$40HP(00(0(K lȼ:4:PA -LP00S 0 3@Ń 0S 0 S ?>#R 0-X0L @! 8T0 $4T0P $84X0Q;+S  ; S80  ;0R 0 S0@@@X  (RPH0RA0R #R!&R #X00X0lALT#> -X0L@lA 0-X0L @TP= \0 C K -  !`0   [ h v D\00L  00h>L0& >\0  L( 0>L0& x>\0L0"p>\0  L0# f>\0  L0# [>\0X 0@ X h00<0L 00I>X0L0 h X0+0 B<>`0  LX  0h0X 0C+ ,>`0  X 0@ X h00<0L0 0>`0 x 0-TL,0@ 0P 0P G=g0St0 gP S tx 00PPx0S -TP 00LR`p @$<0 T ,000@0hY/, \00Q0S 0-(0LP0/X0@08X0 T0$4P0T 0h2/ p-X0@L$!;98 T8}0P0dU 8 T0$4` PL0S X0  p8;T$8p 0-X LP@ `0   @  P0T$8 8T$8 <8T>X0.L 0\ <#3  `0 + ;8#(0T$8 8X0@ `0T*, ,0$8 8T$8 <80 X000 X5S0@e0}T 8 T0$4 @ @000l@X0 0>}/@0BPA: 0-LTP 5& 0 08 $4T0@8$ 4@h d0R 0h Sd0 P0d@Kp0 -T`L0@' 2 1C P ^{"jY$8 80T$8 8X0@80T$ 8 $84  X0  h>PA -Tp@ P0P,@`L8 T0$4T0 P8$4@,0 0,0T0$84  00 P, 0P 00S0P 000 00P0P8 T0$4T0P8$ 4X0@@ ' 0PVP0P(0S  \0P`0  8 T0$4T08$ 4    0PVP0P  0PVP0PP0P 0PVP0P    0PVP0P@ 0PVP0P 0P0PVPP0P0P -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T0$8 4 8 T0$48@T0$ 4  006000T08$ 4@0000000000600  006000 006000@ 006000  006000 0-@L8T0 $48PT0 $4<#38T$ 80 0-(0PL@ " 0ES:::t:0% 8T0 $4V>0$T8 8Z)00C0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP > p-`L@P  xgg(0pL0 P8 TP0 X0h T$8 40 \pph>PA> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  000000008 T0$48@T0$ 4@P::::::::::::::::::::p:006000006000006000006000006000 -@L8T$ 08 0-(0PL@  0ES::::0%W&00@0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP ,> p-`L@P  pdf(0hL0 P8 TP0X0T$8 40 \pph,>PA > -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000   0000000000660000 0-(0PL@  0ES::(::0%X00r0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S+p -LP P> p-`L@P  pe(0hL0 P8 TP0X0T$8 40 \pph0P>PAD> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 400000  0000000000660000 0-(0PL@  0ES::T::0%<000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S`p -LP > p-`L@P  pd(0hL0 P8 TP0X0T$8 40 \pphe>PA> -@T08 L$4@ R\ &RZ X0`0B%S&L:P:P:P:P:P:P:L:P:P:L:P:P:P:P:P:P:P:P:P:P:P:P:P:P:P:P:P:P:P:P:P:P:P:P:P::L: &R& 0T$8 88 T0$4Tp08$ 8@0&S 8T0 $4:89T$ 8 < T0$8 4PT$8 08T Q-L| p-T` @00@,0P8T0L $4T0@8$ 4 ,00,0 0@0@C0@ @0@pX0 @0@ @0@ @@0@0@ F0@0S p96@0S0@8 T0$4T0@8$ 4 00<00p p-(0L@`P# 0BS:::x:0% i0 8T0 $4T98$ 8(ppBp L0"S p L0"S 8T0 $48;T$ 8p L0"Sp 0- @L8T0$4T98$ 8P}U (*T0$8 4 P0 -LP > p-PL`@  Ec(0$L018P0 0T@?>C2@0 0 X  8@0 SC S  T0$84  \ T0$8 4`phhX0  8T0 $4T@8$0 88T0 $4=8$T= 80$T8 8P0X0 T0$8 40 S@098$ T8P0@0>PA> -@L8T$ 1<8 0-(0L@P0  L0"SU U U )000% Lp080{cDSA p-@LP`b(0L0 P8 T@00X0( R Xph{b T0$84  \pphlSA>SA - 0LT@ᣌP0 3@50  S R ? SAZ -$0Tp @0 ,@0`L8 T0$4T0 P8$4@,0 0,0T0$84  00 , 0 000  0000008 T0$4T0@8$ 4   ! 000000 1P ,P8T0$X 4 000 0008T0$ 4 00@ 000  000SADB -(0Lp L0,S@R R R 0%  T08$4! 0%!R T0 8`$@8P0  0T$8 8ZIbSA 0- 0@ LhPP 00 3@5 ? 0吋P  勋P00>DBSA p-L@P`hP  ,a(0xL0 P8 T`00X0T$8 40 \ppha>PA>SA -T` 0P00,T0L8 $@4 ,0p0,0T0$8 4  00 0, 00 00300 0008 T0$48@ T0$4 00000 0000000000 660000 p-@L}8P$`T0 8@40 p 0-(0PL@  0ES::T::0%> 00'0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP  > p-0L P3 LP@`( 0P?> S0P0w  =`(0L0 T`8 0P X0T$8 40 \pph?( P 0 3L> >PA> 0-0BPL@ S P::8:,: L0"S0%(y00 L0"S 0 L0"Sbp -LP <> p-`L@P  t_(0lL0 P8 TP00X0T$8 40 \pphf<>PA0> 0-(0PL@  0ES::8::0%E00.0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP `> p-`L@P  pR_(0hL0 P8 TP0X0T$8 40 \pph`>PAT> -TP 0,00@T0L8 $p4T8 $4,0`0,08T0$ 4  00 , 0 000  000000 0000 00 -@L$8T 088T$ 1<8 0-(0PL@  0ES :8:::0%rA00[0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -LP > p-`L@P  p^(0hL0 P8 TP0X0T$8 40 \pph>PAx> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 40000000000@660000 0-(0PL@  0ES8:P::,:0%*{000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"SNp -LP > p-`L@P  p](0hL0 P8 TP0X0T$8 40 \pphS>PA> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300  00000000T08$ 4 0000000000 660000 0-(0PL@  0ESP:h::D:0%d000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"Sp -L;P > p-`L@P-  t\(0lL0 P8 TP00X0T$8 40 \pph>PA> 0-(0PL@  0ESD:\::8:0%i800R0 L0"S 0 L0"S 8T0 $48;T$ 80 L0"S p p- 0`@LP\ 0?.C""}\(0L0 P8 TP00X0T$8 40 \ \0 `0  ph4phX\T0$8 4`DUAtUA>UA0 3$ A5S ?>S @ -T@ 0LP 0, 004Õ0_ p,0S,0`0,0430p , 430` , Q' <#0B RSQ4300 ,00000000004300 , 00600 0060000000  @  \0  006000 , \0 @- 006000006000<3 SS430CPp \`,0p 006000\0  006000 00000 -TL0h @4Ô0S`\p,0h L"430S`h \@,0h  -T0X Lp Z @,"}Ty 430` ,: S@@430S@0 \`,70 430S@0 \`,<0 430CPh \`,0h \0 44×0p 1\430S@h \`,0h 430S@p \`,0p 430CP` \`,:` 4×0p 00\X00X0 -LM(0p R R0 R  N L0"S&  L0"S5 @430` ,Pd0h 0Sd0X0d@0X0( L0"S5 0X004Ú00 ,0q,Q,  Qb Q{ 430S@h \`,0h 430S@p \`, 88p 06S\ 430S@p \`,x -@Lk@0S 8T0 $408T$8#8 88T0 $4 08T$8#8 88T0 $408T$8#8 88T0 $4$0 08T$ 8 -Tp@ P0P,@`L8 T0$4T0 P8$4@,0 0,0T0$84  00 P, 0P 00S0P  00P0P000T0$8 40P0PPP0P0PV0Pb6P0P 0-(0PL@  0ESH ;` ; ;< ;0%&w000 L0"S 0 L0"S 8T0 $48;T$ 80 L0"SJp -LP 8> p-`L@P  X 0?>C2@0( L 0P80TP 0h0X T$8 40 \pphI8>PA,> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84 00300 000 00000$8 0T8T08$ 40S;0;0;0;0;0;0;0;;0;0;0;0;0;0;0;;0;0;0;0;0;0;0;|;00660000 5;00@ 005<000000000 0000000000 000 -@LP0X )  `0> T$88< 0R#  -@L8T0$ 88T0 $4;8$8T#8 8T$80 88T0 $4;8$8T#8 8T$8 0 88T0 $4<88#8T$ 8 0-0PL@ 0T$88 R0> 0-0PL@ 0T$88 R0\> 0-0PL@ 0T$88 R0D> 0-0PL@ 0T$88 R0> 0-0PL@ 0T$88 R0> -@L8TD0$ 88T0 $48 0-@L8T $98PW00U 8 T0$4P 0: -$0p L@E< ,7Re $7R3 7R; 帀P>X0 2T0 P3 x {~  Y< 6R[ 3c  8@$PT0 8`40 @0 0CS #@60S @0S* .S tPT05T#"XX0 i 5X Q oA@0S SU SSGD0SS< D5R@0ST$8 0833  3 3  3{$8 ;T8 0T@$8 83sT$8 p48;T$8 83XAX0  $8 08$8 0T8T 0$8 8$@8PT0 8`40 $P8@T0 8`40 \3T3T#QQ D3Q `3@8 d38#8S3 $8T 08d3$88T#8 88T$ 08$8T 28T@$8 08Q *00 R0S#  <$8 8$P8@T0 8`400 \3YT$81 8$P8@T0 8`40 $8T 18$8T :88T$ X18T$80 8$P8@T0 8`400  0T$8 8a$P8@T0 8`40 H$8T0 8$P8@T0 8`40 VA @VAW W WW Pp -Tp@ P0P,@`L8 T0$4T0P 8$4@,0 0,0T0$84 00S0P 000 00P0PT0$8 88 T0$40@T$8 8?< S0PP0P S0P P0PVV0P0P P0P S0P P0P  S0PP0P 0P -Tp@ P0P,@`L8 T0$4T0P 8$4@,0 0,0T0$84 00S0P 000 00P0P00 P0P8T0$4T0@8$ 4@ 0P0PVV0P0P 4P0P -Tp@ P0P,@`L8 T0$4T0P 8$4@,0 0,0T0$84 00S0P 000 00P0PT0$8 4< SB  S0  SB  S 0PVP0P S*  SA  S: < 1R@0S0  P66P0P0S8T0$ 4  00\0P0PVP0P0PVP0PP0P0PVP0P0PVP0P0PVP0P0PVP0P -(0LPp` R R4 R, l 00R1 < P3R7 ;R  L0"S1 8T0 $48;T$ 8@0S]L0 S:  L0"S, X00R0S @0S S&0% P 00Sy $;@%;@%;,$;@%;@%;X%;@%;@%;@%;@%;@%;@%;@%;@%;@%;P%;@%;@%;@%;@%;H%;0 8T0$4T0@8$ 4~d0h 0Sd0xdt0$6S8 0T8$8 0T8 0T@$8 800S S SO$8 0T8< T$88< p0R=@0S:0T  0$8 8/ @D0SS0L -LP ,> -$0P L0@p`|P^0  \ u  ;R(0L08 0#C%< 0?>C2@0 T` D 0 X0|2P0xX0 0h0h0X00X0P T$8 40 \YL0"+x%X0 P L-+0m%>|P\3\L  0m]%.|PX L# 0N%L#,0F%L&*0?%L0&!,7%XL00@ .%L00-&%T0$8 4`{P T3#(x0(Rp0P0y h0Rd0P0t \0P0qL 50%0EVA,>PA>VAW> W>> -Tp@ 0,@00`L8 T0$4T0 P8$4@,0 0,0T0$84  00 0, 00 00300 000 00000T0$8 48T0$ 4 ! $ .  0060008 T0$48@T0$ 4   006000006000006000@ 006000 0-0BPL@ S +;H+;+;+; L0"S0%c00 L0"S 0 L0"SLp8T0 $48;T$ 80 -LP > p-`L@P  tP(0lL0 P8 TP00X0T$8 40 \pphA>PA> -Tp@ 0,@00`L8 T0$4 P8T0$4T0@8 $4,0P0,08T0$ 4  00 0, 00 00300  00000000 0000000000 660000 0-0BPL@ S .;P.;.;.; L0"S0%P00 L0"S 0 L0"Sp8T0 $48;T$ 80 -L.P H> p-PL@`  O(0L0 P8 T`0 X0h  T$840X  \\0 pphzL' 00#L' 0(#H>PA<> -dT`0LSP, 000,84!T0$4T0@8$!4p,00,00S ,0 00 OT0$8 4 000 wO8 T0$48@ T0$4 000000000000000660000 k7[A[A[A>[A -|1`LQPp@(0 0GS 2;(2;2;2; L0"S0%Y "OL0!S  L0"S0% 8 T0$4T0@8$` 4@d0h 0Sd0P0d@p k>[A7 p-L`P@N0 R$(0L0 P8 TP0 0h X0( R pphN T0$84  \pphk N[A kx>SA>[A -0 3B5L  ,0xP ? CA -D0LSp8T$ 08$8T :8T$84 8$@8PT0 8`4; 8T0 $4:8$T#: 8$8T 08$8T 08$8T 38T$8: 8$@8PT0 8`4; $@8PT0 8`4; 8T0 $4:#:$8T: 8$8T 38$8T 28$8T =8T$8w0 88T0 $4:#:$8T : 8$8T `28$8T H28$8T 028T$8< 88T0 $4:#:$8T : 8$8T 18$8T 18$8T =8T$80 88T0 $4:#:$8T: 8$8T 18$8T 08$8T 08T$8< 8$@8PT0 8`4; $P8@T0 8`4; $8T 08(h e A` -L@h 0-D0LSP@X0T 8 T0$4@ 0$T8 ;8: -@LP0\ X0,B# 0;8T $88T <$88$   L0"S 8T0 $48;T$ 8 L0"S 0% P0T$8 400S-4@;?;?;(@;?;?;@;?;?;?;?;?;?;?;?;?;?;0% D0SMT08$ 4 d0h 0Sd0@d@@ 6S) 0S, MS 0$8T 8<$8T 80T$8 8^`U0 +0S, @T08$l 4B -LP > p-`L@P  K(0$L008P0 0?>C2@0 TP D 0 0h X0 B40 \ \0 `0  P0pT0$8 4`>PA> - pLT08$48?N T$4$0 0~uP$} 0I+S,dC;B;B;dC;B;B;B;B;B;B;B;B;B;B;B;B;B;B;B;B;B;B;B;B;B;B;B;B;B;B;B;C;C;B;B;B;B;B;B;B;B;B;B;B;, oJZZ q8@$PT0 8`4: $P8@T0 8`40 ZZ =$P8@T0 8`4: 8@$PT0 8`40 $@8PT0 8`4: $P8@T0 8`4< b$P8@T0 8`4: 8@$PT0 8`4: $\A(\A -L7h. -Tp@ P0P,@`L8 T0$4T0P 8$4@,0 0,0T0$84 00S0P  00P0P T0$84 R0P@P0P R0PP0P R0PP0P l'J0P V0PT0 8$40 0S  <00^6P0PL\A -RLpP`$ R5 R ) 00R t, W00R0Sf L0"S5  L0"S 8T0 $48;T$ 8 L0"S 0% n 0SI;pH;hI;`I;pH;pH;XI;pH;pH;pH;pH;pH;pH;pH;pH;pH;xH;"p@6S$8 0T8$8 0T80T@$8 800S 0$8T 8 p-`L@P{  AI(0L0 P8 TP0 0X0h T$8 40 \\0 pphT0$8 4`>PA> 0- LP|@ ,0\ 0| 00\00 -PLp `0  P4 P @ 00?T0S @ 00?T0S 0S $X@ R 00 -L MT`pVM`VJ <0 @P<0 P(U@<0  <0 <0< < K $0K}P <0$  L 0<0$  T 0H0`VK<0$  P<0$  T -LM`p 0K@PCP R  =S  R 4W 00 R000K 0-LM 0KP@P   K0R-8.\ 0S0 S$0S < <S S 80S  8 0008q -$0LS@ <0#,R R#80S #8 04 P4 0@ 0q -L M,Kp 00KP`P( Z)0  12[((18,0 0 @T J0 P@,  X p(K -L M,Kp 00KP`lP( Y)2[((8,0 0 @T 0 P@, 0   X p(K -LM` 0K Pp0P V   R @ 0 0TVD @K 0 ' -L MT`pVC <0 81 R9P@< 0@(TP<0  <@0 0 < 0<@< 0< K $0KP `VK<X t<$ L0  0 <$  P0<@$  T0<$ H0<$  T0$q 0-T@LTP@T <0 80 R <GX< '@T0$q -L,MH `4p@0K08 K<0K  YF (3@*P ,0KPPZYU (K0K4KDK,0 BP0Q ,0S& "*D0 H P 4 0!3P H0P,0P 04 03P,0P YSH P 4 02P 8K< @0@E0 ,0 0400 @0  XJX00@$&&Q020a00#40 540 %H00 P Q 4 R 2 *0*Q020a00#H 40 540 %0 P Q 4 Ro$ @2 *0*Q020a00#40 540 %H00 P Q 4 RBH P Q 4 R9 H0 (  @P0Q0U0S5   d0r2P- 8< @0\0^E&8K< @0@@UE0 ,0 P0 ,0=0M2P 8K< @0@7E$ 00:2P 8K< @0@$E X0|0'2P^ 8K< @08@E0 O ]A]A\A|]AL]A p-LP!`P TP @T0T0p -LM<8K 0 0 K40K   P @(K    3("(R R 40dpH@4 8DL@PPX`0 h00 00| 0 00 h0 8 0X T0 L x `  t@ pP l` 儀 Wd \ Pp l0p 0H0 D Hp D  <  4 RH00C000@ K@0K> K?K,K  <0K%P ,0 h 0 00 Q$ PK0@PS T <   < @P  pQ\ tT0@S0T0T0\T0< (p3:\Wp    -W`P  0@  0 0P W`ʤQ KT T0"@p  0 0 b;J; -LM`0, S`<@E`0S?0\  P 80Sp 0("(R R  !oP  pYpP U0\  ,0 P00SP  -\PL0pS` @0 \@ P0S0 k p-L0P@`^CT`000 4 080 < 0@0 D 0H0 L $0P0( X ,0\00 d 40h0 ,`80Pl0< Pp  \ 0>0 HM 8I ,EP$0 Pph=ı@U; A0-L@Qc;c;c;c;P06PK00h.0h)'P0 0-0LP@lP  0q, ,QP00 p-@LP`  p p -LM@ P`,0  1 0  0   p 00  JW% ,0S$ 0,0  0  p 0 $W -RL M@PpA?QX@  ,   `<  0  8 0 X04 00 P<QF, z @0 Q (KBX] 00@8@P` H D HpK pPw`0@0K 0 S SM S0S00 R 80 0b00 R 0 000 @ 4 0  0  40 0p80 0b0'SZQB40 rQ ]A^A -L M@00@2K R-LP@`ca  / 0  p 0 < 00c0 3 Q000S  Q0 00   0   0p0 A,^A@- @ @ @@ -L M@00@vK -L MP4`@ 4K0K 0QpP00S,a P  40R !Q30 .P p(K 004 0S 0 4@ 04 Z3 04 0@  R4  4 0S 14 5,0K00 0Pp\@ R,00 0S00 0 R400Pp 04 0@p,0 S!0Q ᆀ.h>< 0P8#Q0S P,?L 8Q#Ƞ    Q 0R S0RS > -LM0!Ƞ8 p 0 <0 !l*ȠP4 ,  , "0Sn 0VP0S P0S@XT ,Q$ ,0 <!? fj<00! `(Ko?P@T 0S 0W0S 0S @40 <!m?8, 0Q0R0S <  i 5j0S( T \ < ` Q? %j<0 `00(KoG? Ƞ,Ƞ4 <l l0=?P<T `p4?<0< `0p,?>+A _At^A?^A^AH^Ah^A^A^A p-X0LP\` 0 T@0 Tp+@HnFB -P0L @R 0 T0 $@HnFB p-LM`@PT x0SKp0K"0 0P80  P ? ?Hn@nFBFB8#8 S- H 00S P\^ 0\? -0L8 $0CU0S, 0" $0@`P! Tp$0! `L@0 P à@ 0" T0 8 T0P@! T`$<<0! 0P@; T`$<<0; 0 0P@ T`$00  -L@MP`8<T0 p 4XP@ 0 0  00  00 00 00 3101 4P; X8 @0K8KP@KHK0  @XPZ7 <0D4  0 0,K$P9 X>Q 000YlZ  40<L (K@4K 2ᇓ  00 !20@ 5   1(Z   $0   $ 0@, R @0  0010 %0",0 @0  0@ P7@( 0P7@ HB|HB -`Là p" P x| $0 #x 00| Tx@! |0\ 0i[ -遒ၣp LM@P`   0P, f(\0000    0 $0 ,  00100(P@P"!B0,5 0P(P 00 P% B 010(\  $0  B 0 @ 5, d0%0!D0,(K, 06 HB- e -2@001"L M`5PSp (K,0K(080K 0,pP  0Tp6=00 0 8K,  04pP=008 0 pP  0pu6 0pn6% 0pP  0pp]6 0   pP  0pF6(IBIBdIBIBJB -pL`@P30  0 t0S#PUO aP3003 -LMp,0 Pt@`ph0l hl0 0X 0  0  P#0 0X 0  P,0  0 0(K$@5 0  $5vxJBXJB -8 LR`p+p@PPLR@"ڰ5Sx0! |$8  3P8 p $58 PLR@JB -80LS@-Pp80PSp$x0 |$0S`3P 8h5x0 |T80PSpJB - 1L@0@ ,8#8@ p\0` ,0` \80 PU@`$PU@` 3B@ @DP80 0580PJB -0pL0@ ,80 PU@`$PU@` 3B@ @P80 0480PJB -8 LR`4@P5S)#200%10Rp 0 0QQ+ 0Q( <Q% 0Q" 9Q :Q x0! |$8 PLR@P8  448    hMhbiMuJB -x0|`L ,8pQ&@PPLQ@ڰ5!S;2 3P8 $0V48PLQ@JB -80LS@-Pp80PSp$x0 |$0S`3PP 8#4x0 |T80PSpJB -`u Lhl8 R$@ PPLR@ڰ5pS5 3P8  $38 PLR@ JB -P `lLh~W plhy8 R$@P 3P8 8 PLR@ ڰ5SU UPLR@ p-LM`0 P$p0 4@0$0 0 P $xh3 0$ 00 P $<xhw3,0( 0  ,0xhn XJBxJB k -LM1 P$$!`p0ba p  aH1@!  0 P $ o<304 <0N>00 P'4@@0  !  T 00   P@T10 $ L (  04$,o3$o2?JBX kJBKB p-4LSP`p @(0@TTp -pA Lhl|8 R@ PPLR@ڰ5SX5#20010`P8 PLR@ P P Z8 -8 LRp@PPLR@ڰ5S5S #20010`P8 PLR@P P X8 -L@qPh -d2 @LTH` D2p\4 <\0@ ,0PST;@;(;T;@;0 i22 i-20S@   0S> 000`@VT330033 10#P P1 i1 i11  0T 0 $  $ 0 $ 0` $@PKBKBKBKBı@@KBKB p-1PL$+` 0\j $+ 1\^ $+ <\`R 0$+,0S;;;0;;0 ph{1 phv1 21CA@c@$0 T ' 0 (  ( 0 ( 0 P (@UT330033ph: ph<1pPKBKB@KB -t0 L@P XpX`$ H0\ $ <\hP#20 0p-L!0 00P0@!Q%`PP p% 0p? LB#200 1t p-Q`L`@ń`PP 05p%0pHBHB 000@XT330033 00#P P/ i/ i//  0T 0 $  $ 0 $ 0 $@꼞?PKBKBKBKBı@@KBKB - 0L@`4 PP0pr@D@ 0SP :0S:  Dh  @ 04  0480 p -LMP` [2p 4 >04 @L' 84 ( $ 0@ P O/$K00 E/@/y0t0 S0 4 !A> 000\ 0 506 l1l!<X0d 8 0(K$P9 0( ( @p(  `@1,Pp* W  /80S P@ʯ80PLS@P #20010p5S X\.P.W @..PdLBLBı@(~;;<;|;LBLBLBLBAL -L`P@p3& Wh儀l 000 # '8Q 00B90908 809 80h40 lpWOi# 9080Q #:088 # -L@`p1# 000  083 08P 00B8090908 \^ x!0| Th| 908PU Ѷ# -P@h0Ll@ p# 000 %8P 00B8090908 \^ x!0| Ti; 908`V Ѷ#038 0:0S0:0 -LMPph0l@ 4 h0lH h0lD , h0lT 0 8 8`#' 000 rO8@080T8@00C9090T080@ 0,0 0  0Xoh00lT h@,0lD h 0lH h@ 0l@ 80S 4x!0| T(Ko 03   90 ,0.8 08@, 0  T  @8 0 00<  :0080 80 80 8@y꟝?? -LMP`h0@ lph0P l@h0WT X l, ,0 - 000  :0 S#5!2!50 008 020, 0, 88\080900 808 0CR900G^h0l@ h@P 0lhWT X  0l, R ,x!0 |T(Ko 90800 Y 0  Ѷ -LM`ph0P lhlX h0Pl\ h` l@:0h!2# @00@ Pc @% 000  :8! d00 0 0 083 0. 0d8Q 00B90809008  P@TόY x!0  |Th0lX h@l00` (Ko] 9080Q,0 0dж#ѿ 0d,?? -L$MH 0 R h0l@ 4B40h< D l!02018 L0 L 0H4 D0 , 0@ #+ H000 aF003 0S 8P3P#0<02 < h0l@PH @ (6H @ 0,Z㏏0 , 4 RLH0 RU h<0l@ h@l80D (K 03 0S 9424"002<0< 4  0*4 0 RV :1!1 D  0<1Ì8 < 8 4 04 x4!0 |TH0 RLh@ <0lh@l80T h0lO 010 BL 8 < ;80 0<04 "Œ< U:0 0 <  28,0 < 8 9404 0<04 "Œ< ~˝?Н?ŝ?ȝ???? -L M< h0l@ h0`lD h0PlH <h0l@T H H0<  < 01D T" !0 0  @P04@ , 8P 00 @` 0D 801P %₡140@0 4  F5003`VOh0l@ h@80lD 0`!Q h40lH h00lT ,0S Hx 0|T (Ko 90 , 08 , *8 30S:0 %90@ 08 0 ,*ƌ8 , :\h0, l<0  020:0 ؝?՝? p-L`@P3P UOphL303 -LHMP V9$7 0K$P )(K 00 (H 0&Q 6Q d0CQ   D 06,p6QJ0CQS:  0D   L6,pp0S- @x|,K  0 @@PPt) 0p 000 0@ @@P)5%00\ 0 405 0p%60X <05P8 [0CP <0CP  l 5\0H ,008080$SH 4$L0P D 4 < @ 8 @ <2001T 0p 0L0 00%5@ 䐊 P @04X 40@0 2\0  `10a8000T0/0 PX\ P0@TplU  U !00 @ PP tD@ )U4 01040\ X0!c83 01@a<000T0&.0 PL000T0/0 PP vLx04@CQ1P%0CP*z>CP01` \080!1` d0D@ \(8pD@ V(8pD@ P(8p0P 0P0` \00P 0PHGBt55Ț;=;LMBMB;l;3;;L;MBt kLBLBxMB MBAı@s=4;; NBMBMBp5 - L@`pP 3  0UP/^ x!0| Th& 0:0S0:0… -Lp0t#QQD d3QA `@P* Z 0:e03 (3  (Ƃ83#00P0U05 h  !` lPUOV x!0| Tmx0| $hl@P ;: Q-2 dQ1 :0S. 03Vʠ 0e91 0 0(Ƃ W1  v"R:0SQ0v2 Q :0Sv"וR0 v2DžQ41 ( 020x0| T 0    9x ! |\O0 K  00S0v2Sv"R:0S0:0Dž00S0:0Sv"ׅ0R:0 8M0M?ݝ???r?? -LMPZ `lh@ 00CS8; ; ; ;;&(Ko !ܡ0 , @p3 pWOX  x!0| T||!|0 , 0DSGTK \!\1\0 ,0  h0  !@ l3  03 0bY3:# 01  h!@ l 8 R90S0B909 0, 1 800 1:Q0:0ą P0PP00 , 0  00 , PNB k k k k4 k@ k\ kl kx k k k k -LMh0T lP,"00 e` p0 @ 001.0#A#0 0^8 0 ^2 03:@!001P0S8֕I 0`!Z 0 hlpWoh0lT Y  x!0 | To#9 80P808SP0@00909 0R8 @@hl/Bx0P :0S0:0ȅv2S0v2ȅh@l0K ,0 d00,K l@8r?? -LMB0 hh0lD 0 24 , @pP3Z_p4 R 004x! 0|T(Koh0l h 8 l000! #*80 \8000C9090,80!h@  1l h8  0l#  4 04 :L08 # #4  0*984  \??? -Lp`@ 3 F81!0P h  !D l0 0  !E hlXOY:Zh@lPA 0 # 00A #x0@P|pA@ T`$0 8 R 9h0h 0 2P9B0S9 x!0  |TD?I?Q?N? -LMP`20`,0 @ip0 3 0,,\ ;;;;; $pWO h!@ 0l0 R  0x!0 |T(Ko ,980 S8 80RQ8,, 0 00 81 *0#8 0 9:S0C0090903H hl 02 :0S0:0ą, 0LS;;;l; P*$,0:0D :04 :$0  lNBl?g?`?Z?T? -LMp`P@,` hlW 3@@p 8 80D!1h! l0`VO,0S  x!0| To 980 S8 80RS0C00909,  0&, 103 h Q l^: , 0, 0080! 1 :\0:0ąꐞ??t? -LM010p,0 `RP@3  0v90 90S`80 4 21 PU@h0lL 0u290,0v`P  Q10Y  x!0 | T?? p-L@P `3  0 ` 0 `PR @0 100b 10t UphN ? -LM 4 8 hl ! 8Pp`9 000    @0 < J : 03R  :0S0@ 0 100T0Cp T:00":0,",Ÿ 0 ~8 0Ō<@8 pPUo !  0l8P 4 x!0| T(Ko < @9 AX1@ @ X@D@00  p E0 ,4  ?8 08 <@8 A@0 @ \@D@, 0  p &,  ,4 "` B   0:0  :0S0@u0@s00   0@0:0eC?\ 00B9080908 X1a 0 #< 00!PEuOY  x! 0|Th0lH h@l 0P (K  03400(::Q0:0ą` 0`20804 O 3803 t???NB -L MPph0@ lh0@lD h0lH `8 h0  lT H H41 (KH 4 2 !H 0`0<` l 4 0 , ,000Q q0Q p3Q`3Q T3Q L3Q 0Q @0Q 0CQ 0Q 0Q e?Q >Q q0Q: RxR::<R0 D0v"2QQ:0S0<D  00 j h :X"80@D 188 @ 4, 04 , 3b4P,0`S  8.,`⏏, I 8wH9a<  < ,0Q4\:h0l@ h@<0lD h80lH h@l 0T (KoS0<:< : 0@ D 0, 0Q3@ 9 `4x!0 |T0:0D 0 t@ 9 H 9b<00<0 {%&$vJ$K$$? 0-@LP3 0 3 h0 0@ 0 R 400h  @ r  -LMp @۽x2hl$ P  $ 0A P  U  K|'wt0 S01A0\000506 1!`<0X0d 4`8` 0$K$P7 0$ ( @P$  p@01,Pp U! >0 R 80SP80PS AP 3B@@A@@{DP \`,7  0\dLBLBAı@LB(~;;|;|;LBLBLB S2 b 0-L @P 0 pQ ha0p00 p-LM@`S1 x0400@aPP$TP;NB 0-@LP 4S 0h0h2#0010PJ p-80LSP`@3 80@S0P ph|p -LM@pPU`c T 0ph0 4!   0Pp pPP! 4!  N0PP Po`P $5 0 (K$l(0 00 P  0 0$ 0    0,K$P  0, (0 p ,p0 ,PPp 0\ P PpPs@00S ,(xJBXJBNBLBLBLBLBAı@ 0-LMP@  0?4S8 4S 0 $0( 8h -LM< 80S 4040  2ሓ4   80 !81`4X@ `0 P2pP@4  0h@l&T4 0 408 S 00P% `@U,0K0K 4 @5S(K  40l%(>HBHBJ?HB(HB0HB U 5 001 `p05 0 5S(K 0010@,0K0K @ 5S P U0 4Q x 0%(%HBHBI;XOBC0CSL<<< 8P 9P :P h0lP 4 0PP P' X8P$ P8P 9P :P 4  4 (8PP 8P 7P 7P 9P :P 40 8   8 < 000 7R 0RR700t0S 00l'A>000\ @4@5,7,'QQ  0& 7Q# 9Q :Q 6QPPQpp06Q <Q \R6Q00SW6 6@060T&T6QQ H6Q <Q 86Q 9Q :Q4&0&0X  <08 6RR 0CR 880%5QQO 5QL <QI 5QF 9QC :Q@ 80Sp`Ph lt5h@ d5l80pSP0$5QQ0(5x| \x0| $x00| Tx0| $x00| T80SPp8 P 00$,4QQ 4Q <Q 4Q 9Q :Q 4QQ:74 ᇣ 0010<80 5S| 0#QQ# d3Q <Q T3Q <Q D3Q 9Q :Q PC0K<8 ,0K@ ,3,#L0P B C0K<8 ,0K@5Sx 0"2QQ% 2Qa <Q^ 2Q$ 9Q! :Q AP 0`"QQ:74 < 804 O0!1QQ9 1Q6 1Q3 1Q0 9Q- :Q* F80p\SPH0l!h1QQ \1Q <Q L1Q 9Q :Q hl40P (K 80p\SP 80<80p\SP0CRIF0CQ07' 4)%80p\SPʰ060s0CQt080Q07xthMhbiMibuLB3M(~;0M8Mt;; sE s ; ;Ȑ;;XOB -LM< "80S"4p4  00S S S S S 4 0BSL <t0 S0 (#(3\ $#000X <04504  SRn60 R}08 8080`P- xP! 0 2C0010 |Ÿ , K00K5SF @@A0 @@1!DJ80PlS`S!P hl8P %,8P 80PlS` R5 R7 R5 R3 R1 0BS40RS l@hP[ 0 0[ (K8 0BS060ǕR40S00606080SR 40ASh@lPQ 0Q h@lPU }0U hPl@Z rZ 0{0 0K 8 ,0KjLBı@(~;4;ԝ;XOBPB -LM`< 4 <t0 S0 40S0004 00R;00H#H3\ H0h@lP8#040X <85S +00S 3h@lPP 00P 'h@lPC 0C h@lPM 0M h0l h 8 0l h0l  840S]80SGPp %580p\SP: ?P 0S #20010<0  B5S 4 P1RLA0K@<,0K  @C5S P-5S  0 <80p\SP(K 4 0R000C60K40S006060Dh@lPK 00K 8  40h 8 80l 5SLB(~;ԓ;;XOB|;; -LMP= #t0 S0 \!\1\ X!000840<56X (18R:0004 S80S4`p80plS`+ P #20010 0 5S @0K  ,0K@Ŗ\  0h80plS`(KXLB(~;D;|; -LMpG t0 S10 !00\ 0hlT h@lPA 00A x!h040X <85 l Dῠ8 l@ h@@0lh@ 80S4P`80`\SP+ P #20010 0 5S x@0K  ,0K@ŕ\  080`\SP(KLB T;P;; -LM< plJ hf<08 =040 P4`)@T 0S 00600<t0 S0  3#00\ 0S3000 40< 850SD+ 000\ 0 506 D1D!X0080d << P"80S"4`80`\SP! P #20010@,0K0K  @5S X80`\SP(K 04@  04@ (X;PLBı@(~;;<;|;dLB -`Lp@E,@t0 S0  1 B00 16 \00<00 4 5X08hl| 00hl h@lP 00 80S@P80PS e5LS@ 380PSPBı@(~;; -< L"80S"4p`@P P 4@ PPJt0 S0  !00 |!Q7 t1QF 0CQd1\06 0<0T1 X04 85y80S@P80PS w5LS@ 3Y80PSlhq 0hI0 0006 \0T0 006 T h0\0X0 00P06 \0hls 0+hl{ 0&LBHI(~;;0; -L M@ < p"80S"40@< <0 80$#Q :4Q= 4Q: 4Q7 @0 (,  h0@ h0 P <S  @,0S P4%P @4P 0P \2R:0R60RP0CRH0CRV:00000#20010840 @5S A,0K0K84 @E5S8 40 d1Rz 1R |1Rs0CRp*90CR060lP"5S X5St1R M:=B 0CSI0R 0CRAi0CR 0CR99:h00 l@ |0R 0R'T0R X0R =B 0CSLB(~;$P(o&$.0PO<;XOB&$|;v'$qʄ -LMp=  t0XㅀS00A0 \000406 0 `<80X0 580`S xP 3B@@A@@PP(0K,K  Pt80`S$KLBı@(~;;;|; -LM8 <0`#4@ 07 (4R 8t0S0 ) 0 t@@ 08<00 4@5@ 8PpPß00K8, K5S"8p\PPu P 02C40 0010,0K0K8 5S 08 5S 0010 PB h0l h@0l  ht"P0l@@ T 0%< 058 00, 4 RY 00 5S 0 1! 8p\PPt0S5 P3p PUOZ!80pS'ڇ2#0010@ P3   P0 d 050 80pS(K0 N 30300 5S5 0@d: 0 t@T5 t0S 0 @0+ \00 LBh?tOB|;E.Q@p3 0-LQ@h4 04PST4TS 4TS @4D$T0H4L$P4T$ 0-LM@\# Q (PU $0 B  $  8 00 008 -`"LÐ0PHPhE@" 2,p\^P` "0 \3"RB.+0\3^!0 \3P!0C.\2@S1*3d0C`!S00#A.\3P$!H5-\2S-0C$S%H5S45 Q00+\S0S03 ,#4p \3\ L5\2(8$8888 ` ` 8 p(8,8 p-3L`,0\#P5P1"B/\Q P5S3 z?\p"@0QŖ`"F/2,P\Q0@0("E/\3"R. +0\|3#6I@R5@QC SDH @  SDH @  SDH @t#1R @Q3QC 0AS#0,\3P(!.0\3P!5J/\p3 ,#4 \3*,#<*\Q3@  0\38 T5\X (((((((,(2S 0 02@ 0@02 0 0  0 202 -3L@ ,#1 \ -3L 0\ -2LS 3 0\3 0\ -Pp(0` L@P8 8  (#8880P  0-0L(@PP  800 - L<(P0  - L(@0P0   Rp@-P`00  0AS R 0ASN0@0 @ 0@0`00 p0`00p -LM3S1 3 ,(3)cN0,en043,,XF\VPT3,,fnX\3d,,hFlV`d30,,gnhl3+,xF|Vpt3+,mx|3+,jN03`+,fv3,+,kN03*,fv3*,M03*,fv3\*,mN03(*,fv3),nN03),fv3),oN03X),fv3$),L03(,g w3(,qN0 3(,gw3T(,rN03 (,(g,w $3',sN0(,3',8g08V cT0D8#H @* K5S5 101[Q % 00a 0"[00b05`e0 00W 0 0@0@e00 0 tP  X0  00eet30^(\ 04 00 ĥ 5%NSB -LME`T/ 0 R&p0pS  5(PU $05$)005\0 @ RET 5055S05P )055 -LMEPT8 0 R/p @Q (0Sژŕ(`V  $0  Bŕ $P )00Q %00@0p RʔET 055S05 -LMdĐ@p  p 0` PP  <00 0(K 000p p *,PP  00 0 04PP  00  0dĘ0  P00PP`  (w0 8HSBSBSBTB -L MA0P@ 㖛PZ `K0d$S%@p0` @Rŕ 00 0 `Pp  L5(\ `  $0  B `#P P1[< 1KD% p-@L `$1!!|1|!tÔ8!p1p!LA0`1d0].B0@]T$P01,1(!30CS- 0# 0 0& 02S 0 00 0  ph2dS`0 0+@.@ 0z<<<Џ@R 0C/000 /  0 4#3`P V TxP4x#x%xUBUBXUB -L Mhp P {(KE ͇K 0mKN P @`P囸P c Q/ !20S) S'Z h4 0 䤇͇KNK^ 0 @P   P@ P0jP 2X0ASh4  !E· 0EN] P PEP h4,K$PP DcXt, (0@,  0p1,P T k2S ch4K 00KٯP 0 hė 0 03h 0\3L 0\?UBUBpVB,VBHGB$ ,hD0 h4, \0 /P "R4#803 0BS020 wHVB 0-8P=8 0L8@Q T^090h p-LQP0`h4 0@DY U ap -3Lp ,0 <5S 00CS= R0000<5S# 0S 00iiSN@-!0S 0P 5`E$ 0@0<0CSD%0@0@=0l S<"0BRSR3-,#6-\>@B p-LM@Po#0 0<5Sx  30CS00dS& S0 S#= R 0S x2&S 00x  K1[ 0<0x@kF> 0-L@Pu#= +0hd -LM쁟2 S@( Y 3,,8P 2S-< P8P#0,\2S ( 0RN$K3,,#0,\;>  "RPʯK ʯK` p` !Vp" 0I 3,,;> P #0,\ 尽 DoС? -3L`^! ,58 X# U+ p U' %20 0!X PP("x P0–@h\d  \R Upb>Q0 @  6$Fm88 0-LP+@0h耻 -L`MlDlT 0`R 2 S %21C0 `  0l Ŗ Pt 606zl0#(00CQi,6US  Q| tl`@ x p %,0@Ŗ50  h3 A R @0 0pP PPlx (0 Sx m,^ ,\pK0 0 Ph 2 R( pdP 2 dP R 5Ŗ 5("80|2 APUh pP @0W 0d0p0 |055%05l$70t0 2 S t(Kd(\ h $0  B 0RT570t 5d(\M h $0 B E,6SUCl0D( 00b8#800` 0l00(\ l $0  B 0 400%p2 Sd(\ h $0  B = R 3–@x\p 0 \ "8 00j8#80t`@p 88 -LM5P=@S` <5S 2 S d(\ h $0 B p@0  BQr0C2 S d(\ h $0  B W 3^ 5 \P0@DQ 0S*DP ۭ0p5 10R!!  10C15;588 -3L` ,2pSP 8@07 @6068@ 2S2XsP 3P J/5\L@PS ~q@6068@ K_  0>X ( -@L5p2 0CSt0 0P? +2, "<0$0K c @ 2[ " 2"t3?0 0P TV<2t3:t355NP #Z B2SS  1 S/ S8$,  PM=~P4 _ (ZE-03KLP9 3S8 0,60,43 , 8Pꀧ 7C=B0CS 0080CR C80CR Q00 , / 0 1 0  ,%R R R  0 \0R 0R00!\00S 0000R 0R00@PDP{ 0-0@LTP+?JG, 9:0+\0 ,0 -0L@ ,(0S0<$<<< 0S0 \32 -0P1PP0L@`p` ,0S ?Q0d0 0000000 B - L0BS0BS0 ,P0S<Ĵ<P4, ;0 0 P%Y! A`0 FP2[00I8#8`0VP@ \ *0K  QZ(K 0-`0LS@" 0S% 3PPU 0 , 0 \0 ,2 003P ۯPU 0( ,0P[ p-h0SLP!hd0SphP0D ,@ 0 \ph\[ 0-40LS@ 00 , 0 \2^0 ,d PU 0 p-LPdPp0,, @0,,  ]0@ T T @`0o/!"+,@T d0R V0  0 0R0a0P0 IAMT -LM @0BS`)@K*@K0BS (K0S 0 ,UF 0-0P qd ) [P* KedYX*0[=#=*0K* [P X$ 00PAp0\) K0d)0KѮ ) [Pd 0#4*0KŮ 0000 Y'@* K%*0[0 *0KP 0 0 00 P00 '0!,Pꎮ0PU 0 ,@w0U_< S  7 \@ll0@T 0 ,40T  :0,0\< p-L`P@FP0T U00 4 ,0@ @pp蠆, 0-0LP ,80@S S 0S @0 \0hB0 @ 0\0@0 \0@0 \0 ,0@0 \0 ,ԭ 0-0LP ,80S& S 00@0 \0 ,ᰭ 0 \0 ,0h螭0@0 \0 ,ጭ 0 \0 ,{0@0 \0 ,i 0 -0L00 @ \0 ,hN -0L00 @ \0 ,h6 -LM0!@ ,X 0 pKP0'` 8#X0 ,0`0P$0 X -LM0PH >r4B,8 0R0 0  R0 0  D0B `K 00 0 0 0  \0 ,Ҭe@ 0 0 0  \ 0-L@P긬08#XH0U #r 0U00 -h0!XSL@hd0Si}i p0,0 T|pW gP<  0 \p\[ 0-LPP 00 , 0BSR8@TB T4 0 @0 \0 ,0@30 ,30#@0T # 2RS  @0 \J0 0 \ 00@ 0\ 0 \0 -L(\P@!h"x V:@0w03 fW0SLP H0S 80SI SM S- @H0S]P W@  0,0 X  1 0\T@P  W #$!W0W 0m'P 4SVQ #g!$bW `, 4`4V0*@p -LM0PSD1:8#x 0CSp7@`"K! 0FP`/"[V"40 @0S #00S 0 , 00#0 0 0L1S0psH p-LM`KP 0@Px1[80 0 P0![00x 0-LM0@ ,0P0CS* < < < C20000 00 40, 00040,0Q00,0 00,0 (Qp-L@"hP40S6 S!x0 :380 \@0T) ㎦0 ,@ 0S p x ppdmD 0pp -LM`pPp@0SS0 ,0L@0 \0 ,< 0 \0 ,+0 S S 0CS񟗤<<<<<<<<TpL1SV SV SW Wd@ @T 0#, 0S S 0S0 h#h3PP( C@, P0 ,@DP@$d1U@@ԥT0 , < \0,,@0", 0,,T2P0ࣇ*KpPpP["[@08#XZt@@H$H 0@HpP$,0K  d|}0,, <4<,\0@0P!, 0$!\0\1P p60 ,0@ 1\0 ,0St4 0 \0 ,0S@0Rd'IMP[N -QLMP@0'0Ss S$ x0:38 \P1U^ 20 ,P QP0SV 0 Px J0 , pK 60' \0 ,`P8#h0 ,0`$0 0PU0`0D 0dㅤ0 -LM @KxdP` p ^P "[00 2KP"[ P+&(0  PW P, "[ ( ` -L ? \x ppP`t@PV  l@T0X @ NXBXXB -LMPp`bP'5#H2TD  T0#03x0%x05%( T@ 0W 0 S UW  2@ @ *"(PW t0S x0S0  $ K<0bC0P  0-@ -LM0P0CS"K` K0@DqP @ 0SSVS' S @"[0@S("(@P t0SV(*@P @T0ST (*`V ,0@(*`N -L@0LSPp0i1\\ P ` 0SS S S. S ` `S0 ,U("([`P t0SU(*N`P `V0SV (*>PU `(*1P -LM 0@ S @ KP P1S1[1[::1K1K![` 0-LM KPp@P1[A=A S 80$ , 1[ 00$ \8 p-LM0@SP x`K 04P1[UP 0 S S ,P nx|A,P x "P1[M=I SP1K P1[3;# S1K 0 0PS` 0-LM 0@ S 8PK 1[  P1[3;# S01K7$$ P +~8@ a -LM0 K@P1[; 1Ki0` 0-0LS@P 0jPPd SPP 104 HPP$ BPP <PO$ -LM P0@P t!(@P "@P`pK @P y@P1[0S 0F8#h嵡 @P孡 @P奡,@P坡 @P @P` B@P <@P(1[0F8#h@BP 0-LM@ KHP"P T1[1[001K1K1[; 1K8` 0-LM0P),0 ),0 p),0 T),0 8),0 ),0 ),0 (,0 (,0 (,0 (,0 t(,0 X(,0 <(,0  (,0 (,0 0CS0',0 ',0 ',0 ',0 h',0 L',0 0',0 ',0 &,0 &,0 &,0 &,0 &,0 l&,0 P&,0 4&,0 &,0 %,0 %,0 0CS0%,0 %,0 SK00p%,0 L%,0 0%,0 %,0 $,0 $,0 SS0$,0 $,0 t$,0 S0A,,0 ,$, 0 0CS0S0$,0 #,0 #,0 #,0 #,0 l#,0 L#, ^08#,0 #,0 ",0 ",0 ",0 ", 0",0 h",0 L",0 0",0 ",0 !, M@K         x l ` T H <'@@@@@ @(@0@8@@@H@L@P@T@X@t@x@|@@@@@@@@@@@@@@@@@@@@ @4@<@@@@@@$AAA AAAA A@@@@@@\@`@d@h@l@p@PaQaRaSaTaUaWaXaYaZa[a\a]a^a -LM0@0CS`PPP0S 0,, 0( , 0.,p KPP1[ V !K @@01K1[01KpP1[;1K,![PH@01K1[01K` p-LM0@SS  `x0,P K`P1[+  PP1[9 S\  S\ 0 \x -LM K@P; 0SE   KP31[ 0K1K1[![@01K1[01K1[ <1K <K1K(0S0====1[;1K![P 0S  ![1[;;1K1[;1KK -LM0@Sp` S?000 PU$ 0S@ S 0Sq 0S0 ,?0@d0 00000 PU0S "K $P2[P  P0dS S2[@00\0Sk 0 P2KP0A., ?0 0A.\$ KPU2[2[;;2K2K"[w\00S*K@ `P22[99 2K$`P*X3,`P",Ǜ"[`P002 KpP3[=3ST=|=t=l=d=`ꌀn}P{2y`1Xw*K@ K0PO2[9#9 2KPZ00^BK  Vဠ@BD2 K-P@3[0@ 8}S!Z!TX0j8#8C!'" 0 0C?8#.2 KP3[0S񟗟T===\==s<`긣?[/ N5???? 0-L M @0BSGR R K00S @P0SS0S PK P P1[   KP KP![  1[  |0S! 0(0K K=P1[S(0S; S  S |0SS 1S0 0(0(01[; S0(01[; S -L M0@Sj 0 ,0 `, p0BSPRR1SoR R 0BSQR PK7SHrP0P0  01^/\0 , A0 \4PP0S0^/,P0 , P0S K" K1P1@  0^/0\ @0 \01`K PP PP[0 !S@  0 S! 0S 0SS S SS   S S S 0S 0CS&0S&0S 0 \0 , 0 \0 0\0Sw 0SS`PP-1SV $K& K PP$2[Sw 1SJ 0,, 0,\ Q90^/,P0 㗙0-,0 3"1 0-, PR0S 01& K&Pn2[?0j+PP & KP\2[ 020WPPP[3PP6 PP4 bPP0A 1S 0 1,, 0,\ -0LSS@P Q P h[ -LM<@/0S0A8 B#p -0 1K    ,| pp h \? P N[/s q!y012 0-LM@SPPP  R KP- P8026 P 00CS10S% SPPqPP0 , pU1[9 1KAP PPMP'T[ p-LM`PV@ x 0BS@T7 R R 0S #@P0 x0 @Tl Ke@PT [@ 0St00CS+@P+@P Rt 0BSR! ! ! ! h! L! 0! !      ot 0BSo @P\ ~@PV R`t0t0S SY-lR@PB F1`#$%'5439`1DP` p-LM1@S xP x0 0BS{ 0S 0BSR)0BS KP00CS 0.\0S S KP![x40 1KPPK qP0 S S| 1[ $R00:K1K R:1K:1K![P0S X0P`S0XS0C0< S   CP![ 0  00VT0 V V;1K![ x0,, <4<,\ pR R. 0BSO0.,0S SZ 0CSL 0.\0S S  P0.,V1[ :1K  KP1 KP)![10 1KlP![10 1KaPK7 KP ?![d10 1KKP![<10 1K@P P![00 1K/P  P![00 1KP:  K}P1[0 1K KoP1[0:;1K![3:1K![/: -L M0`0CSdd-F@P  KH$ K]@P2[?0 $2K4@P0 ,0SP @0; \Q QQ QQ Q Q Q01Q 0SS= S; SS_ S] S[ S SS1S0& K@P2[#; 2K@P 8P@P 0,\ a= \@P@P@T @PzP"pK @P o@P k"["10@108#X U^Q00CS&PK @PPp :R P2[;2K2[ |R 0K2K R@02K R`02K0"[@S0K2KP2[;2K"[@P% 0St0S+p 9R'  d@P 0S2[02K2[t pRK9p R90; 90< 2K@P 0S S P@Pl0S ( K42[0 2K Q>Q.2K@P 0(@ ,P& K@P"[ȟQQ ;2<<K2K2K0AS2[2[:L@0ÓL=Ã2K2K@ 0 \ 0SS S SS SM *K @P"[70 2Kp@P"[j@P0SI BKP(pK @P o@P<k2[60E8#X 0SSS  A@PW ;@PQ 5@PK2[P 2[ؓ @P 80E@P83#X 0SSM SK S Ur@P#0"[S00K2K2K2[0 U2K@P*K W@P"[50 2K@P2[92Ks &0K@P2[\%9#S @P,%@PA S[1SX7@P& K@P2[#; 2K@PE 1S 0S>$@P&PK @P"[d40 2K@P0 , 5 \ @PP2[0 2Kq@P @P"[30 2Ka@Pw @Pq2[0 `2KR@PhSmH@`2[0 2K>@PT @PN2[ ;2K*K @PB"[20 2K"@P8&PKU @P02[0 U2K@P' p@P!2[!Q "K Q 0`02K2K"[0S0K2K"[@Pd@P>t0S  @P @P 0 :@P2[\ 0  K@P (@P2[p0 2K@P @P0p R2[2[;;2K2K"[@P00CS<0S90S6^@P1S^K: A A A40R? -LM0PSD1@:8#H<P`>( R Q ( 9 Q7Q|  p0S6  R]`00CS]0.<\ 00CSD(0@0P(,Z/0\0P,0.\ K$1S ( Q0x0x00AS] R 0BSQ[Q0 00ASm0&@Kx0x00Sx0 cP2[p妑$ KXP2[p 0 Lt0pR0J=J=K=K=K=hK=K=K=J=J=J=J=0C=0C=J=0K=J=hJ=hJ=TJ=I=I=I=I=I=Rt  0BRSR 0 ,0@S S\ Qp 0Q2Kq Qo W(0S?I=H=I=H=1S'0P<)Z/\0P|)<.\]Q "0K8P2[:D (0 <P(1Z/0AQQS%Q# P!Q Q0 0FQ Q Q $0K`P"[p8R 0 2KA`P0 0p$ K`P 1`P&@K `P"[70 2K `P `P y`P2[; 2K `P"[`PV`0S`0@':\$,00 7\0, <\0( 6\0$ ;\ Q B!x60S=  Q(  ( [P 0p 0]`P F0^/0\ 0 \0 ,@@0S 0 ,P`0@@2T d+0 , 2T00`00V`P` E`A4Q  4Q  4Q  4Q 4Q 4Q +4Q 0 0R7 4Q :x$x4QQF \) pX4Q  4Q 4Q 3Q 0Q   4Q V3Q 00CQ 0Q 3Q 0 03Q t0S0 0 \0 03Q 0 0x3Q 0d#,>  x`0 ,P! P 04 , 04 \w|2Q8 02QB {1>CQ 0 0p0|", 0P"\p0`0J0 , 0 \K;1Q >P0CQy0 0?1Qz 90CQoz 0 04 0 01 0LS0 0,0 0)0 0& J <1Q (1Q 1Q  &  "0KPr 2[02 \7A9>CS90Q 0Q2F0Q d0Q+ So ( `!h!@_;`' 0 T0 AP A ATT APT@M A A AB -LM0PS 40S 00CSu0 0\0,0\ 0+\0 @, A匎0 , p R R 0BSR/ RS 3 \P Rr ROPh RS$_0A S  Q Rs Q Q Q 0 0\0 , R 0BS0&, 8d&\ 0BSTR( @"460Sn 0l@  0\0  3\02  0 , : \0 ,}0A S  Q R 00%, :%\ Q Q{0,, <4<,\Qg0$4\^ %>2 1S % 3 \坍0S(1S%0$,I匍 3 \ }0 1\lq 0BS0,, ` 0 ,\0,,@ }Q`V 0 R0*0\0"0\ 0[,, 5  8[,\w< . P) 00C S @ 0AS0 , @Tt P 0 , : \0 ,2"0 6\L1 S;7#$0K0 ,1[ 0 \ P0qS0D , '0p XP_eeeeT[ Na -L M pR$ 0BS5RR PU1Sw 0ES'U<U 0ES 0ES`@PU8zT (u$s,YBHGB#@ j=+AdGBAı@ p-QLM`P͐ :lBpt2 ` l•p 0Xxh< "< S "80S"40S 0-L@ᣩPP Q 8 0Xt"R0l2ptR0 p-@L㳅0`=2PP  \ l”pt"8 0ph0 ӞpYB$8 -LMp'N_`@ P  0 P ؿ$Kl2p ,l–Tp 1\儈0lBh2Ppt2 P l–p 1\Q 0P(K$PX;( (0@(  0`(1,P" 喿8f3PH8+  pPP& l–pt"8 0ptT |oxml2t"p^3D 0=2,+O|DYBHGB*$ AdGBAı@+An=< "< S "80S"40 S88 8#8S  0!S<0:0CSC -l2@Lp , `/'4`, 7 0Sp ǔ 4PX0U 7 PZX '4`\YB 0-L@pPP Q 7 0Wt"R0l2ptR0 0-6LSP@ Q 0h'0 -pML'N_`@ P  0 P4}@P 垾(KW0h24l2p $l–x p0X8(3("(RQ A?R 0,K$P ul2t"p f, (@,  @2,P Y `  P:Lw=v=v=v=v=v=v=v=v=v=v=v=v=v=v=v=Lw=Lw=v=v=v=v=v=v=v=v=v=v=v=v=v=v=@w=1!(R 0RzP 7P ǖ0P 0`28}3P2K  L1"R|20|2@P'  7 0|0`20`20!Sg<00`Sc7H ǖ2H U ˂0t 嫜,hɽT XĽT½K3 @ }DYBHGBhZ$@Cr=YB|YB1$8dGBAı@+A -|0L@Q 0C 0T0 P=PB=0 <=4= 0-@L0P  0hp4= -QLM Q  (0嚕 K0 x=4= -LM8p8!#8S`K !1  1圁  4 z@B͆ B0] P@@f|P <. K 0$K$P0$ (P 0@$  ` ,0P  80!0 (R R 0Rx P0 l0Rd 40 XT HD8k4=|8=DYB<= AYBk$kYBAı@ t겥? -(0L@0  VV - 0L0 V80 -QLM QV  ,0Д K8@ D|= -L@>0  0V V -LM1p 吁` 41 4 yPB͆BVL  $@0P @PP{P (Y K 0$K$P00$ (0@$  0`0,0P 9 0 0 4, < 0  s0x p0 \TT D@VVDYB`# V A{=`U|=tzYBYBAı@88< #8S 0 s!8C > >>> > > >>4x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`<<4t5r@`X@`TT``\\Pdd@4zll5~~4|X4zll5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`DD@`LLxx5r6r           xxxx(C|zwi_do_hostdecryptwi_do_hostencryptwi_attachK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-rt2661_rx_intrrt2661_tx_datart2661_tx_mgt@02D0H0L0\0;51.`0,***|00 0 l(000400000#0  00 `4H< 4s"$4D#(444!,-./0 8  "%')`56<=>KVXZcfk3 3 3 3 3 3 3 3  3  3  3  3  3 3 $3 f`(3 h`,3 i`03 j`43 k`83 l`<3 n`@3 o`d3 h3 l3 p3 t3 x3 |3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3  3  3  3  3  3 3 $5 `(4 `,4 `04 `44 `84 `<4 `@4 `d5 &h5 (l5 *p5 ,t5 .x4 |4 4 4 4 4 4 4 5 B5 D5 Frt2860_set_keyrt2860_txrt2860_rx_intr:: u <<4400$,,0,,H((`((l((,?  04P H ,Fs"D#4 ?LGdthtt@tx@l@tp@@?XD + $3A,B8EF IQ7RbSjTV[\gij5@p  A ! {X,              $ f`& g`( `, `. `0 `4 `6 `8 `< `> `@ `d f h l n p t v x | ~                    bwi_encapbwi_rxeofbwi_mac_fw_alloc7 dKZ-B"5*#    a.@:4@x}CCCCCCDDDFFFGGG G%G CCCCCDDF G G eS./`xZYXzRC./`xZYX zC0&* ZYXzRC   MLKJJIHGGFEEDCBBA@?>=<;:987654210/-,+)(&%#! MMMLLLKKJJIIIHHGGFFEDDCCBAA@??>=<;:98765421/-+(%!  )ZYXCQR bwi_rf_workaround)ZYX +RCz i )) i ) I i i I) i) I I)i)i(h(h(h(h(h(h(hHH( h !H!!!("h""#H###H$$$H%%&h&&('''G((G))'**G++,g-G.g/G2&5F6&788F99f::f;;E<<===E>>>E??@E@@@EAAA%BeBBCECCC$DdDDEDEEEFDFFF$GdGGG$HdHHH$IdIII$JdJJJ#KcKKK#LcLLL#McMMM#NcNNN#OcOOPCPPPQCQQQ"RbRRRBSSSTbTTUBUUUBVVV"WWWAXXYaYY!ZZ[[[a\]] ^^_`a<1??????????*?7?D?P?]?i?v@@@@@@@@@@@@ @@&@2@?@K@X@e@q@~?????????????!?.?:?GT@<wlbQ@;53-/**'%!!%'**/-35;@Qblwzuqlgc^YTPKFB==========================BFKPTY^cglquz˓dfX&ئ͟8ʴ)ǎi+jlbsCv ViDz#((?-җ1h5u85;5=f>?@?r>e 5=5;/u8h5#1E(?- -(1#4T8;i= >C??b?l"?+=;85&Z2X.dϚ)m$bwi_phy_init_11b_rev2"$#X#|# n bwi_mac_testohci_root_ctrl_startehci_root_ctrl_startsr_checksumsr_raid_inquirysr_map_rootsr_meta_opt_loadsr_meta_native_probesr_ioctl_installbootsr_meta_native_attachsr_rebuild_initsr_hotsparesr_meta_validatesr_meta_native_bootprobesr_meta_probesr_ioctl_createraidsr_boot_assemblysr_raid_read_capsr_rebuild_threadsr_crypto_read_key_disksr_crypto_create_key_disksr_crypto_calculate_check_hmac_sha1sr_crypto_decrypt_keysr_crypto_alloc_resourcessr_crypto_change_maskkeysr_crypto_ioctlbioioctlhotplugclosehotplugreadhotplug_device_detachhotplug_device_attachdb_fncalldb_commanddb_print_cmddb_examine 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-|db_show_regsdb_printsymdb_write_cmdextract_entropyarc4_initrandomread n;AvXaM ְdx cd9660_mount&&&P&&&&&D&&%̝(&coredump_note_elf32coredump_notes_elf32coredump_elf32elf32_load_fileCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2013 OpenBSD. All rights reserved. http://www.OpenBSD.org Xo&n&ho&k&k&l&(o&n&(l&Dl&hl&l&n&n&m&Ln&n&n&&ؠ& $$ @@ @? @ @ @coredump_tradcoredumpsysctl_diskinitkern_sysctlsysctl_tc_choicesysctl_tc_hardwareconfig_detachdisk_mapfindblkmajordk_mountrootsetrootdisk_attach_callbackextent_print1extent_freedb_show_all_poolskprintflogprittwrite@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@cache_lookupsys_fhstatfssys_fhstatsys_fhopensys_getfhsys_mount  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????msdosfs_lookupUmsdosfs_mount+***̝((**̝(H***̝(*msdosfs_createmsdosfs_mkdirmsdosfs_renamemsdosfs_readdirbpfwriteifpromiscifnewlladdrif_getgroupmembersif_getgroupifconfif_clone_listif_group_egress_buildif_downallifioctln; &C vkkMPG&"֊/aK+d 5ӆ1 q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_wep_decryptieee80211_wep_encryptPPPPPieee80211_ioctlieee80211_ibss_mergeieee80211_end_scan  0ieee80211_node_attachPP ^/ f ^/ ^/ieee80211_recv_4way_msg3ieee80211_recv_4way_msg2ieee80211_recv_4way_msg1PPHB@TB@`B@lB@|B@B@B@B@B@B@B@B@B@B@B@B@B@C@ C@C@C@ C@(C@,C@dA0C@ieee80211_newstateA8C@AB3A0 Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTT @6MD5FinalRMD160FinalSHA1TransformSHA1Final؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~                               A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||cryptof_ioctlswcr_authencswcr_authcomputeswcr_encdec66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\aes_xts_cryptaes_ctr_cryptZAES_CMAC_FinalHMAC_SHA256_FinalHMAC_SHA256_InitHMAC_SHA1_FinalHMAC_SHA1_InitHMAC_MD5_FinalHMAC_MD5_InitAES_GMAC_Finalaes_key_unwrap H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@ffs_mountТ0000000P00؇0܈000 ufs_makeinodeufs_mkdirufs_linkufs_renameext2fs_readdirext2fs_direnterext2fs_mountt10k100Li1g1d1@c1a1y1a10h181^@111(11^@D11^@H11^@,11l11_@@1Ȫ1X111_@181 _@uaddr_pivot_removeuaddr_pivot_insertuaddr_bestfit_removeuaddr_bestfit_inserttjjxj`j`j`jxj`puvm_map_printitvmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVEENCRYPTPMAP0PMAP1PMAP2PMAP3\sys_swapctlin6_pcbnotifyin6_pcbconnectin6_prefixlen2maskin6_prefixlen2maskin6_ifpprefixin6_delmultiin6_addmultiin6_ifloop_requestin6_update_ifain6_controlin6_lifaddr_ioctl0123456789abcdefin6_ifdetachin6_nigroupget_last_resort_ifidin6_ifattach_loopbackin6_ifattach_linklocalin6_ifattachin6_selectsrcfrag6_inputicmp6_redirect_outputicmp6_mtudisc_updateicmp6_redirect_inputicmp6_notify_erroricmp6_reflecticmp6_rip6_inputni6_inputip6_nexthdrip6_savecontrolip6_setmoptionsip6_getpcboptip6_ctloutputip6_outputnd6_lookupnd6_ioctlnd6_rtrequestnd6_freend6_na_outputnd6_ns_outputnd6_na_inputnd6_ns_inputin6_ifaddnd6_prefix_onlinknd6_prefix_offlinkdefrouter_delreqdefrouter_addreqnd6_ra_inputnd6_rs_inputrip6_outputrip6_usrreqrip6_inputudp6_output0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs<555 5Hz5 Hz5Hz5 Hz5 Hz5 Hz5@И@@ܘ@@@@@(@@   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`D545o(55o(@AĜ@AМ@AԜ@@ BBBB ؜@BBܜ@@ @@@@@@ @@@@p @$@p 0(@$@p `0@$@p p8@$@@@@@`D@@P H@$@P L@$@P @P@$@P PX@$@ `@d@l@d@`@p@l@p@X@\RBP@\RBx@\RB@\RB@\RB@\RB  8@A8@A@@@@@@@ @@ @@ @@ @@ ĝ@@ ȝ@@ ̝@Н@ ̝@ԝ@/؝@dBoܝ@@0/Ԝ@dBp @? @@ @@ @@@ `@@ !@@ @@ @@ @@  @@ 0@@ @@@ `@@  @@ $@(@ ,@@ 0@(@4@8@@@8@ D@8@0H@8@@L@8@PP@8@`T@8@pX@8@\@8@`@8@d@8@h@8@l@8@p@8@x@|@@|@ `EB|@0@|@@@|@P @|@`@|@p@|@@|@@|@@|@@|@@|@@|@@|@ @@ @@Ğ@Ȟ@О@Ԟ@ ܞ@@0@@@@@P@@@@@@@@@@ @@@@@@$@@(@0@4@0@8@@@ D@@@H@@@ P@@@eqnecsccmiplvsvchilsgeltgtlenv0.01.02.03.04.05.00.510.0daiadbibedeafdfasdeppmzlsllsrasrrorAТ@q>Aآ@q> A@q>`A@q>A@q>`A@q>`A@q>`A@q>PT@q>A @q> A,@q>D8@q>D@@0r>iH@pr> iP@r> iX@r> $i`@0s>0$ip@0s> ,i`@0s>0,ip@0s> .i@ps>0.i@ps>!i@s> !i@s>)i@s> )i@s>-i@s>Ai@s> -i@s>Ai@0t>Aiȣ@0t>Aiأ@0t>`A@q>`A@q>PA @q>pA @q>A $@q>A $@q>A 4@q>/A H@q>?A \@q>A p@q>A @q>/A @q>?A @q>OA @q>A Ф@q>A @q>/A @q>?A @q>? @@(@4@<@H@<@T@\@h@p@|@@@@@@@@@ĥ@ԥ@@@@@$@4@D@T@d@t@@@@@@@@Ħ@̦@Ԧ@ܦ@@@@@@ @@@@$@,@@Ħ@̦@Ԧ@ܦ@@@@@@ @@4@<@@@@Ħ@̦@D@L@T@@@@ @d@@@@p@|@@@@@@@@@@ @@̧@@@@@ @4@Ԧ@ܦ@@@@@@ @d@H@p@T@`@@Ħ@̦@Ԧ@ܦ@@@@@@ @d@p@@@@@Ħ@̦@Ԧ@ܦ@@@@@@ @d@@@@@@Ħ@̦@Ԧ@ܦ@@@@@@ @d@H@p@|@@T@Ħ@̦@Ԧ@ܦ@@@@@@ @d@H@p@|@T@l@l@t@Ԧ@ܦ@@@@@@ @@@@@@@Ħ@̦@Ԧ@ܦ@@@@@@ @6Ī@| 6ت@6@| 6@0 6@4@0 6L@l@0 6@@0 6@@0 6@@0 6,@L@@````` ```dumpsysh@|@@@@@@е@@@@ @@(@8@AL@l@@@@@@@4@P@|@@l@̷@@@@<@`@@@@̸@@@(@X@@ȹ@@ @T@@ @ @ $@ `@ @Ի@ @D@d@@̼@@(@X@@@@ @<@d@@@Ծ@@ @ 8@ P@ d@ |@ @ @ @ ؿ@ @  @ T@ @ @ @ @ @ D@ l@ @ @ @ @ @ <@ \@ @ @ @ @ @ D@ `@ @ @ @@@$@@@T@x@@@@0@H@`@|@@@@@@ 0@ @@ T@ @ @@@ @<@\@x@@@@$@@@T@t@@@@@@4@T@@@@@@@@p@@@@@<@p@@ @@0@h@@@@@@@@\@p@@@@@@ @,@H@l@@@ @ @ @ 8@ \@ @ @ @ @ @ D@ h@ @!@!@!@!@"8@$l@$@$@$@$@$@$@$@$@%@&4@&L A& A&T@&x@&@&@&@&@& @& L@& h@& @& @&@&@&4@&\@&@'е@'@'@'@'@'$@'<@'X@(@(@(@(@),@)\@)p@)@)@)@)@)@*D@*(@*@@*X@*p@*@*@*@*@* @* $@* D@* d@* @*@*@*@*<@*p@+@,@,@,@,0@,T@,t@,@,@,@, @, @, @@, P@-t@.@/@/@/ @00@0P@0t@0@0@0@0@0@@0T@0 @0 @0@0@0@0@10@1H@1`@2@2@3@4@5@5@54@5T@5x@6@7@8@8@8@8(@9H@:h@:|@:@:@:@;@;8@;d@;@;@;@;@;@;@; ,@; D@; d@; @; @;@;@;@;@;0@;L@;d@;@;@;@;@;@; @=,@>P@>|@>@>@>@?@?$@?<@?\@?x@?@?@?@?@? @? @? @@? T@? l@?@?@?@?@?@?@?$@@@@A`@B@C@D@Dq@E@F@G(@G<@G\@G@G@G@G@G$@HT@I@J@K@K@K@K@K@K @K4@KP@L`@N@P@P@P@Q@Q @R@@SP@Sl@S@S@S@S@S@S,@SH@T`@U@U@U@U@U@U@U<@U\@Uh@U @U @U @W@X,@YH@Z\@Z@Z@Z@[@[@[@[(@\D@\X@\p@]@]@]@]@]H@]@]@]@] @]T@]@]@]@] @]T@]@]@] @]!,@]"d@]#@]$@]% @]&@@]'x@](@])@]*@]+H@],|@]0@]1@]20@]3h@]4@]5@]6@]7L@]8@]9@]:@];$@]<X@]@@]A@]B@]C4@]Dh@]E@]F@]G@]H,@]IX@]J@]K@]L@]P@]QT@]R@]S@]T@]U$@]VT@]W@]X@]Y@]Z@][L@]\|@]`@]a@]b$@]cX@]d@]e@]f@]g,@]h\@]i@]j@]k@]l$A]`A^A^A^A^A^A^@A^dA^A^A^ A^ A^A,A^BLA^ChA^EA^GA`AaAaAa AbAc8AcdAdAdAeAfAfAfAf@AgpAgAgAgAgAgAg4AgXAgxAg Ag Ag AhAiAi0AiPAjhAkAkAkAlAmAnAo4AotAoAoAoAoPAqArArArAr ArT Ar Ar Ar As As As As As$ AsH Asd As| As As At At At At4 AtT At At At At At  At , At T At t At At At At At! At0@ At@d Ata| Atb Atc AtdAtn4Ato`AtqAtyAscsibus_printlinkAA AA A@4A@A@TA`AtAxAA@AA@AA@AA@AA@@A@AA@AA@AA@AAA$A(A@A0A@8ADAXA\AhA|A\AAA\AAAA@AA@AA@AA@AA@AA@ A(A@<ADA@ATA@AdA@tA|A@AA@AA@A @@@@@@@@@@@@A@@sd_read_cap_16sdgetdisklabel@@@@@@@@@@@@@@@@@@ jB7(jA7Dr7q7o7,o74o7(o755505(5P5x555@5h5555 5`55555555\5l5|5555,5P555t555AA A A(AwddonewdattachwddumpABCDEFGHIJKLMNOPQRSTUVWXYZusbioctlp8"88P8usbd_set_config_indexusbd_devinfo,A$,A0,AD,AP,AX,A`,Al,Ax,A,A,A,A,A,A,A,A,A,A,A,AX f(  pt""(4I@@@@1` #U3UCU4QF              @@@@@@@@@@@@@@@  @  @ Q@  @  @ @ P@ Q@ u@d@d@@@@|@@@ @ @@@]@@@@>@$@c@c@eaQ@X@W@0@ w@Q2@U@4@F s%^^uhub_attachD r8xm8i8i8ucomopen`r888hr8ugen_do_writeugen_do_readL8D888ugen_set_configuhidev_set_report_asynctļ88p88uhid_do_ioctluhid_do_read(88888=0>R> N>]b>>R>I>$>J4>Rȡ>7l> ڢ> > > :>KJ>>@#>>>>>> >>H@> N0> _̤>>>\> <> T> <>Ej> >m >K>A|>[>>0Ҭ> 2>B>jT>(>?H>nư> >J>J>abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L.MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.ehLiMjNkOlPmQnRoSpTqUrVsWtuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    8P8<888h888885dd5(I*LCDEOMPJQNRKl88H8,H88888@88X8\88888p8(  v      W 1 Q `  88@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   8  L+ L h8L2 D   O  {,8o  A umass_scsi_probed(99<99fGg ---0000 0@0P010`0p0aLfLLLLiF  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n@n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF 9 |9%9 99axe_iff B  w *w +w +~ W UP  < 1b0 0r{&"79n= wF@W wn a- x-9p99 49X-9PK9T9]90K9$$0$0$$$$$$$$$$$$$$ $8k9l9s9k9@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0x999x92V{%1" `"'`~%ZP `|909990w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-udav_iff9P99@9hF F hF fF `9|9 99t9999url_int_miibus_writeregurl_int_miibus_readreg@@9WP P Q@9999uftdi_2232h_getrateuftdi_openP9<999`VV !y`V'V%V&V3V4VPVIVVVVVVVVVV}  H(02135HPPQ nY ol\k] ih^_mZ[Xj 2``` ``x     tq?=:>9;<8pq8     JKLIؼټy`ؿۿٿڿHIJprsq"`r``xȽPW8P3 & & & & & & & & & &     < < < l F F ! ========== = = = = =================== =!="=#=$=%=&='=(=)=*=+=,=-=.=/=0=1=2=3=4=5=6=7=8=9=:=;=<===>=?=@=A=B=C=D=E=F=G=H=I=J=K=L=M=N=O=P=Q=R=S=T=U=V=W=X=Y=Z=[=\=]=^=_=`=a=b=c=d=e=f=g=h=i=j=k=l=m=n=o=p=q=r=s=t=u=v=w=x=y=z={=|=}=~=================================================================================================================================0 B9 !PPPPPPPPPPPPPPPPPPPPPP PPPP PP PPPP PP PPPPPPPPPPPPPPPPPPPPPPPP: :  !RR !R !R !R !R R "R !"R "R ""R "R #"R $R !$R 1$R A$R $R "$R 2$R B$R $R #$R 3$R C$R (R !(R 1(R A(R Q(R a(R q(R (R (R "(R 2(R B(R R(R b(R r(R (R (R #(R 3(R C(R S(R c(R s(R (B@  >d l, :: ::G W WnPnPA   !^y 4Xhp9{#{{{{ rS#S&@'ah 33.U 1(Ex$ #hp::h:0:0    `l::\:$:   &  l! eX`(:%:l%:4%:D|+:+:(:(: B  Q  umsm_umass_changemodeX5:6:5:T5:=beeK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-   Pp < aA>bA >bAx>bA>(@>bA,>$bA>` @(>4bA >hA >DbA `>PbA >\bAP>`bAh>ܦ?>pbA>xbA`A)gbA:gbA%hbA2hbA6hbArhbA3ibAricAqcAq$cAqwAk?wAk@wAkAwAkBwAkCxAkExAkFxAkGxAkHxAkIxAkJxAkK(xAkL0xAkO8xAkP@xAkQLxAkRXxAkShxAkThxAkUhxAkVtxAkWxAkXxAkYxAkfxAkgxAkhxAkixAkjxAkkxAkE\pA8xA8xA B푠yA홠yAyA yA(yA 4yA0@yA`LyApXyAdyApyAyAyA yA0yA`yApyAyAyAyAyAyAzA[zA!B zA!0zACuAHzA`zAP1|zAP1zAT1zAP>zAT>zAp>zA6AzA7AzADAzAEA{AFA{AGA0{AHA<{AIAP{AJA`{AKAp{APA{AQA{ARA{ASA{ATA{AUA{AVA{AXA{AdA{ApA{AqA{ArA|AsA|A7B$|ABB0|ACB<|A6CL|A7C\|AACh|ABCt|AEC|AGC|AHC|AIC|ALC|AMC|ASC|ATC|AXC|AaC|AbC|AcC|AeC}AgC}AhC}AiC}AlC(}AmC4}AnC@}ApCL}AqCX}ArCd}AsCp}AtC|}AuC|}AvC}AwC}AxC}AyC}AzC}A{C}AC}AC}AC}AC}AC}AC~AC~AC~AC~AC~AC~AC ~AC,~AC8~ACD~ACD~ACD~ACD~ACD~ACD~ACP~AC\~AC\~AC\~AC\~AC\~ACh~ACt~AC~AC~AC~AC~A7D~ATE~ABG~ADG~AIG~ALG~AMG~ANG~AOG~APG~AQG~ARG~ASG~ATG~AUG~AVG~AWG~AXG~AYG~AZG~AfI~AfI~AnI~AHJ~AIJ~AJJAKJALJ~AMJ ANJ0AOJDAPJTATJdAiJxAIKAJKAKKALKABL~ADL~AELAFLAGL~AIL~AMLANL~APL~AQL~ARLASL~AWLAXLAYL(AZL(AdLB0A$ DA$0TA$PdA$QA$tA$%A$A$A$A$ īA$!ԫA$"AtqAtPAtX A]A]h$A]i0A]xDA]PA]XA]hA]tA]A](A]8(A](ĬAԬAAo#p(zAA8 A?A? A?,A?Ā,A?Ȁ,A?4A?DAWLA\Ap`AhApnAxAAAA$AȳAAA.A:AjAOI"$AP|A@ACAHĺAIغAJAKALAMAPpAQpAR|AS|AT|AU|AV|AW|AX|AYA^(A_@A`XAdpAepAf|Ag|Ah|AiAjpAkpAuAvAwȻAxAyAzA{A|,A}DA~\AtAAAAAAA|A|A|A|A|AȼAAAAA$AAA AAA(A(A8A8A8AA8AHAHAHAHAHAHAHAHA XA"lA&|A-|A:A;A=ADAFAIAJASAUAWAXAYA]A^A$A$(A$4A$@A$PA$`A$pA $A!$A"$A#$A%$A&$A($A@$AB$AC$AD$AE$AF$$AH$4AI$HAJ$PAK$`AL$lAN$|AP$AR$AS$AY$A]$A$A$A$A$A$A$A$A$A$,A$8A$HA$TA$dA$pA$dA$A$A$dA$A$A$A$dA$A$A$A$A$A$A$ A$A$4A$DA$A$TA%dA%pA0%|A1%A2%A3%A4%A5%A6%A@%AA%AC%AD%AE%AF%AG%AH%AL%AP%AQ%AR%AS%AT%A`%(Aa%4Ab%@Ap%PAq%\Ar%hAs%xAv%Ax%Ay%A{%A%A%A%A%A%A%A%A%A%A%,A%( AO(0A0(@A1(@A2(@A3(@A4(@A5(@A6(@A:(@A?(LAA(LAC(LAE(LAG(LAI(LAK(XAO(hAP(xA)A)A)A)A)A)A )A!)A")A#)A&)A()A))A*)A-)A.)A0)A2) A4)A5)A6)A7)A8)A9)A:)A<)A>)(A@)8AB)8AD)8AF)8AH)8AJ)8AL)DAp)PAq)`Ar)pAs)pAt)Au)Av)Aw)A)A)A)A)A)A)A)A)A)A)A)A)A) A),A)8A)DA)DA)TA)TA)`A)pA)|A)A)A)A)A)A)A)A)A)A)A)A)A)A)A)A)A) A),A),A)8A)8A)DA)TA)`A)lA)xA)xA)A)A)lA)A)A)A*A*A*A*A*A*A* A*A*$A*$A*4A*4A*@A*PA@*\AA*hAB*tAC*tAD*AE*AF*AG*A.A.A.A.A.A.A.A.A .A!.A".A#.A).A0. A1.A2.A3.A0$A$14A2@A@3LAA3\AB3hA4xA4A4A4A 4A 4A 4A 4A 4A4A4A4A4A4A4A"4A#4A%4A&4A'4A(4A)4A*4A+4A,4A-4A.4 A04A14A24A34A84A?4(A5LA50A 5@A5LA5LA5LA5LA5LA5LAu5TAv5`Aw5lA5|A5A5A5A5A5A5A5A5A5A5A5,A58A58A58A58A58A58A5DA5TA5`A5lA5A5A5A6A6A6A6A6A6A 6A 6A 6A 6A 6A6A6A6A:A:A:$A:A:4A:DA:TA:dA :pA":A%:A&:pA0:A4:A5:A6:A7:A8:A9:A::A<:A>:A@:AB:AD:AF:AH:AJ:AQ:AU:A`:Ab:Ad:(Ae:(Af:(Ag:(Ah:(Ai:(Aj:(Al:(An:4Ap:HAr:HAt:HAv:HAx:HAz:HA|:XA;dA;dA;lA;xA;A;A ;A ;A ;A;A;A;A;A ;A!;A";A#;A%;A&;A(;A);A,;A-;A.;A/;A0;A2;A4;$A6;$A7;$A8;$A9;$A:;$A;;$A<;$A>;$A?;$AB;LAD;LAF;LAH;LAJ;LAL;LAN;LAP;LAV;0AW;@Ad;PAe;PAf;\Ag;lAP8A?PA@PDADPDAHPDARPAR`AepAe|Ae|Ae|Ae|Ae|Ae|AeAeAeAeAeAe|Ae|Ae|Ae|AeApApA pA0pAqAqAqAqAqA q,A!q8A"qDA#qXA$qlA%qxAqAqAqAqAqAqAqAqAqAqAqAqAq Aq AqAv Ax,A8ADAXA dAxAxAAAAAAAAAAAAAAAAAAAĄAńAʄA˄,A8ADAXAhAtAtAtAtAA A A A tA tAtAtAAAAAAAAAAAAA 0A!DA"TAAdAtAAAAAAARATA0A1A2A84A94A:4A;4APAQARASATAUAV AWAX,A8ALAXA~dA`r8xA`s8A`w8A`8A`8AA @AaAaAAAA0 AA A{P4A{`|APAQARASATAUAVAWAYAZA[A\A],A^#BL?#BLA(zAL#BL$BLf$BL$BL $BL0$BL@$BLP$BL`$BLp$BL$BL$BL$BL$BL$BL $BL!$BL"$BL#%BL(%BL@$%BLA4%BLBD%BLDT%BLFd%BLGt%BLH%BLI%BLJ%BLK%BLL%BLP&BLQ$&BLR4&BLSD&BLTT&BLUd&BLVt&BLW&BLX&BL`&BL&BY B&B/ &B/ &B//&By ByAy'By 'By('By8'ByL'BydAyl'Byd'Byx'By'B# 'B# 'B#'B# 'B#'B# 'B#'B# 'B# (B# (B#P,(B#`8(B#D(B#P(B#\(B# l(B#@x(B#%(B#`(B#(B#(B#P(B#P(B#(B#(B#`(B)B)B )B,)B8)BD)BP)B 2d)B 2x)B 2)B 2)B 2)B G)B)B)B)B )B *BP*BPP *BR0*BRR@*BSPW3P*B`\*B`l*B`|*B`*B`*B`*B`:g*B`*B`j*B`*B`*B`*B`*B`*B`A`+B` +B+B+B(+B6 A0+BD+B` \+B`p+B+B8+BX+BY+Bi+B+B+B+B+B$+B'+B6,BQ,BS,Bd(,B4,B@,BL,BT,Ba`,Bql,Bv|,B,B,B,B,B,B,B,B,B-B-B-B,-B<-B& L-B\-Bl-B"|-B+B8+BX+BY-Bi-B+B+B+B$+B'+B6,BQ,BS,Bd(,Bq-B-B"+B8"+BX"+BY"-Bi"-B"+B#+B#+B$#+B'#+B6#,BQ#,BS#,Bd#(,Bz(-B{(-B|(-B}(-B~(-B80-B@0 .BC0.BD0,.BP0<.BQ0L.BS0\.BW0p.BX0.BY0.Be0.Bh0.Bt0.B0.B0.B1.B1.B1.B1/B1/B1(/B1@/B1L/B1`/B"1h/B#1p/BG1|/BH1/BI1/BW1/Bd1/Bh1/Bw1/Bx1/B1+B1/B2+B2/B20B2 0B'20B02(0B82+BI2<0BJ2H0BK2+BN2X0BS2d0BX2+BY2l0Bi2-B2+B2x0B2B$3+B'3+B63,B730BC3/BD3/BI30BQ3,BS30Bd3(,Bq30Br30Bz30B{30BB+B8B+BXB+BYB0BiB-BB+BC+BC+B$C+B'C+B6C,BQC,BSC,BdC(,B8R0BS0B$S1B'S 1B6S1B7S,BQS,1BSS<1BdSL1BrS\1BaiA8b,Bbl1Bb,B'cx1BSc,Bdc1Br+Br1Bs+B's+B6s,BSs,Bds(,B8r+BXr+BYr1Bir-Br+Bs+B$s+BQs,B11B51B1B$1BS1B1B 1B2B2B$2B42BD2BP2B0\2BЕl2B8x2B'2BS,Bd2B2B2B2B2B2Bh2B3B 3BS3Bx2B8x2B'È2BS(3BdØ2B 43B8x2B8x2BS(3B8x2BS(3B%tq@3BP3Bd3Bt3B3B3B3B3B3B3B 3B 3B 3B 3B 3B3B3B3B4B4B 4B,4B84BD4BP4B\4Bh4Bt4B4B4B4B 4B!4B"4B#4B$4B%4B64B74B85B95B:5B;(5B<45B=@5B>L5B?X5Bfd5Bgp5Bh|5Bi5Bj5Bk5Bm5Bn5Bo5B5B5B5B5B6B 6B6B$6B06B<6B`H6BaT6B`6Bl6Bl6Bp6B|6B6B6B 6B 6B6B6B6B6B6B6B6B7B 7B@7BpD7BtT7Bd7Bt7B7B7B7B7B7B7B7B7B17B18B28BB8B 8BJ BP(8BP@08BP@ @8BPeT8BPd8BPZZp8BPf|8BJ8BE!8BE$8BSX8B 8B!8B@8B]8B]8B]8B]8B] 8B] 9B]8B] 9B]89B]@9B]L9Bs\9Bs`9Bsd9Bsh9Bs l9Bs p9Bs x9Bs9BsAs d9B9B89B @9BW`B a9B{!9B{!9B{!9B9B=9Bp9BW9Bu9B9B :B:B:B(:B,:B<:BD:B T:B X:Bd:Bl:Bp:BA:B:B":B#:B%:B(:B):B+:B,:B/:B1:B3;B6 ;B9;B< ;BB0;BC@;BDH;BEL;BHT;BJ\;BKh;BLt;BMx;BN;BP;BT;BU;BW;BZ;B[;B];B`;Ba;Bf;Bi;Bk;Bq;Bs;BtB>B>B>B$>B,>B<>BH>BX>B \>B h>B p>B>B>B>B>B>B'>B1>B7>B8>B<>B?>BB>BH>BO?BY?B]?Bc ?Bf,?Br8?By:B@?B9BH?BT?B\?Bd?Bp?Bx?B?B?B?B?B?B?B?B?B?B?B@B$@B0@B8@B?@@BDH@BML@BY9B[X@B]t,A``@Bll@Bo|@Bt@By@Bz@B@B@B@B@B@B@B@B@BABABAB AB0AB > > >  >> ! >> >E<2 <"E<0$@<.$@<v$@<p$@<q$@<4$@Derror %d timeout on SCSI command 0x%x INTRF single step dsp 0x%08x dsa 0x08%x %s: DMA IRQ: illegal instruction bus fault parity DMA fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid %s: scsi gross error %s: unexpected phase mismatch %d %s: phase mismatch without command parity error %s: selection timeout without command %s: unexpected disconnect without command %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x %s: script interrupt (0x%x) with invalid DSA !!! %s: command with invalid status (IRQ code 0x%x current status %d) ! error, DSP=0x%x %s: reselect with invalid target %s: reselect with invalid target %d %s: target %d reselect with invalid lun %d %s: target %d lun %d tag %d reselect without command %s: reselect with invalid tag our reject message was rejected scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x unhandled message 0x%x %s: extended message too big (%d) MSG_IGN_WIDE_RESIDUE: bad len %d invalid retval from siop_iwr()invalid retval from siop_wdtr_neg()invalid retval from siop_sdtr_neg()reselect failed %s: done without command, DSA=0x%lx unknown irqcode %x != NULL%s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s %s: unable to load data DMA map: %d siop%s: %u (%d dBm) Unknown PRISM2 chip%s: Firmware %d.%02d variant %d, Symbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: unsupported crypto algorithm %d %s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: host encrypt not implemented for 802.3 %s: wi_start: xmit failed %s: wi_cmd failed with %d %s: wi_scan_timeout: %d tries %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: device timeout %s: init failed %s: wi_mgmt_xmit: xmit failed wiiocwiscan%s: tx buffer allocation failed %s: mgmt. buffer allocation failed %s: wi_cmd_io: busy bit won't clear %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: received packet of unknown type on port 7 %s: received packet on invalid port (wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. : unable to read station address address %sWaveLAN/IEEE nodeIBSSwlanLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB)Sending deauth to sta %s wihap_disassoc_req: unknown station: %s wihap_assoc_req: from station %s wihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: rates mismatch. wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: returns status=0x%x Sending disassoc to sta %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_auth_req: station %s short request wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_auth_req: new station challenge: 0x%x 0x%x ... wihap_auth_req: algorithm unsupported: 0x%x wihap_auth_req: returns status=0x%x wihap_init: sc=%p whi=%p wihap_ioctl: i shouldn't get other ioctls! wihap_deauth_req: unknown station: %s wihap_mgmt_input: len=%d MGMT: assoc req: assoc resp: reassoc req: reassoc resp: probe req: probe resp: beacon: ann traf ind disassociation: auth: deauth: unknown (stype=0x%x) ftype=0x%x (ctl=0x%x) wihap_shutdown: sc=%p whi=%p wihap_shutdown: free(sta=%p) wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s %s: power management is disabled, cannot do WOL %s: no auxiliary power, cannot do WOL from D3 (power-off) state %s: can't map mbuf (error %d) %s: tried to map busy TX descriptor %s: unknown imtype %d%s: tried to map busy RX descriptor %s: reset never completed! %s: PHY write failed %s: bad phy register %x %s: PHY read failed %s: unknown bus speed, assume 33MHz : unknown ASIC (0x%04x): %s (0x%04x), %s, address %s %s: can't allocate tx listseg, error = %d %s: can't map tx list, error = %d %s: can't create tx list map, error = %d %s: can't load tx list, error = %d %s: can't create DMA map for TX %s: can't allocate rx listnseg, error = %d %s: can't map rx list, error = %d %s: can't create rx list map, error = %d %s: can't load rx list, error = %d %s: can't create DMA map for RX %s: no PHY found! %s: watchdog timeout RTL8100RTL8100E 1RTL8100E 2RTL8101RTL8101ERTL8102ERTL8401ERTL8402RTL8411RTL8102ELRTL8102EL 1RTL8103ERTL8110SRTL8139C+RTL8168 1RTL8168 2RTL8168 3RTL8168C/8111CRTL8168CP/8111CPRTL8168F/8111FRTL8105ERTL8168D/8111DRTL8168DP/8111DPRTL8168E/8111ERTL8168E/8111E-VLRTL8169RTL8169/8110SBRTL8169SBLRTL8169/8110SCdRTL8169/8110SCeRTL8169S%s: probed fifo depth: %d bytes : unknown uart : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : st16c654, 64 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: console %s: can't establish soft interruptcomcninit: mapping failed%s: %d silo overflow%s, %d ibuf overflow%s comprmRT5222unknownRT2522RT2523RT2524RT2525RT2525eRT2526%s: could not write to RF %s: could not read from BBP %s: could not write to BBP %s: timeout waiting for BBP %s: could not enable device %s: could not allocate protection frame %s: sending mgt frame failed 0x%08x %s: sending data frame failed 0x%08x %s: could not load old rx mbuf%s: could not allocate beacon %s: could not create desc DMA map %s: could not allocate DMA memory %s: can't map desc DMA memory %s: could not load desc DMA map %s: could not allocate soft data %s: could not create DMA map %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: could not load rx buf DMA map%s: MAC/BBP RT2560 (rev 0x%02x), RF %s %s: could not allocate Tx ring %s: could not allocate ATIM ring %s: could not allocate Prio ring %s: could not allocate Beacon ring %s: could not allocate Rx ring ralRT2529 (MIMO XR)RT5225RT5325 (MIMO XR)RT2527ral-rt2661ral-rt2561ral-rt2561s%s: error %d, could not read firmware %s %s: could not allocate beacon frame %s: timeout waiting for MCU to initialize %s: could not load 8051 microcode %s: timeout waiting for NIC to initialize %s: MAC/BBP RT%X, RF %s %s: could not allocate Tx ring %d %s: could not allocate Mgt ring RT3053RT2820RT2850RT2720RT2750RT3020RT2020RT3021RT3022RT3052RT3320%s: timeout waiting for DMA engine %s: could not read RF register %s: could not read from BBP through MCU %s: could not write to BBP through MCU %s: timeout waiting for BBP to wake up %s: can't map DMA memory %s: could not load DMA map %s: radio is disabled by hardware switch %s: timeout waiting for MAC %s: could not allocate Rx mbuf ral-rt2860%s: error %d, could not read firmware file %s %s: MAC/BBP RT%X (rev 0x%04X), RF %s (MIMO %dT%dR) %s: could not allocate Tx pool %s: reset rx ring timedout %s: can't allocate DMA mem %s: can't map DMA mem %s: can't load DMA mem %s: can't select regwin %d %s: invalid max txpower in sprom %s: no tssi2dbm table for 11a PHY %s: bwi_rf_calc_txpower failed %s: only BCM2060 rev 1 RF is supported for 11A PHY %s: only BCM2050/BCM2053 RF is supported for supported for 11B PHY %s: only BCM2050 RF is supported for 11G PHY %s: unsupported PHY mode %s: %s is not implemented yet %s: unsupported 11A PHY, rev %u %s: unsupported 11B PHY, rev %u %s: unsupported 11G PHY, rev %u %s: unsupported PHY type %d %s: too many MACs %s: %dth MAC already attached %s: MAC rev %u is not supported %s: can't select regwin 0 %s: no BBP id for device id 0x%04x %s: no number of win for BBP id 0x%04x %s: bus regwin already exists %s: no MAC was found %s: no bus regwin was found %s: MACs bus space mismatch! %s: config PS failed %s: can't stop MAC %s: invalid IV image, ofs %s: invalid ofs (0x%04x) for %dth iv %s: invalid IV image, val32 %s: invalid IV image, val16 %s: invalid IV image, size left %d %s: load IV failed %s: load ExtIV failed %s: firmware (fw & pcm) loading timed out %s: firmware version 4 is not supported yet %s: invalid firmware (%s): invalid size %u %s: invalid firmware (%s): size mismatch, fw %u, real %u %s: invalid firmware (%s): type mismatch, fw '%c', target '%c' %s: invalid firmware (%s): wrong generation, fw %d, target %d %s: base tssi measure failed %s: TEST1 failed %s: TEST2 failed %s: %s failed, MAC status 0x%08x %s: %s failed, intr status %08x COMunknown regwin type 0x%04x%s: %s disable clock timeout %s: %s wait BUSY unset timeout unsupported rate %dimpossible lna gain %dunsupported lpdunknown PHY mode %u%s: zero tx id %s: wait for TX ring(%d) stable timed out %s: reset TX ring (%d) timed out %s: can't create %dth tbd, %dth DMA map %s: can't create spare RX buf DMA map %s: can't create %dth RX buf DMA map unsupport modulation type %u%s: invalid rate %u or fallback rate%s: prepend TX header failed %s: can't load TX buffer (1) %d %s: can't defrag TX buffer %s: can't load TX buffer (2) %d unsupported modtype %u%s: zero length data, hdr_extra %d %s: can't allocate %dth RX buffer %s: can't create txstats ring DMA mem %s: can't allocate txstats ring DMA mem %s: can't map txstats ring DMA mem %s: can't load txstats ring DMA mem %s: can't allocate txstats DMA mem %s: can't map txstats DMA mem %s: can't load txstats DMA mem %s: %dth TX ring DMA create failed %s: %dth TX ring DMA alloc failed %s: RX ring DMA create failed %s: RX ring DMA alloc failed %s: TX stats DMA alloc failed unknown LED event %d%s: %s invalid channel! %s: can't set channel to %u bwi-airforceucode%d.fw%s: error %d, could not read firmware %s! pcm%d.fw%s: no suitable IV for MAC rev %d b0g0initvals%d.fwb0g0bsinitvals%d.fw%s: no suitable ExtIV for MAC rev %d %s: PHY calibrate failed %s: can't initialize %dth TX ring %s: can't initialize RX ring %s: can't initialize TX stats ring %s: invalid MAC address: %s unknown phymode %d%s: can't drain TX status %s: intr fatal TX/RX (%d) error 0x%08x intr PHY TX error %s: EO_ATIM %s: intr noise bwiuhci_alloc_std_chain: maxp=0 uhci_device_setintr: 0 interval uhci_device_isoc_close: %p not found uhci_allocmuhci_abort_xfer: not in process contextuhciabUHCI root hubuhci_device_isoc_enter: xfer=%p in frame list startstop%s: cannot %s %s: controller did not reset %s: interrupt while not operating ignored %s: host system error %s: host controller process error %s: host controller halted uhciohci_setintr: 0 interval ohci_device_isoc_abort: early return ohci_rem_ed: ED not foundohci_add_done: addr 0x%08lx not foundohci_abort_xfer: not in process contextohciab%s: isoc TD alloc failed OHCI root hub%s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted %s: blocking intrs 0x%x %s: reset timeout %s: SMM does not respond, will reset ,, legacy support version %d.%d%s %s: unsupported OHCI revision ohciehci isoc xfer being freed, but with no itd chainehci: isoc xfer suddenly has 0 bInterval, invalidehci_check_itd_intr: not valid itd ehciiawehciabehci_check_qh_intr: not valid sqtd ehci_open: bad device speed %d%s: Error opening low/full speed isoc endpoint. A low/full speed device is attached to a USB2 hub, and transaction translations are not yet supported. Reattach the device to the root hub instead. ehci: opening pipe with invalid bInterval ehci: zero length endpoint open request ehci: isoc descriptor requested that spans the entire frametable, too many frames ehci: unexpectedly ran out of isoc itds, isoc_startEHCI root hub%s: port reset timeout ehcidiehci_abort_xfer: not in process contextehciaw%s: config timeout ehcidb%s: run timeout ehciinvalid data offset%s: %s: illegal block count for %s %s: %s: illegal cmdlen for %s %s: %s: %s: invalid chunk state%s: %s: invalid volume state transition %d -> %d %s: invalid target on wu: %p%s: i/o error on block %lld target %d b_error %d unknown optional metadata type%s: sr_wu_enqueue_ccb got active wu%s: sr_wu_init got active wu%s: unable to start background operation %02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x%s%sOPENBSDSR %s%03d%s: %s: %s: invalid chunk state transition %d -> %d %s: sr_startwu_callbacksr_sync%s: invalid optional metadata checksumunknown old optional metadata type %u %s: no in memory copy of metadata %s: could not allocate metadata scratch area %s: could not write metadata to %s %s: save metadata failed sr_shutdownsr_down%s: roaming device %s -> %s %s: sr_scsi_cmd NULL discipline %s: %s device is being deleted, failing io %s: wu %p not on pending queuevolume %s not found%s has unsupported sector size (%d)could not allocate memory for metadatacould not allocate memory for foreign metadata%s: sr_rw: failed to allocate vnode %s: I/O error %d on dev 0x%x at block %llu failed to get DUID for softraid volumeinsufficient boot storagefailed to write boot blockfailed to write boot loadercould not save metadata to %s%s: sr_meta_rw: invalid metadata pointer cannot clear foreign metadatanot enough memory for metadata buffercould not read native metadatanot part of the same volumenot all chunks are of the native metadata formatsrc_dev_mm == NODEV%s%d%cdiscipline does not support rebuildrebuild already in progressvolume not degradedno offline chunks available to rebuild%s: sr_rebuild_init: can't allocate vnode %s partition not of type RAID (%d)%s partition too small, at least %llu bytes required%s partition too large, wasting %llu bytes%s is already in userebuild of %s started on %s%s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s sr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s is already a hotsparesr_hotspare: cannot allocate vnodeHOTSPAREcould not save metadata for %sunsupported state request %dchunk not part of arrayinvalid foreign metadatanot valid softraid metadatainvalid metadata checksumcannot read metadata version %u on %s, expected version %u or earliersr_meta_native_bootprobe: cannot allocate vnodenot enough memory for fake disciplinesr_meta_native_bootprobe: cannot allocate vnode for partitionnative bootprobe could not read native metadatasr_meta_probe: cannot allocate vnodesrdiscould not create discipline workqcould not initialize disciplinechunk %s already in useinvalid metadata formatdisk %s is currently in use; cannot force createfailed to clear metadataone of the chunks has corrupt metadata; aborting assemblychunk sizes are not equal; up to %llu blocks wasted per chunkvolume level does not match metadata leveldisk %s already assembledtrying to bring up %s degraded%s was not shutdown properly%s is offline, will not be brought onlineno free target for %sscsi_probe_lun failedvolume %s is roaming, it used to be %s, updating metadata%s volume attached as %sunable to create sensor for %ssdwdfailed to allocate boot volume%s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_locksr_hs_lock%s: controller registration failed%s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %d%% %s: rebuild exhausted wu_r%s: rebuild exhausted wu_w%s: could not create read io %s: could not create write io sr_rebuild%s: could not save metadata to %s sr_yieldsoftraidsr_raid0_rw%s: %s: too many ccbs queued RAID 0 requires two or more chunksRAID 0could not requeue io%s: retrying read on block %lld %s: sr_raid1_intr_cb%s: permanently fail write on block %lld %s: wu: %p not on pending queue sr_raid1_rw%s: is offline, cannot read invalid volume stateRAID 1 requires two or more chunksRAID 1%.2x %s: %s: invalid volume state transition %d -> %dio error: disk %x sr_raidp_rw%s: can't get wu_rDisk %llx offline, regenerating buffer %s: is offline, can't read %s: %s: %s: invalid chunk state transition %d -> %dRAID 4RAID 5sr_crypto_rw2%s: sr_crypto_finish_iosr_crypto_wu_get: out of wussr_crypto_intr: no wusr_crypto_done: no ccbs on workunitcannot open key disk %s%s partition not of type RAID (%d) %s is not a key diskCRYPTOKEYDISKunable to allocate work unitsunable to allocate CCBsincorrect key or passphraseCRYPTO requires exactly one chunkold_state = %d, %d = %d, invalid new_statesr_raid6_rwDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy +Q singleDisk %llx offline, regenerating Dx%s RAID 6sr_concat_rwCONCAT requires two or more chunksCONCATRAM diskfictitiousrdattach: out of memoryrd%drdattach: device name too long%s: insufficient message buffers %s: %s htplevhotplug: event lost, queue full Not set. All breakpoints used. Already set. Too many breakpoints. No breakpoints set Count Address %5d the kernel did not panic Bad function Too many arguments Argument missing %-12sNo such command Ambiguous Bad modifier Count missing ddb> procscalloutpoolsmountsvnodesbufsallbcstatsbreaksextentsmallocobjectpagepanicpoolprocuvmexpvnodewatchescrashdumphaltrebootpoweroffmachineprintexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallpsshowboothelphangmandmesg.strtab[ %s symbol table has bad start address %p ] ELFbad e_machine.symtab[ using %lu bytes of %s ELF symbol table ] bad magicsymtab unalignedsymtab corrupted[ %s ELF symbol table not valid: %s ] ELFAddress missing Value missing : %*lx%*ld%*lu%*lo\%03o= 0x%lx %-*s%-*lx%-*ld%-*lu%-*loSymbol not found Syntax error Divide by 0 Negative shift amount () Score: %lu/%lu ^R Bad character in number Bad escape String too long Bad character Faulted in traceback, aborting... Starting stack trace... End of stack trace. -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*lu--db_more-- %-12s%s %s+%s [after %6d] [%s:%d]invalid symbol table nameSifting table %s: Unable to find symbol table slot for %s.No slots left for %s symbol table%s%s %s bsd[ no symbol table formats found ] After %d instructions Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! Unknown variable No value radixmaxoffmaxwidthtabstopslineslogNo watchpoints set Address Size %8lx %lx All watchpoints used. Too many watchpoints. Unknown size %s = %s Nothing written. /mnt/etc/firmware/%sRRIP without PX field? SPIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect NM flags? RRIP with incorrect flags?isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] CD001%/@%/C%/Ecd9660_mountroot: can't setup bdevvp'scd9660root_devicetag VT_ISOFS, isofs vnode cd9660_strategy: spec%s@%dOpenBSD#!/dev/fd/%d/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedscheduler/sbin/init/sbin/oinit/sbin/init.bakbqquiesbqqueuebqwaitbqdestbufq_init: type %i unknownbufq init failbqinitinitclocks: unable to register softclock intrfdlockfileplfdescpldup2: fdallockqreadkqueueplknoteplwaitinit died (signal %d, exit %d)thrdeathcpu_exit returnedprocessppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d lockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: locking against myselflockmgr: non-zero exclusive countlockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: draining against myselflockmgr: unknown locktype request %dNo KMEMSTATS compiled in %d,malloc(): allocation too large, type = %d, size = %lu malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_mapphysiomawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-12s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-12.12s %-16s %-16s %-8s %18p %s PROC (%s) pid=%d stat=%s flags=%b CONTROLTINMEMSIGPAUSEPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCISPWAITCOREDUMPINGSUGIDEXECSUSPSINGLENOZOMBIEINEXECSYSTRACECONTINUEDSINGLEEXITSINGLEUNWINDTHREADSUSPSIGSOFTDEPSTOPPEDCPUPEG pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p process=%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u, swtime=%u user=%llu, sys=%llu, intr=%llu chgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplidlezombiedeadonprocplimitplcpu_switchto returnedidle%dfork idlestunrsensor_task_unregister: unexpected state %dsensordevpausesuspendsigwaitusersystempid %d (%s): %s write of %lu@%p at %lld failed: %d /var/crash/%s%s.coreissignal sigaplhashinit: bad cnt%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx%s:%s,sysctllksysctldlkthrsleep%s%s(%d)Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %ld.%09ld to %ld.%09ld dummynanosleepdenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds ?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func boredunexpected %s wq state %dunable to create workq thread for "%s" wqdestroywqtaskssyswqsmashed stack in %ssetrunnablepreempt: cpu_preempt not yet implementedfailing resume cannot be handled resume %s config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structureautoconfconfig_detach: forced detach of %s failed (%d)%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe %s at root%s at %sroot device %s not configured not configured unsupported /dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read:root device (default %sswap device (default %s%s)root device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%croot device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not founddisk_unbusy: %s: dk_busy < 0 disk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)%s: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx extnt%s: start 0x%lx, end 0x%lx %s: region not foundextentplklog page %p, nmissing %d POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d items per page pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d expected usage: show all pools [/a] %-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s SizeRequestsFailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdle%-12s %18s %18s Allocator%-12s %18p %18p inf %*u %*lu %*d %*s %*lu pool_put of NULLpool_do_put: %s: page header missingpool_get: PR_ZERO when ctor setpool_do_get: %s: page emptypool_init: too much uptimephpooldma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d*FOUND**UNKNOWN*0%o0x%x%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devices enter ddbattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- Error unknown state already%3d can't enable free slot %3d %s disabled %3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot %3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addchangeddbdisableenablefindquittimezoneverbosepollselectpipeplpipelkpipeclpiperdpipewrttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d mbuf %p m_type: %hi m_flags: %b M_EXTM_PKTHDRM_EORM_CLUSTERM_PROTO1M_VLANTAGM_LOOPM_FILDROP M_BCAST M_MCAST M_CONF M_AUTH M_TUNNELM_ZEROIZEM_LINK0m_next: %p m_nextpkt: %p m_data: %p m_len: %u m_dat: %p m_pktdat: %p m_pkthdr.len: %i m_ptkhdr.rcvif: %p m_ptkhdr.rdomain: %u m_ptkhdr.tags: %p m_pkthdr.tagsset: %hx m_pkthdr.csum_flags: %hx m_pkthdr.ether_vtag: %hu m_pkthdr.pf.flags: %b GENERATEDFRAGCACHETRANSLATE_LOCALHOSTDIVERTEDDIVERTED_PACKETPF_TAG_REROUTEm_pkthdr.pf.hdr: %p m_pkthdr.pf.statekey: %p m_pkthdr.pf.qid: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.prio: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.routed: %hx m_ext.ext_buf: %p m_ext.ext_size: %u m_ext.ext_type: %x m_ext.ext_backend: %i m_ext.ext_ifp: %p m_ext.ext_free: %p m_ext.ext_arg: %p m_ext.ext_nextref: %p m_ext.ext_prevref: %p m_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufunknown type of extension bufferm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLmbuf prepend length too bigmbplmtagplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersrequested tag size for pool %#x is too bigm == NULL in m_pulldown()unixsoaccept: !NOFDREFnetclssoclose: NOFDREFsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsemi-panic: sbcompressnetlcknetiosbappendaddrnetcon2netconacceptunp_disconnectunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqCurrent Buffer Cache status: numbufs %lld busymapped %lld, delwri %lld kvaslots %lld avail kva slots %lld bufpages %lld, dirtypages %lld pendingreads %lld, pendingwrites %lld bremfree: lost tailbiowaitbufplbiodone alreadyneedbuffernobuffersbuf_get: dup lblk vp %p bp %pgetblkbuf_needvabufinit: can't reserve VM for buffersnchplwtf? leak?vop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dot vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b AGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERROR INVAL NOCACHEPHYSRAWREADWANTEDWRITEINPROGXXX(FORMAT)DEFERREDSCANNEDDAEMONRELEASED bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} tag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %d holdcnt %d numoutput %d clean bufs: bp %p dirty bufs: flags %b vnodecovered %p syncer %p data %p RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSvfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %llu free %llu avail %lld files %llu ffiles %llu favail %lld f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %llu asyncwrites = %llu syncreads %llu asyncreads = %llu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p, %pall vnodes: %p, %p,brelvp: NULLbgetvp: not freevflushbuf: not dirtyvflushbufvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvgetvfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done kinfo: vp changed VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSNTFSUDFsyncer vnode syncermount: lost mountunmount: dangling vnodevn_lockspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_read typespec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode dos2unixtime(): month value out of range (%ld) detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largedenodedeget(): pcbmap returned %d extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modmsdosfs: reducing max cluster to %d from %d due to FAT size RRaArrAatag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfifa_update_broadaddr does not support dynamic lengthegressif_attach_common: malloctoo many interfacesifaddritempl%s: can't handle af%d looutput: no header mbuflo%difmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedcan't establish softnet handlerrn_init: radix functions require max_keylen be set rn_initrn_init 2Mask for route not entered rn_addmask: mask impossibly already in tree rn_delete: inconsistent normal annotation rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation %s %p at %p rn_delete: Orphaned Maskrn_delete: couldn't find our annotation rn_addroute: t->rn_p is NULLNon-unique normal route, mask not entered next == NULLraw_usrreqrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 ifafreertfreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrplrtrequest deletertrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 rtinit: wrong ifa (%p) was (%p) rtentplroute_init rtable_addroute_outputrouteunexpected mode %uUnexpected mode %u%s: invalid channel freq %u flags %x %s: invalid channel (NULL) Bad IBSS channel %u%s: bad channel ignored; freq %u flags %x number %u Pairwise key expansionPMK Name%s: Michael MIC failure %s: station %s disassociated by peer (reason %d) %s: station %s deauthenticated by peer (reason %d) %s: %sassociation failed (status %d) for %s %s: received %s from %s rssi %d mode %s 80211scanfreeing bss nodenot in ap mode, mode %u%s: station %s purged from node cache %s: number of cached nodes is %d, expected %d,possible nodes leak unable to setup inital BSS node%s: no memory for AID bitmap! %s: no memory for TIM bitmap! -%s: tsft offset %s%llu %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: creating ibss activepassive%s: end %s scan %s: begin %s scan invalid group data cipher!invalid integrity group cipher!management frame too large: %unull node%s: sending %s to %s on channel %u mode %s %s: no node for dst %s, discard raw tx frame %s: failed to queue raw tx frame %s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: received msg %d/%d of the %s handshake from %s group key4-wayEAPOL-Key frame too large: %u%s: sending EAPOL-Key request to %s %s: sending msg %d/%d of the %s handshake to %s "0x%s: no recent beacons from %s; rescanning %s: bogus xmit rate %u setupassociatedsynchronized%s: %s with %s ssid .5 channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s newly%s: station %s %s authenticated (open) %s: open authentication failed (reason %d) for %s assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocauthdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11bturboaearazbgbhbnbrbybzcacncocrczdodzegf2fifofrgrgthkhnhrhuidiqisj1j2j3j4j5jmjojpk2kekpkrkwkzlblilvmcmkmomxmyninlnzpapkprqarusasgsisvtntrtttwuaukuyvnyezazwAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLD la_rt=%p la_hold_head=%p, la_asked=0x%lx [NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d rtentry=%p flags=0x%x refcnt=%d use=%llu expire=%u rtableid %u key= mask= gw= ifp=%p (%s)(NULL) ifa=%p genmask= gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) arptfreearpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arp_rtrequest: bad gateway value arp_rtrequest: malloc failed in_controlinvalid argument to in_lifaddr_ioctlIPv6 pcb passed into in_pcbconnectinpcbplin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinterneticmp_do_exthdr: m_getptr failureicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp lenipqeplipqplip_initaeshmac-sha1deflate%d.%d.%d.%drip_attachrip_detachrip_usrreqsynpltcp_pulloutofbandm_pulldown malfunctiontcp_output REXMTtcp_outputtcpcbpltcpqepltcp_inittcp_usrrequdp_usrreqipip_input: should never reach herelibdes v 3.21 - 95/11/21 - eaycryptopcryptodesccrydevcuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lenSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128Rijndael-128/AESAES-CTRAES-GCMAES-GMACAES-XTSARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512GMAC-AES-128GMAC-AES-192GMAC-AES-256Keyed MD5Keyed SHA1MD5SHA1DeflateLZS1.2.3start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: lost blockmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free dev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimfile system full %s: write failed, file system is full ffs2_balloc: block too bigffs2_balloc: unwind failedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: newspaceffs_update: bad link cntsoftdep_flushfiles calledffsinodino1pldino2plupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsffs_fsync: not dirtyffs_fsyncffs_write: nonsync dir writeffs_write: typecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_strategy: specufs_readdir: lost in spaceufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotaifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebad block %d, ino %u dev = 0x%x, block = %d, fs = %s mode = 0%o, nlinks %u, inum = %u, fs = %s ext2fs_valloc: dup allocext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapext2fs_indirtrunc: bad buffer sizecheckpathrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryi_size too smallext2fs_direnter: newblkext2fs_direnter: frag size%s: nonsync dir writeext2fs_write%s: typeExt2 fs: unsupported first inode positionExt2 fs: unsupported optional feature ext2fs_statfsext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) ext2fs_mountroot: can't setup bdevvp'sext2fsext2inoplext2dinoplext2fs_mkdir: blksizeext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dir- uvm_addr %s: NULL - uvm_addr %s: %p (%s 0x%lx-0x%lx) entry %p: 0x%lx-0x%lx G=0x%lx F=0x%lx free: 0x%lx-0x%lx start=0x%lx, expected at least 0x%lx 0x%lu entries, 0x%lx free bytes pivot 0x%lx, epires in %d, direction %d empty 0x%lx - 0x%lx free (0x%lx bytes) contains pivot %d (0x%lx) %s: entry was not in tree%s: duplicate insertion: state %p inserting entry %p which collides with %p%s: duplicate insertion: state %p interting %p, colliding with %puvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxuaddruaddrhintuaddrbestfituaddrpivotuaddrrnduaddr_linuaddr_rnduaddr_hintuaddr_kbootstrapuaddr_bestfituaddr_pivotuaddr_stckbrkamap_unadd: offset out of rangeamap_unadd: nothing thereamap_lookup: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_wipeout: corrupt amapamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpluao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_getpageuao_getudv_faultudv_detachudv_attachuvm_fault_unwire_locked: address not in mapanonget1anonget2flt_noram1fltamapcopyflt_noram2flt_noram3flt_pmfail1fltagain2flt_noram4flt_noram5flt_pmfail2uvm_init: page size not setkm_free: unmanaged page 0x%lx km_allocvakmallockmthreadvallocwaitkm_alloc1wkm_pgrmuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kerneluvm_km_pgremove_intrsafe: no pageuvm_map_clean: weird flagsuvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)OBJECT %p: pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> PAGE %p: flags=%b, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] vm_page_md %p >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found in uvm_pmemrange >>> page not found in uvm_pmemrange <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< MAP %p: [0x%lx->0x%lx] brk() allocate range: 0x%lx-0x%lx stack allocate range: 0x%lx-0x%lx sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) vm_refcnt=%d vm_shm=%p vm_rssize=%u vm_swrss=%u vm_tsize=%u vm_dsize=%u vm_taddr=%p vm_daddr=%p vm_maxsaddr=%p vm_minsaddr=%p - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d hole=%c, free=%c, guard=0x%lx, free=0x%lx-0x%lx fspace_augment=%lu freemapped=%c, uaddr=%p (0x%lx-0x%lx %s) any[%d]brk/stackvmspplvmmpeplvmmpekpluvm_map_splitentry: split address 0x%lx not on page boundary!uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries vmmaplkuvm_map_setup: rw_enter failed on new mapuvmspace_fork: no space in map for entry in empty mapfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_map_teardown: rw_enter failed on free mapuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of twouvm_pglistallocuvm_pglistalloc: Upper boundary 0x%lx not on pagemask. uvm_page_physdump: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM uvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in inituvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_initsize 0 uvm_pagereallocpagersegpgdaemonpagedaemon: deadlock detected! Ranges, use queue: * [0x%lx-0x%lx] use=%d nsegs=%ld maxsegsz[%d]=0x%lx free=0x%lx #ranges = %d pagedaemon: wait_pla deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx uvm_pmr_split: lost one pmr Flags: 0x%x, will panic now. Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p warning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel regionswapmount: no device swapmount: no device 2 /dev/%s%d%cblkdev0x%xswapctl: copystruvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplkuvm_coredump: user process with submap?sbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_getpageuvn_getuvn_cluster: offset out of rangeuvn_flshuvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressin6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_ifawithscope: output interface is not specified in6_savemkludge: no kludge spaceCouldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix ADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix invalid argument to in6_lifaddr_ioctl%s: didn't unlink in6ifaddr from list in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) %s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) in6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerOpenBSD-currentip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s assumption failed: hdr not splitscope error in prefix list (%s) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s nd6_init called more than once(ignored) ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) default router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_na_inputifa == NULL in nd6_dad_ns_inputnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found ???nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p defrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) rip6_attachrip6_detachrip6_usrreq invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versiondb_fetch_reg: botch address 0x%08lx not a valid page address %p is invalid branch_taken: botchFaulted in DDB; continuing... spsrr0r1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spframetrace: pid %d not found at %p scp=0x%08x rlv=0x%08x () rsp=0x%08x rfp=0x%08x%sr%d=0x%08xBad frame pointer: %p Bad user frame pointer: %p frame address must be specified frame address = %08x spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbuscpu, rrx, %s r%d, %s #%d#0x%08x[r%d][r%d%s, #0x%03x#0x%02x{r%d-r%d}^f%d#%s0x%08xcpsr_p%df%d, c%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d[%c - unknown]und%s %08x imbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtdsbisbstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpnopyieldwfewfisevdbgmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcNo support for this CPU type (%08x) in kernelUndefined instruction in kernel real mem = %u (%uMB) avail mem = %lu (%uMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock _bus_dmamap_load_raw: not implemented_bus_dmamem_map: size botch_bus_dmamap_sync: mix PRE and POST_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-SARM1136J-S R1ARM Cortex A5ARM Cortex A7ARM Cortex A8ARM Cortex A8 R1ARM Cortex A8 R2ARM Cortex A8 R3ARM Cortex A9ARM Cortex A9 R1ARM Cortex A9 R2ARM Cortex A9 R3ARM Cortex A9 R4ARM Cortex A15ARM Cortex A15 R1ARM Cortex A15 R2ARM Cortex A15 R3CPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA1100XScaleCPU_XSCALE_...ARM11JCPU_ARM11CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0badaddr: invalid size (%lu)kernelFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortUVM: pid %d (%s), uid %d killed: out of swap data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)mmrwxscale_setup_minidata: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %pCannot allocate L1 KVMCannot allocate L1 physical pagespmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplpmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufcan't init serial console @%lxunknown option `%c' cpu not recognized! OpenBSD/armish booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx initarm: out of memoryinitarm: Failed to align the kernel page directoryWARNING: powerdown failed! The operating system has halted. Please press any key to reboot. rebooting... boot device: lookup '%s' failed. boot device: %s cdDiagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %usyncxspendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial.~ offline: %d targets, initiator %d, WWPN %016llx, WWNN %016llx%s: unable to register bio scsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMNEC CD-ROM DRIVE:260SCSI opticalSCSI disk%s %s(unknown)%s: %lldMB, %lu bytes/sector, %lld sectors, thin%s: WARNING: unable to establish shutdown hook softintr_establish: unknown soft IPL %d"%s" at %s addr 0x%xiiclm75alm75lm77eeprommax1617xeontemplm93lm81lm87adm9240adt7470adt7476adt7475adt7462adt7466adt7467adm1033adm1034adm1030adm1031adm1025adm1024adm1023adm1028adm1022thmc5047m192sch5027emc6w201asc7611asc7621ne1619ds1780adt7460adm1027lm85adt7516lm63lm86lm89lm89-1lm90gl523smadt7461adm1021adm1032g781g781-1max6690max6646max6657max6642tmp401sa56004xw83791sdw83627dhgw83792dw83781dw83627hfw83782das99127fw83783sw83791dw83l784rw83l785rw83l785ts-lf75375asb100gl518smadm1026se97max6604mcp9805mcp98242mcp98243adt7408stts2002cat34ts02ts3000b3lis331dlit8712lm96000emc6d100sch5017it8712f-amtp008w83795gw83793gstts424e02%s: addr 0x%x %02x=%02x words %02x=%04x: %s%s: ricohrtc_clock_write: failed to write rtc %s: ricohrtc_clock_read: failed to read rtc %s: ricohrtc_reg_write: failed to write reg%d : RICOH RS5C372[AB] Real-time Clock ricohrtc: F75375 rev %d.%dVcc, unable to register update task unable to read reg %d fintek: PCA9532 LED controller pcaledi80321_mem_bs_free(): not implementedi80321_mem_bs_alloc(): not implementedi80321_io_bs_free(): not implementedi80321_io_bs_alloc(): not implementedpciiopaauiopiiciopmuiopwdogi80321_intr_establish: IRQ %d out of rangei80321intcresettodr: failed to set time WARNING: preposterous time in file system WARNING: preposterous clock chip time lostgainedWARNING: clock %s %ld days WARNING: CHECK AND RESET THE DATE! clockstattcr1: I2C controller %s: unable to subregion registers, error = %d iopiiclkattempting reset %s: unable to map VERDE registers%s: unable to subregion MCU registers%s: unable to subregion ATU registers%s: unable to map IOW registers: i80321 I/O Processor %s: unable to map PLD registersiopxs%03d:%02d:%d %04x:%04x WARNING: unknown PCI device header. mem %02xh %s 0x%08x 0x%08x NGOK [%s] Resource conflict. No available resources. fixup failed pci_addr_fixup: fixup failed. (new address=%#lx) new address 0x%08lx PCI I/O memory spacePCI I/O port space[%s]----------------------- device vendor product register space address size -------------------------------------------- System BIOS Setting--------------------------[%3d devices bogus] PCIBIOS fixup stageirq %diq80321_pci_intr_map: no mapping for %d/%d/%d (%d, %d, %d) board id failed Thecus Nx100I/O Data HDL-GCertance CP3100 addr 0x%08lx intr %dobio_bs_free(): not implementedobio_bs_alloc(): not implemented: failed to map registers: %d %s: unable to establish interrupt at CPLD irq %d com_obio%s: standby command didn't complete %s: standby command timeout %s: standby command: drive fault %s: flush cache command didn't complete %s: flush cache command timeout %s: flush cache command: drive fault ST506wd_get_params: bad return code from ata_get_paramsST506/MFM/RLLESDI/IDE disk__wdstart: bad return code from wdc_ata_bio()device faultdevice timeout, retrying %s: soft error (corrected) %s: IDENTIFY failed : <%s> %s: %d-sector PIO, LBA48, %lluMB, %llu sectors LBA, %lluMB, %llu sectors CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors %s: enable look ahead command didn't complete %s: enable write cache command didn't complete %s: freeze lock command didn't complete wddump: try againwddump: polled command has been queuedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: %swddump: unknown error type%s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: not ready, st=0x%b, err=0x%02x wdc_ata_ctrl_intr: state==RECALpiomodedmamodegeometrysetmultirecal%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq error not notifiedno media/write protectedaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorinterface CRC erroraddress mark not foundtrack 0 not foundbad block detectedwsevent_read%s: can't attach mux (error=%d) wskbd at %s%s: event queue overflow wskdetwskbd_detach: %s didn't detach mux %dcannot load keymap: console keyboard%s: attach error=%d wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry attach error=%dwsmouse at %swsmdetwsmouse_detach: %s didn't detach wsmousewsmux_getmux: no memory for mux %d wsmux: attach out of memory usb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task thread: USB revision %s, not supported %s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d pre 1.01.12.0usbusb_desc_iter_next: bad descriptor usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usbd_start_next: error=%d usbd_transfer: not doneusbsynusbrefusbpalockusbdetusb_detach_wait: %s didn't detach out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port%x.%02xvendor 0x%04x"%s %s", class %d/%d rev / addr %d port %d configuration %d interface %dNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: strange, connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: hub depth (%d) exceeded, hub ignored %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubucom at %s portno %d%s: lost %d chars %s: read start failed , %sucomlkucomugenwbugenwiugenriugenrb%s: secondary, not changing config to %d %s: setting configuration index 0 failed %s: setting configuration %d failed ugenBAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d uhidevwiuhidev_intr: bad repid %d uhid at %s reportid %d%s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no report descriptor %s: iclass %d/%d, %d report id%s%s: no memory uhidevuhidrea: input=%d, output=%d, feature=%d uhidno usable key codes array%s: was console keyboard ukbd: %d button%s, Z dir, W dir, Z and W dir %s: mouse has no X report %s: X report 0x%04x not supported %s: mouse has no Y report %s: Y report 0x%04x not supported ums%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s Bulk-OnlyCBICBI with CCIISD-ATARBCSCSIUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%s: failed to set configuration, err=%s : failed to get interface, err=%s %s: device is neither visor nor palm %s: init failed, %s GenericDebuggerHotSyncRemote File System%s: no proper endpoints for port %d (%d,%d) uvisor%s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: aue_send error=%s %s: usb error on tx: %s %s: %u usb errors on intr: %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: reset failed %s: abort rx pipe failed: %s %s: close rx pipe failed: %s %s: abort tx pipe failed: %s %s: close tx pipe failed: %s %s: abort intr pipe failed: %s %s: close intr pipe failed: %s %s: tx list init failed %s: rx list init failed %s: MII read timed out %s: EEPROM read timed out %s: setting config no failed auemii%s: getting interface handle failed %s: couldn't get endpoint descriptor %d %s: missing endpoint %s: address %s aue%s: usb errors on rx: %s axe%d: abort rx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close intr pipe failed: %s axe%d: usb error on tx: %s axe%d: watchdog timeout axemii%s: couldn't get ep %d no valid PHY address found, assuming PHY address 0 AX88178 AX88772B AX88772 AX88172axe%d: rx list init failed axe%d: tx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s %s: media change failed axe%d: write PHY failed axe%d: read PHY failed axe%s: warning: Failed to write register 0x%0x %s: warning: Failed to read register 0x%0x %s: warning: failed to read SMSC_COE_CTRL (err=%d) %s: warning: failed to write SMSC_COE_CTRL (err=%d) %s: warning: failed to read initial AFC_CFG, error %d %s: warning: media change failed, error %d %s: warning: timed-out waiting for reset to complete %s: warning: timed-out waiting for phy reset to complete %s: warning: failed to set the MAC address %s: warning: failed to read HW_CFG: %d %s: warning: failed to read HW_CFG: (err = %d) %s: warning: failed to read ID_REV (err = %d) %s: warning: failed to read MAC_CSR (err=%d) %s: error: smsc_chip_init failed (err=%d) smscmii%s: warning: MII is busy %s: warning: MII write timeout %s: warning: MII read timeout smsc%s: cue_send error=%s %s: read MAC address failed cue%s: kue_send error=%s %s: warm boot, no firmware download kue%s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: usb error on rx: %s %s: too many errors, disabling %s: open interrupt pipe failed: %s %s: abort interrupt pipe failed: %s %s: close interrupt pipe failed: %s extra ethernet descriptor %s: no data interface %s: no descriptor for interrupt endpoint %d %s: interface alternate setting %d failed %s: no descriptor for bulk endpoint %d %s: could not find data bulk in %s: could not find data bulk out cdce%s: udav_send error=%s udavmiiudav%s: upl_send error=%s upl%s: url_send error=%s %s: %s: bad register %04x urlmii%s: failed to get interface, err=%s %s: couldn't get endpoint %d url%s: Invalid notification length! (%d) %s: abort notify pipe failed: %s %s: close notify pipe failed: %s no %s: data interface %d, has %sCM over data, has %sbreak %s: no endpoint descriptor for %d %s: Could not find data bulk in %s: Could not find data bulk out %s: could not set data multiplex mode %s: status change notification available umodem%s: failed to set configuration, err=%s uftdi%s: failed to get configuration descriptor %s: failed to get device descriptor %s: failed to get interface, err=%s %s: Could not find interrupt in %s: failed to get second interface, err=%s %s: reset failed, %s uplcom %s: failed to set configuration, err=%s umct%s: uvscom_intr: abnormal status: %s %s: uvscom_set_line_coding: %s %s: uvscom_set_line: %s %s: uvscom_shutdown: %s %s: uvscom_readstat: %s %s: cannot open interrupt pipe (addr %d) uvsopuvscom%s: this device is using CDC notify message in intr pipe. Please send your dmesg to , thanks. %s: intr buffer 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x 0x%x %s:notify serial state, len=%d, data=0x%02x %s: ubsa_request: %s %s: failed to set configuration: %s %s: failed to get interface: %s ubsa%s: unhandled set request: reg=%x onoff=%x %s: no proper endpoints found (%d,%d) uipaqumsm%s: this device is not using CDC notify message in intr pipe. Please send your dmesg to , thanks. %s: umass only mode. need to reattach %s: truinstall mode. need to reattach %s: no endpoint descriptor found for %d wiusbthrwitxlwiIDLwi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet %s: %s error=%s wiTXsyncUGH TX UGH RX write_record buf size err %x %x invalid packet len: %x memsz %x max %x %s: %s: error=%s %s:%s: invalid packet id sent %x %s: already detached %s: open pipes failed wi_usb%s: could not get card cfg! unknown-device%s: %s loadfirmware error %d %s: reattaching after firmware upload atuatu-rfmd-intatu-rfmd-extatu-rfmd2958-intatu-rfmd2958-extatu-rfmd2958smc-intatu-rfmd2958smc-extatu-intersil-intatu-intersil-extatu-at76c503-i3863-intatu-at76c503-i3863-extatu-at76c503-rfmd-acc-intatu-at76c503-rfmd-acc-extatu-at76c505-rfmd-intatu-at76c505-rfmd-ext%s: could not retrieve Tx statistics - cancelling automatic rate control %s: could not write MAC register: %s %s: could not read MAC register: %s %s: could not read BBP %s: could not read EEPROM: %s %s: could not allocate tx xfer %s: could not allocate tx buffer %s: could not transmit buffer: %s %s: could not allocate rx xfer %s: could not allocate rx buffer %s: timeout waiting for BBP/RF to wakeup %s: could not allocate AMRR xfer %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not transmit beacon %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s uralOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmedia: MASTER on wrong media: %s, rev. %d nsphyDP83840 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephy88E1000 1 Gigabit PHY88E1000 2 Gigabit PHY88E1000 3 Gigabit PHY88E1000 4 Gigabit PHY88E1000S Gigabit PHY88E1011 Gigabit PHY88E1111 Gigabit PHY88E1112 Gigabit PHY88E1116 Gigabit PHY88E1116R Gigabit PHY88E1118 Gigabit PHY88E1149 Gigabit PHY88E3016 10/100 PHY88E3082 10/100 PHYPHYG65G Gigabit PHY88E1000 5 Gigabit PHY88E1000 6 Gigabit PHY88E1000 7 Gigabit PHYexphy_service: can't isolate 3Com PHY: 3Com internal media interface %s: ignoring this PHY, non-zero instance xlexphyrlrlphy_service: attempt to isolate phy: RTL internal PHY rlphyRTL8201L 10/100 PHYIP101 10/100 PHYlxtphyLXT970 10/100 PHYLXT971 10/100 PHYluphyLU6612 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphy80220 10/100 PHY80225 10/100 PHY84220 10/100 PHYtqphy78Q2120 10/100 PHY: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphy: internal PHY dcphybmtphy3C905B internal PHY3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYbgebnxbrgphyBCM5400 1000baseT PHYBCM5401 10/100/1000baseT PHYBCM5411 10/100/1000baseT PHYBCM5421 10/100/1000baseT PHYBCM54K2 10/100/1000baseT PHYBCM5461 10/100/1000baseT PHYBCM5462 10/100/1000baseT PHYBCM5464 10/100/1000baseT PHYBCM5701 10/100/1000baseT PHYBCM5703 10/100/1000baseT PHYBCM5704 10/100/1000baseT PHYBCM5705 10/100/1000baseT PHYBCM5714 10/100/1000baseT/SX PHYBCM5750 10/100/1000baseT PHYBCM5752 10/100/1000baseT PHYBCM5780 10/100/1000baseT/SX PHYBCM54XX 10/100/1000baseT PHYBCM5481 10/100/1000baseT PHYBCM5482 10/100/1000baseT PHYBCM5722 10/100/1000baseT PHYBCM5755 10/100/1000baseT PHYBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5787 10/100/1000baseT PHYBCM5706 10/100/1000baseT/SX PHYBCM5708C 10/100/1000baseT PHYBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5717C 10/100/1000baseT PHYBCM5719C 10/100/1000baseT PHYBCM5720C 10/100/1000baseT PHYBCM57765 10/100/1000baseT PHYBCM57780 10/100/1000baseT PHYBCM5906 10/100baseTX PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHY%s: %s: enter updown%s: %s: link %s : RTL internal phy urlphyrgephyRTL8169S/8110S PHYnfe%s: unknown CICADA PHY model %x %s: unknown PHY speed %x ciphyCS8201 10/100/1000TX PHYCS8204 10/100/1000TX PHYVSC8211 10/100/1000 PHYCS8244 10/100/1000TX PHYVSC8601 10/100/1000 PHY%d:%d:%d: mem address conflict 0x%x/0x%x %d:%d:%d: io address conflict 0x%x/0x%x %d:%d:%d: bridge io address conflict 0x%x/0x%x %d:%d:%d: bridge mem address conflict 0x%x/0x%x %d:%d:%d: bridge bus conflict %d-%d dev %d function %dpci_mem_find: bad requestpci_mem_find: bad 64-bit requestpci_io_find: bad request%svendor 0x%04x product 0x%04xunknown vendor "%s", unknown product 0x%04xunknown class 0x%02x, subclass 0x%02xclass %s unknown subclass 0x%02xclass %s subclass %s, rev 0x%02x) rev 0x%02xmiscellaneousfloppyIPISASethernettoken ringFDDIWorldFipPCMIG Multi ComputingXGAvideoaudiotelephonyhdaudioRAMflashhostMicroChannelNuBusRACEwaySemi-transparent PCIInfiniBandserialparallelmulti-port serialmodemsmartcard8237 DMA8254 timerRTCPCI Hot-PlugSD Host Controllerkeyboarddigitizermousegame portgeneric386486PentiumAlphaPowerPCMIPSCo-processorFirewireACCESS.busSSAFiber ChannelIPMISERCOSIrDAConsumer IRRFbluetoothbroadband802.11a (5 GHz)802.11b (2.4 GHz)standardvoicenetwork/computingentertainmentDPIOTime and Frequencysynchronizationmanagementprehistoricmass storagenetworkdisplaymultimediabridgecommunicationsinputdockserial buswirelessI2Osatellite commDASPundefinedOZ6729 CardBusOZ6730 CardBusOZ6922 CardBusOZ6832 CardBusOZ6836/OZ6860 CardBusOZ68[17]2 CardBusOZ6933 CardBusOZ69[17]2 CardBusOZ711Mx MiscOZ711EC1 SmartCardBusOZ711M1 CardBusOZ711MP1 SDHCOZ711MP1 XDHCOZ711MP1 CardBusOZ711EZ1 CardBusOZ711SP1 CardBusOZ711E0 CardBus3c9853c9963CRDAG675 (Atheros AR5212)3CRPAG175 (Atheros AR5212)V.90 Modem3c9403c3393c3593c4503c555 100Base-TX3c5753CCFE575BT3CCFE575CT3c590 10Mbps3c595 100Base-TX3c595 100Base-T43c595 10Mbps-MII3CRSHPW796 802.11b3CRWE154G72 802.11g3c556 100Base-TX3c556B 100Base-TX3CCFEM6563CCFEM656B3CCFEM656C56k Global Modem3cSOHO-TX3crwe777a AirConnect3c940B3c900 10Base-T3c900 10Mbps-Combo3c900B 10Mbps3c900B 10Mbps-Combo3c900B 10Mbps-TPC3c900B 10Mbps-FL3c905 100Base-TX3c905 100Base-T43c905B 100Base-TX3c905B 100Base-T43c905B 10/100Mbps-Combo3c905B 100Base-FX3c905C 100Base-TX3c9201 100Base-TX3c920B-EMB-WNM3cSOHO 100B-TX3c980 100Base-TX3c980C 100Base-TX3cr9903cr990-TX3cr990-TX-953cr990-TX-973c990b-TX-M3cr990-FX3cr990SVR953cr990SVR973c990BSVRVoodooVoodoo2BansheeVoodoo3Voodoo4Voodoo5GLINT 300SXGLINT 500TXGLINT DeltaPermediaGLINT MXPermedia 2GLINT GammaPermedia 2vPermedia 3Wildcat III 6210Wildcat 5110Wildcat IV 72105000/6000 series RAID7000/8000 series RAID9000 series RAID9500 series RAIDFE2500 10/100PCM200 10/100FE2000VX 10/100FE2500MX 10/100PC4800 WirelessPCI35x WLANPC4500 WirelessMPI-350 WirelessACCM 2188 VL-PCI2051 PCI2051 ISAATP850U/UFATP860ATP860-AATP865-AATP865-RAEC6710AEC6712UWAEC6712UAEC6712SAEC6710DAEC6715UWMPX 5030/5038EN2242EN1217RhineIIrtl8139AWA-100M1435 VL-PCIM1445 VL-PCIM1449 ISAM1451 PCIM1461 PCIM1489 PCIM1511 PCIM1513 ISAM1523 PCIM1523 ISAM1531 PCIM1533 ISAM1535 PCIM1541 PCIM1543 ISAM1563 ISAM1573 ISAM1575 ISAM1621 PCIM1631 PCIM1644 PCIM1647 PCIM1689 PCIM1695 PCIM3309 MPEGM4803M5219 UDMA IDEM5229 UDMA IDEM5237 USBM5239 USB2M5243 AGP/PCI-PCIM5246 AGPM5247 AGP/PCI-PCM5249 PCI-PCIM524B PCIEM524C PCIEM524D PCIEM5261 LANM5263 LANM5281 SATAM5287 SATAM5288 SATAM5289 SATAM5451 AudioM5455 AudioM5457 ModemM5461 HD AudioM7101 PowerAL981AN983AN985ADM8211 WLANADM9511ADM9513AIC-7810AHA-2940AU/CNAHA-2930CUAIC-7850AIC-7855AIC-5900 ATMAIC-5905 ATMAPA-1480AIC-7860AHA-2940AUAIC-7870AHA-2940AHA-3940AHA-3985AHA-2944AIC-7815AIC-7880AHA-2940UAHA-3940UAHA-398XUAHA-2944UAHA-2940UWProAIC-6915AIC-7895AHA-2940U2 U2AHA-2930U2 U2AAA-131U2 U2AIC-7890/1 U2AIC-7892 U160AHA-29160 U160AHA-19160B U160AVA-2930LPAHA-3950U2B U2AHA-3950U2D U2AIC-7896/7 U2AHA-3960D U160AIC-7899BAIC-7899DAIC-7899FAIC-7899 U160ServeRAIDAAC-2622ASR-2200SASR-2120SAAC-364AAC-3642Dell PERC 2/QCAIC-7901 U320AHA-29320A U320AHA-29320LP U320AIC-7901A U320AHA-29320 U320AHA-29320B U320AIC-7902 U320AIC-7902B U320AHA-39320 U320AHA-39320B U320AHA-39320A U320AHA-39320D U320AHA-39320DB U3201200A1200BABP-930/40UAABP-940UWASP-3940U2WASP-3940U3WWaikato Dag3.2Endace Dag3.5Endace Dag4.22GEEndace Dag4.23PhysXAT22AT24AcenicAcenic CopperBCM5700BCM5701AC1000AC1001AC9100AC1003AMD64 0Fh HyperTransportAMD64 0Fh Address MapAMD64 0Fh DRAM CfgAMD64 0Fh Misc CfgAMD64 10h HyperTransportAMD64 10h Address MapAMD64 10h DRAM CfgAMD64 10h Misc CfgAMD64 10h Link CfgAMD64 11h HyperTransportAMD64 11h Address MapAMD64 11h DRAM CfgAMD64 11h Misc CfgAMD64 11h Link CfgAMD64 14h HostAMD64 14h PCIEAMD64 14h Link CfgAMD64 14h Address MapAMD64 14h DRAM CfgAMD64 14h Misc CfgAMD64 14h CPU PowerAMD64 12h HostAMD64 12h PCIEAMD64 14h NB PowerAMD64 14h Reserved79c970 PCnet-PCI79c978 PChome-PCI53c974 PCscsi-PCI79C974 PCnet-PCIGeode LXGeode LX VideoGeode LX CryptoCS5536 PCICS5536 ISACS5536 AudioCS5536 USBCS5536 IDEElanSC520 PCIHudson-2 PCIE751 System751 PCI-PCI762 PCI762 PCI-PCI761 PCI761 PCI-PCI755 ISA755 IDE755 Power755 USB756 ISA756 IDE756 Power756 USB Host766 ISA766 IDE766 USB766 Power766 USB OpenHCI768 ISA768 IDE768 Power768 AC97768 Modem768 PCI-PCI768 USB8131 PCIX8131 PCIX IOAPIC8151 Sys Control8151 AGP8132 PCIX8132 PCIX IOAPIC8111 PCI-PCI8111 Ether8111 USB8111 LPC8111 IDE8111 SMBus8111 Power8111 AC97Hudson-2 SATAHudson-2 SD Host ControllerHudson-2 USBHudson-2 USB2Hudson-2 SMBusHudson-2 IDEHudson-2 HD AudioHudson-2 LPCHudson-2 PCIHudson-2 xHCIRS780 HostRS880 HostRS780 PCIEMegaRAIDMegaRAID Series 428MegaRAID Series 434ADSP 21535 DSPAD1889 AudioSafeNet ADSP 2141TC9021BanditGCOHareHeathrowPaddingtonUni-N EthUni-NUni-N Eth FirewireUni-N AGPUni-N GMACKeylargoPangea GMACPangea MacioPangea USBPangea AGPPangeaPangea PCIUni-N2 AGPUni-N2 HostPangea FireWireUniNorth FirewireUni-N2 GMACUni-N ATAUniNorth AGPUniNorth PCIIntrepid ATAIntrepidIntrepid USBK2 USBK2 MacioK2 FirewireK2 ATAU3 PCI-PCIU3 HyperTransportU3 AGPK2 GMACShastaShasta ATAShasta GMACShasta FirewireShasta PCIShasta HyperTransportK2U3L AGPK2 AGPIntrepid 2 AGPIntrepid 2 PCIIntrepid 2 ATAIntrepid 2 FireWireIntrepid 2 GMACARS106SARS0303D1000PV2000PV2000MT2000MIARC-1110ARC-1120ARC-1130ARC-1160ARC-1170ARC-1200ARC-1200 rev BARC-1202ARC-1210ARC-1220ARC-1230ARC-1260ARC-1270ARC-1280ARC-1380ARC-1381ARC-1680ARC-1681ARC-1880AX88140A/88141ASM1042 xHCIASM1083/1085 PCIE-PCIRadeon HD 6310 HD AudioRadeon HD 6500D HD AudioRadeon M241PRadeon X300 M24FireGL M24 GLRadeon X600FireGL V3200Radeon X600 SecRadeon IGP 320Radeon IGP 340Radeon 9500 ProRadeon AE 9700 ProRadeon AF 9600TXFireGL AGZ1Radeon AH 9800 SERadeon AI 9800Radeon AJ 9800FireGL AK X2Radeon 9600 ProRadeon 9600Radeon 9550FireGLRadeon 9650Mach32Radeon 9500 Pro SecRadeon 9600 Pro SecRadeon 9600 LE SecRadeon 9600 XT SecRadeon 9550 SecRadeon IGPRadeon 8500Radeon BC R200Radeon IGP 320MMobility M6SB200 AC97SB200 PCISB200 USB2SB200 USBSB200 IDESB200 ISASB200 ModemSB200 SMBusMach64 CTMach64 CXSB300 AC97SB300 PCISB300 SMBusSB300 USB2SB300 USBSB300 IDESB300 ISASB300 ModemSB300 SATASB400 AC97SB400 PCISB400 SMBusSB400 USB2SB400 USBSB400 IDESB400 ISASB400 ModemSB400 SATASB450 HD AudioSB600 SATASB600 AC97SBx00 HD AudioSB600 PCISBx00 SMBusSB600 USB2SB600 USBSB600 IDESB600 ISASB600 ModemSBx00 SATASB700 USB2SB700 USBSB700 IDESB700 ISASB800 PCIERadeon Mobility IGPMach64 ETRage ProMach64Rage XLRadeon 9000Radeon 9000 SecRadeon X800Radeon X800 ProRadeon X800SERadeon X800XTFireGL X3-256Radeon Mobility M18Radeon X800 SERadeon X800 XTRadeon AIW X800 VERadeon X800 Pro SecRadeon X850 XTRadeon X850 SERadeon X850 ProRadeon X850 XT PERage128Mobility M3Mobility 1Rage P/MRadeon Mobility M7FireGL Mobility 7800 M7Radeon Mobility M6Radeon Mobility M9Rage 128 MobilityRadeon 9500/9700Radeon 9600 TXFireGL X1Radeon 9800 ProRAdeon 9800Radeon 9800 XTFireGL X2Radeon Mobility M10Radeon Mobility 9550Radeon 9500/9700 SecFireGL X1 SecRadeon 9800 Pro SecRage 128 ProRage FuryRage 128Rage 128 PXAIW RadeonRadeon 9100Radeon 7500Radeon VEES1000Rage MagnumRadeon Mobility M300 M22Radeon Mobility X600 M24CFireGL M44 GL 5464Radeon X800 XT PERadeon X800 XTPRadeon X800 XLFireGL V7100FireGL V5100Radeon X800 SecMobility FireGL V5000 M26Radeon Mobility X700 XL M26Radeon Mobility X700 M26Radeon X550XTXRadeon X550XTX SecRS300_100 HostRS300_133 HostRS300_166 HostRadeon IGP 9100 HostRadeon IGP 9100Radeon Mobility IGP 9100Radeon IGP 9100 AGPRadeon 9200 PRO SecRadeon 9200 SecRS480 HostRX480 HostRD580 HostRadeon XPRESS 200Radeon XPRESS 200MRX780 HostRD780 HT-PCIERadeon 9200 PRORadeon 9200Radeon 9200 SE SecFireMV 2200RD790 PCIESR5690 HostRD890 HostSR5670 HostSR5650 HostSR5690 PCIERS400 HostRC410 HostRX480 PCIERS480 PCIERadeon X300Radeon X600 (RV370)Radeon X550FireGL V3100FireMV 2200 5B65Radeon X300 SecRadeon X550 SecFireGL V3100 SecFireMV 2200 SecRadeon Mobility 9200Radeon 9200 SERadeon X800 XT M28FireGL V5100 M28Radeon Mobility X800 M28Radeon X850FireGL R480Radeon X850XTRadeon X800 GTO SecRadeon X850 XT SecFireGL V5000FireGL X700 XTFireGL X700 ProFireGL X700 SERadeon X700 PCIERadeon X700 SE PCIERadeon X700 PCIE SecRadeon X700 SERadeon X700 SE SecRadeon HD 6670Radeon HD 5800Radeon HD 5700Radeon HD 5670Radeon Mobility HD 5470Radeon Mobility HD 5430Radeon HD 5450RS100 PCIRS200 PCIRadeon X1800Radeon X1800 XTRadeon Mobility X1800FireGL Mobility V7200FireGL V7200FireGL V5300FireGL Mobility V7100FireGL V7300FireGL V7350Radeon X1600RV505Radeon X1300/X1550Radeon X1550M54-GLRadeon Mobility X1400RADEON X1550 64-bitRadeon Mobility X1300 M52-64Radeon Mobility X1300Radeon X1300FireGL V3300FireGL V3350Radeon X1600 SecRadeon X1300/X1550 SecRadeon X1300 ProRadeon X1450Radeon Mobility X2300Radeon Mobility X1350Radeon Mobility X1450FireMV 2250Radeon X1550 64-bitRadeon X1300 Pro SecRadeon X1300 SecRadeon X1650Radeon X1600 ProFireGL V5200Radeon Mobility X1600Radeon X1650 ProRadeon X1300 XTFireGL V3400Mobility FireGL V5250Radeon X1700Radeon X1700 XTRadeon Mobility X1700Radeon X1600 Pro SecRadeon X1650 Pro SecRadeon X2300HDRadeon Mobility X2300HDRadeon X1950Radeon X1900AMD Stream ProcessorRadeon X1950 ProRV560Radeon Mobility X1900Radeon X1950 GTRV570FireGL V7400Rv560Radeon RX1650 XTRadeon X1950 Pro SecRadeon RX1650 XT SecRadeon 9000/9100 IGPRadeon RS350IGPRS690 HostRS740 HostRS690 PCIERS690M PCIERS690 HD AudioRadeon X1250Radeon X1250 IGPRadeon 2100Radeon HD 4870Radeon HD 4870 X2Radeon HD 4850Radeon HD 4850 X2FirePro V8750FirePro V7760Mobility Radeon HD 4850Mobility Radeon HD 4850 X2Radeon HD 4800FirePro RV770FireStream 9270FireStream 9250FirePro V8700Mobility Radeon HD 4870Radeon HD 4890FirePro M7750Mobility Radeon HD 4650Mobility Radeon HD 4670Radeon HD 4670Radeon E4600Radeon HD 4600Radeon HD 4650FirePro V7750FirePro V5700FirePro V3750Mobility Radeon HD 4830FirePro M7740Radeon HD 4770Radeon HD 4700FirePro M5750Radeon HD 2400 XTRadeon HD 2400 ProRadeon HD 2400 Pro AGPFireGL V4000Radeon HD 2350Mobility Radeon HD 2400 XTMobility Radeon HD 2400Radeon E2400Radeon HD 2400 Pro PCIFireMV 2260Radeon HD 3870Mobility Radeon HD 3850Radeon HD 3850Mobility Radeon HD 3850 X2Mobility Radeon HD 3870Mobility Radeon HD 3870 X2Radeon HD 3870 X2FireGL V7700Radeon HD 3850 AGPRadeon HD 3690FireStreamRadeon HD 4550Radeon HD 4350Mobility Radeon HD 4300Mobility Radeon HD 4500FirePro RG220Mobility Radeon HD 4330Mobility Radeon HD 2600Mobility Radeon HD 2600 XTRadeon HD 2600 XT AGPRadeon HD 2600 Pro AGPRadeon HD 2600 XTRadeon HD 2600 ProFireGL V5600FireGL V3600Radeon HD 3600Mobility Radeon HD 3650Mobility Radeon HD 3670Mobilty FireGL V5700Radeon HD 3650 AGPRadeon HD 3650Mobility FireGL V5725Radeon HD 3470Mobility Radeon HD 3430Mobility Radeon HD 3400Radeon HD 3450Radeon HD 3450 AGPRadeon HD 3430Radeon HD 3450 PCIFirePro V3700FireMV 2450RS780 HD AudioRadeon HD 3200Radeon HD 3100Radeon HD 3300Radeon HD 3000Radeon HD 6620GRadeon HD 6520GRadeon HD 6480GRadeon HD 6530DRadeon HD 4200 HD AudioRadeon HD 4200Radeon HD 4100Mobility Radeon HD 4200Mobility Radeon HD 4100Radeon HD 4290Radeon HD 4250Radeon HD 6310Radeon HD 6250Radeon HD 6320Radeon HD 7290Radeon HD 2600 HD AudioRS690M HD AudioRadeon HD 3870 HD AudioRadeon HD 3600 HD AudioRadeon HD 34xx HD AudioRadeon HD 48xx HD AudioRadeon HD 4000 HD AudioRadeon HD 5800 AudioRadeon HD 5700 AudioRadeon HD 5600 AudioRadeon HD 5470 AudioRadeon HD 6670 AudioRadeon HD 6400 AudioRS100 AGPRS200 AGPRS250 AGPRS200M AGPS5933 PCI MatchmakerMyrinet LANaiAST2000AR5210AR5311AR5211AR5212AR2413AR5413AR5424AR5416AR5418AR9160AR9280AR9281AR9285AR2427AR9227AR9287AR9300AR9485AR5210 (Early)AR5212 (IBM MiniPCI)AR5210 (no eeprom)AR5212 (no eeprom)AR5211 (no eeprom)AR5212 (emulation board)AR5211RefAT76C506IDE-2015PLL1EL1L2CL1CL1DL2FL1FL2Vortex 1Vortex 2Vortex AdvantageAVL2301AVG2302ALG2301ALG2302ALS4000Dual SerialQuad SerialBRI ISDNFritz ISDNFritz v2.0 ISDNPRI T1 ISDNRT2890F5D6001F5D6020V3F5D7010F5D6000VME 617VME 270655015601BCM43224BCM5752BCM5752MBCM5709BCM5709SBCM5716BCM5716SBCM5702BCM5703BCM5704CBCM5704S AltBCM5706BCM5708BCM5702FEBCM57710BCM57711BCM57711EBCM5705BCM5705KBCM5717BCM5718BCM5719BCM5721BCM5722BCM5723BCM5705MBCM5705M AltBCM5720BCM57712BCM57712EBCM5714BCM5714SBCM5780BCM5780SBCM5705FBCM5754MBCM5755MBCM5756BCM5751BCM5715BCM5715SBCM5754BCM5755BCM5751MBCM5751FBCM5787FBCM5761EBCM5761BCM57762BCM5764BCM57766BCM5761SBCM5761SEBCM57760BCM57788BCM57780BCM5787MBCM57790BCM5782BCM5784BCM5785GBCM5786BCM5787BCM5788BCM5789BCM5785FBCM5702XBCM5703XBCM5704SBCM5706SBCM5708SBCM57761BCM57781BCM57791BCM57786BCM57765BCM57785BCM57795BCM57782BCM5702 AltBCM5703 AltBCM5781BCM5753BCM5753MBCM5753FBCM5903MBCM4401B1BCM5901BCM5901A2BCM5903FBCM5906BCM5906MBCM4303BCM4307BCM4311BCM4312BCM4315BCM4318BCM4319BCM4306BCM4309BCM43XGBCM4321BCM4322BCM43225BCM43227BCM4401BCM4401B0BCM431358015802580558205821582258235825586058615862BT848BT849BT878BT879BT878 AudioBT879 AudioBt8474 HDLCMultiMaster NCMultiMasterFlashPointGPPCINITROX XLNITROX LiteNITROX PXCinemasterNx10 10GbEPE9000 10GbET302E 10GbET310E 10GbET320X 10GbET302X 10GbET320E 10GbET310X 10GbET3B10 10GbET3B20 10GbET3B02 10GbE643106554565548655506555465555685546900069030CL-GD7548CL-GD5430CL-GD5434-4CL-GD5434-8CL-GD5436CL-GD5446CL-GD5480CL-GD5462CL-GD5464CL-GD5465CL-PD6729CL-PD6832 CardBusCL-PD6833 CardBusCL-GD7542CL-GD7543CL-GD7541CS4610 SoundFusionCS4615CS4280/46xx CrystalClearCS4281 CrystalClearVIC PCIEVIC ManagementVIC EthernetVIC FCoEAAR-1210SAAAR-1220SAAAR-1225SAPCI0640PCI0642PCI0643PCI0646PCI0647PCI0648PCI0649PCI0650AUSB0670USB0673PCI0680SiI3112 SATASiI3114 SATASiI3124 SATASiI3131 SATASiI3132 SATASiI3512 SATASiI3531 SATAGigaCardEX110TXSmart Array 64xxTriflex PCIQVisionQVision 1280/pSmart Array 5300Smart Array 5iSmart Array 532Smart Array 5312Smart Array 6iSmart Array 641Smart Array 642Smart Array 6400Smart Array 6400 EMSmart Array 6422Hotplug PCINetelligent ASMCPCI HotplugUSB OpenHostSMART2P RAIDISAPnPNetelligent 10/100TXNetelligent IDENetelligent 10 TIntegrated NetFlex 3/PDP Netelligent 10/100TXProLiant Netelligent 10/100TXEmbedded Netelligent 10/100TXNetelligent 10 T/2 PCISmart Array 5300 rev.2Smart Array 5i/532 rev.2iLONetFlex 3/PNetFlex 3/PBCompexeRL100-ATX 10/100PMAC 9871356k WinmodemSoftK56 PCIHSF 56k HSFiMUSYCC CN8478MUSYCC CN8474MUSYCC CN8472MUSYCC CN8471CX2388xCX2388x AudioCX2388x MPEGCX2388x IRCX2388582C599 VLBCY82C693U ISAFEther CB-TXD 10/100FEther II CB-TXD 10/100CG-LAPCIGTRTL8192ERTL8190PC-Bus II-PCICache Coherency FilterSoundBlaster LiveSoundBlaster AWE64DSoundBlaster AudigySoundBlaster X-FiSoundBlaster Live (Dell)SoundBlaster Audigy LSSoundBlaster Audigy 2SoundBlaster X-Fi XtremePCI Gameport JoystickSoundBlaster Audigy DigitalEctiva 1938Cyclom-Y below 1MCyclom-YCyclom-4Y below 1MCyclom-4YCyclom-8Y below 1MCyclom-8YCyclom-Z below 1MCyclom-ZIQ80310Cx5510GXm PCIGXm ISACx5530 SouthCx5530 SMICx5530 IDECx5530 XpressAUDIOCx5530 VideoDM9009DM9100DM9102DM9132PCCOM 2-portPCCOM 4-portPCCOM 8-port21050 PCI-PCI2104021030Zephyr NV-RAMKZPSA21140TGA2DEFPA21041DGLPB (OPPO)ZLXP-L2 (Pixelvision)Memory Channel Cluster Controller21142/3Farallon PN9000SX21052 PCI-PCI21150 PCI-PCI21150-BC PCI-PCI21152 PCI-PCI21153 PCI-PCI21154 PCI-PCI21554 PCI-PCISWXCR RAIDPERC 2/SiPERC 3/DiPERC 3/SiDRAC 3 Add-inDRAC 3 Virtual UARTDRAC 3 Embedded/OptionalDRAC 4 Embedded/OptionalDRAC 3 OptionalPERC 4/Di i960PERC 4/Di VerdeDRAC 4DRAC 4 Virtual UARTPERC 4e/DiDRAC 4 SMICPERC 58139Viper/PCIDFE-550TXDFE-530TX+DFE-690TXDDRP32TXDDWL-610DGE-550TDGE-550SXDFE-520TX C1DGE-528TDGE-530T C1DGE-560TDGE-530T B1DGE-560SXDGE-550T B1DGE-530T A1Memory ControlSmartCache/RaidSmartRAID (I2O)SmartRAID 2005SPCI-SCIDMX3194UIS64PH ISDNRT2860155P-MF1 ATM (FPGA)155P-MF1 ATM (ASIC)25SS-3010 ATM (ASIC)SpeedStream 1023QuickStep 1000 ISDNLPFCLP6000Lancer 10GbELancer 10GbE VFLPe121LPe1250LP952LP982LP101LP1050LP111LP1150LPe111LPe1150LPe1000LPe1000-SPLPe1002-SPLPe12000LPe12000-SPLPe12002-SPLP7000LP8000LP9000LP9802LP10000LPX10000LP10000-SLP11000-SLPe11000-SLPe12000-SLP11000LP11000-SPLP11002-SPLPe11000LPe11000-SPLPe11002-SPEndace Dag3.6DEndace Dag4.23GEFlash memoryMemory StickSD ControllerCB-1211 CardBusCB-1225 CardBusCB-1410 CardBusCB-710 CardBusCB-712 CardBusCB-1420 CardBusCB-720 CardBusCB-722 CardBusAudioPCI97AudioPCICT5880ES366H ModemMaestro IISOLO-1 AudioDriveMaestro 2EES1989ES1989 ModemMaestro 3ES1983 ModemMaestro 3 AudioES366H Fax/ModemES2838/2839 SuperLink ModemES2898 ModemRoadRunner HIPPIRoadRunner Gig-EFreedom GBusWL11000PSST-64PSST-128PSST-16PSST-4pSST-8pXR17C152XR17C154XR17C158ATM PCA-200ATM PCA-200e801 SoundMPC8349EMPC8349MPC8347E TBGAMPC8347 TBGAMPC8347E PBGAMPC8347 PBGAMPC8343EMPC8343FL1000 xHCIFL1009 xHCIPW008GE5PW008GE4PRIMEPOWER250/450 LANioDrive v1.2ioDriveioXtremeioXtreme ProTMC-18C30 (36C70)GL24110P03GL24110PGL24110P02Pulsar G7370 ADSLPR103WinTVPN672TX 10/100Visualize EGVisualize FX6Visualize FX4Visualize FX2Tach TL FibreChannelTach XL2 FibreChannelJ2585AJ2585BDiva Serial MultiportElroy Ropes-PCIVisualize FXeTopToolsNetRaid-4MNetServer SmartIRQ82557B 10/100 NICPluto MIOzx1 IOCMercury Ropes-PCIQuickSilver Ropes-PCISmart Array V100Smart Array E200iSmart Array E200Smart ArraySmart Array P800Smart Array P600Smart Array E500Smart Array P400Smart Array P400iSmart Array P700mSmart Array P212Smart Array P410Smart Array P410iSmart Array P411Smart Array P812Smart Array P712mSmart Array P711miLO3 SerialiLO3 SlaveiLO3 ManagementiLO3 WatchdogSmart Array P222Smart Array P420Smart Array P421Smart Array P822Smart Array P420iSmart Array P220iSmart Array P721m77516500781179517814/7851/785480658165815479567955/7954HB6 PCI-PCIHB4 PCI-PCIMSVCC01 Video CaptureSH7751 PCISH7751R PCIMCACPU - Alta LiteCPU - Alta MPISA w/PnPCPUAuto LANStreamerGXT-150P82G267582351 PCI-PCIMiami/PCIOlympici82557B 10/100RSAFireGL2133 PCIX-PCIX4810 BSP4810 SCCCalgary IOMMUEnvy24 I/O CtrlrEnvy24PT/HT Audio77201/77211 ATM (NICStAR)89HPES12N3A89HPES24N3A89HPES24T689HPES4T489HPES24T3G2WDT 50x Watchdog TimerINIC-850 (A100UW)INIC-1060 (A100U2W)INIC-940INIC-941INIC-950VirtualBox Graphics AdapterVirtualBox Guest ServiceIPN2120IPN222050265027502888498853Twin Turbo 128Twin Turbo 3DEES ISA21145Core HostCore PCIEHD Graphics3400 PCIECentrino Advanced-N 6205WiFi Link 1000Centrino Advanced-N 6250WiFi Link 1030Centrino Advanced-N 6030Core 2G HostCore 2G PCIEHD Graphics 2000Xeon E3-1200 HostHD Graphics P3000HD Graphics 3000Xeon E3-1200v2 HostXeon E3-1200v2 PCIEHD Graphics 2500Core 3G HostHD Graphics 4000HD Graphics P400080303 IOP80312 I/O Companion6700PXH PCIE-PCIX6702PXH PCIE-PCIXIOP332 PCIE-PCIXIOP331 PCIX-PCIX41210 PCIE-PCIXIOP333 PCIE-PCIXDH89XXCC SGMIIDH89XXCC SerDesDH89XXCC backplaneDH89XXCC SFP82375EB EISA82424ZX Cache/DRAM82378IB ISA82426EX ISA82434LX/NXGDT RAIDCentrino Advanced-N 6235WiFi Link 6150WiFi Link 130WiFi Link 100i960 RP PCI-PCIi960 RM PCI-PCIi960 RN PCI-PCIAtom D2000/N2000 VideoAtom D2000/N2000 HostPRO/1000 (82542)PRO/1000F (82543GC)PRO/1000T (82543GC)PRO/1000XT (82544EI)PRO/1000XF (82544EI)PRO/1000T (82544GC)PRO/1000XT (82544GC)PRO/1000MT (82540EM)PRO/1000MT (82545EM)PRO/1000MT (82546EB)PRO/1000MF (82545EM)PRO/1000MF (82546EB)PRO/1000MT (82541EI)PRO/1000MT (82540EP)PRO/1000MT Mobile (82541EI)PRO/1000CT (82547EI)PRO/1000CT Mobile (82547EI)PRO/1000MT QP (82546EB)PRO/1000MT (82545GM)PRO/1000MF (82545GM)PRO/10082559PRO/100 VEPRO/100 VM82562EH HomePNA82801DB LANV.92 ModemPRO/Wireless 2100PRO/10GbE (82597EX)ICH8 IGP M AMTICH8 IGP AMTICH8 IGP CICH8 IFEICH8 IGP MPRO/100 MPRO/1000 PT (82571EB)PRO/1000 PF (82571EB)PRO/1000 PB (82571EB)82801FB LAN82801FBM LAN82801GB LANPRO/1000CT (82547GI)PRO/1000MT (82541GI)PRO/1000MT Mobile (82541GI)PRO/1000MT (82541ER)PRO/1000MT (82546GB)PRO/1000MF (82546GB)PRO/1000GT (82541GI)PRO/1000 PT (82572EI)PRO/1000 PF (82572EI)PRO/1000 PB (82572EI)PRO/1000MT (82573E)82573E IDE82573E KCS82573E SerialPRO/1000 PT (80003ES2)PRO/1000 PF (80003ES2)PRO/1000MT QP (82546GB)PRO/1000MT (82573L)PRO/10GbE CX4 (82597EX)PRO/1000 AT (82571EB)PRO/1000 AF (82571EB)PRO/1000 QP (82571EB)PRO/1000 PT (82575EB)PRO/1000 PF (82575EB)PRO/1000 PL (82573L)PRO/1000 PM (82573V)PRO/1000 PM (82573E)10GbE (82598)ICH9 IGP AMTICH9 IGP MICH9 IFEICH9 IFE GICH9 IFE GTICH8 IFE GTICH8 IFE G10GbE SR Dual (82598AF)10GbE SR (82598AF)10GbE (82598AT)PRO/1000 (82576)ICH9 IGP M VICH10 R BM LMICH10 R BM LFICH10 R BM VPRO/1000 MT (82574L)PRO/1000 QP (82571PT)PRO/1000 QP (82575GB)10GbE Dual (82598AT)10GbE SFP+ (82598EB)10GbE CX4 (82598EB)ICH10 D BM LMICH10 D BM LF10GbE SR Dual (82598)ICH9 BMPRO/1000 FP (82576)PRO/1000 QP (82576)82577LM82577LC10GbE CX4 Dual (82598EB)10GbE VF (82599)82578DM82578DC10GbE DA Dual (82598)10GbE LR (82598EB)ICH9 IGP M AMT82574L10GbE KX4 (82599)10GbE Backplane (82599)10GbE CX4 (82599)10GbE SFP+ (82599)10GbE XAUI (82599)8255282815 Host82815 AGP82815 Video82806AA APIC82559ER82092AA IDESAA711682452KX/GXEE Pro 10 PCIEE Pro 100EE Pro 100 Smart8255x82437FX82371FB ISA82371FB IDE82371 ISA and IDE82437MX82441FX82380AB Mobile ISA82380FB Mobile PCI-PCI82439HX82806AA82870P2 PCIX-PCIX82870P2 IOxAPIC82870P2 Hot PlugICH8 82567V-382579LM82579V10GbE SFP EM (82599)10GbE BX (82598)PRO/1000 (82576NS)PRO/1000 (82583V)82576 SerDes QPI340-T4 (82580)82580 Fiber82580 SerDes82580 SFPI340-T2 (82580)10GbE KR (82599)82576NS SerDes82599 T3I350I350 FiberI350 SerDesI350 SGMII82580 QFX540TSFP+ FCOE (82599)FCOE (82599)80960RP ATU82840 Host82840 AGP82840 PCI82845 Host82845 AGPI/OAT7 Series xHCIPRO/10GbE SR (82597EX)PRO/10GbE LR (82597EX)6 Series SATA6 Series AHCI6 Series RAID6 Series PCIE6 Series HD Audio6 Series SMBus6 Series Thermal6 Series DMI-PCI6 Series USB6 Series MEI6 Series KTZ68 LPCP67 LPCUM67 LPCHM65 LPCH67 LPCHM67 LPCQ65 LPCQS67 LPCQ67 LPCQM67 LPCB65 LPCC202 LPCC204 LPCC206 LPCH61 LPCC600 SATAC600 AHCIC600 RAIDC600 PCIEC600 HD AudioC600 SMBusC600 ThermalC600 USBC600 LANC600 MEIC600 Virtual PCIEC600 LPC7 Series SATA7 Series AHCI7 Series RAID7 Series PCIE7 Series HD Audio7 Series SMBus7 Series USB7 Series MEI7 Series KTZ77 LPCZ75 LPCB75 LPCH77 LPCC216 LPCQM77 LPCHM77 LPCUM77 LPCHM76 LPCHM75 LPCHM70 LPC82801AA LPC82801AA IDE82801AA USB82801AA SMBus82801AA AC9782801AA Modem82801AA Hub-to-PCI82801AB LPC82801AB IDE82801AB USB82801AB SMBus82801AB AC9782801AB Modem82801AB Hub-to-PCI82801BA LPC82801BA USB82801BA SMBus82801BA AC9782801BA Modem82801BAM Hub-to-PCI8256282801BAM IDE82801BA IDE82801BAM LPC82801BA Hub-to-PCI82801E LPC82801E USB82801E SMBus82801E LAN82801CA LPC82801CA/CAM USB82801CA/CAM SMBus82801CA/CAM AC9782801CA/CAM Modem82801CAM IDE82801CA IDE82801CAM LPC82801DB LPC82801DBL IDE82801DB USB82801DB SMBus82801DB AC9782801DB Modem82801DBM IDE82801DB IDE82801DBM LPC82801EB/ER LPC82801EB SATA82801EB/ER USB82801EB/ER SMBus82801EB/ER AC9782801EB/ER Modem82801EB/ER IDE82801EB/ER USB282801ER SATA82820 Host82820 AGP82850 Host82860 Host82850/82860 AGP82860 PCIE7500 HostE7500 Error ReportingE7500 PCIE7501 HostE7505 HostE7505 Error ReportingE7505 AGPE7505 PCI82845G Host82845G AGP82845G Video82865G Host82865G AGP82865G Video82865G CSA82865G Overflow82875P Host82875P AGP82875P CSA82915G Host82915G PCIE82915G Video82925X Host82925X PCIEE7221 HostE7221 PCIEE7221 Video82915GM Host82915GM PCIE82915GM Video6300ESB LPC6300ESB IDE6300ESB SATA6300ESB SMBus6300ESB AC976300ESB Modem6300ESB USB6300ESB WDT6300ESB APIC6300ESB PCIX5000X Host5000Z Host5000V Host5000P Host5000 PCIE5000 Error Reporting5000 Reserved5000 FBD5000 PCIE x85000 PCIE x16E8500 HostE8500 PCIEE8500 PCIE x8E8500 IMIE8500 FSB/Boot/InterruptE8500 Address MappingE8500 RASE8500 MiscE8500 ReservedE8500 XMBE8500 XMB MiscE8500 XMB MAIE8500 XMB DDRE8500 XMB Reserved82801FB LPC82801FBM LPC82801FB SATA82801FR SATA82801FBM SATA82801FB USB82801FB PCIE82801FB HD Audio82801FB SMBus82801FB Modem82801FB AC9782801FB IDE6321ESB LPC6321ESB SATA6321ESB AHCI6321ESB RAID6321ESB USB6321ESB PCIE6321ESB AC976321ESB Modem6321ESB HD Audio6321ESB SMBus6321ESB IDE82945G Host82945G PCIE82945G Video82955X Host82955X PCIEE7230 HostE7230 PCIE82975X PCIE82975X Host82945GM Host82945GM PCIE82945GM Video82945GME Host82945GME Video82801GH LPC82801GB LPC82801GBM LPCNM10 LPC82801GHM LPC82801GB SATA82801GR AHCI82801GR RAID82801GBM SATA82801GBM AHCI82801GHM RAID82801GB USB82801GB PCIE82801GB HD Audio82801GB SMBus82801GB Modem82801GB AC9782801GB IDE82801G PCIE82801H LPC82801HEM LPC82801HH LPC82801HO LPC82801HBM LPC82801H SATA82801H AHCI82801H RAID82801HBM SATA82801HBM AHCI82081HBM RAID82801H SMBus82801H DMI-PCI82801H USB82801H PCIE82801H HD Audio82801H Thermal82801HBM IDE82801IH LPC82801IO LPC82801IR LPC82801IEM LPC82801IB LPC82801IBM LPC82801I SATA82801I AHCI82801I RAID82801I SMBus82801I Thermal82801I USB82801I HD Audio82801I PCIEICH9 IGP C82946GZ Host82946GZ PCIE82946GZ Video82946GZ HECI82946GZ PT IDER82946GZ KT82G35 Host82G35 PCIE82G35 Video82G35 HECI82Q965 Host82Q965 PCIE82Q965 Video82Q965 HECI82Q965 PT IDER82Q965 KT82G965 Host82G965 PCIE82G965 Video82G965 HECI82G965 PT IDER82G965 KT82Q35 Host82Q35 PCIE82Q35 Video82Q35 HECI82Q35 PT IDER82Q35 KT82G33 Host82G33 PCIE82G33 Video82G33 HECI82G33 PT IDER82G33 KT82Q33 Host82Q33 PCIE82Q33 Video82Q33 HECI82Q33 PT IDER82Q33 KT82X38 Host82X38 PCIE82X38 HECI82X38 PT IDER82X38 KT3200/3210 Host3200/3210 PCIE3210 PCIEGM965 HostGM965 PCIEGM965 VideoGM965 KTGM965 PT IDERGME965 HostGME965 PCIEGME965 VideoGME965 HECIGME965 PT IDERGME965 KTGM45 HostGM45 PCIEGM45 VideoGM45 HECIGM45 PT IDERGM45 KTQ45 HostQ45 PCIEQ45 VideoQ45 HECIQ45 PT IDERQ45 KTG45 HostG45 PCIEG45 VideoG41 HostG41 VideoRCU32 I2O RAID3124 SATA31244 SATA82855PM Host82855PM AGP82855PM Power5500 HostX58 Host5520 HostX58 PCIE5520/X58 QuickPath5520 QuickPathX58 GPIOX58 RASX58 QuickPathX58 QuickDataX58 IOxAPICX58 MiscX58 ThrottleX58 TXT6321ESB IOxAPIC6321ESB PCIE-PCIX82830M Host82830M AGP82830M Video82855GM Host82855GME AGP82855GM Video82855GM Memory82855GM Config82854 Host82854 VideoE7520 HostE7520 Error ReportingE7320 HostE7320 Error ReportingE7520 DMAE7520 PCIEE7520 ConfigE7525 Host3100 Host3100 Error Reporting3100 EDMA3100 PCIE7300 Host7300 PCIEI/OAT CNB7300 FSB/Boot/Interrupt7300 Snoop Filter7300 Misc7300 FBD82801JD SATA82801JD AHCI82801JD RAID82801JDO LPC82801JIR LPC82801JIB LPC82801JD LPC82801JI SATA82801JI AHCI82801JI RAID82801JI SMBus82801JI USB82801JI HD Audio82801JI PCIE82801JDO VECI82801JD Virtual SATA82801JD SMBus82801JD Thermal82801JD USB82801JD HD Audio82801JD PCIE82801JD LANP55 LPCPM55 LPCH55 LPCQM57 LPCH57 LPCHM55 LPCQ57 LPCHM57 LPCQS57 LPC3400 LPC3420 LPC3450 LPC3400 SATA3400 AHCI3400 RAID3400 SMBus3400 Thermal3400 USB3400 HD AudioQS57 HD Audio3400 MEI3400 PT IDER3400 KTE5 HostE5 PCIEE5 DMAE5 Address MapE5 Error ReportingE5 I/O APIC5400 Host5400A Host5400B Host5400 PCIEI/OAT SNB5400 FSB/Boot/Interrupt5400 Coherency Engine5400 IOAPIC5400 RASE600 HostPRO/Wireless 2200BGPRO/Wireless 2225BGPRO/Wireless 3945ABGPRO/Wireless 2915ABGWireless WiFi Link 4965Centrino Ultimate-N 6300Centrino Advanced-N 6200WiFi Link 5100WiFi Link 5300WiFi Link 5350WiFi Link 5150Turbo MemoryEP80579 HostEP80579 MemoryEP80579 EDMAEP80579 PCIEEP80579 SATAEP80579 AHCIEP80579 ASUEP80579 ReservedEP80579 LPCEP80579 SMBusEP80579 USBEP80579 PCI-PCIEP80579 CANbusEP80579 SerialEP80579 1588EP80579 LEBEP80579 GCUEP80579 LANi960 RD PCI-PCIPRO 100 Server5100 Host5100 PCIE5100 FSB5100 Reserved5100 DDRI/OAT SCNB82371SB ISA82371SB IDE82371SB USB82437VX82439TX82371AB PIIX4 ISA82371AB IDE82371AB USB82371AB Power82810 Host82810 Video82810-DC100 Host82810-DC100 Video82810E Host82810E Video82443LX AGP82443BX AGP82443BX82440MX Host82440MX AC9782440MX Modem82440MX ISA82440MX IDE82440MX USB82440MX Power82440BX AGP82443GX82372FB IDE82740 AGPUS15W HostUS15L/UL11L HostUS15W VideoUS15L/UL11L VideoSCH PCIESCH USBSCH USB ClientSCH LPCSCH IDESCH HD AudioSCH SD/MMCE600 PCIEE600 VideoE600 ConfigE600 LPC82450KX/GX82450KX/GX Memory82451NX Mem & IO82454NX PXBEG20T PCIEEG20T Packet HubEG20T EthernetEG20T GPIOEG20T USBEG20T USB ClientEG20T SDIOEG20T AHCIEG20T DMAEG20T SerialEG20T SPIEG20T I2CEG20T CANEG20T 158882802AC Firmware Hub 8Mbit82802AB Firmware Hub 4MbitI2O RAID PCI-PCIRCU21 I2O RAIDRCUxx I2O RAIDRCU31 I2O RAIDRCU31L I2O RAIDPineview DMIPineview VideoS21152BB PCI-PCI21154AE/BE PCI-PCICore DMICore QPI LinkCore QPI RoutingCore ManagementCore ScratchCore ControlCore MiscPowerstorm 4D50TIntense 3DExpert3D5526 FibreChannelPRISM3PRISM2.5Prism IndigoPrism Javelin/XbowPrism GT/DuetteAEONGV-BCTV3AGX016ITT3204 MPEG DecoderIT8211FIT8212FIT8213FIT8330GIT8888F ISAIT8892E PCIE-PCIJMC250JMC260JMB360 SATAJMB361 IDE/SATAJMB362 SATAJMB363 IDE/SATAJMB365 IDE/SATAJMB366 IDE/SATAJMB368 IDExDKTIHSSIDS3SSIDS1HSSIcAppian LiteParallelDual ParallelS3 805Leadtek WinFast TV 2000Leadtek WinFast TV 2000 XPLXT1001EG1032EG1064PCMPC200PCM200PNICPNIC-II8031K56flex DSVD LTMODEMLTMODEMVenus ModemUSB 2-portUSB QuadraBusFW322 1394FW643 1394ET1310LS242 DVD DecoderPMAC 98715PMAC 98727MX86250Smart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 CardbusPresto PCISmart 100/16/4 PCI-HS RingnodeSmart 100/16/4 PCI Ringnode16/4 CardBus Mk2Collage 25 ATMCollage 155 ATMi740 PCILibertas 88W8300Libertas 88W8310Libertas 88W8335Yukon 88E8001/8003/8010Yukon 88E8021CUYukon 88E8022CUYukon 88E8061CUYukon 88E8062CUYukon 88E8021XYukon 88E8022XYukon 88E8061XYukon 88E8062XYukon 88E8035Yukon 88E8036Yukon 88E8038Yukon 88E8039Yukon 88E8040Yukon 88E8040TYukon 88EC033Yukon 88E8042Yukon 88E8048Yukon 88E8052Yukon 88E8050Yukon 88E8053Yukon 88E8055Yukon 88E8056Yukon 88E8070Yukon 88EC036Yukon 88EC032Yukon 88EC034Yukon 88EC042Yukon 88E8058Yukon 88E8071Yukon 88E8072Yukon 88E8075Yukon 88E8057Yukon 88E8059Yukon (Belkin F5D5005)88SX5040 SATA88SX5041 SATA88SX5080 SATA88SX5081 SATA88SX6040 SATA88SX6041 SATA88SX6042 SATA88SX6080 SATA88SX6081 SATA88SE6101 IDE88SE6111 SATA88SE6120 SATA88SE6121 SATA88SE6122 SATA88SE6140 SATA88SE6141 SATA88SE6145 SATA88SX7042 SATA88SE9120 SATA88SE9123 SATA88SE9125 SATA88SE9172 SATAMGA PX2085 (Atlas)MGA Millenium 2064W (Storm)MGA 1064SG 220MHzMGA Millennium II 2164WMGA Millennium II 2164WA-B AGPMGA G200 PCIMGA G200 AGPMGA G200e (ServerEngines)MGA G400/G450 AGPMGA G200eWMGA ImpressionMGA G100 PCIMGA G100 AGPMGA 1064SGMGA G400 Twin HeadMGA G550 AGPMGA P650 PCIeMGA G200eRMGA Millennium G200 SDMGA Produktiva G100 SDMGA Mystique G200 SDMGA Millennium G200 SGMGA Marvel G200 SDPCI32PCI509PCI511PEX511GPS170PCIConnectX ENKSZ8841 10/100KSZ8842 dual-port 10/100 switchRT3090MN-120 10/100MN-130 10/1002IVDC-PCX1MiroVIDEO DC20Media 3DMiroVIDEO DC10/DC20Powerstorm 4D30TGUI AccelSerial MCS9865MPC105 PCIMPC106 PCISM56Raven PCICP-114C104HCP-104ULCP-104JUC168HDMA4 serialDAC960P V2 RAIDDAC960P V3 RAIDDAC960P V4 RAIDDAC960P V5 RAIDAcceleRAIDeXtremeRAIDZ8EMyrinet LANai 9.2MTD800 10/100MTD803 10/100MTD891 10/100/1000MV1000CH352NCP130NCP130 Rev A2PCI-GPIBNET2282 USBNXB-10GXxR (NX2031)NXB-10GCX4 (NX2031)NXB-4GCU (NX2035)IMEZ 10GbEHMEZ 10GbEIMEZ 10GbE MgmtHMEZ 10GbE MgmtNX3031DP83810 10/100PC87415 IDE87560 Legacy I/ODP83815 10/100DP83820 10/100/1000CS5535 HostCS5535 ISACS5535 IDECS5535 AUDIOCS5535 USBCS5535 VIDEOSaturnSCx200 ISASCx200 SMISCx200 IDESCx200 AUDIOSCx200 VIDEOSCx200 X-BUSSC1100 ISASC1100 SMISC1100 X-BusNS87410PowerVR PCX2I/OVersa MaestroVersa Va26D MaestroMagicgraph NM2070Magicgraph 128VMagicgraph 128ZVMagicgraph NM2160Magicgraph NM2200Magicgraph NM2360MagicMedia 256AV+MagicMedia 256XL+MagicMedia 256AVMagicMedia 256ZXXframeXframe IIMA301GA620GA620TNm9805Nm9820Nm9835Nm9845Nm9865Nm9901Nm9922CMI8338A AudioCMI8338B AudioCMI8738/C3DX AudioCMI8738B AudioHSP56 AMRCMI8788 HD AudioNSP2KNetVin 5000Universe VMETsi381 PCIE-PCIFalcon PFalcon SEF100253c81053c82053c82553c81553c810AP53c86053c1510D53c89653c89553c88553c87553c151053c895A53c1010-3353c1010-6653c103053c1030ZC53c103553c1035ZCSAS1064SAS1068SAS1064ESAS1068ESAS1066EMegaRAID SAS2208SAS1064ASAS1066SAS1078SAS2116SAS2308SAS2004SAS2008MegaRAID SAS2008SAS2108MegaRAID SAS2108 CRYPTO GEN2MegaRAID SAS2108 GEN2SAS1078DESAS220853c875JMegaRAID 320MegaRAID 320-2EMegaRAID SATA 4x/8xMegaRAID SAS 1064RMegaRAID Verde ZCRFC909FC909AFC929FC919FC929XFC919XFC949XFC939XFC949EYellowfin61C10263C81553c1030RPacket Engines G-NICPI7C21P100 PCIX-PCIXPI7C9X130 PCIE-PCIXFNW-3603-TX 10/100FNW-3800-TX 10/100NX82C501 PCINDR4600 PCIBS21 10/100E-mobility WirelessImagine-128Imagine-128 IIImagine-128 T2RImagine-128 T2R4NV1DAC64Riva TNTRiva TNT2Riva TNT2 UltraVantaMCP04 ISAMCP04 SMBusMCP04 IDEMCP04 SATAMCP04 LANMCP04 AC97MCP04 USBMCP04 PCI-PCInForce4 ISAnForce4 SMBusnForce4 IDEnForce4 SATACK804 LANnForce4 AC97nForce4 USBnForce4 PCI-PCInForce4 PCIEnForce4 DDRnForce2 ISAnForce2 SMBusnForce2 IDEnForce2 LANnForce2 USBnForce2 AC97nForce2 AudionForce2 PCI-PCInForce2 FireWireMCP04 PCIEnForce2 400 ISAnForce2 400 SMBusnForce2 400 IDEnForce3 LANnForce2 400 USBnForce2 400 AC97nForce2 400 PCI-PCInForce2 400 SATAGeForce 7800 GTXGeForce 7800 GTAladdin TNT2GeForce Go 6800GeForce Go 6800 UltraQuadro FX Go1400Quadro FX 1400nForce3 ISAnForce3 PCI HostnForce3 PCI-PCICK804nForce3 SMBusnForce3 IDEnForce3 USBnForce3 ModemnForce3 AC97nForce3 250 ISAnForce3 250 PCI HostnForce3 250 AGPnForce3 250 SATAnForce3 250 SMBusnForce3 250 IDEnForce3 250 USBnForce3 250 AC97nForce3 250 PCI-PCIGeForce 6600 GT AGPGeForce 6600GeForce 7800 GSGeForce 6800 GTGeForce 5300 PCXQuadro FX 330GeForce256GeForce256 DDRQuadroGeForce2 MXGeForce2 MX 100GeForce2 GoQuadro2 MXRGeForce 6600 GTGeForce 6600 GoGeForce2 GTSGeForce2 TiGeForce2 UltraQuadro2 ProGeForce 6200Quadro NVS 285GeForce Go 6200GeForce4 MX 460GeForce4 MX 440GeForce4 MX 420GeForce4 440 GoGeForce4 420 GoGeForce4 420 Go 32MQuadro4 500XGLGeForce4 440 Go 64MQuadro4 200/400NVSQuadro4 550XGLQuadro4 GoGLGeForce4 MX 440 AGPGeForce4 MX 440SE AGPGeForce 4 MX 420 AGPGeForce4 MX 4000Quadro4 580 XGLQuadro4 NVSQuadro4 380 XGLGeForce 8800 GTXGeForce 8800 GTSGeForce2 Crush11nForce PCI HostnForce 220 DDRnForce 420 DDRnForce 220/420nForce APUnForce AC97nForce ISAnForce SMBusnForce AGPnForce PCI-PCInForce IDEnForce USBnForce LANGeForce 7300 LEGeForce 7200 GSGeForce 7300 GoGeForce 7400 GoGeForce 7300 GSnForce2 PCInForce2 AGPnForce2GeForce4 MX nForce GPUGeForce3GeForce3 Ti 200GeForce3 Ti 500Quadro DCCGeForce 6150GeForce 6150 LEGeForce 6100GeForce Go 6150GeForce Go 6100GeForce4 Ti 4600GeForce4 Ti 4400GeForce4 Ti 4200Quadro4 900 XGLQuadro4 750 XGLQuadro4 700 XGLMCP51 ISAMCP51 SMBusMCP51 IDEMCP51 SATAMCP51 LANMCP51 AC97MCP51 HD AudioMCP51 USBMCP51 PCI-PCIMCP51 HostMCP51 PMUMCP51 MemoryC51 MemoryGeForce4 Ti 4800GeForce4 Ti 4200 GoGeForce 7900 GT/GTOGeForce Go 7950 GTXQuadro FX 3500GeForce 7600 GTGeForce 7600 GSC51 HostC51 PCIEGeForce FX 5800 UltraGeForce FX 5800GeForce FX 5600 UltraGeForce FX 5600GeForce FX Go 5600GeForce FX Go 5650GeForce FX 5200 UltraGeForce FX 5200GeForce FX Go 5200GeForce FX 5500GeForce FX 5100Quadro FX 500/600GeForce FX Go 5300GeForce FX Go 5100GeForce FX 5900 UltraGeForce FX 5900GeForce FX 5950 UltraGeForce FX 5700LEGeForce FX Go 5700MCP55 ISAMCP55 SMBusMCP55 MemoryMCP55 USBMCP55 IDEMCP55 PCI-PCIMCP55 HD AudioMCP55 LANMCP55 PCIEMCP55 SATAGeForce 7300 GTGeForce 7600 GoC55 HostC55 MemoryC55 PCIEGeForce 6100 nForce 430GeForce 6100 nForce 405GeForce 7025 nForce 630aMCP61 ISAMCP61 HD AudioMCP61 LANMCP61 SATAMCP61 PCIEMCP61 MemoryMCP61 SMBusMCP61 IDEMCP61 USBMCP61MCP61 SMUGeForce 8600 GTGeForce 8600M GTQuadro FX 570MGeForce 8500 GTGeForce 8400 GSGeForce 8400M GSGeForce 8400M GMCP65 ISAMCP65 MemoryMCP65 SMBusMCP65 IDEMCP65 PCIMCP65 HD AudioMCP65 AHCIMCP65 LANMCP65 USBMCP65 PCIEMCP65 SATAGeForce GTX 285GeForce 7000MGeForce 7050 PVMCP67 MemoryMCP67 SMBusMCP67 Co-processorMCP67 ISAMCP67 LANMCP67 SATAMCP67 AHCIMCP67 RAIDMCP67 HD AudioMCP67 USBMCP67 IDEMCP67 PCIMCP67 PCIEMCP77 MemoryMCP77 PCIEMCP73 USBMCP73 IDEMCP73 PCIEnForce 200GeForce 9800 GTXGeForce 8800 GTGeForce 9800 GTGeForce 9600 GTGeForce 9300 GEGeForce 9300M GSQuadro NVS 150mQuadro NVS 160mMCP77 SMBusMCP77 Co-processorMCP77 IDEMCP77 PCIMCP77 ISAMCP77 LANMCP77 HD AudioMCP77 USBMCP73 HostMCP73 MemoryMCP73 ISAMCP73 SMBusMCP73 LANGeForce 7100GeForce 7050MCP73 SATAMCP73 AHCIMCP73 RAIDMCP73 HD AudioGeForce 8200m GGeForce 9100GeForce 8200nForce 780a SLIGeForce 9400GeForce 9400mGeForce 9300ION VGAGeForce 320MGeForce 210MCP79 HostMCP79 MemoryMCP79 PCIEMCP79 SMBusMCP79 Co-processorMCP79 USBMCP79 ISAMCP79 LANMCP79 SATAMCP79 AHCIMCP79 RAIDMCP79 HD AudioMCP77 SATAMCP77 AHCIMCP77 RAIDGF108 HD AudioGF116 HD AudioMCP89 HostMCP89 MemoryMCP89 PCIEMCP89 SMBusMCP89 Co-processorMCP89 LANMCP89 LPCMCP89 SATAMCP89 AHCIMCP89 RAIDMCP89 HD AudioMCP89 USBGeForce 425MGeForce GTX 550 TiOTI107OC2325OC2183OC232682C092G82C557 Host82C558 ISA82C568 IDE82D568 IDE82C621 IDE82C70082C70182C82282C8613G+ UMTS HSDPA (F32)010L100L110L200L210L400L800Lx10H100H200H400H/800H800H200HV2011HOX16PCI954OX16PCI954KExsys EX-41092OXCB950OXmPCI954OXmPCI954 DisabledExsys EX-41098OX16PCI954 ParallelOX16PCI952OX16PCI952 ParallelQStor SATAPMC/GNIC2ToolsRZ1000HSP MicroModem 56Virtio NetworkVirtio StorageVirtio MemoryVirtio ConsoleCMIC-LECNB20-LE HostCNB20HE HostCNB20LE HostCIOB30CMIC-HECMIC-WS Host (GC-LE)CNB20-HE HostCNB20-HE Host (GC-LE)CMIC-GC HostGCNB-LE HostHT-1000 PCICIOB-X2 PCIXHT-1000 PCIXCIOB-EHT-2000 PCIXHT-2000 PCIEHT-2100 PCIEOSB4CSB5CSB6HT-1000OSB4 IDECSB5 IDECSB6 RAID/IDEHT-1000 IDECSB6 IDEOSB4/CSB5 USBCSB6 USBHT-1000 USBCSB5 LPCGCLE-2 HostHT-1000 LPCK2 SATAFrodo4 SATAFrodo8 SATAHT-1000 SATAHT-1100HT-1100 SATAVerite 1000Verite V2x00SH7757 PCIE-PCISH7757 PCIE SwitchT1/E1/J1Dual T1/E1/J1Quad T1/E1/J1ISP156x USBSAA7130 TVSAA7133 TVSAA7134 TVSAA7135 TVSAA7231 TVPS5000PT80C826PT86C521PT86C523PC87550PT86C523_2PCC-ISESPCI PC WDES1849I/O 1076I/O 1077PCI 6520PEX 8112PEX 8114PEX 8517PEX 8518PEX 8524PEX 8525PEX 8532PEX 8533PEX 8547PEX 8548PEX 8603PEX 8612PEX 8613PEX 8614PEX 8616PEX 8624PEX 8632PEX 8648I/O 9016I/O 9050I/O 9080Cronyx OmegaPDC20265PDC20263PDC20275PDC20318PDC20319PDC20371PDC20379PDC20378PDC20375PDC20376PDC20377PDC40719PDC40519PDC20771PDC20571PDC20579PDC40779PDC40718PDC40518PDC20775PDC20575PDC42819PDC20267PDC20246PDC20262PDC20268PDC20269PDC20276DC5030PDC20268RPDC20271PDC20617PDC20620PDC20621PDC20618PDC20619PDC20277ISP10160ISP1020ISP1022ISP1080ISP12160ISP1240ISP1280ISP2100ISP2200ISP2300ISP2312ISP2322ISP2422ISP2432ISP2512ISP2522ISP2532ISP4010 iSCSI TOEISP4022 iSCSI TOEISP4032 iSCSI TOEISP4010 iSCSI HBAISP4022 iSCSI HBAISP4032 iSCSI HBAISP5422ISP5432ISP6312ISP6322ISP8432PWDOG185008580RT2460ART2560RT2561SRT2561RT2661RT2760RT2790RT3062RT3091RT3092RT3562RT3592RT3593RT5390R1010 IDER1011 IDER6021 HostR6031 ISAR6040 EthernetR6060 USBR6061 USBRTS5209 Card Reader80298139D81298101E81388169SC816881698192SE818081858188CERTL8192CE8187SE5C465 CardBus5C466 CardBus5C475 CardBus5C476 CardBus5C477 CardBus5C478 CardBus5C521 Firewire5C551 Firewire5C552 Firewire5C592 Memory Stick5C822 SD/MMC5C832 Firewire5C843 MMC5C852 xD5U230 Memory Stick5U822 SD/MMC5U823 SD/MMC5U832 Firewire5U852 SD/MMCRS56/SP-PCI11P1 ModemViRGETrio32Trio32/64Aurora64V+Trio64UV+868ViRGE VX86C92886C864-086C864-186C864-286C864-386C964-086C964-186C964-286C964-386C968-086C968-186C968-286C968-3Trio64V2/DXPlatoTrio3D AGPViRGE DX/GXViRGE GX2Trio3 DX2Savage 3DSavage 3DMSavage 4ProSavage PM133ProSavage KM133ViRGE MXViRGE MXPSavage/MX-MVSavage/MXSavage/IX-MVSavage/IXSuperSavage MX/128SuperSavage MX/64SuperSavage MX/64CSuperSavage IX/128 SDRSuperSavage IX/128 DDRSuperSavage IX/64 SDRSuperSavage IX/64 DDRSuperSavage IX/C SDRSuperSavage IX/C DDRTwisterTwister-KProSavage DDRProSavage DDR-KSonicVibesSafeXcelMagicLAN SWL-2210PA10xNeo-4Neo-8SK-98xxSK-98xx v2.0SK-9D21SK-9SxxSK-9821SK-9843SK-9ExxSK-9E21MBladeEngine2 10GbEBladeEngine3 10GbEIOC3Rad1TigonIOC4ImageSync 1STG 2000XSTG 1764Kyro-IISTG 1764X64GXDVDmagic-PROSC9230186C201 AGP86C202 AGP648FX AGP86C20585C503 System5595 System85C503 ISA180 SATA181 SATA182 SATA183 SATA1901915597/5598 VGA6215300/305/630 VGA315 Pro VGA85C50185C49685C596530 PCI540 PCI550 PCI85C601 EIDE620 PCI630 PCI633 PCI635 PCI640 PCI645 PCI646 PCI648 PCI649 PCI650 PCI651 PCI652 PCI655 PCI656 PCI658 PCI661 PCI662 PCI671 PCI730 PCI733 PCI735 PCI740 PCI741 PCI745 PCI746 PCI748 PCI750 PCI751 PCI752 PCI755 PCI756 PCI760 PCI900 10/100BaseTX961 ISA962 ISA963 ISA964 ISA965 ISA966 ISA968 ISA1182 SATA1183 SATA1184 RAID1185 AHCI540 VGA530 VGA551155125513 EIDE5518 EIDE5571 PCI558155825591 PCI55965597/5598 Host6204650 VGA6326 VGA6330 VGA5597/5598 USB7002 USB7007 FireWire7012 AC977013 Modem7016 10/100BaseTX7018 Audio7019 Audio7300 VGA966 HD Audio83C170 (EPIC/100)83C175 (EPIC/100)FDC 37C665FDC 37C922Voyager GXLynxEMLynxEM+Lynx3DMLynxELynxE+Lynx3D910Victory66 IDEVictory66 ISAVictory66 USBVictory66 PowerPirahna 2-portTulip, power, switch extenderFPGA I-Bus Tracer for MBDSZB6120CXD1947A FireWireCXD3222 FireWireMemory Stick SlotRS780 PCI-PCIEasyIOVelocity128PCIO EBus2HMERIO EBusERI EtherGEMSimba PCI-PCICrypto 5821Crypto 1KCrypto 6KPsycho PCImicroSPARC IIep PCIUltraSPARC IIi PCIUltraSPARC IIe PCICassiniNeptuneSBBCST201ST1023ST202140XX4018A50XXNE-344S2P4SSpectrum24 LA41X382C10182C10382C10582C565 ISAMC322TC9021 GigEB2C2 Sky2PCTN3009TN3010TN3014DC-290(M)DC-690CDC-3x5UTerratec TV+Terratec TValueTerratec TValue RadioTLAN3DLabs Permedia3DLabs Permedia 2TSB12LV21 FireWireTSB12LV22 FireWirePCI4450 FireWirePCI4410 FireWireTSB12LV23 FireWireTSB12LV26 FireWireTSB43AA22 FireWireTSB43AB22 FireWireTSB43AB23 FireWireTSB82AA2 FireWireTSB43AB21 FireWirePCI4451 FireWirePCI4510 FireWirePCI4520 FireWirePCI7(4-6)10 FireWirePCI7x20 FireWirePCI7XX1 CardBusPCI7XX1 FireWirePCI7XX1 FlashPCI7XX1 Secure DataPCI7XX1 Smart CardPCI6515 CardBusPCI6515 CardBus (Smart Card mode)PCIXX12 CardBusPCIXX12 FireWirePCIXX12 Multimedia Card ReaderPCIXX12 Secure DataPCIXX12 Smart CardPCI1620 MiscXIO2000A PCIE-PCIXIO3130 PCIE-PCIE upstreamXIO3130 PCIE-PCIE downstreamXIO2221 PCIE-PCIXIO2221 FireWireACX100AACX100BACX111PCI1130 CardBusPCI1031 PCMCIAPCI1131 CardBusPCI1250 CardBusPCI1220 CardBusPCI1221 CardBusPCI1210 CardBusPCI1450 CardBusPCI1225 CardBusPCI1251 CardBusPCI1211 CardBusPCI1251B CardBusPCI2030 PCI-PCIPCI2031 PCI-PCIPCI2032 PCI-PCIPCI2250 PCI-PCIPCI2050 PCI-PCIPCI4450 CardBusPCI4410 CardBusPCI4451 CardBusPCI4510 CardBusPCI4520 CardBusPCI7510 CardBusPCI7610 CardBusPCI7410 CardBusPCI7610 CardBus (Smart Card mode)PCI7[46]10 CardBus (SD/MMC mode)PCI7[46]10 CardBus (Memory stick mode)PCI1410 CardBusPCI1420 CardBusPCI1451 CardBusPCI1421 CardBusPCI1620 CardBusPCI1520 CardBusPCI1510 CardBusPCI1530 CardBusPCI1515 CardBusPCI2040 DSPPCI7420 CardBus5634PCV SurfRiderR4x00TC35856F ATM (Meteor)R4x00 PCIToPIC95 CardBus-PCIToPIC95B CardBusToPIC97 CardBusToPIC100 CardBusFast Infrared Type OLongRun NorthbridgeMem1Mem24DWAVE DX4DWAVE NXCyberBlade i7CyberBlade i7 AGPCyberBlade i1CyberBlade i1 AGPCyberBlade Ai1CyberBlade Ai1 AGPCyberBlade XP/Ai1TGUI 9320TGUI 9350TGUI 9360TGUI 9388CYBER 9397CYBER 9397DVDTGUI 9420TGUI 9440CYBER 9525TGUI 9660TGUI 9680TGUI 96823DImage 97503DImage 9850Blade 3DCyberBlade XPCyberBlade XP2HPT343/345 IDEHPT36x/37x IDEHPT372A IDEHPT302 IDEHPT371 IDEHPT374 IDEPyramid3D TR25202ET4000w32p rev AET4000w32p rev BET4000w32p rev CET4000w32p rev DET6000/ET6100ET6300IGA-1680IGA-1682IGA-1683CyberPro 2000CyberPro 2010CyberPro 5000CyberPro 5050CyberPro 5202CyberPro 5252Santa CruzUM82C881 486UM82C886 ISAUM8673F EIDEUM8881 HB4 486 PCIUM82C891UM886AUM8886BFUM8710UM8886UM8881F HostUM8886F ISAUM8886AUM8891AUM9017FUM8886NUM8891NUS201USR9979023CP5610V961PBC i960 PCIV292PBC AMD290x0 PCIV960PBC i960 PCIV96DPC i960 PCIK8M800 HostK8T890 HostPT880 HostPM800 AGPKT880 AGPK8HTB HostVT8363 HostPT894 HostCN700 HostCX700 HostP4M890 HostK8M890 HostVT3351 HostVX800 HostP4M900 HostVT8371 HostVT6415 IDEVT8501VT82C505VT82C561VT82C571 IDEVT82C576 3VVX700 IDEVT82C585 ISAVT82C586 ISAVT8237A SATAVT82C595 PCIVT82C596A ISAVT82C597 PCIVT82C598 PCIVT8601 PCIVT8605 PCIVT82C686 ISAVT82C691 PCIVT82C693 PCIVT86C926 AmazonVT82C570M PCIVT82C570M ISAChrome9 HC3 IGPPM800 ErrorsKT880 HostVT82C416 IDEVT82C1595 PCIPM800 HostVT8251 PCIVT8251 PCIEVT8251 VLINKVT83C572 USBVT82C586 PowerRhine/RhineIIVT6306 FireWireVT82C596 PowerVT82C596B PMVT6105M RhineIIIVT82C686 SMBusVT82C686 AC97VT8233 AC97RhineII-2VT82C686 ModemVT8233 ISAVT8633 PCIVT8366 PCIVT8653 PCIVT6202 USBVT6105 RhineIIIS3 Unichrome PRO IGPVT8361 PCIVT8101 VPX-64 PCI-PCIVT8375 PCIPM800 Unichrome S3VT612xCLE266VT8623 PCIVT8233A ISAVT8751 PCIVT6420 SATAS3 UniChrome Pro II IGPVT6410 IDEP4X400 HostVT8235 ISAP4N333 HostVT8377 PCIVT8378 PCIPT890 HostK8T800M HostVT8237 ISADeltaChrome VideoVT6421 SATACX700 PCI-PCIVX700 HostVT6655PM800 DRAMVT8251 ISAVT8237A ISAVT8251 SATAVX800 DRAMChrome9 HC IGPVT8237S ISAVT8237A PCI-PCIPM800 PMCK8T890 IOAPICPT894 IOAPICCX700 IDEP4M890 IOAPICK8M890 IOAPICVT3351 IOAPICVX800 IOAPICP4M900 IOAPICVT8237S SATAVT8251 AHCIP4M890 SecurityP4M900 SecurityVT8378 VGAPM800 PCIVT8231 ISAVT8231 PMGVT8363 AGPCX700 ISAVX800 ISAVT8371 PCI-PCIVX855 ISAVT8501 AGPVT82C597 AGPVT82C598 AGPVT82C601 AGPVT8605 AGPVX900 IDEVX800 SD/MMCVX800 SDIOK8T890 PCI-PCIP4M890 PCI-PCIP4M900 PCI-PCIVT8633 AGPVT8366 AGPVT8361 AGPVT8101 VPX-64 IOAPICVT8363 PCI-PCIVT8235 AGPK8HTB AGPVT8377 AGPVX800 PCI-PCIVX800 PCIEVX855 IDEVSC-7174 SATAGDT6000/6020/6050GDT6000B/6010GDT6110/6510GDT6120/6520GDT6530GDT6550GDT6x17GDT6x27GDT6537GDT6557GDT6x15GDT6x25GDT6535GDT6555GDT6x17RPGDT6x27RPGDT6537RPGDT6557RPGDT6x11RPGDT6x21RPGDT6x17RP1GDT6x27RP1GDT6537RP1GDT6557RP1GDT6x11RP1GDT6x21RP1GDT6x18RDGDT6x28RDGDT6x38RDGDT6x58RDGDT6x17RP2GDT6x27RP2GDT6537RP2GDT6557RP2GDT6x11RP2GDT6x21RP2GDT6513RSGDT6523RSGDT6518RSGDT6x28RSGDT6x38RSGDT6x58RSGDT6x33RSGDT6x43RSGDT6x53RSGDT6x63RSGDT7x13RNGDT7x23RNGDT7x18RNGDT7x28RNGDT7x38RNGDT7x58RNGDT7x43RNGDT7x53RNGDT7x63RNGDT4x13RZGDT4x23RZGDT8x13RZGDT8x23RZGDT8x33RZGDT8x43RZGDT8x53RZGDT8x63RZGDT6x19RDGDT6x29RDGDT7x19RNGDT7x29RNGDT8x22RZICP82C592 CPU82C593 ISA82C594 Wildcat82C596/597 Wildcat ISA82C54182C54382C53282C53482C53582C14782C97582C925Virtual SVGA IIVirtual SVGAVirtual NICVirtual Machine Communication InterfaceVirtual EHCIVirtual UHCIVirtual PCI-PCIVirtual PCIE-PCIEVirtual VMXNET3Virtual PVSCSIVirtual Machine InterfaceP9000P9100WD33C193AWD33C196AWD33C197AWD7193WD7197WD33C296AWD34C296WD9610W83769FW89C840F 10/100Linksys EtherPCI IIW83C553F ISAW83C553FW89C940FW6692 ISDNLinksys EtherPCICF32APlatform DeviceVolari Z7Volari Z9s/Z9mVolari V3XTX3201-3X3201-3 (21143)CardBus EthernetMini-PCI V.90 56k ModemMini-PCI K56Flex ModemCardBus 56k ModemCBEM56G Modem724734738737740740C724F7441221PCI-ST32Genie TV/FMDVDZD1201ZD1202ZD1205D-LinkMartin-MariettaHauppaugeTTTechDynalinkCoregaRhino EquipmentCompaqSymbios LogicATIULSI SystemsVLSIAvance LogicNSTseng LabsWeitekDECCirrus LogicWestern DigitalAMIAMDTridentAcerDellSiemens Nixdorf AGMatroxChips and TechnologiesToshibaMiro Computer Products AGNECFuture DomainSiSHewlett-PackardPC TechnologyAsustekDPTOptiElsaSGS ThomsonBusLogicTISonyOak TechnologyWinbondHitachiSMSCMotorolaPromiseFoxconnNumber 9UMCITTPicopowerMylexAppleMitacYamahaNexGen MicrosystemsQLogicCyrixLeadTekInterphaseContaq MicrosystemsBit3OlicomSunIntergraphDiamond MultimediaNational InstrumentsCMD TechnologyQuantum DesignsBrooktreeSGIACC MicroelectronicsSymphony LabsSTB SystemsPLXMadge Networks3ComSMCAcer LabsMitsubishi ElectronicsSurecomNeomagicMentor ARCAdvansysFujitsuMolexMacronixEvans & SutherlandNVIDIAEmulexIntegrated Micro SolutionsTekram (1st ID)NewbridgeApplied Micro CircuitsTviaRealtekNKKIO Data DeviceInitioCreative LabsHighPointSigma DesignsVIACogent DataSiemensZnyx NetworksAcctonAtmelVortexEfficent NetworksIDTFORE SystemsPhilipsCiscoZiatechCycloneEquinoxAllianceSchneider & KochDigiMutechXircomRenditionServerWorksAlteraRicohCorollaryAcardZeinetOmega MicroMarvellLite-OnV3 SemiconductorPinnacle SystemsAT&T/LucentDolphinMesa Ridge (MAGMA)Analog DevicesZoranPijnenburgCompexCycladesEssential CommunicationsO2 Micro3DFXATMLC-CubeAVMStallionASIXIntersilNortel NetworksSilicon MotionEnsoniqTransmetaRockwellDavicomITExpressPlatformLuxSonorTriTechAlteonUS RoboticsNVIDIA/SGS-ThomsonPericomAurealADMtekPacket EnginesForte MediaSIIGDTC TechPCTELMeinberg FunkuhrenCNetSilicomLAN MediaNetgearMoxaLevel 1HifnExar3wareTechsan ElectronicsAbocomSundanceC-Media ElectronicsLavaSunixIC EnsembleMicrosoftOxfordChelsioEdimaxTamarackWorkbitAskeyAvermediaMSIAironetGlobespanMyricomVScomAvlabInvertexBroadcomPlanexConexantDeltaMyson CenturyTopic/SmartLinkENEAralionTerraTecSymbolSybaBluesteelVMwareZoltrixMellanoxAgilentQuicknet TechnologiesNational DatacommPacific DataEumitcomNetSecZyDASSamsungAtherosGlobal SunSafeNetMicrelVitesseLinksysNetoctaveAltimaAntares MicrosystemsCaviumBelkinHawking TechnologyNetChip TechnologyI4ArecaNeterionRDCINPROCOMMLanergyRalinkXGI TechnologySilanRenesasSangomaSolarflareOptionFreescaleAttansic TechnologyAgeiaJMicronPhisonServerEnginesASPEED TechnologyAWTFusion-ioQumranetASMediaEtronFresco LogicTekramTehuti NetworksHint3D LabsAddtronNetXenNanjing QinHeng ElectronicsIndustrial Computer SourceNetVinGemtekTurtle BeachMosChipXenSourcec't MagazinDecision ComputerQuancom InformationssystemeIntelInnoTekSigmatelAdaptecAtronicsNetMosParallelsTigerJet NetworkEndaceBelkin ComponentsARC LogicINVALID VENDOR IDcy82c693_writecy82c693_readcy82c693_initcy82c693_init: bus_space_map failed (%d): broken match/attach! : unable to map device registers : couldn't map interrupt : couldn't establish interrupt: invalid memory type %d , using %luK of on-board RAM, can't map on-board RAM: can't subregion offset %lu size %luchannel 0channel 1configuredwirednative-PCIcompatibility, %s %s to %s%s: %s disabled (no drives) %s:%d:%d: bus-master DMA error: status=0x%x %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x %s:%d: unable to load xfer DMA map for drive %d, error=%d %s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s: couldn't map %s cmd regs %s: couldn't map %s ctl regs %s:%d: bogus intr %s:%d: bogus intr (reg 0x%x) %s: couldn't subregion %s cmd base %s: couldn't subregion %s ctl base %s: couldn't subregion %s channel cmd regs %s: port %d: device connected, but communication not established %s: port %d: PHY offline %s: port %d: device present, speed: 1.5Gb/s, speed: 3.0Gb/s%s: port %d: unknown SStatus: 0x%08x %s %s channel: cannot allocate channel queue%s: %s cannot allocate channel queue: unable to map BA5 register space : DMA%s: couldn't map native-PCI interrupt unknown interrupt%s: using %s for native-PCI interrupt %s: couldn't establish native-PCI interrupt: couldn't establish native-PCI interrupt: couldn't map bus-master DMA registers : couldn't map IDE registers : DMA %s: channel %d: cannot allocate channel queue %s: couldn't map channel %d ctl regs %s: couldn't map channel %d cmd regs %s channel %d: can't subregion DMA registers %s: no known timing values unknown SiS IDE type %d %s:%d:%d: multi-word DMA disabled due to chip revision %s: no compatibility interrupt for use by %s %s: unable to subregion %s ctl regs %s %s: cannot allocate channel queue%s: %s %s to %s mode %s: %s ignored (disabled) : no DMA, unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers), (unsupported maptype 0x%x)%s: unexpected PCI function %d : 5597/5598: unexpected PCI function %d , (unable to map ctl registers): cannot allocate channel queue , %s %s to native-PCI compatibility %s: bus-master DMA support present: ATA133: ATA33: ATA66: ATA100 (unsupported), (partial support)not responding; disabled or no drives?other hardware responding at addresses%s: %s ignored (%s) %s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers %s: restore for unknown chip map %x unmap not yet implemented for this chipsetpciide540620630630S633635645645DX651652655658661730733735741745746748750760962963964966968port 0port 1port 2port 3: can't map mem or i/o space em_rxeof: NULL mbuf in slot %d (nrx %d, filled %d)%s: em_dma_malloc: bus_dmamap_create failed; error %u %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_load failed; error %u %s: Unable to allocate rx_buffer memory %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u %s: Unable to allocate tx_buffer memory %s: Unable to create TX DMA map %s: em_get_buf: slot %d already has an mbuf %s: unable to fill any rx descriptors %s: The EEPROM Checksum Is Not Valid %s: EEPROM read error while reading part number %s: Hardware Initialization Failed: mmba is not mem space : cannot find mem space : cannot find i/o space : flash is not mem space %s: Unknown MAC Type %s: Unable to initialize the hardware %s: Could not setup transmit structures %s: Could not setup receive structures %s: Unsupported media type %s: watchdog timeout -- resetting %s: Media change is blocked due to SOL/IDER session. %s: Unable to allocate tx_desc memory %s: Unable to allocate rx_desc memory %s: EEPROM read error while reading mac address %s: Invalid mac address %s: PHY reset is blocked due to SOL/IDER session. %s: No GCU found, defered attachment failed Could not write PHY the HV address register Could not read data value from HV data register %s: phy read timeout: phy %d, reg %d %s: unable to read phy %d reg %d gcu0%s: init failed, error=%d : can't map i/o space : can't map mem space %s: timed out waiting for BIOS %s: pre-2.0 USB rev : can't map interrupt : can't establish interruptpciide_machdep_compat_intr_disestablish calledpciide_machdep_compat_intr_establish calleddjȍBҁB>jȍBBjjȍBB8>jBB%l>jȍBB>kȍBBܖ>HkBB7>kBB74>kBB7H>kȍBB>kȍBBX> kȍBB<> kȍBBX>4kȍBB>TkȍBBT>hkȍBB>|kȍBB>kȍBB$>kȍBB8>kȍBB>kȍBB>(kȍBB>\kȍBB8>kȍBB`>kȍBB>kȍBB>,kȍBB>`kȍBB>BȍBB>kȍBB>kȍBBkkBāB9kkBāB9k kBāB9 k4kBāB9Hk\kBāB9pkkBāB9kkBāB9kkBāB9kkBāB9 k$ kBāB98 kL kBāB9` kt kBāB9 k kBāB9 k kBāB9 k kBāB9 k kBāB9( k< kBāB9P kd kBāB9x k kBāB9 k kBāB9 k kBāB9 k kBāB9 k0 kBB D kB؍BBE k k؍BBEkB؍BBEkk؍BBEkB؍BBEk$B؍BBEkXB؍BBEkHB؍BBELkB؍BBEԦ?ܦ?????"B 8/t%x%(+t=+s%`2̨?  H ' 4' X& & )+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuw ! ? dD T O `/A$ D x t , ̩ DBH=B%%K$X!W!tF!?VVVWWWWW XXXX[[ \\\\]]]]] ^^^^__ _ ```` aaaaa ?H?#4######8#0##ĸ#####Ĺ#ȸ#########X# #t#T#ܷ######ܷ####t#\## # @ @   ) 24?      $$%$T$$h$#4 $0$\#`###<#d#####*$T*$$P$##($&$$ ##$$*$0($$ $##&$@&$$#### @ @   )T?@T$y$ Z$I$t$(t$=$o$d$`>$d>$>$>$?$l>$C$>$>$h>$d$c$r$$t$>$?$ b$`$r$t$=$O$c$$>$A$ @ @ @   )X$$@$?`$<$`$@$D$x$D$d$(WEVrdroot2.5M@vC/[WEV  08`wAQ<  swAQM` /mntO~  wAQ`@@<@T 08`swAQ<  swAQM`[~ [~swAQ`@@<@TU wAQh bwAQ`sA twAQwAQnQ5wAQnQ5h2uIAtwAQp twAQp twAQp a#MQAtwAQtwAQtwAQbIeAtwAQ'twAQj wAQ,px 3&MMwAQeJ:wAQTwAQTc0N*wAQ횩wAQ wAQ i$rEpHwAQTwAQcwAQ_Un;wAQwAQ wAQ_U # #wAQv0 wAQ)$wAQ)$ (08@HKMFIޓ]EXtMR~lfXCFΛie<1o7RH ;YG3,N,ɸ~c<x$OZN7ȣ?ұG<SֲT]B@!yͮD*F@B8QA,HwP3y#E}ϒYepz`4`V-gzw-NDIyMքv GG!5bh^ӚO9 6 hcy@H3a$ţg =>rUp8LoENQù$xz!zt-!7 f_o(޴e,_S֡^&bqf\v[+,f'iO /7W};vr{W"cAF.v+mR1bL?CrqoJRIN3sH  OQBUnb+*`qI?p` *NF@ٽ}<z1BOR[vُVc,Jv;mKVM4L%3zu'S4b[rؾpxB=͠uw ... ... export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- $(dmesg | sed -n '/^root on /h;${g;p;}') rootdisk=$3 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo ! : > /etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT while :; do read REPLY?'(I)nstall, (U)pgrade or (S)hell? ' case $REPLY in i*|I*) /install && break ;; u*|U*) /upgrade && break ;; s*|S*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi  . .. bin@ dev etcA mntmnt2BsbinԢ tmp usrCvarinstbin.profile1 install.mdupgrade install  install.sub md_installboot() { } md_prep_fdisk() { local _disk=$1 _q _d while :; do _d=whole if [[ -n $(fdisk $_disk | grep 'Signature: 0xAA55') ]]; then fdisk $_disk if [[ -n $(fdisk $_disk | grep '^..: A6 ') ]]; then _q=", use the (O)penBSD area," _d=OpenBSD fi else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in w*|W*) echo -n "Setting OpenBSD MBR partition to whole $_disk..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return ;; e*|E*) cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. Inside the fdisk command, the 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} [[ -n $(fdisk $_disk | grep ' A6 ') ]] && return echo No OpenBSD partition in MBR, try again. ;; o*|O*) return ;; esac done } md_prep_disklabel() { local _disk=$1 _f _op md_prep_fdisk $_disk _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ; AUTOROOT=y ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel $FSTABFLAG $_f $_op -A $_disk return done fi cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel $FSTABFLAG $_f -E $_disk } md_congrats() { } md_consoleinfo() { } #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED." ; exit ; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED." ; exit ; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!" ; exit ; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startftplist munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!" ; exit ; } mount_fs install_sets finish_up ELFa(4"4 (hzhzhzhzhzMMHH88MTTTۣehzhzhz$$OpenBSD -LP@0! MP@ -0L@ 0pS`0& 0 /R0 R S000  P P00<Q  A P 00  000PL t2 h0-L` 0 R   1S0B@Ct1P @D0t0($<0< 0 R-L @ R0  0S00l2 -x@x @0LS ``00T0H 0S 800S$0h(8|2  p-L 0P `P dpP B@POU8 h (4PP ]㔾ldz -PLU`p 0S /t0PPQ @Q GP P0 Vizl Pp-L@P`D ph0,0d -Lb@ -"L<MȂ0r"`8K01P@H =P  P0Sl b`Ÿ X08@ sG P4  0` $8 000P  10S000 B 1 0S0 Sb10S 1!0!0S !l 7000@1@1@0,10S0(!1 P R `@T00SRT!0z?$0S 0S  0n?$0S 0Sl 1/b(K, (d4Xl ԛhԎ8T| -LM K `p@Pqx1 pe 0SM bR KR MR(mR wR kR!$+%$+*$&U'T$0@P 0 !$/UT0 0 @P 0xS S *Sd1#pUT D0"@7 04a 0 a@P   -L0 $, -L0 $d 0-LMK PUp@1 e 0S7 bR KR MR mR wR kR$%*T0@0 !P00 @0xS S *S T <0"@ 0,Ha0 Ca@8   -0L00(d -0L00(, -L0| -L P00 -Lx0 -Lp 00d,%0 R0 ,d -L ` | -L ` | -L ` | -L ` | 0-t0LP d0  a0R00BAq 8@0P 0R0 : 0,d -L1P``8q8L  XoPP  / (0S dP00OU0@0V 0000 00 0U0 0 0 0S0|0f 0  `c`e0 f` R*Rb;0 00d $$ 0-LMPKdP \c0: S D4 K@CP0: S S000K0 m @ -DL8P40  !HPD40S0o DP4000 T0$ |4HP 0d `4H$G0000S|TD $ 4 0S 0@`9Pc0S 0R9P 0K9PGc\hS $0   $0 <0; S 0 @c$ #"Yc0$c`V _ ~'D$D$"0spw R 0Sj*0  Q : 垭P X "0  db\a0 0K( a0 0 0 0  P0 0 0 0000000 0 00 00` 0 B00~0 0081А(q@00Cs01 1R0R#0R 00 l R R *p bQ {90 00$00S::,(>|Ddp(xX@ Ԏh -LsMb,K~$ (0 b,0P a,  B=9, =( ,(0  1c@(P 0 0pᨵwOKP PP0p!dpdPP8L@ > H R 818R^OKd0 !8D@ >@ ` R 0REOK$KQ0d 8(@=$,0(0<;@0A d0  0`K $Kq0dP P8(`= $LKH$K.A?؝ -LhD -L⽑@`뺑@ -LMpa0@ 0P$ 0$"JpLq  G@Pp: 0,0 00 K3KAP7 a "P$p0 K03K,p Ap   l0P@PX`$0 p S  0S@P$0S 0S(Kdm  -8QL0s#P0 @c$ #"0"Jp8q 0 30`p @0( ëP0 `V`@ Pl 0S0C0T]P 0  Z <-_ `0,|P(  -LB 0B㴸l -MLM\"0`p( ,4 4"}|p, R0@!S!Ԟ̞ĞT!P|pt1 aARB^KPEPE@粝PH ,4004 4 J>K 0C8t 4 D , )jP20-S) \РBKAL L P0 0$RpB.K0 B Bxpppp~0H\0<$N` $H`hzp((tT| -LM@pP4  PP 0S nS6 =`P00QD @ Q? mP 0V0S D 0 YppV 0`pY" 0 0 p 0oSP00,K 4,0@S00?p @ `J\0 p00؏0"S 0(;\$P 0 03\bPl$4 -LM`P0P( @(K,pK 0 g(0@S /$K_ -0L P[zl -LMP@`0poH U@ 0S T f 0((+nl p-LP@C`P P@4_p lP@n]@  -2L`M2\Ÿ\[\ @ll2` @P> 0 00 , P  0 p1/ d`1 R+ $`@P,@T P0@ ,P P`q 0K9@P9 0 0 `p00Kƙ(Ko忙 7@P 0w: @ < 8K0p: 0PKZ7`pT@ K 0` p圙`Y@|Oh -0L MPpP`+0 R ; $0  0x0 RW @PP $0UNK K$K RD\<@ 00 @Sԡ  ̡ p-`PL& 0S# nS$ 0 @@,P[10PP@`00@,Pp4Y0oS0 ` ]|0 0-t0L0PS Q @Q  /P,0 r300 R00| -萟0LS0 R) ZPp`0@S 0  |P |0@\. 7p Wn Aq]0 Ro| -LMp K݌`P @PUN APP -LtM`P#9xp/ P0@$S$İ|l\<(# xp3#Q 3 R(K ၌P A0pS he0P( PPKp Po0: S S` 4(BC\Pf`2 Rf (`0 d |PE pPWi q(`@P8PXUN Xd1 RX  w3˳1 RW1b1 ^|1 Z|1 t1SD1 OT1 D1H 1 D( ( | C{(0AjPPY(`,{0 Rb 0 R^ !{Zy  w3r(` `X[ p}<[h(|( Ȣt@ -BLM0 j 0`PP\%H2R  0`P $K\%2R004  000\%1RN = 0@8P3o , ( F,,@K0d @P,@ (P @P<@md@d_ .,@K004`Vp0@0S@0 @, 0C@$0(@,0 @\@`@0e0PZ L20Z H2| C(d  80&`p<(@dl4_@TP0  R0 0, 0C@$0(@/,0 TTQ -tMLK 0@CP#81RL0S `f`0R30 @0@c3p(30E`3` @b@cP @P   0@Q  0@$0(@0 ,0 \0`0D0PZ 1Z 1| SQ  -PLP@@P G*`P @P |PlpP \PDP < 0y$y,04lp8 -L 0똣l -LM@`CV$ P$pKVh P 0S -SD01!@!=P0@0@V@b  p-LMPP` 0Sm@7*x5@5@@/P ( 0 @`0#*x Y$ 0-\ P0LS@ 0S  0S 0S00| p-`PL& 0S# nS$ 0 @@,6P-0PP@`00@,"Pp4U0oS0 ` |Y|0 0-t0L0PS Q @Q  P,0 r300 R00| -0PLMP` Pp$ ` @$KD5 j8`p`3$@0&T00S})b -LM` KXpP 0PP> U @PP@ -L0Mp| 0,  0DSH  `T 7 R P R   0S`7V Д00@T0TWS\qP\1L' H700W@ T嵔PPL7Q`' V妔\! 6`V&囔\!@ 6`V&吔\! l6`Vd&\兔\! `<6V88T&z0S`!`! R 6`V$0&j0Sd!d! R 5`V0%Z0Sh!h! R 5`V|0%J0Sl!l! R D5`V<d0h%:0Sp!p! R 5`V$0,%*0St!t!R 4`V0$0Sx1x1S TD`V$ 0S `V1$l!!|t!pdh4Vd, 0R(K0SJ 3`V($ݓ\!@ɈP% `V ѓ)0D#3` `3V\0Ó04SS l0F@KLKL0 0.0K崓^P pYPP `TPo0Si!R] 2`V,ß(0 #P蓓0S!Q t2`Vl0"冓1 D2`V<<"{1 2`V"p1 1`Vx"e1n `1VX"ZePKLKL`1PPVxA@00"PGRXP!B`W^!1R!P!1 0`V!%1 0`Vl!1# `0VL!8P0S D1 `@0V<!4{@hz,|@l,lhtpxȤФؤ |HQ4UD\l8T@PX< tdl,ܟt| -LMMß |KpG`pG , P@ΓP #T@U (`DP^ Qe@*PP K@A@A <0 f: 3q A R t:S@m:@S Sn&&Ÿ, 0R(K`p@i PLK@Dtb@DE0h"!-@J\0S 8 wT0SQ0So P?`KVPYMKZ YPK  RPP1 R IK A0 a&_& KA A P<:#41 R0SQP@M#TA&?&T}P V VutOKVPjTe pShEdS[TUhzQ.ܥ~̥ܟ|0s -AMLM6 `Pp, &IqpJ A0@6S6\4$-P^p%pp5 `bA0V84 Vm VZ @ #;`P PDP $PP PP (0YP@4 sPnpi4 RDP`t4 \HPW4pR84 RM pIPDp?3 ;963 R `84@ 0@@Z00S WP; Ꭼ`3 RZBKHHӑP (\PI P@0 0  EP *P 0DP|0 0 04 2 0@PP B.K B BxP@4Ppp_ BK@@㝄`Pa gT:PP7 @P P P 84 P`P⨑n($P`hftP@T@h@XsPx D+T9PP849PP84 PP9PP0D{0S  T84 |P P@ PUN 0|P 0pShz@ܟ(T|(8$<\P0,|@h0s -L. 0#㕫뤨l -GMLp1M ha d!@0P$4 @![op oP: !Rop 0bSQ`A~K pG0pG4 崐P- $$004 4 =K 0C0C 0]PP -P P| n0$\OA.KP0 B BD5 ,eShz(,Ԩ ,ب@(| -LM@pP4 'PP 0S nS6 =`P00QD @ Q? P 0V0S D 0 YppV 0`pY" 0 0 p 0oSP00,K O,0@S00?p @ `eO0 p000"S 0(VO$P 0 0NObPl$4 -LM`PKP( @(K,pK 0 g(0@S #$KR -@0L R  (0(r 0lPh -Lpd000p3 P@@0PP``0 &np kP` sPP aP`  npt0 RU `- Pq) 808,.qQz|x( -L nl@-0 S R@4 00 ӑR^ ^R-0S \ Q-0L Q* N |Nԫ -LMp@` $K7rP0S 0S $0 UR#U 0XN -0L 㣩zl -MLMp0,0 /ompI B0@3S3 D4hD0 p X4|> >~> > .%mp. 0b0CS/[>KQ0C 0C 3"p g>K0C 0C6 RP<ϟ@T |6: S(  S plK`F `F@ H(pW@ԭP  P @TDP Mx= =%=^T= p=l= d= R$=.L=H=I=t.0=,@<P.<> =7<,2<.<<)< << < P< << <  < t V5  U,@ P0@X S P P 0J Q  ]|^ \ P Q U e/ᨌP 00BR SP 00BR SQRG  00B SQA `RCpRAqa@B 9 R.R600U0pup3S Q &R&  5S 5S]K 2.p t8@T2 RS DfJ 3'6q0#0P` UJ@ 06 &Mhz`~( (HTpԭ$(,048<@lDH4(,2\2P<3l/@t edA44UQ4pȲԲhhz`H L `\gfffX( ~tA440X$P̯ ԰бP\ SV&0I6 S F %&T)`I 6!&a 0 . `& @P 0 2" p0! ) ^ 1 6S12S \ 2^0B0 S&& R 0@, & l& ?&6 `@P p! 0)@@T@!^1: Q0 &R0:S P3  3Q2S*& R,C 6S<3B@6 L!!X  1l6ttR 00 T@塈5S%%R005  P0Lc5 0S 05 Q5 5 % & 6倈Q,|Q8x@uQLqT%5lQhh5S%a_TDPWUQP :d$@T , 0RP(K H H K@ @g5 K@5 {8"pP9 % R%6"&  P660X*l0 ^PPS00SB %`5R> P;X9:@X2 &0ST#3*&婖p  6PX&  \ 6S X*cQ&%P50U&00Q* ^ 000S 0@6 # 06U0 $!4060!40 4 05 0!4 0  40 ,40!̠!4!05#Ƞ##0  %$0""Ƞ"$ %@"̠""    $ !$ )0` (00ST 08 4  (088 [NKR@Dd@D%6|(+" 40S66 { &Vp 6P &M"GX 8Q  ( 520#$ 0 0 P0C"$ "40 && t9  0@!Nav. 4 0 %9R X2 5S X R 0SR0aA006 6 r0CC C C C CCCU B!!!Ƞ C CCC CC  0C0 [0C*00S @T %&U0& U 0A Ah 6#U #j[NK@D@D68+s!&P J00 5 % \6 S(+u 5S,+m 5S0+e %?RR5 c02?  5 % G Q(<Ps 5P n @ S%X<T E I @ .6S =tPPM&F<Q &Rp5F0%F%8J<R 66  Qk T  Uy,%F8F D0F PF\Fd0FpFxFT 0xF tF tI&0jF&IcFA /#6}0#0P`6 S ^ʠ 68GF5oLBFPG \"HP@,8)p$#0plp  -LMxR p, `0 P 0LS 0 P~@~T   @Q @T] @a R_ ;         0 Qd ~@ X z #L v D %r?QPP  hU c _U YU SU  MU @  BU   @ 9U p 3U  \ -U L    @ $U 0   ( UN0  N U   U_@  U@ U U  |Ul 0`@  < S S 89U      U  U U0S m\0 `p \$ ^ 0 R AdPd␐K 0d'0 `K0p0' W \uZu pG\W KRuKPu, 0R(Kr0S k^0d ` R@ xY0S  `R^  H. G9,C ?@083U5  -@4)6% 8! U7 h@4 < S2t 9U3     @U/  /, 1 3 *0S3@T P`K0 0d$ @TP0xtld0/X  R2R4@hU   L@]U ` 579 ;.@? ;~ [ zU: @:pt<dp >Xl F LhU=  =8b B ,^U<   ;V@U  S?  SuJr u[X @ R @> ;  48 05  1stm@w'+\$"0! 04t  4KPIGPECPA?P=;P9Z帚hzLdyqpȿ$Lmxɾپ!@dh0Qaͽ5E|%Mqp`4DXyxYl Ⱦؾ  Ae!x<̽P  -0L 㓚zl -#L`M#0㘣p , 0x0 0S`pAPUH#M^p a0@S`X`0`K1`x ` Pxt K"P4Kx "PXqB&Px tkB`0S0 t 7` l h 0SD PKx@K 00 Q/ PP>P `000C S61|K |0`SpP @) { 0l0 00 Ql0S$h0S xD"P(, 0R((K` t c` (P  0l0 x?DPA[ax@p@chW`AXO>0 Ahz$(t@ht@( gt4@ -0L 0yㄙzlT -NMLMpp0S( `@pH P2P"L2Q0T INK@D@DP4: S3*@PG B^KPEPE0!@M PINK2@D2`1@D2=*DP0S> 1 R ~PO|1P l?( 0RJ$KIKAAP01 R4: SWq00t?m?Hq?00 d?KAAًP%4R%4Rh0 Rh `&q0S@A?0刘hz|J,t xL -LpMP@"\p1 F0@-SL4!41,1Q`$!  1Q\ ` \# \ 10pKUP.0: S 0 0 0 0 ^ YQP @P PQI (y@(P |tx0  -LP(@`w p~B@D 0T0@444t4444444444$ t0ol 0@8PJ  0 ,0[ 0W 0Sp=>P?> *Q-L QP!00(L\ ]\hPQè]0PSw84'<XPr]P X@ P Ph]PPXPPP Qx ^]XdY]\V]TS]sHO]PPP T {$X Pd  p-L M`0P0 @P  0 R#Kp 00B0 Sa0BSW0B? K Q02\ 0A@ $0KLA0BS70B hz M-LM@0T`pP T0P  t 0@T00 0 @$K  0-LLPჼ0@S0@00ᑼ0S - L@ᅼ0P -BML\< M @$ BK L, :L H D L 0'0LD$=PG LjP00LpP :P x 00`P<Vk a;P`KpP WPc p;@TdKBKJ0PJ _044 PSTH440LD$PHʟ@, 0PR(KrP=V4 % 0S!T 0S `T@]P44 4$  \UP44 4$   @ \@$T @$ 44HX0q \@40@4 j0gHC10e \/P*VY 0SV BKJHtJ 0R0X0SpG @0P 044 S H  [44\0`P0B.K B BAP 9V`P PH4 EH$ E4$0BSH(̑ [@H$0@ 8lP H\P  0D [@@ (PBKJ0J }044 S(  0v[@@ vPBKJ0J _044 SH, 0 T V[@40@4 ;;SH$( (xPBKJ 0J:044 SH$8bPBKJ0J $044 SH0}LPBKJ 0J044 SH$4g,6PBK@J0QJ 04SHO<OPJ PE P@ P;  P6 P1 pP, `P' aB0S0SH8X:XH`0B8̑V BK@J0pQJ 04S   Z@$ @$ W @0`Q 04S  dZ@R@ VH 0` 4DpP \P 4@T000C S 4$ 0 a4 04S   [Z 4$ H 0 H0ࠀXX XWM n@0 @pP`8 T4 \0 .0@p`8 Iw @@FwA@HX0`4t  B9P0  kH4R O Z@$ @$ ] Y@@ VWT  @0 P`p<$ F T 0 0@p`< v @@vA@H4t 0'4$Rle Y@@ jH4R O Y@@ \H0hC1 0S Y@40@4  Y@$ @$ hz ĵH8Q(܌Hhpt`X( -LMB0S007|"0002"000-HB0S00&{2~Tc @|TY?@TQ1 RE G\@0DSAe/Pgµ`PG >0@PD0@0- 18!0*0DS* e/PG,@P @@ 0&0 0 ~@Th l@3 \<3( (t$l 820P#! 0Q "-0 P`0@p` P0@ ` R VUQ -LMPP`0 ` TP4`@p080 00 R0  n  -LM@ pR 0P`PBT 0@n in  -LM, (0 @n 0p-uJ 0n`P 0pxn,K 0 XXX on8S P 0< 8PS$K$0< -p@LpP20` ````aPUP%P R8 K 4 80S##`@Bl\Lpࠀ@@@!0NSnS 9Yᘐp@  ` 0 @P@ < H0 D@ P L 8 4 0DpS:< XD0 SruX 0XKdckd @@ dA@@l4pl0P -LzM0 ,0 {'00'72 A P9`p@ ^ @00 0@  0@ Z 1R  000OO[P``4;D1 A 0@ 2 B   ! @r00@@Te/ K( K2ACt6 P 1 AT^AvK 00@0 @H 0K0@0 @ K!Rژ14p1  `1   c 1 Z ! `  0xP@0 0p ^y/K  R0! 1 1Z`yKd 0[  @A  K9@ @00@0 Z^^1A0@1 A hYJ R Q1SD ^ ABT;^9Py/K  R0! 1 2(@K2 @἟@a1 A SW%; U U (K0L1 0/SL) ! P ! Ke/B, 0R(KBQ 1K $ .P!*1K $ %0B 0L K d唬P d"Zm 0@Sm ^`r!/ 1 P@`p0W`RO {KQ  !  K @ P   R0S    R@PW 0SP !R ~V{KP`p  TNU0M0M 8b @GU`p!1`S {oKQ0ST+0AT |hz$4H - 2L(M 4 R 08 R (KP6 00C BC1  Pɯ* /0 , `p 0h!4d@P `p0a`vp v 40(@PU 0 a!   00 ,0 w 0rw 0iT?@ , 0@0ᖄ## @84 0@D~Ua @@0aA@@l0L -L(M280 4 400 , 8` 9ᘀ@\\@P`pP@p@ P04xx! @P0@K0p0pp* w1 P8 84 0P`0 10Z  0 R00V$/ ,0X%! 8P4O p徉q 0x h0h L0(K0@W0 K $4%Yxl0 -QL M, 3 aIZ00,0(Z` (Ko,  20P` p0@ (Ko,0(, $ 0 T`, (Ko6 88bP,0 (Kohl4p0 -$ML4 `)p@@0P\0XX"`p `p0Pp] xi 2 R B0  00蘮(Kf A0 SP40 @P 0P /0U T04 P ༙9@㘀p@ 0`Q 0 , 00K 0S@P`V00 ,@ :,4@0 O09 T 0 TSq 00Sy h0SQL# 00 Utl0 -QLM`N aP@U00? (Ur \9@ @0@00 ,@K$P K(` Khޭ5PPaPPP H<Kh辭 44DP(0 KhJl4p<P0 -LMPpk U a@Q00ϓ4 VQT4 "<  0S 9@ @0@084\20    8408#8^8<0 @ 0 @ 0  P `  & R0S  0P`  R0Stp p=(KR. D2D<4 8 8Q`P弙ᘀ4TPO24qP-80P`0(0 @ Q Pd&  VUR VVS U<04P4P 4P4$P @00 0000*PK0@ @00@000\00S a0*PK*0K 0)0KKPP h0tS{\ X@屬rUU{^ @4l0 -L M<G 0PP@@P!0 `p0 `p0 , 0 rT 7<@ 0@,@Q0 PG 0PP@@PDL1` X0K0@TP !p0 `ppP`+ 7<@  0@ 00KQ V$ 0KP,0``|dTP00KP0(K,0s\\0 (Koq880 (KoUD`0l -LnM0e/ K,0 t6t*]0hFh!dzP2 X傠P: Lf@P zPD p@PT`U  ] 5j]P` 5`0P@!`pV5 R`00CS`0X0  X0Ud\00@@V UP`8#8@00, P  ^*,@P0 $`p `p0p pw ,0@P0 $`p `p0p p} 08@P0 ll$`p `p0p px 84@P0 $$$`p `p0py pl 484C 0C`F ! R! _ 0SST 0P`@@0@0Q a H $0p`p@ p@ pQ    161({ |1-yP0@`@w_K`0@a0@TḀp+r?K 0S@ $@0Pot K !_0B 0S" 0H @P2 0<S0Sk* P0x.Ke/_)PO 0< 8uhz4lHd$0t -L*MgKJ0J e/ ,0 50: uP pP jP ; KAA  J PP[( K0S@ (K0@ @0@0 5 S:5 5S:5  e/ K e/K N:K@0@: J : ^  P @P |PuQUQ 0ApS|PLȮHܭЭ|xX,8dP 0`p: '@P 0STHK@ @H <p 4VPP  0WV  _ Ke/}PA 8P< NKKAe/ 37 RR M@   ~ P{ ǟ, 0R(KTY 47 Re , IP7ǟ e/NNK@D e/K e/e/K x l |MUR l(@Pl  0CZ `@0p`p @TP0,,@ P咧0 0  0僧nU @@ 0 c5 R  [ WWU $0N QK0 $TE PB z> 7: 7 3ğ$00s03S0pX' Ke/P NNK@De/ JKe/ Fe/KB ; 8 5dL04 R L4 R 2 44 ( zP3 @|#00@@T  fP~ Ke/ 5L(K0S (K (K@V0`@ N lß(Kh3开(KⳀ 廅Ką 弅KNKe/K@e/ K    3 R `00CS`0QX0  X0q0 |:K{*KX ;`2 RT2 Rf "&P P|"0000ӑyS PX"0000ӑnSP4"00ӑyP/ @pPYATA y42 Q P>?VU@@Tʼ!000PUH0 SX QH0SE MH0SA IH0S= TU@H{?<1 4t?$o? 0Q 0O Q EP@`@@H0S H0S H0ES0X@0yHT 0P |?@4?00hp`\ԂPd$ -t0 l0RL T@ 0 RPG G?`\p p-LMP K`@KP1Y!0P/T  @ } 0RPKpT  mk@@ (w t pxX8H\ -L$MePpEx5tp5 llu d%d5P$U  %P4p 5Q ~0STP P TPd0: S   S  S00  0p 0Z0X4X$T4L4Dq G0S0C00Z0 P6tU #fPF0#h>Um t#VP00pn P3Q  0SdL3L# 03 (K# <003 "?;00Zr H2 ARRŸ:0Z P% 2 ZN 8pxŸ?;0P`? 0L L9 T2@P`? uv ;0Z 2?+ "2 P1!1 1!0,H KP00Z00V;;S\ @1`V 8p ?1!``0Q 0 v5F0 =.F0 =L'F0 =X0 Y= 00 KF\ 0x =pЂt` |hpm @x  -LM T0St0Sfc0S3 RCP$K Q0S 3 R 0 0R R3 KtC 0 S `#000 R HS0S@ <3 R(00CS00  000`V 2@&P[2@0} +0# 06rM00d2 Rl2 Rd `2 RxL00CS0~0  0(24 a*0Sy BPs0: So<08@@k1QR@f1!11 R^ XAP[#NXŪP;e0L9;NK@D84;NK@DbLP*; q0S 00%P000 @0@0:hz\t (p`dЂ| Hp 0  PxЄh<X0l -qL R Q3!  0 XRO PAx` wP`V 0SDQ@%@1S!#100P!0!  0 P " PZ `Z `FVڌ Lf lR:`0 R PI:8 `00 R  =:ꘂԂHЂ  -LM衟 0, ؑ0`PpH@ 00 T0$P1= 0S, Ut1 RI d :PP @ T 00p34P9 P6U0 R5 9P0@00  ,0K8P P@0S 000(K 08PH989(9ԂЂt -bML,Mⴡ0,0 P70DP10 P,x1 R.㌑b}K(pG$pGTP0  0BS'|)P +P2 DPK`<0KP0( =&, 0R*(K$ P Pb]K(PE R,PE0 <P`D0K(P'P  fihzԂ  -ML M0,0 vP=0DP70 P2/P/5 R /P( b}K*K(pGH $pGP0  0BS (P ,DPK`<0K1P 0( J.?&, 0R(Kb]K(PE R,PE0 <P`D0K7+PXD0SL4 RM(PV'P.DPK`<0K\K(PEPEP0Sx 3 R}( 0SʢS0S3 R LK(@D@DjP0Sj h3 R ( 0S0 0S<0S S(3 :KHP P P00S SJ 0CSDPK`<0KX0S B0S 2 Rt"00CS00  0000S3 0S0 42P+ @ "t8%1 R 0 0Sc)( 0S^( 0SG@PDb]K(PE,PE0 <(0S dA0S X1 R=@!00CS0>0  000X`D0K'@ 0 '8v|00 a-zDPK`<0K-|g\0 `0H0 [0 o0w l0hzԂLD, <HT@  -L%M$MŽK5HU@(KHd%,@ 其 P-KL' 0Z/S /0 0 0*KL5%K(II ZKLPnKHD0: S n7, 0R (K.0[/S `7 @0$79.PP-PT4 RmK(`F(`FxP% 4 (K )PPt0S3 R5 :KH5@/Q  KHP !7RP  Hx,, PPt0Sx H3 Rx a=( Q0 <S@k/P%P,:KL%!$PB0S2 R  P0Su 2 R a=( Q0 <S`R0SBTT2  Q 7 P 4<S S8 0CSWP[0Sc A0S_ 1 RK!00CS0Y0  000M_-PF"d1 Ra=( Q@ډX1@1  p(KP$@P'( K K(A,A/a=( QڐfZ0 .7,? <6UK(A,AO .hzTX xLD, 4<  -L Ml 0,0 p@WP P0,P2,$00Q. `;Pm(P3 , Q# .P\&P V 04  3 R(K,P;+WX<30 SS S c$P,K+R P, {>0"5+2 R6R0S S=ڜ2 >"000 P60S \R0S P2 RO4"00CS0r0  000,KI`p-P,xPU~N,PM11 0,4 K@,K`#0S XQ0SV^4KQ..PWb=0Q!&PO`20 -,K+@0 R 00CS00  000P`P,K! -@0 - -ԂLDh< -bML$Mx0x@ R  h.P P L0 DPb K@$@ 0RK eDhzԂ  -bML$M 0,0 @P T T 04, 0Rp(K0DPA0 P0SN0 XN!0Sb}K(pG$pG h1h ` b}K(pGT1 $pG r-PX r,PDPK`<0KP AP&P0S 0(@P0*wP0S @0S ,-P+P8 D0 X00(qdhzԂ$DtT<p 0 0? !| -T2LMR`u<0S1,4P}""0\ 0 0"Pl1!!0ȁPp P+0@PB 1 V PaB P 0O0@U <01j 1 U Pa`n,` pPoP` , `Q, 00 0Q ,P 0  `P0SPQ~8 @0 0@,0 |Ԃ8 -PQL`tt 0hpcPP@@ 0Pd0U`00<P| 00b0 -ĀL0S` pP@P 0@`Ph0lP/`T0 P<0`  `00脀|8 -QL`ڀp P P@@ 0Pd0U`0 0cPʥP eQ  -a=LpM00UpE``a 0 cR#?S 3VP/0@TP0U0 P-0 0 20(KR 0 P0TK Pa=p Q 00C h2T\;< 0< 2T; 0 2| -LM a a= 0T ^,  r  K PKX0S`pP0 >PU ?`p U@P 00Kڤ\,K  PU ? U?l1 R \1 P0#2P ,\ 0S4  (K:!0P20SKt P$ a=x Q 00C 010S :l 0d (2<0 R:$ 0$ 2|PlD -LM Qa  0p" ,0   K% P|X0S<0 0@W0 m 0 cPL@_1UC@ ,K  00KR PKڬ1 R000  PJ0 RZ0O`VpW' ,Q 0SE  W+ڰ 00 1 R `(KT@PPV0 R  B1V 90T s1<0 }V,0 R hP Q-LP`.Āp 0cP 0OT @  ?PU`V S0U 0cP,0PP| 0-D0DP LP0,@  `0 0h| - LM q00l ?S 0P`PU`@00(KR`1 ȟ 08 80 4@ !,0( K@"4@@4@ 8K8P6 000KP`PU`8KP` V0 0bQ  Q 0PU`0V0ʴUP QP -@L0S< 01 R; 5P=qaPP RPR $P PP 0@Pڠ0/0P0 l0PPPH/PP 0@ꀀЂ|4 -@2L @RPv("0S "00000aPv0 0bȟ` 0 !F!#PY(% &P@T PUJlta0`!0Q0:D0 R 19P/X@P`P0 00 0 0 0S @0  NP0 ph/ <D 00 00T8|Ђ\ -0@ 0RL0 0P00 0 0 R ? Rʂ;;S \< /P4?;/Ђ! 0-A!0QS0 L? Q!ʁ P$~ Q0 09P 0@ 00 ~<|.0 h?;.0 P<.0P0!Ԃ|$X 0-`@L0S 0HP0S 04|P000.ꈀ= -Lp`IPP0S 00SE  #0X @TМP0 @0S X \P00 0$ 0 ㅿ000 c#P(@PP 00T $00Pꈀ 0-`@L0S 0HP0S 04P000.ꐀ= -Lp`PP0S 00SE !#0X @TSP0 @0S X ߬?P00 0$ 0 000l "P(@P P 00T $00Pꐀ= 0-`@L0S 0HP0S 0P000-ꘀH -\qL0`SF D1#41C0b0cQU R$0S A0S U3 ܿP U@ $`@ _00㑾000ZR @@U 0$`00 L Z@P$@(@PꘀQ\o 0-`@L0S 0HP0S 04P000!-꜀=| -hqL0`SI P1"#200b100cQU R$0S A0S U3 P U@ $`@ ܫ00㽿000ZR @@U 0$`00 L OZ@P$@(@xP꜀/>3Q\oW|Q  @4S4S  P00q& -$L0 03 Py0F#0  0( PnP0N 0 Pe0V#0  0 PZ P^0 PQ n]PDXP? Po000c@`P300S S, S* S] 6b-  0@pa- p0P`@0S@b-P ``6 0q P_ T0 t(hX (0 P(hz0hqqT (,$ , -LTMs0 0 PP2b@ @0R2  0@`l@KSH@HHA 0z Pt 0s P \2 TL( 0R~K a=0A 0 P 1 4(1 0L P1  0D P1 0< P1 04 P|1 0, P`1$ 0$ P1* 0 Pa=0 0 P`; 0 PL^P YP00S S S S  HPT0 l'|`Wx(0 H'qhz0q$ (,$, 0 \hZ0 h mQ-L {P T mQ-L nP \ -2L pRPi nPbb0@ J 2 D 넢  > p2 8 \2 .2 H2a-0C 6 am` &! 2 > @ F 40@@1 N @ V 40@@1 ft1 ^P@n|P0@0Pn000c@07P 0: S  0@P`0@0S@P`   mPP` P`PU`0@Pmh (,H$0 KQ-L ~P d -PL`LPb-0 @ w\1 qH1 k4q e 1 _ 1 $Y0 *S0  0M0a-0C A aM@ ;<P0@0DP0: S 000 <>D?D?>>0""2 R D0, K(0K-P0,( 0#0\" Pb]b-0@ PpK| |@Dp 2 * RV  R,  R1    R 0!P P;01 1$K R1    R!  R`1  aL!0!00 +"P5'0 0 nh0 0S 00a͠ 00  00~PJ'0SuPC'X A0 | Ԁ؀!!p!P!  !8D! 0-0L R0@T P@T 0S0S 0SU 88B@T0 P܀lLS!d0 R00T0 RL0  D0 R80 R,0Q 0 @$؀Ԁ p-@PL` 0Sp?PP =@P0/S/0C0T 0SD0 00@ `PPPPpip"܀$" -0 0R000000L R0000 R0@00|0 Rpl0P PT0 RP(/dp`܀ L"@-PP:P 00S S R U2 /R/7R+ /R7R10P0C U P 0B0 SA@B0 7pB bTaBWB0 "Q0U S- L Q0000L B 0Q000B 0Q00P000BQPQL0 S0W0 ̕0̅  RL*G-MP : \ 00S S R 0 SY/QV7QpQ/Q 7Q 0AA1/Np 0\Ѝ Rp6p  RP"00NPo0A@N S@'.@a0N ɯb"T'nɯR'.0 0@ pS 0@ p pA- R`PN) \1>A P0 0` NA 0\!00 ` P0@ 0\!00000@\\N@0pXW0@ W@%2>&BP` PA:@0pXW@-@S1Q0 \ \ PT00΅ p-0LM @RPP Q `K0 2QKp @둷P% -0LXMp Q P@ a ^t`K 0@P0PtK4@K 0\ 0R Ka=@qtHL( (0T@@LPhz ""|"T  -3LpMß@0 ßT S, pP`$T2 R0 CR s00ϴ, 0R(Kp2 R T2@K fD2 R@u a ^뀐K 0@ `P2PK0C@1Po0 @P @@w!00CSBa ltA t0S'0 CR F0  0@10 CR 0,S 0S0 CR 0R Xy ^ 0Ͳ 0 "88"$#4 $a-0x8

g -= /0CQXZ] Q1pZ1@TZ plP0`VQ T=pPH`PxN:!P @ P,PMP%X= R  !Z `PVJ@6P\ x< p Ts@P <Pp=" P < -RZ < t < ,00 \xLAP040x+8< L< ,+00`D; x  R4 < I: ; +0*00*; *|; *l; *\; *L; *<; *$; : ; ; *000P+00@+00: *000`l: x*x: V): |9P xP=Z+@T @`PPU p VPPJ *^PPGP@9 R  Z PUJ P >P p*PI hr@P |)0Sp)8 X8 t0SH0S 0S P 0S70(KPkP8l8D(8 @Lg (' p 60@DScccccccccccctc\ccbbc@bbccdccbccc,_ccccccdcccccctd,_TdHdc8dcc(dd,_ccccccc,_$bbddcccdX&6V HPi4&5  & p  00@JSmdddddddddddddddddmdmDmd$mmdddlddlldddllddlpl\lddddddTlllkdkddkkkkd|kdjdj`jLj8jhi`ihdh;Pp00AD4D$05:LUDH0pK @p 4P@+ LH 05徭l4$ dH@zT 5H屭40 -R 0 Tq@PP᳇3 R 004l33+ @$00x#h3 3 $00 30#03H#00L3 "D3 4#43 #00(3 00"2 2 2 "2 2 2Pi[,@wPD@P }P !p0007x2 O>B  P!1 h" Q<L"0S(!x1 4"0SHii|i|ij "\!01@Q񟗲eeDfDff@P0 P@ RP 0 1P@0SP1 bt ((()$H((((x(l(`(T(P)$X))t* )8)0n9)SԂ))T)(XD)܂l؂@4@(L$  `dpP*,(0(**d *(( 0Ђl*)($#8wP1 R (Oy R0t0 0 0 x0 y@P  P ! Rh 1R B P 0 0/U!d1 4QAH0pK @p 1P@  T12` H@~xT 1<BP2  `B0X000X0+PP*B0X<00X07PB0XHH! 3 3  $3  2+P20 R @a0BSlkjjjDkjjjjjjj4kj$kk Rc3 3 4 4$ 4 $04 <4  DL4 〠 ?\4 @ :l$l4 6t4 1P4 4 +4  &4  !D4P B4  5  5   5Pl,5Pd`5  x5 5  5  5RPI5@WP5   1j5P36  $F$VQ^8 `0@0X6  l,``&0 0 R 07 ED6  0w@6 @0 S:&w (P6 R00CS010  0 <HD'0 0\\'0 0l ! P |w  p  o kdC p-0@0?PL`A PQQSp[P$ 0QSA?P0QSp*P0*S0*S S 0S P P 0SQ\ 0!SPPU0]S@ S -R \0]S@^ T P ]P \@\ 00 R /Qp$ p-@PL/Q@d ^`\0Q\0@0CR0QR0@00p 0p* p-@P`L 0P@ 00CSp  0Pp 0-\0L@T P @@v@T 0UP0ĂlLS + -LcMK M <KK(@D ,@D KK(*K, K$8 _ KP b-K( BŽKHK(B:K(H K@ KKK8  Px3(K -KY X1 p! * p00Q  X #R X[ K*K0* R &R@P \R  U+* R( &R@*K80/S89S6 K00CPaK2@0Q S``V 0eVO PB U:hPEK"(K00a Xp 0S  K@0 S@  X$:0 X0H KQ *K(0 -<[SL:Kh(d=u-<[S<, 0RE(K0 X*0S:K8S K(K:KK A(吐KT"K KR(/0S K\  K>K(\ 0CK>K@( 0C(t,A-Khz Xx+l8+T++  -MLM`s0\cP$0 0S0S 0/SK0S.00 @ 900C00S2 ;0S2P  0P 20SSQ SO 2 R0$ 0R KK @ <B0C<0S0S  HP=80Sq  ?P480Su  6P+80Ss  -P"80Sq 0  ,0 "P PP"00CSa꠆x P!P1 KQc v@0KH0 D@ @0KH0 D@ @0KH0 D@ s@0KH0 D@ f!!1 P 0 P P P l0 RzD0H.T\/PPЂ/8...0/-1^ 1!3,H -L` pR @00B S R NT PP~ .RT@ N000G SȊ||`||| 0!000!.CDRk?C `0 0!000!>C s 3 S R00C0` 1   !.B0r03R0S `0!000!>CS0`0!000!>C;S0Np 0!000!>C10!0v>C 0C0   !.B ` 0!000!>C=S0pGҁt -PPL @T` /#pP 00@T`  `00D S 0,TV`0B .TQL@T@Pv W 0S 00 R MR- (CR1 0( *# 00d0S&V 0S00L! 0P@!<10@ @@@cR mR000 R000  P000  P000 R 0` Ҵ D ʴ, P//80h//0// p-@PLp R @a0S6 #R. \R' P@9  1"#200b100c!QR 0S  R=P% @ 00 0#R@ j@\EP Df 4 `  [ />3=t000 p-@PLp R @a0S6 #R. \R' ᑟP@9  1"#200b100c!QR 0S  RڹP% @ 00 0#R@ @\P D 4    />3=0(1H1 -@QLMp)@0@P`@^ K00\ 0U@V 0Q 0  K0P0 0@᭼!QU`@ p-T`L0S P0@T  0;@T0PUp -pL0S& 0`SJ2ጠ匀PC0 S@0S  0RPEH Q  {`VZw000؂܂ p-LPP`p0"#200b10 0c1@T0@S 0 S0S00 00?=p/>3 -\pL0S ` PU 00@(&TP0`V' -0L^2 0 R.x00S* S( S& 0<%100b1010b 0c1@T0@S 0\< 0S00h$qv -MLM440S, `p 1 RQA0Q( @PhBP) 00(00 徠 000, 0R (K0/S BKAArPp ` ̶P (0  $ 9hzl11  -L@L0S 4 @00EPg 1 -@@L0S (.PP =1 -@@L0S (P9 =(2 -@@L0S (P"  X2 -@@L0S (P  2 -LpPP 0"#200b100ca R  R 0S0S㖷@P hP 80pP  00@бo/>32 -p@LP 0"#200b100cQP 0S P\ Y`P 0@0 00`/>32 -1PLP 1!@ Q0``ppP  R R 0S0HH!00 @T@p qP 0$V00Sp00S@0ڂP0 P  >; P 00 tp 00dP 0S ڶP `$ 000 3H3 -0LCP -$L@pTP> !a@T KvP @T 㢶@P gP gP 00@P.vP ӰѰTʰfP( 333 -|0L@`TpP \ AT uP @T ᆆW0G0  -鰁LP\^ 1 RS x0C RO0Cx0%100b1010b0ca@pT#0p@S 0P!0S ! I0  S;00 S0000 00CS 0"@P vfP 0 0  0  00@-8&00$"qv 3 -MLM"@0T,0  pP! @T@T 0S00S3 !-h, 0RH(K㗵@PJ Da 0Q : P ! ˯a= 000@ 0SnK`F`F *P  ^Pa=0 S0Ÿc\ H6Z@ ,hzG4@4(4 `44 0-@LPU 0PP t0t@p `0P40&08 0$Z0G\T444  P 0S  PR00S0S 0-B0B N N S0N0B S00B N N Q0000L  0Q000B 0Q00P000BQP 0N0Bp@-^ 00BPB ` @@ ^0@0B ^00B @ @) \1> A0 P A0` 0\!00 ` P0@ 0\!00p000@\p 0@0B-P0!̠#*̠ 0 R0 R*0P  -$6LM0 S, F SS4XP FW0 0| 0-L㜼@PpqlPP \qX0P 0|p40 R $ G07 $L7NM 0P Q0A000  B@ Ѝ 0-P`L p 0q  0O?0@@c0@0S@ 0 @TpS 0@S 0S  O0 R 0 S -L ^b]/8l -l1LM0l  y 0D8 YhK0 0(0 0,00$(0480P@`p $,00< 0 Pp 4@`p;PPp e @ 1Q0^l0  L00@ @/l4*@T (K 88X 99 -|0LM0 K 㕄@P夿D0@ @ݭ@囿0 ӭKX  <#-0 CR 0R0 S00 0-LM@Pk0 !P)) 0 ZUPhQUTPE@H00S< K0h( K0h9`9|9999 -@L0 0Q 0 $0Q0 $ h|99 -L@Q񟗤,4\LWQ6(08@HPX`hpxYWUS0SO #SHFDB@><:864;0Q xtlhd 堾T!PhH0 $#$(,"(h Q Q  ~0ShC <8#"h9:$:D:h:::::::;0;X;|;;;;;<,<@<P<x<<<<<<=<=t=T===> >>0>D>\>> -3LM,MQ (K@ 30S  lxdl K(@T*`T IK@3(@D8#0L K(@*|`K(HJK0#(@Db<*m`0"3*d`20S "'*X`P% `V"a@P] 0 L2o 0 0(" KK(@(A*/` K*(@*`1 Ra 10S] 1K@1@P 0p` 0躮6(J@P/1)K0 B0/0᧮9K00C/0j/0᙮/0^/0 ፮/ 0 RK0L/0〮)K0 B0/DK 80 ᔫ K(@ *_JK(@D° (K>T > >` >\ >?Y@$?| T\DL8? -@L㪵T  p3p3],`  -L M@D 0KH CD000T 60  H  D@j 0 S<@ @ 0& S6 0 S pC @8 K048,< 4 ,$!4 !$, <c00Q,, b=90 = B, 0 ,0 0&,02#`pǏşP ` P`0S%0S0S*@ 0#p5 H` R0 H 0 0 B0 00 0403  !rH0v@0 04!48#8<D |40S /0z/@0? hY`<0XD C0RL5;@D4p0 S A@PR P<0 T$*0T@:< Q* Q:L30  @< 0010RPH0V< Xp@DHP`Q @11:Q1 Q\p@WJ*P 0@$4,<4("4F! %@pGW JiTO "0S=l 0 JR !pR@T 0W T( VP 000@ c>'W` p*P 0@$4,<4("4! dpW\ J TXBS3  % 4E 40K墶00@000 ' 0)[R00@ 0  0 00  0400L40 ! 40<2S@K(P R#K K0 KPePlb30 3@ *0K@SP(30 P3@ )0K@CPh30 3 00K3PBH@KP#<0K@P صPs< 80R\#80KPPLe0;CS00\Lb$CP#0PP 2Qx"Eې"XR0S@W 0   ʯǯį@p a0 hA0 02qᥤPP@lKPKL`K<0 @2 X0 \@ 唥0     \K0.PT TK8 0謮@P~0S a:  P0 ߤ @ ֤P R ,0S:ᡞ& @,(X {Gz? @ A8A(A?@A  dA(|AAA!A@AA(.At BT (BLB d pBxBBBC(CDC`ClCxCdCCCd80s'D`  -1P p0u03W0SL`F 13`P,*W# L0S'0S 0 U0/S \0S /S   0S /S  \0S*`0X-|& - @L R000u!- -LA6L 0CR1 0P 0" `000 L0S T1` L1 P`(p@W  0000 P0001]U0 a``@ 00CS Q00 0S 1018,a0` 000|&-- -L4MP04   0 < @0  K00 ,0 (0 $0 0 0 0 8 d@Ke K( -ML M P00P0Sp, M3Q  0P1#\CSAEKI I0#X `$ d 8 4K\ *wd3&?( " BnK`F`F 0$_#60 c S1 Q PP1t4 p(0S, 0Rq(KF"V0EOo 0d5!,@ 0 $Ph 01p4 ( l ( h("6O0@ 0l0!0(0PS1wpP^ 1&M!h0PS" ᴜp$t( 0P( (PD0&0b0(!6 OQ T0h0C0#0&ጜl (x0PS0&  0 R t00 a\PP < 80k#hzX-|&$DpDH-DE,l p-,@(`LP0P p KP  L0S `00 0p 00C S 80( 0 0p0000000|&, p-L@Ah1PS* 0S" 0 : SbL@ f0S V0S 10f1phylUP p\0 P@ph Y,D-ElEH-,E\EhEhEDE -LCM M$E~KpGpG 0,           `$ d \$ `0$: SYp@h\0S0PP$ D0S8q0 44 $4P\4 0$KXT j@T40 0SN ^0أ: S= P, 0R(K x0S |3 @FPP[ @3 PT  1 \:q`\ !50:1Q@(@F@  ᔠ,6" 0 0 偠6P,0 $F 0  0  Pky00@ ,0#0<0H 000(KHbD0D  -X-- -|&---P&-LG-- - @6 80(P@ 0L 0cp`@5먠@@P300@ 00`S mPӜP P, |&-- -------pG P00P0 S-L30 P/萟0S P,*`$F(pP@뼠,6 R0`00̟ڟ|P$Fџ00ở0#0 `$F0P5P@2*X- |&-G -1` LV@p$`টP  %#T*V&0 R B 05"| ;P%#0VL0 R @, 05", %-|&4-GGGH 0-PLL@T d0h0 R \d0T@0d0`0000,0 P|&H-PH\-HpH -0L: SpP` RHh PR@l qPqH -PLM@ l1 Q PP1P*<1P 0ES0S PUPQ z W W  W؀0 0`+P( 00P蔀0 0`P( @$KD$ `@0 0 /&8$ 000h 0G -X-|&P-, p-0 : SLP` V pu6pl0@@0P` 0-LM@? T00T0S0 T8}P.'0H>P $!0 R d0K0 o. D84 (HX-HاHH-HH7H -L`p1&@B_?௡ PP1d(P@P( 0 0V 10 A `   h! $ ((⭟dPd 0RX` 0 A8`d00@P|&-H&L&@&T&I -MLMCL 0\, |p@  L(,P DC, 0R(K0CL8N6@GTPo#1D 4H <8  #1<8 6"0\P`u!#Znk 0 0@ @ 0LHx2 Ra D8pW8 :O4HLT >L@?8p^@Y RLH00S00   LNK @D@D0PL(h@  Q $tp1DH000yL4 0\ D(000mD000gY<<P*D0P"Sn@00!0002  0b1  d1 RP 1P!K%@A2@000) 00 |XtUlR dO\ TILFzDC801(㽡a3q(?Kt | x IP j hz-TJ(`lH-4-|&J,JP-<-KX--K LD&LDL------.L-T-(l4Jm@-IK`J-\-lJK\K.9! Q ! E 0!R!0P52 5:1  11^ʠğ0S ,6 1R 0h p JKJD$ 0 ,6 1RJ rK vP#0Sg# 0 ؍&7PL0Sz 0# ȍ1&'P_1!̑0  1 +`3 0ASBLBDDDLB ,1   1pG1\0S1 S,6!0  ,6!{  eK P l2&1劑001&ԍP,B H(4" eKP 1&g00&ᱍPA| !p,6KQ01,&K p,6hAQ000F0S&\"*0 R !Q0 S  17 0`S rKP ჆၆h, 0R(K! |@1! 0 u000SL]H hz|&-4-`QQQ R-@QQQQR\-0RlR,pD00 ᬃ0ᬃ0᠃ -Lo<P R Q-L@ cP T(ڵR P-L ыP ͵R 0-/LP0@P 00+8[/00,+ @+@00 R p-LpM/P@P KIP0: S Kp0`rS@ᒑ nj P0-L@P0 R 0 R 0m0h萜፜t0 R0h0l] FH0 R <0<R808N% 0H꤃R7zR --LM0 0   --LM0 0 K --LM0 0 K -L@*@ h<# -LM@08K0P@`AK:P0: S VPP SV H`@P$K袚P U @`0 R000]K@P l1: S 8((Pꠃ.SR S --LM0 0 墀} l@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% |&p@-`L0(&SP d0 60PpP0\ lSQ!A\SQ0|& -T L@HfP4T6? f$edACPP R R,1,,!!00@ S c. P 00C %`f#P0Fx3 @O&6F n  P @06  ?P00`CDSlS P-L@ 00 R$hpH-S7 -LM0 Z3 ?33s ;@P (K謓k  `Q#3R 0X 0@cX, 40 夌"8 @0E8  OƉ 6F&V呌3 ($6勌 0( "00ፌ80S2 4 ,0|B 0S<PUL2   00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  `0d0 1 R0H0C+P 0 R04 0 / d0\/d0L `P@ 0R@X  aA T@--P&\-|&SSX&\&4-8TSTTdT|T -kMLM0',0 7K@0AA`@`6 PP6: S 3/PR ߖ먦P%0S~ 6 Rn 0`StA0Sn dfd6d&@`v@@ @@@@9 60SL PJ P(0%%<0000PF%0S 0Se.K B BPL, 0R4(Kp5p@d5 R\U,3S. &(0<%04%S $R2 &aP0S 4 R}TT0Sp< p0S хP, 6S!@Ƒ` 6S3Ɠ,6@ \   0P V[`WP `3 00B10@ច3P LHC┅`3P D3P ℅(3P 6cS00 ,20!6 S 2" dB_0"S[ PY &>'< p"`\P@56D"D2MdEk@@)1 R_b)YP @0S@@0@S H6<4"D0#@1 ]P @0T!1x>1\H@I8( 1R  }hzX&-D-TLP&H-T-HU\---\&8--@-xV4-|&X--@WTU0UVV8UTdW--,--L&@&T&H&UV0W?|UV4VTVUUUUW X|WxDWWLSQVVD,@-0 @BTx00 Q< 1P 0<000  --<- -LW@*SPM@ 0-LMMpPANK@D0@D\ 0 1 _80 2 0RK0 hz0X-D -RSL4MP`p \|1  BR d;V$K T6V^0@ X 0X@K( L (0KT P H D @ < 8 4 0 , L % L 0T0 P LP ,p  0U0 ?00j  jਊˋ @` ᠊D0/ Z D:PPU P0P X@KT0 , PP  00갃-<. Є -L4M00 @K,0 K -L: S S  S  S 80P ,y S  S  S4-dX 0 -@@@0 ܠ`L @@``廈Pp!p 0XD0@@ Q@NPTPX P}-.--|&|-xX -2L `R^D@p@3 T1 RL1 RH0S?T 1 R9qQn0SK00CS0JX0@X0FTI T00CS0)0 R0' 02P0S G P 0S PP G PyTYT nTNT YTyTXEG@XEG@00H-LT-D-L-XXXX -0L@Seeee|00S \JX0 R L 00,FP0000X H-XX 0-L0L PR@  ,/(+P 0 ; H-YL$Y -LMpP`4p 8 <0 Tt@_0/q,0p , , 0K)QH< 4g<P1  8 80K40Q0<\%0 4K ` 0P @_4 0K@P  X8 `0<0 S (Ko(K,88|--@YHYtY8Y -0LS@p PU 0 +0U ` 0`` r0T xP 6Sƕhp@X0Ɠ,6@ \   0W 6S-Q|YY\-|&D- -TLP@ 82 R),r@T T~ `U@ P}}U` Qm!0Y0011 RC1PoMa  ? @_TG p1 Rd"P  ?DA P PaP[Q30 R% @C@H0 R 0 @P2!t0 X0oUdP `fHJD-\-X&|---4-P&-H-Y\&|&Y.-ZYY -LN F -LM< !<@`_',0 , , @0 @00K8 ĕQb8@ s@ P4 V <W0K80㱕QS@ P@ R 4 ?0440 <啀 @< 40040 0@Q$ 8: `P0@_8 0K@P u|0 d0PR Uυ< Lj S4(K0< <-4Z . -\v0LS` PW00CS00@0tR U T` T 5 Rk 0 0S`0 CR` !X0M  X0`0 CR` )X0-  X0@tO 5  0 H 0SX`0 CR` X0^  X0`0T C?@R` ş .X0 X0p P0S C@t0S40#3P50S$6#3P4 R 0Sh`0 CR` X0$  X00SG4ğ`0 CR` aX0X0pPPPP 3ܨ0 S3 0`003 R TR 3 RW # 0T0Q0SO pp N50S06#3PA 4e03 R 0SL`0 CR` X0^  X0`0 CR` X0I  PX0hp0R QU@C@ $x6pP} YZNMD)pP 0S< -$!pG^ pB 0Sp T?@.^ p4 0S] Ip, P"P4p0RAX$ pp0RXMp 0S `0 CR` p0RX-pp0RX^pp0RsX^pp0RtXIp PPJp0R RXU,T@©. .. .$. ..Z .p -0L0@`TPp B@T .$ . 0-@PL5e! p( b0@S| { {{ { { { { { { { {{ { { { {{{{<{\1\ X4 L1 (!p,1,!0S1 R% wAP2 "( 0000 0 000 0000 Rl0 RX0 R00 RJ<0QZzlZ.(..p .$. ..Y -LL0 L \ 00 (0 $0 0 $646x3(6 -0L0 (6 -0L0 (6 -$$ 0L00  $6(6Qd d00A00d0X6( 0 QP`e-@0 0 S RP$ae -(0L00S 0 (60S 00S0 $#$("(  @-0S\\ @ T2  R T2  R 0 SR 0-h0L0 X0XPT0 P@0D MN40, 0h=0 6T6443D6065i 0-LM@=P@KS0[P00K'dPPd\\@\ N0 0M00 ( P K0ee3D606i e 0-L M4PK @20 Ppl M[T0DT 00000 40402KׇP$ϥK0306i eD63i e -@0L Z~(.\o -T L0R S S0RS  P0 ?~d(/f p-L$M<@K$ ``Pi~\ MP ᎇP< 0,` 兇P PKp06D6i$fi$$f 0-L M4PK @0 iPxt iM[T0D\ 00080 <0<02KQP(K0306i 8fD6<6i Hf -4L ,CM(0( 6p D6306yi Xf Q-LP ]$ 1ZA@b  0(0 S^Q@娀帐`p0 0 S V |Zt H X00`@0D S% 4oاhfQl؃pfdb|ff -PPLD@DDp(` <h0  $}@TheQbl Qp-L`P 00S  R000 ӑxR 00 0 S r 0 QQ 0v03P0SLL  ph<4:@6@Tp fhf9 p-L$M<@K$ a1} bL Vp ,0S0 (0S*,P%5zP(  <p(@`ph;P VX T`PE@TUV н(:vKp06D6i$ff`f -@L 0lf -40L0S$00S  0 @6,6 0-L M@P 00S00S 0 QP K<7, RP P *@KD K80 0QKŅp$ K0@6,6,gD606iDg -L M K,0 Ap,$0PS` X0000PPpp@ c| ^|  @A0SS c020 K Xg p-L MK,` 0 AP+0S 0V000 PP0 $| PPBN0S S c020KpXg -0L(M08@K( |p 3Kd0 \&P0S@( 80 000$ X K 6D6066i(hg4xg p-L M0P0 00xl<d`0K @M+0S 0,, 0 0>0Kp 6gg4g -`L MPp@Kp P$J1 @P%+ 0S 0,0 $庄PK3D6g06i h -LMP, 0P ,`p0  R100 ӑxRP 0G`p@TR X 9PPJY t H0 0D 0s 0D0 V Y P8 P4Y 00D ST00ӑW0A 200B SR0000ӑW0C00P\T00X0S 90PP0,0 @cT d{@(K h(hDh -QL(M5K ! z00 0K  # eP D@0@ 50KJ00 (50K0PK3D606i Xh -QLM@ K z _PP) K~&@K4 I(0 ڃpҡ KhhD606i|h -|0L0@S h ? R00S L00  c~,0T, @00 0 0 0$646(6x3 -\1LKMp@DK Qnz0W@0 < /8P RoK`F!IAP /8000@pD K$0KWP  0㴟$0 R  嬟~0S 00S Q  R ("(04"40$  K h-0 CR 0R0 S00 Q-L X6 p`@ -0CU3@% R 0S,,0SR00ӑR00Hӑ@ 4 R @0 S0S -@RLP 0S 0 TC 1@0S<p `(<0C3@ R 0S,x ,o0So|f@ l R @0 S0S400S(>hT>hKhh p-LM*@KxPx` [yh @僂pP  Ny0 01Kup @Kp306:i h9i h -L M K0, @($0 x\p  006@K|P`x  `yd @@pL  @rK7p0 K4h0306:i h9i h -LM"@K xTT0 L@p [Q"0[S "0[ S K306:i hh -LM0@KQ x!x  P G0 P - 0`p@P0S 0   0S-|-w0lS v PmPU@K0/D606ihi$i,i4i@iTi -81LM@8Kq`P  jxV@! V/P  0jp@ 'PK 0xP !400`PP@P 0 | zJP A 㙝$Kdihih p-L M.@K `xP0 @>p'  >G00SA[T 0K '0SK XbT001K,0H p4Kp306:i h0d|i49i h -L M Kp,`0 S'$@\P  0- t000S \"TK6PpH0 p@h  4A6P$0 t@l  K@Bi(6iiX6iii p-x0LP @t T 10S ] lThax0 4]H/]8TS`RV$ }@YL+NRMpAd0S=B0S 0B400S " 5P +T00SH  4x07@ phpiiijjBj$j0j4jj ->ML@M|10ld@K PvL *F 8pP 0S=l:>[KD@K$PE@PE >kv v ,P 0` F P 40S >KK$@D`@@DPD.0tS  X哿P|@40HUZ<]$K<6Tl06D6i ji|kk k$k -LPp`@P0 SP 0S@ 0-@PL0 p0 0Ѓ,k -L`Zd00XԛTp@Pp 4ɛ 00 0  2 6Hk4pk 0-@PL0 p0 㨛0ak p-PPL@0SA00pd00X L㌛<8@P`RPPPp6 6kkk4 -@pL`@1PMP@Tde p-L$M@`P xW <@K$ dPu` ET P@ 4` ~P$ǞKp,l06D6i$fi$$f -Lp6%`PP h尞d p0 @80 0P(帄@PnPldXlb -L@D008 ,$00 6tll44 -L@cD008 ,ؚ$00 6ll4T6 p-L$M$PP& h`@ C0P  `Z@T}@K $  td ,AT 1S1S1S(Q$!000C S0:S Q$ PJ`T 0S,5,,Q'V@P T "R0S p8&0S$H&K 2S*0S' $&0 & 0&0 &0x&a`&\"Rd0S`2S|\1Q|!| [0l |P01S H10S  峻|0 10S  x夻00S 00S `p@[(K306D6i i8i4iiiii$mmmmi|mBmmmmmmnQlmbnnDm(n4nDnXntn|ni n@6,6 -ML MPpk4 4$4Q|^x4QpYl4QdT`40ST B @9U 0S 0SS0X9L@KMc ( Ar rA f{PW |,PL啺uAoPx  \( I{PXP <0 <0R$ 30S  20S((׺0 20S))|Ⱥp20Sd  P彺IH\P20SP` pA00S UHP 㘲`,0V pWP`jZ10SAQ 4T0@$0$@SFNKP@D/LRKLQKq @1H zP/K4[S SoKL[ <P .P,@K[K[ 0QppPK OKL[K < PP,@ 0J 4$K7D63ĵ<6n6Hot3To6`olo066i(xoohgo6o k(6`3Ki¼oQo -L|M\pK@8 P`K)q@ %q0tL0 H0 0L0 D HmP81 L0 , H D < 4 6 tP1PL0 00 C R0:S@H P$pK@` 0$ rP& $0@@T0P0S T@K $0K$ [P $0@@ D0 \@KD  @80 0yp( KmoboD606i8p 0-L$M8@KP$ p ?0S u0P00C SX8@K ?P800 (yp K0D6$pXp06i$|p 0-L$M8@KP$ p ?0S vu0P00C Sh8@K ?PHٕ@0 8ypf0SXK0D6pp06i$p -LMpK@P4 HptH A ` @pA0K0 o?1 by@PC,uBP 00S0xS 0K`# P 0 S 80A7S$ゕA0[S K Ό@ KPnP00@KP 0 *? yPh@K$ o\ ?t yP`0X X0 yP@K3D606i ppqTqlqi4qi$fi$$f 0-0LM00S % oPKPP 塘 @0S|:.P 0S 00StPU< 08(6ix6qqD6q 0-TPL0@S s<0Q % 0P@0000806 -LM,p0S[0+S LP`IOK`` <(P,p>(307 OK./o `>K \NxP $01SDB@K o032K4BKOKI_K4[ <巵P,4>_K.n (>Kt2 xP01S hKPOK.n >K1 wP01S 424242424242@42Z 10SC OK.n =K0 ,wP01S) 夕&02S42S @`0P PdVSQ4P PdGD .$K06Qq<6D6"i rr%i $r8rIi Hr\rhrtrrrrrrăQi rr rr4 0-LMhz@7787|H7 |4774|7607 7 "{||7{Q(|<|l{x{ -LM,KP4 d R 0Q R  0 l2 0S ! R,@ b bP0080SSZ> 0 0 !8 a Pp8  P`! 0 Y,0pW @40Sڔ!0S`0 CR` #X0  @X0T!0SH`00CS`09X0  X0000 S00 (K @ p0RX "@0 R0 R 0 @[bl ]@P 0P 0@nX 00LY$ 0@ @0%P6@777{ -0L zlL| p-LQP@4 `@q 0  00 R?`0 CR` X0X0@Q 0S q l0  0X0 R?L@⊨Qpp0R0 S唨 7 -pL@P`nP` P (p00pT@P a@T7l0 P @ P@0㕓#PU`pW*L7|lH(XP7 0-LM@P  K0K PPbp (00S' $K0L7|` -L MP@ `$K 0PP|bp $^pP 0 PPobp ,00S  ዸ KL7|@0P0 R0 RP= -LM0 Cr  0&X0 Cr P X1 @,K@ P\,PU 0   0 R$ PUQ /\PD 01(1$1 R Q @0 0@S, Z&p`@+P @ T0 R[pPh` d0@p AP 000 ,e$b_D~ ~<~Pl -p-M L M0` R P  0 R 0RKp  \(ST ɦANK@D@D08 ] $@hzlP~| p-LM0 0P@0<0R$$0!Kp800 S800ta<80< <0\S*@ 0R&D0H@(0,!40Sa<a<_0Ϡ `Al $!B30b 0@@< <0S  KⅢ0@ < 0Q =9A =CD H H0t0D R0<X PVL0 R `<`<0@@}X~|~@BC?B~ -LpE`PW PPJ\\@PV \ ]`  `P/ Tw\PL z0VX0PPPPPPP$0 ( [(0S<0 0P000 P00003 0S0@ 00 V0dh PX wV0$8 nVlV= }}~~~` -@PL 0S@R 80bDb0PdS J 0 VDl -L$MP`U@ 0S x D  ፡pH 10@<S<                                                            t  Dp6 6pg RP0S6  0S 0S  ) : )P !P0 80 @ #KPt$0S1@GTPa@ PP䅟k0K%p@PT D00Q  R1 0S0%000S     \5 D00A00>00:0070040D0 140SDDU 00SHp@PT0U 0 U 00S 0000Sdp$`D0Sx Q 8 R 00S P0So R(KDP000 P0000000`V} 0#@e0003 R 0SH3  0S#/P  㷥 30S0@⨥0S) -P :(P )#P P C H0W00kH ,0R  -Q  l"31C0La1 @K{P6ں3[ ,00cS b0=9 = B 0S!000400 Q- $0< 0bS$0'0$00|,0W003X1 R*Pl!910S -@0p@-` VPU \ 0 0)R @ TpQ \ 0 0)R @0/S\ pp@-` VPU \ 0 0)R @ TpQ \ 0 0)R @0.S \ p0  cR=9L = 00 0c0 -L 0%<dl -LMq0.$0 PSP `e?V $ 0RO KYgK 70 KS |!A q 0  0 Q 00ӑ0S@KX TgKA aK 4PK{D@KX P8K  <7P hz ( -LP`p gR@@04 @TV- 5Tp`WVH-0 S +++++++++++++Pp`Qp`%Qp`%Rp` < p-LxM`\ |J d1  0DBs@ 0D< 0SPKLKHKDK@K L_>Y@ć|_?dlT\؇ -L@-[ pϳT 0p3%] 0p3P_ p-`L VPU ^ 0 0 )R @ TpQ ^ 0 0 )R @0,S,^t B @QP R T00S R @0   -$up P:p(_ _D_ -L Qp3b_ -L M4 4 W40`1   4 0e K VA*4 0p$Q Pf:0E SX*VU @,K U, <( 4"4,< ,0 @Up 40p 10$8`# "[04"4858#Y(KU 0KT3[ $#$("0U:"[Q04"48#710S`<D_Xl| -L8M 0p1$ ̵[`P.ŵµVPR@K .0P  PⱵU t[P`P⦵U$ 0R  K4. 4(嗵 hz̈؈< -LM P0a0@%K,K0pK  0pfo@t% %0[S S , h0( K0o2[d#!Z4 K00Co4 0 8#"K$KT4 0-LP \P @0)S 0 00 0S@0Q 0)S0#0CS;,;,;,;,;,;,;,;,;,;,;,;,;,;;;;8 0  zꔉt -3L M Rßp3S00@@@@@@@@@+R "刓0 0j0e!KgP3Ƞ ,Ƞ("(<3 ",!$ Ġ0^0 `a2 pt0 0````S8#8 $#$2p` 22@H0KL HP D 0 @@ <@ L/W00S@ RC02 (0|0P (K ᱃ t00@@@@LS8#8 Ġ#Č BS p|1@0K,0@,̠<Č4("Č!4 <$̌8K 8 40 0tv(1 @t00@S8#8 Ġ#Č S p0t0 0@@R8#8 $#$pD0@ i0R ʉ\_T_8> ?D_>_<`_X_> _<_A(_H_ -LMP |0 R 00  @d @ @ @ X K <_K80 0)(0 )#P0 0 P_4\@@0` 'S0-LP@帳 0hH(@0dS<Q<TBHBHBHBHBHB|BHBHBHBHBHBHBHBHBHBHBBHBHBHBHBHBHBHBHBHBHBHBHBHBHBHBHBHBHBHBHBHBHBHBHBHBBBHBHBHBHBHBBBHBHBHBHBHBHBCHB,C0hlj001@U 0$ 0hW 0$ |0hLplH0\0hէT@001 80h6,̉`Љ99؉ -CML MLw@0 @ 0 PR񟗋EFdFFEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEFFFGG G,G8GDGPGEGG劲 0RKQ񟗎|HpHdHXHLH 048< ("#lQm Q XaP^Qf *<X 048< ("#IFC@=:741.徦NPK .0P   .0P h`\ 04S<@I4I(III,  04SpIdIXILIH刦~|{yxvusrݱ2  N Q32ұFϱp̱l2  = 0`S fC -*Rb L徱2<廱8帱0嵱(岱 寱嬱婱妱壱報Q 囱A+*啱;SRNPK .0dP 1 傱|V( ppMKy @D K`@D @@ 0Td ;P 0h$. ~H. ~9NPK .01PROhz܊`<9tЋ ,<=$h:$:pD,D_Xxl`LDPT=8L$،Ȍ< -2L4M  , P@A 0Sp S 0gԡ0S[`00CS`0cX0  X0TTڜ1PZpK""2! T`` h`00CS`09X0  X0@DT$PV @D <4("4! .0P İV x ὰ0S @D⦔T, 0R(K嬰. A~X 㪔 d叔T`.X嘰P啰X 㘔8D_hzTh\<D800 -GML M號ENK0@Dp, P4 7W `V Q 9   ݓ, 0RH(K0SX X9    @ ȓp 3 >P 0PS- Sj H0   / ȟ08 R`00CS`0EX0  X0l0 t3lh匓 P PP 0R8(0 00@|4 xD $04"4(4 7M R000t 0 7ǟ 0 B0@tD 0 l0u@F   aP 0TG #D7$   M(ǟ R0004'00F0000I\ 壯0Q :Q $ᘯj3l こuIv?4 d兯\傯 0  $0H@ 0@ @@ <@ 8@ 4@ G0KD@ HK0@K00 HKgş0S |x$_tP[p0 E0 P4  R b5Q% QaD00XPPPU`0 S PP  0 S ) FKAhd , <$ 4!$EK 4A,,.<A`$ \4 5X 4C&  T 4$ 0$pD 0| x $|$x4LD)& $8D0ğ |xVP|xD|x :P|x$X ܒЮ 04S *Ǯ®S 0HSሄ l P UKH@H p P4`U :@TJ4[S N( K#D@Pd $嘮P4UuŸp$4\@P劮(B0 X 僮@TI T`{`0jS'V <4("4!L,Y0F T@LeX@! T,K0]lP t ,@l$$OP1 RD`0 CR` X0)  X0lUP T,%74`p0RX)3)\$P UP q $1  0 P4UP | j jhzD_t?,@<_P_8 ?L_@<ԍl<<>?@@dlT\(\lQ|@0l ( -NML?M? $ $ $ $ $ ,  h$       \/^p= E0@2S2XkHZHZDkkHZHZHZHZkHZHZHZjPjHZHZHZhHZHZHZHZHZHZHZHZHZgf4f f feepedHZHZTdDd0dHZ dcHZcxcHZdcHc d. pX>@dXXpHSP00 p Ο1 1 0`JKI I8^ " 0@D %Pt0 R=|= `0Q   L=zP-0 k4S- -K B B@@@@@F>K@0C @"0C D J%Pl$0S 0͟0   00 )XPulz,0  t Wp` ̟ 0Sa  ,0 R t,00`- ANFP : T̟0Tڴ+00B0S e[+0 00000000`@CI`@ T @D0XD @;˟@ 0\$ SE>K0C0C5  \ d)* 5\ Wp D-K B B0$ * R44:0  4 4 ˟: 4WP0 ʟ$0R pspW@$R$ 4S 5P 0s 00) /d:   t)00P@@X04 .PHQ 00) 30 ) B0+RpP UFnK`Ft `FP@  0T$PGl4 RLQPDPlU@(ɟ0) h$R ɟ0RFNK@DPh(0PWP9)0P WPsɟ@)$ 5\ @VP+d9)% 5@VPq(@o @廫|m嵫HgDQ @$@T8P(Pǟ0@ g00K @w娗FKKAHJ A H0 J PUT@T0SX'0 08@6t (K@fP PP7PƟ 04 H0K4 4 4 ̤ D (Pz $46 R Ɵ0Rڈ&6  0 aBQP6 50S׎PU D5 &0:;:0{%0<0v%0:;70o꜕EKAA q6Pb0 R^ `4 RZ%PYkX%000QDş 5   H %080C ?rPRДEKAA >P-0 R) `4 R% )ꄔEKAAP0`S `4 R 43Pt@@ 0r  3!T3P#000CEKA A4@ R `4 R0 S Lk`304 qPd#0 00D#0600#0@00bEKAL L0 P d$2R 0jtR0EK0AA `4 堎@h g0S 0 R `4h$TQ (jP2, *++ 0S @A0C2S2h hph h h h\h h h h hHh h h h h h h4h h h h h h h h h h h h h h h hph h h h\h h h h hHh h h h h h h4h40SL!0<0 0:0 0;0 0:0 0;0 090 0:;80'hz>>4(<_ ?`_>ܓ? \_H@l ??.A'@ĎH__(_H'@A@_?D_P_>pBt> _(_'uD h_h&LT_LB\p xPl,ԏTđ@4ؐx4(Ē8l<@X_J.K B B@@@@@@H1TQ@ N"0 !P0( 4Hp1 !090i!0701 0*4 !080~"050yFnK41`F`F@P)' 0lD PITPl1)( 0P@TP( m0S22 0 .0@>@$ 4 /r20GpP-   ji 3PWA03@R ]PKT0 G dѨC0S? |kS:ܜ0S6 jS13p3=K0C 0C 4 CI3 媥P l1 0`POMT3F>K0C0C@)& lD SP8 `l 00) 0t   0,0Q @@$ -B4P @p$)+ 5\ SpilX$E>Kd 0CS͋b0l4 v@Ph5P 4 xx%S00  4). bSP :l0 Ps `) 0`QSP0s 0) `FSP (lQ 0)3 5SP h lpl$UcPF.K B BkPkMGKA  A|4 xD 4 D FS6 R=;UUhOl$E.K B B% ) 5Rp3Lk%NT ;hTl6ht3h /h +h 'h #hii걛00h뫛00h  hM hk kkk$k,g4kM$0DgPgXsk`pkhmkpjkxgkgakg$gWk(0 SŠ˴8ɠE>K@(0CX @jRa 0-8P8@L4 :G  0lz`Q - L♊hܔ -AML MpP&E0`00 ,0 7rP dP jP4`- aP* uP zP# tP#~P, 000T4tt ip d000C Sa0 ($倆p00S4@,0S 0KmP jZp 1 dR 0+S 3D4  D$ H@TPp00F S.VWpqP`V$W0P 0p `FP` 0RR!>C 2#=S0WF@ PR`wwC0 2#0@0TT!>C 2"0r03 R0S 00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0\QP p8<1@T&(10S @KՅp4M @0 c8K8 4@ p 8K8 40 0mP7i0P  %.HQ 0+SD HXڜ]fY T hD CNK@D@D0D$h^P0Q(___(;$<d|_C0 S S  -`0@P@@T0 Lg <00S 000S.?9i_؈ -L=@PQ/X p-L@EP `p p-2 B 0L`@0PP 0S00+|2P& $ -8L2@ZE0P/S @P,P$2 B 30S &,$,", , 1RqP @P`F ,V 0+S-S0S`*P]*P *_L10S Y*PT1  @` `Po4P`T@D00SDP]PP100S 00St0Q. 1'29y8 P9PQQp贈Јpp|\ 000Td 00@`ἅ 0-L@PU0 0 YAA0,0 7A00蜅d44d,d$d -L@`0X #AP0@ A<0( A(0 A0@ d4(d0dd -L@$000P h蜅 0 0S00@4dd 0 @d40 0@ d400S 0 @8d4 0 @d4 0 @d4 -D0L0S (0@ThVh{d0 0@c4 0 @c4 -h@L0S X00SL0L H0@@00S40$ 0}@00蠅Dd4Ld - 0 @L0 0i@TdX} p-0PSL`0S <0 S @Tp蘅00Sg,L 0-0L0S0 01@|00Sp0` \0'@\00SDP@|,0 T@J$0 0踉Hd4@dx - 0 L> h@d4 p-LM`mP& 0S0@ P& @T PC@}0\ =H 00P (@K 0?  9Kpԗܗ -L@P hs00Sh=Pd -L@P 0S0S00Sh=Pd 0-LP@P00S0h=0Pd -L `pP@P0000P0S004Q -ALMP@ # P PP P P P P P (P |Kplhd`\KP 00 0000c  -LM KxFP![A[R0 @tP x0t8d P00TX0@PaP 804%$ PP00Kht@{ -LMhEP\5\EKP @P@=P004P00f- 5@K 554444P4444444P40$4P 4 P4$0Px4$0tPX4h$0\PT$440D@P 0S($0030 K3 0S P 0S#0030 KP 0S#0030 K#P 0S 830 tCtSt3 c pK dd0`LLL#L3Pp888#83Pp$#$3$ Ppze 3P   HPBXP 0S20 KMd2 P0PPS@  <"  `E  @ A00 0 `"`X2 KP+1 P0``S@ $2  B<!  `!  @@00 0 Q ;1 @K1P   PP@@t0P0aS@ `100ST1  K Pd($, 04 8܈<_cQ@dĿDd@HdLddDd$ dT)HdddL$ d$dP4(d,d0d4dTX8dd̾dh hc -2L,M0P 2pPpLPK 2b&0S B00PP2pa nP4 2P+ KP, P 2UP/ PP(P, KPK, P9 1P, KPA%P) K P<) P0 K P6) P- 1P0,|1 +p1 (d1 %X1 "L1 @1 41 (1 1 1 1 0 0 0 0 0 09[7[0@H 8@[0G  @0@ H ,0K1K+K.KX0,@L KeXm0 K謅c( -PRLp@Q*pq P U* ( P pU P@DTUt`l`@ P@ P@TZ<U  ip i)l̘0@-T0P?0" 0@0S0S0 R0Xd00P $00SCXd,p@-@00Sp($$,F6PI`pXdP<0 5-=?0S> 06S000ᰅ,0 0@S200 Xd 0PXd 0- L0S( 4 @ 0   0*3@0Q@ DLP 4b 0T430@0h'0Xd| -0L Kp0q 0 -0LPU5 40 0@044D 0S 040P`0$44p Td$T(d,t$0@044D $ 0hKpqh3(Xd -0Lp`PP#~60 4@0$($,T044Dt T$F P 404(0$00 4si|Xd8 p-L@ 00s'0@贅 -4LtMP3 Q $$0R($0R,0Q00 :$($? 20€0 S 0S0,$R030 5: Z02Z00 L R 0s0s* 30S 4 3 R 4S5P3 3@ 40 400@000  D3   0 0 0 $4(D0@0 00 2$($6F`Ip\ 20S C. rs SʝR4S4S 4?  0bJp@Pq4,'B20dtŸ q 00010*b%ph P '"1 4D0O4D0P00/0d4t`10S% 0S,+K H& H<10S01rKʫP1 0S1 0S 0 +00 00S$00 S 0 0 0  0 0  02 0 ,0PK*0(KXd , |048 0-0LPU ,4S0C$(QP40@eP $4(D 0@$4(D0,40h0Xd -l@L0S{p D0,$R0,4$4(D 0@$4(D0,4Xd -1LpPW`` 10S CVYqr V0U00I0O,?   69F$4S4S  P4S* 4S&p" 0ꀀp 4S4S:AX0Q$(0<0@00,00Xd, -LP l0 P 0R 0R Q0$4(D0,4Xd 0-PL@T 4 l 04P X00S Cpq 0hH0 0@ p0Xd,p$ 0 010# Q0S4:Ss0p 0 00   p-L 000 x 0Pd `P @ r 0 04 (0$ ;6 ( \d$(00 , (0$0 0 0 fddlfdfpftf0 0 0 fhfdfdd -LMp@P `@_00C0 S%"0 .S0K0 $ K Kdd p-RL@Py0` ;TUp -LM`p$ @PL0 `pdd -L|@||PM$pK(`K  L(0S0C(0 0$ 0b0 0R 0 000 Kdfhflfpfdd -LMP@p`:   e0` p-L@LMPK@%:`@@00S xdd -LMsP@܀,pK(`K, 0(  R,00# (000 0S( ,0S(00#D@(`K,PK 0S#@0 S$Klfdf -H0L0S00@@Y$ 0@00ddpflfxf -P1LMH!0SK$@K0$p,`K0PK),0S(0S 0 ,00R$ 0 ܠ p@4`K8PK4  80@00l?T 40S4 h0 c\0@d0 ]H,0 ( c,0 0 W00S C$Klfdddfhfpf 0-P0@LT0 0S0 <@/800 0P0s300lfddxf -0L M 0 PK Ѐp %@(`K(0@00l?T $00S, (0S ,0$0 ,PK(@K$ 0S$ (0 c,0@0  Kpfddhflf p-LM@ 0S0 K K 0P 0 0 R0AR00S t 0 d@0000"`K PK 0S ʇ"000 0SKplfdf - 0L00S Llf p-PL`@)90 Rpl00 AP@*D0P0A0Q: gpddlf p-2b0@S2LTP00P P} P PS PMP $ Po  P> J1PD eP PyN{yJB00S SAA00 S nrQA0S0S S gQA0S\0S SXx1@@`1pDA00SG?/=-p1 1R0R S P@0S00S S ,P@0S%0S S!, 00 S@ #h@00 S 00 SS 00pPphp踅tf|flfddpf -LMP<8|||p`,K  ,P }@TL!,0PT@:0S0 0 0 0S踅dfhf0PPf -0LMK0 ! KX0 -L@#P x0pq  T0 hH00S <@ F*.0S.0SPK !>P 4 P L>f P p>0S G P =D>W Pt 8^0S, @T-$@$PXT 0S:6LP>0S 0S 6>(0P 5=;l>`-0SD0eSKpd](4-@TD0eSe @D 0S Sf Sc S S/S 7S[ S00G.W S}dPx @,0S P0!W@  +W W R0R00@0#0<0WT <0WP <0WKC+Pl@ @K0@0SP +aGQ0+qx;/$P%W} W W W !Ws W*W @W07S,g 07S+b07S ]*Z W W LP 0#0CS<P9&0S <P P )0K*pK*K 0K0 @0PuT 0DcSꌾؽ8,dD(Xp (̾(Dlh`p|l 0IRQ|80S0SL80S8s  2RQ80S0Sf +0S0S0@W70S 0S0S@7?  A 0S0S0@9 + 0S0S0@)60S'0S!#0S 0S0S0@0S0SmP60S6 (6  5@T 0S5 %0D020D0 50S 5RQ45t50S85 5{RQ44~ )# k0S0S0@!0S0@40S0dSd0@h4\4o EQP < :{0S0@(4 : /,m!8 8KP%f{"00S0S00S00 0S0@# a0S 0R<00S0@52P0  0S2P0   ,Sl2 0S0@02P&0S0S0@IP hP P %a 0S0S210S0S0@P 0S0S1x18K80 b0S0S0@Pdzw0@ P P kz h00 1! j X0H0p0PN 00PJ 00 PPE PC ,Affff؈ąf|\<ffęQd,TH    f<08ܙDD8Pff0L X0p0P h00P t00 PP P : 0GRQ000S00գ?0O0 R0S0,! 0c0RQ\1h10Sp10գ?0O0 001 0S  0 `p10S !1 |!0SY,00"000Sḅ -LMS0P`p1p (K0`!00 40 0@80 < L0 40P00S T AQ;0 S06S0S 08 R PP,00,0  ,0 P ,0S:<0S r 000 R00 ӑX 0e!0S 0f0@,Y: T00"! 0T S@D0Z00e0X,0 e0f1(K  -L@0 !0S@-P@p`E5 p-0SS%0P gP' 00dP ^S0gS 0S 0S  0S  \:QfPd 0Ѕ 0̅ -0LM0@P3 00P/ 00P`+ P=pK,KUE@@ PP`  0@Sd`dV000E@ U@DPE,P `(K 0-LM@PK ^P8k+P  0S NP 88 -LM@R,  (P @- R P`Pp 0Pڤ`0 C @R`0P R0  0S0@  0R@S  TP1:, 00p - LPh̅t - LPhЅ -L hԅ -LJph& 0-L MP0S$ @Kb 0s0s ddP@T L0VH0 M$00(0 0 0 K0|df04PN -@LPF| -LMB0PP 0S U >0,K0 K00 `P@@p00SJ<VP420,0 A P8  8Ki8#W 0 z#D ##Z f 8P, 8 8K|10SP ,!P P8K8` yPYP ,TSZ$1 v10 @p 1 P0 , KP 0 0 0P@ #PC0 0R0 ;yt0Ul00S(8K8` v#(K|` dfĈԈ04x̉ 0-LP@6@P \P0h#0 -`LP`pW!&`V@ZP PT 0  0 | 0  | 0 | 0  | p-L@P`P U  P V  P php -L@h P-L 0h| -00LP P h` -L@. 0r/S@ R -LpMK@%SPHK 0T;K -L 0P$ -LAMPP2  0:;pq) NK,PKp@%`@ 0S PP  { 0S*# P dP` 0S:VK謉 -HHaLp@P#R %RT0TS 0S %R #RP I-PP@ RW묐0ਠ`P@#R %RU0US 0S %R #R P ! d-@ P R 者| 0-D@L0PS0P(000DP0褈(8 -L M`?, -@pP@0S 0S P W @P RX Y"-@XP@ d \00T @9( P  d,@000S0(KT -LM@pP 0S `PKh菊D-@A-@@L0H P`'}! x@w!K耖$\ -(1LMP, UARNpP; -@-@, -n@`PZ0%S00sSZ,   ,,,P@00@,T:@(!T o։Јh -2LM0S4 8 2@TtPP 0|S0P0@ 00 0-SP <SP ,@, @p`Y0%S 00sS  ,@`00@,T:+P UV 00S h10S@ $@)K P mB)[780P40@p9d0p@d0S 00CS00`Ӥ07` V g0H v R @r 6,p@`00,0Sp(K脉Јt -L@, 0 pS` R0S000S,`PU%P@000S 00 0-LpMKPኚP@|0: S@@$ K0 p-LpM0`0SP +@) P K_PPl00S0: S +*@  P, PKp蘉h<00S,0P 00S00CᨈXx'00S^L 0S00\@ -Lp@P`WV 000CW`K@tPuZ 6X`i_NpWZVX (00S0 mU d -LMp`p@P qV i 0 0-t0L0Spq p@Pq0T0U0000, -LP  00SR -L@pP`\T p200CW `20SWD200CW @w$200CW zUV fUVP@ u1P x@1@T@ ZZP`!hpP`qX6p4q2P P AP!9T 0 0S0uv 0 0S 0S0x  Rp 00pWZYT+00 oZ 00Su|xx@< -LMp`gP P $@;P9  KiXp@P(q&V 0A3P 00S =P@P 0p@Pq Kif 0 K,0PPᰈ0PPᰈ< P000S SP000S0ᰈ0؈P0000000   -0L`Pp@,P `VV'(` W  00P`p0@ 0 @ `000pW 000谈؈ 0-@PL tP 0T T00 00C0 R( 00C00h0|؈ p-L@Pq P`pwp P P@P40`0pj@Pp P P00舅 -LMpXtWr`#0S PHC0S <#0 QPW 0@POP B0S #"@ T T "06 P P p/ `B0* P 000 ,0 pz0 , 0KP0K0PK` p@ !0040  6` P P=ڄA0S9x!0S5@I 00< 80  @P(!0S!0S4@ 1@M P ` 0P`@DTʵ0@0Y@XW40K@Pp6T00S  000K@P*(K萉h܈`D\ -LMpwx 0S P#0S t3tC 00S@_ 0iP0p , @P0p P80 K  00 ,0 80K0KJ0@K00! i @0P`Pڲɯ`V* @T PXW5p@q P P`pR0gt T"@qTP`80S4!P00PUo-`  ) TPPx1@Tl0ST!0; Pp@@D41P`@ = P?P`@0K @PpA00S % 000K@P*00SZ 0 P` D@ P P pZ(Ko(K萉h܈,D\` -L MP`y, $P,0@cT D dqu@P X(Kopw0x0XW0@,@p(Xy z  V0 U00 1 ,0@c 01pP`q @,0T (1(,0@d@ 0@7pP`q XW 000S (Ko@00CTy h00SUD0@@Y$0 0@@(K萛@8x p-L`@PP ~ P p @P$00S ph꜉ -L`ppq|Bp@PqTh 08UT0 h괛ЛH -L MKR K  K p-LP phP`pqP0  Bph4@  B@PQ php -LM`pp@Pq BP |00Sh0 W V @P,0 $K!kK蜉H,P\0 0TSP0 H0 D0 @0 <0 80 40 00 00hfffffptff000 @00hld00S X00S P~0 @P 00 000000fllh0 0 ff -p堀0L@PP `PP.I `,  `' P`@܈hl Q-L?P=0@P60 `Cp* PP 0p V@P  @P@P 0`d 0`FP@PZ<0000Y$000C0f0@P܈h p-Lpq0 7PP-p@) 崠`t T 0 @P00CV]P w@P@P0@`@40W 00 X`@P܈h -L0<0  000 $00 00 ܈ -L0<0  000 $00 00  Pp-LP@1 00S PP@&` Rڔ@00SP 00S@@zP @0 R 4000SwP@p踅fl P-L0Pf P-L@ P0Pf M-LMP0X20 p@ 0(K8P U@P20S62 0@ (`K( PP P& (0 S P1P-!0 xA0(0 P (0 SPP b<1 F$10SWW 11 0(K(  4`P`00S 0@0@0@Tʐ0X 0 K0 0CphRd\0 0X0H0P0 0 0P  Kphff܈l -LM0@@#`p P@D\0@@0@T 7P \ 0  f -PLM@`pS3 R 33\ ڼ0Sڰc000S0  R0  RtS(@K  00$ 7@ p,0 0l0, 0`  0P0`0 2 \0S000S0 2 Ÿ0S#ڔ2 t2Rx2  d2 0TP _TPP^@20SPPX_TP@` _RP0P0P TJ10SnSSjK11 1 1Q0cڨ1!0\A1!1@ ``` 0 B\AQL!01`l  @0J$!00 0S10! VP`F(V(00S TP 00S STT0  0 -P(Kĉffflhfpf`d -2L M@xx2 0 d0dR R `, mH"0D"S PP(2  fP`p4 04 p00P`K 00WH 0SDPP $PpP3V!p0x!0S0Wp!0d!ӷ0 P#D! 0P(!09!P0W!0P P  P0W !P, 0iSɟ@,0Y| T0  000 @ `@HH0T,80 0i `0 (Kfffhlf -qL0PS`@ 0 2Pp1 T 0P0p@0`$0Q 0p00\p0p 0 ?R\0X0 00lW 00psp3ffĉfDfhf0f -2LM0PS`prp10S' 11 001st TS !0S0S1 @0t1 0l0 L1  010S (1 @ T 0S0S: p\ 000  P`0 Rh0P0 RQ0@^0 00 fg  Q-LP`pr1P PU 0 S0S:Q R`\ x1U 0Q 00X@R%Q#@zPE(`@0 /0`p9pq7  0@P Y0$X!WP"`@0 0`ppq 0@P U0T 0/`pf$$0S0  00jt8 0-T@L0S0dS0 PP(000P;000 -2L0`Sp pq WVP2 X 0S0S:0S 0S{ 1X1 0 0Q 0 @0S@T6S4P[1刡@0n0@P3pqI  0 W0V  0U5T30@. P'0帠@00@P Jpq R 0 U0T 0 Z tf -L@P`p@Pt 0u 0 X00S L0XR@P*TU0@0 50S(, -50 S  R(a0@ S-00LA0@S0Dz}Ĝ 0-L MPP @K0 000K0| 'Pp-L7 $P'.P ^P"L1L!@00 0%cP !1 !1L0 0 0  P- 0s0sph0^ ND3s H3s 0@D3HCP0 d00@#L3800 `P0 -P php|؜hH -L M@K>0s0s ?00@3K(| -,0L R00.0|@BH -,0L R000耉@B0P 00ᴉP Pp 0  -PL M P P"P00  R 0ShX0RH0  80< (0K0 K0K0 0K0K0 = K  -PLM@) T TV\Q@p ` "00C0 S10R!@”0,STT901 0b 00@0PK w 0Sp` T441` @0|T @K%aT @K,0`04 0$K$@ Kd`,<b8D  -@PL ThL0 D3@1</8-4+0),'h0脅TX\ȝ4P' P P0p 0-PLM@& P P*0mS MS hS =S sS wS pP hPdP`P\PXPTP@808 0K10 aK0܉$(,  P-L (0 00Shx. -PL M0 " P P>00K.S K 000 0S0-0S $0 0 00S00K,@Kp H@P0t @0S  K0 4 CK,0K0 Khl -PL M0 " P P>00K.S K 000 0S0+-0S $0 0 00S00K,@Kp @P0t @0S  K0 4 CK,0K0 K|H8Q PPP0SP 0 < 0Pᬃ$0$0S0SᄉT -LMK f K` -Q0LM00SK0 U K| -Lp@P000C S @ h,,@0`0 C0 ST @DT  0@TU0 `0 p-L`P@0-S000C S ph!!00 C0 ST00^ap -LM 0R0*, ,0* 蘟x -0Lhfꬃ -LPPM0 pb @`V0@ , `,KWV0  , <,KM 0S SV000S`B V? i 5 fV V V 0 1 0 0s03 V V V&@  00 0FSPV V V 0K$ KP$0S0e90S V0V 0 @00SSS 0010,K0,0 @V 0 \0   000CS(()\))))H) K謟؟ 8 -`LPpP`$T X P$T T T-T00@f F 00P@T -L@0 袃D -PLM8 B Rp,K4K 00S S 0 8K@h2 @9P8@ 0Pz`#80 %5*$P  P P+P -PnP! `$0+SX080 p!000 l, 8 0+S0,0 91[X!0Sn`z`@YPPT 4@ p,p 000CS9--.T.....X@ 00s03X@ 00$aFQ 800S8 80 S  08 800SL0P8K @0S,80Pi(K謃xxH< S 0 Q $ 0S C ሉ -L|P 0S0  @刐匠匀pP`0S dR`P PP pP R000 $@$ TRx -p@!`PLPQ  0 0 -LM d 0 K p-LMP`d@2002 0@?Kp'@B -LMpk`@@@!0 P`~茖 -LMK -锠PLp` @0@SP0000STk0Sk0#S , -L P P Pp h -0LMo@p@`!0K!PK  000e@PV-00e  K -QLM@Pp@tPp0%0K%`K 000 f0@PW-00f c$K -QLM@Pp@tPp0%0K%`K 000 f0@PW-00f 9$K -\0\0L@S L0 P"FP p1 0 0 8 0-L L0PS000@00 R+0 P00 0Љԉ -L@0@S -LMpP`5K+%P0 p`$ pnR sR dR @`0@SP   06`P K 0-0L0PS@ t00St P0@0S @00S \$00S0 Z0脅8 0-L@POD 0 0Љ p-0L0 S P` 00S 00S )0@@ct0P0S h00S ph1XJyP0 @@@400T,0 phꄅ̉d8 -0LM0  l0 `0Pp `K  0T0?Pd@P=8؉p3 -LMP @` \Q  0R QW@X@T11: \ 40KeMp3Q 4 ,0 0 0 00S0!P$K -@LPh-00 -0LM0@SpP nu 0Pr@ @+`P  4@P6-@@U Pȩp p p @00C000C 000C?001 0@-<0  00@P4 p 0q-  + Q 0%P#Rp@q 0Q 0r S 000 PP sP808 PHZ0P:j||DtԈ$Q(0$0 0b0c0AV, -p0p 0LS@ 0@s@3H0H0@0<0 80b0cA6$0 脉(܉Ԉ0&$ -XL7P@L3D0<-804)00,%(0p܉$ (\,@-p^ 001`0S10tu 0S 0Sqr, R*Q'00S  0S qr 0S0S:\^00H00S 0S000s3hD 0-L@PP<0  0S0S0 R00 -0L  0SYp3 -L* h計-  0R 0RQ^  QP 0 0S  SR 0 0 0R 0R ,00 0- LP@  R  0@ 0脈0D -@LP00h0$00S0 0  ꘈP -@Q 1LMPp@  PP0T0 `Kp@&P@ p 000  0S : L0R  @00S 00 0 0 蜈 P 0-@LPT 0S$  0 0計8 -LM` 0 , R\4 ԠP 0R0pK0 0f 0O 00f0pK0O 0@ @T U @  0d 6PP(K蜈D -L@MP`X T0 h@P <` @p < P`00X r T0s  T@0TX\00 Q R` 0@0C 0 , K00K p 0@, K00K p 0@P`wx R@0K0S @ 0bS0c S  0>PB0SH 2Q H l20SHH  S H  H QH ,B00SHH Ho@L H@D ,LD 00K@gP  AP 8K00L 4@K @uP ` p\XPB H008KL 4@K@ YP3 PQ 4H@8D00L  @"AQʸ00S C4H@800DL  @LEDCQP 0 `L9D7@@(Ktĉ0 -L4MP43@(3$H D @ < PP Z 08 40 `8 4 8 4 V8K0`2pq tu Q P`2YXtu 42 0@_` pH D *tu UT@P1 0@_ QP1 0 QP`p` p`VpH` Dp t u  80s04q 00 4 U80T8@K0t u U0T00" 0 0K 0 )Ph0qr ,0S00S0K@ < 0HK@K 0(K脈܈ -LLMvwJ 010 @0R0 , (Ko00S )p@Pq , R00Sp q Q0P 00 r8 00CXZ (Ko(K舅@ -0L0@SPTpW"0000S `pK@tPq Ch7`00CVu0p@ 0-LM K @K0tu ! 0K0 -0QLMp 0S#BP 0y:*R B0S 0S"0S00|2 \ PTB0S v@2 V0S YP `@P/p@Pq@P"10S  S 1```MV@P 0@PLa0Z @Pt u Z J@Ptu t,@ (P u(}$,K  0pP h00S00X0S  D0,K y $0P$K蜈ةH -L 0 0S0 h萉 -<L>P(h/ 00s030h꜈ة 0      ᜈ 000 000 000 -LM0 $ KK0 0 wP$ K -@PL \TL h^^ _ -1LX@ @@ -,%hu0  @`Pp0S0S 0` 0?0080  N000S i^8 -LMLp`KP p@P0[SPKT[ - L" P007 -0L Q\zl -LMP@P 0S 0S1 S K R3 fP 0B?SP (KXP (0Sp`$K $0(RpQ EP` cWQP00 -L 0KM#+ -L(M< @ 0<[ ,0 ``pZP<@@PP 00@徬P 44 04R0  00 4 8  00#0S83C尠o,0Z0 C@ 08 S00ӾP8S0 00CS00S 008@P....L`000<#0S 0@Sv #0P^00对< 'Nx2 ` R p @  0SO ,K04 蕜@T# 9\24P"L"l2 0  H"<0P P R0學MQ0吸  001 `80S1 RE ዸMTh4 ,0K徹@hib0 , 4"4@ 000 00D(K@P 0  t#+.:<@PLP`D` @2@ Tp -@LMh &>oo`p20p0`W` K -LM @`, py` poO&>@P2Ό P, 0U@(K -GMLM䐟0,0 qoK 0P@O$t K@PLL 00npK`2@PΌ  0`0Vp, 0R(K{hz -P8&> Y0L\"]280` R0<2<… 0S20@20D2 叏00CL2 0 0CH20P20Tr( $@S 0X2 g0bTX2i=ST0S0@2U D _R 0S2! 0 ἮԒ0S0?S4 0S 0S0?S0S -!0LS PU  0 0       0@P@c@@cPE@@PcPPcP@ -`!LQp 0 P 0CA2$,0 %@$U00e0PD!00e0P00 -LHMpD W@ !!8 2@  `0 @Pp1C4p 0V< 8 `*`p,0 <040(@001@P 0B@<P 0, D 800$^(K SS(KoSꌒ` M-Lx0\@ P7P3!0SS`p P4 00 ,?0"10  !00  0,?0"100P0fY(Kx0 P0\0 0     !0   PS -L @ p ?  0 1<00 `! 0! 0 ?  0 1<0PP0 P` o -L MR`Hp  p>^`W` 2QPY.EEwOE B1 @@P@*^^WP, p:`W` K$Tp 0-LM 'PP | p0R dK-Ap PQ[@P D0D 0XZG 8,4D48 -LM040K00 ],K0 @m,P\`  ](K0pP 0 W,Q 0 ]x "10 0 d] @T1"0 0 0@1!T$]| -LQ @ ] Q -@L X &> QU -L4M0t(K(0 F](0`S $pK0 p$@\P  H] KQ0( p֧$0`Sp ( 1]P# 2pL`K2A@ @N P0LK000 ]@ \ -Lx -L!M(1`"( S92RS]2S\@\@GP KP\/0p   00`( 0R $KP@0 P@-xhz( 0-PL@W\0 -L MP$K@p`0 $0S  |\ K"100!aRRl@0S`VXPLd\Da\@_ ?0U\@4Xx -L M`(K@0 ܦ(PpU  `7\$K A2@ @ 1P@ p-`L|P @ ;`P 4 8$0 $04 @4 4 '4 $ 4!00 4 $0@|P hP0LP @84 (4@0`pSp@0 @HLD 4@7pP3H 0c40m@ T43P)`pm@P 0 S 00KPX0S0#3  LPP   ᅴ\PU< @R@X00SX00SL0  'H20S\"0000SD"0000S 10S`\B\TRD2p` (,"0QP 0B1 :P !<'!+Anp`0Wp10STX 10S00S1  XSp3 0P @P PDPHx@U1 P 00S0SBszĒ(Вd `ؒlxhԒlp08HP($ lt̒ܒ| 00 0PT0P$ 00C0 R0 PXTt -LP -LP@P-  p-PL0` 00 0@ 0T0000D S0`8``0 0 0S0ڬphpPTX`-0 CR 0R0 S:00 -h1L0`SPp@D凥@<10S T (10S :V@00S T 00Sx:V@T 00Sp`f:Wc80 400S h  hO:ꨒ<  -LP] <~ -LvPS  -LKPI 0s -L 30S: S0S6R) 20SQ b 0R20SR Il2 2R P"(l2DR 0R08 KPK:t @2b PKR8 K-k00C020S 0S0`KJ Z\ 0S00R0S QPK000`` ``` `P 0S!0S @10S\10S d10S\@T T`T`08q@S@`P0SU rI$a`00S0P0S hIT 00S0S0Sp0X00s03Q0S 00S T\00S0`(K$Ԓ `\̒ܒpthlȒd,ؒ$ -L >`P⨠Pp 3S S S 0pS @u L72P6= P}H0S nԒ{ -L 0)plH`| -L 0KM#+: p-PPL `P @ᘗPp.ЭP 00劗P @T P P H0 yP @T qP.p p-`PL& 0S# nS$ 0 @@,㔭P0PP@`00@,〭Pp4Y0oS0 ` 0 0-t0L0PS Q @Q  P,0 r300 R00 -LMp,K0 GP1 -@,PW T^$ W@` 7P00S | h, 0` &P00S | W, 0(K\ -LKMMMK@D@D0,0 `~TKKP@AAPPbpP4: S  S 06L KPP L KP_ @LKbP, 0R(KLK V`Pd 2 RrbPq|LK F0p03Q0S 0W $0P_p U44 V44  5S40D;0D;4 d0%HIl0!8x ,thzX(8,@(p|h -LM@pP4 6PPP 0S nS6 =`P00QD @ Q? ᗓP 0V0S D 0 YppV 0`pY" 0 0 p 0oSPD00,K ^,0@S00?p @ `t0 p00D0"S 0(e$P 0 0]bPl$4 -LM`PZP( @(K,pK 0 g(0@S $K p-0LS`p@VP QP0P@T@T  ̒PP0  r 3R p00 R 0P ܟP 0-LM@PP 0S TU80K 2pk$R -PL`p@0   0@ -4LM@4T, 8 <( @  @T  dP@C ҨBK3APAD  0`D#D80x3P| T  YゎKH p HPdp4  $N@P 0GUE0S -SF 2 1APN@Pp!8R00  @2P"< D8NW@@NT *p@( P" Y @P1 @@, 0R@(K2p`A=HP0P0P0, Y T p ~KAA@(NP008#4 P@ 48 1iNK@DQ@D8(0S 0 4^LpB0S 8QaB0S j88S  XwPshzQ4b  -L$MDPK`pP5.P <0KD0 @@ >PC@ -0H +0K) K$-p; T0L%S񟗰x8$(#000C+K *KH#u-p30V1P@`P@   0] Z P@, АP PT0P p@`5P 0P +P  "000s20K 0p `B0 0cX2P R^ :Py 00@Td@Ta  ゐP  C1  i!00070SQQQ4 F 0SC nS 1 4@K t!,hMPPHP 01夎D10AD0 @@ <0 8@ 0oS1 4@K 4 0PoH0S @H`K0 0 (K Pf ` |]  pY (ܟP(zl8Qb ,0R@ 00 ,($0,0  -L0P R Q-L@ $P TR P-L P R 0-/LPN@P 00+8巶/00,+ w+s00R p-LpM/PN@P K [P0: S Kp0`rS@S  P0-L@P0 R 0 R 0.L0hQNt0 R0h0lL (H0 R <0<L808Lg0 L$(,R7zR --LM0 0 g --LM0 0 K --LM0 0 K -L@?Ԛ h<# -LM@08K0vZP@`AK:nZP0: S VPP SV H`@ZZP$KcP U @`0 R000]K@AZP l1: S 8K((@xK .SR S --LM0 0 c>gl -LM @Tp`P0S C 0P P 0004 -L,MD H &L0 0@  0 40 P @@Pl HP W@ `0YX 4\{ V 4 R08  C@Vp<@ 0S00C S000C S BV0VPpU @ (P0S PUYP:0 0 %0 00 ğP0P00 @TT@TQ tP?.@PX! 4  Y4 @0T l`VR hJ @T PJ@T &`V$`>SVXg 0 0(K4 Jk U00 U  0L P0 I @8 <00  0@@30f0cß`D0S D0XX @T` LP@ 0 ,K +pq Ÿ@TM@TJ 0P,@,4pp PB ^^I R0000 0W G 0020 0  0PP2  A R00C0VV X0Q1 `V` 0S 0SLP 0 Yti- 0`I, ^^  0(4P襘p-+)0\/ @T3 0Q  0匘 P 0@TRf LEPa 0 || -0 F,0  0@\ا,l4hxQ|  -LOMPP幏NKpᅾQnK 7@ dp9e@T:+ XPP@@Ku% ̥lLS P-L <@< 8 ,,e0 zDlp  p-0LPP` @`P PM `Pp  -LM0@0cSz bSz6 PK H- 0`S R r  :- 0 S PU 40!Vā,((0 "4^ LV DS  -PH     -LP@@<1<_Ppp`!_(p mP \ U(p0 !0@S( W VwEW# _cd0#`P jP P 10 pRpp8$X?dQz ((  @-PR0 00@ R! 0b<,4$<, 4,$. !,00 0 0@SQ:00a0P<# P8#,8# P4("$$# 4S   8#8S ,8#  <4<("4  8,#44 괚؝-0^00 *0Q AS^*0rS 00n00 0S 0 \*00b\:\00\ q00l P: !00S괚8P8$,4<DLT@<840,($ Q p-@L M0KP`  @0S"V8#4,|4 <0 @!0 0 Kp@8<#4,4 < @0  -L M A`+QOH0  Qp &0S 00000@0 KP m 0SKtIXX0  QPp <04  Q  1뀚D( -L,M0 K@ 9 P0U`p@K$ K(0K@< 0@ ,` ( @ 8P 4P PPp K:  @ -H@L"0 0尰P 0;0X -0PL@ pc`0 A0 S` a0ASW`AA0AS7`AQ\ HpD`8440e0P*@2 -L Ml pR R P P`@0 (@K@`堐(\;@^ ^ T$K耠P`0 Q  P  R  0aP0,<S*0 CR )00 \ 0 CR 00 \0S & \0 R \&&0R P&>hr&0R>h& -pQL@ᬡ0S:`00CS`0YX0  X0xmIp``B``!o0SD@`00CS`0FX0  X0 Q 0 CS  \  XQ "&P`U = 'B0S0C000@` VP  X U0 &X &X & p-LPL`@LDA0  0A$  php<$ -LM`@ AQ |oS%Q P 0^, ` pP , Rp RP R0S0C000 \  R  R  R,  R P @U@00R pAT dB0P0 LAPW 0yZ  $|AX  uAY @  jA @ cAaA!p G, R UA5(OA00 L 4HA8@T700 L T>AP1 R) 0 44A0! C$1 R)`00CS`0'X0  X00Sd0S` o$ $<o \@`8@ AH o$X o%객0D8  4L\pp -L M0B0r0 S P Q L$ 0RuK0AS@@0 0CShh@ l 1@ @QN QO @  l@ 0 X@PL!0S 8`V;0 40 L @L@(`@@{0@Ky@u#P q@k@ d@xx s xY@pV@h[㢃``8`ꄚhzD pL\8@L -LM0@0 4 80 D4xu/8aT,  cT ,  gT0,0 ) ( (@şş0`4 ğ4P 48 4X0 P$`0 4 dX@ 4d0S0C0Y  @  \\@0S4$0 <400S0C0PP  0@Sß0 30S0C0PP  0@S0 30S0C0PP  0@SD#0 X30LS0C0PP  t0@SŸ0  30S0C0PP  `0@S}0  20S0C0PP  L0@SmT"0  t20hS0C0PP  80@S@g@02 R (K0@gS@ X1 RQ oPR,0SlA/MP 0SL 0R!0S|B  * ( <LA0HQ$Da@q <8}40S,  p 0d0,   00 R H 0؝XT -7LM@ T0 P`0gS 7zw0SAV< T 7T TL '#>V(K0 K3<@ 0@5S(08`x`<D`t `<x` ````(4 @`TPU  T$0002p4 .d4 *(&80! 680 4 ,4PU 3 !R 4 R C 3 !R3 PU uPU  ,K@?0', R4 ,3 !RP3 PUe 0 K0<0 PU[ ?PUU  upPUM  ml"000PUA  aD"000PU5  UPU. 2 !Rm w1 2PU 1 1 PU !0SS@1  uH1 l1$ki$1 !R&H1 a_~ <U00V0S 0 R0w<WXROLIFC0?<|Qܚԝ@<40\DTȠ D40l4X|  -L@$M8PK pK8 L 04 ( 0@ ,@ $@ @@P PK`P 0 @@P 0PV*@0@Ujgd|0s p-!LM0@P` 8 @DT0-SA@P008@DT`  HQpK >K0C0C@ @Op> 1 R1 1R wW`9 8  0@4p nK`F`F+Jp@ 00S p<$ K@ @Bi H;0(hz  -4L0M@PT`t4pPEU50-S.@P"!!"""!!"!!!!!"!!!!!!!!!! PU  ,K@?0', RPEUp|3PLK 00K@L H@ 4 DP @P < 8P PPP0P P0SY Y *0 @P0 0S! @U (K2! 2 2 2 PU} 1P d0SP P20S 82  Q 0QX 0SW 0S0S 1 R00P001 001J `PXP00P0 1 R0SF0 `>  \:0S0C00:,y/kq/0 Rt :oP) 00KLK PP7P00P\ K>0:BV d`X:P L| < Pt,4 |0s -PLM`P0Mē#7p1 T0@"S"(&&&&&&&&&&&&&&&(&&&&&&&&&|(&&l(&&\(&&3 "p2p2Ac"P "P0`gSX@@cP P 2 Rj |t2p T"0SXc 0E2Sj(<)(<)(<)<))<)l)<)<)(<)<)<)<)<)<)<)<)<)<)<)<)<)<)<)d)<)<)<)<)<)<)<)<)<)<)<)<)<)<)<)<)<)<)<)<)<)D)h1 `d1 \X1 XL1 T@1.1 LP -   00 U0 0p;x0@ @lUU zUFBvU EqU@ (T|8($0 R P"!P 80@-t0Q Pl@ O\ 0 l# BN0R0.0N0N 00B0 P***** <dP`X-^𝔰1S00CSH,$,++++++++++,+l,+,+P01 `R$0SX01 `R:H01 `R:D01 `R:01 `R:01 `R:L01 `R:T01 `R: P-L   <4("4#6$ $ h0 -LQ 0S 0S S hbIh|0 ul0 -LKM−0HK,0 @T`? 00CSPPU`p@\K P0 0Z000 00 R@U0 0Q0V @0S <0S80S40Sd ZDX1R_K@\H[ <@P;0!` , 0R9(KP` P` P` P`P` P` P`P P P`4 `vShz80t p-<L 4(M"4Q l 0SPx1 r3VQ0X1@@UT ,8 0Kp <4("4!\jP@ 00@U O8T!P`UU U&Ƞ& &< PPq&Ƞ &<t hPg&<X HP`&Ƞ& @&<, P@ PR80 -LM@0DS3222222222222222 322222322222222200 0(hkhhhM0 -T0 ML\@4 <@P ,K80 p-PLM@  0 R @,hM`xK ⇨`P @.ᝐPP (夐P@T 800 p-L$M|Ÿ|b0 S P? R6 @!T#(505505050505050505050505050505050550505050505505050505050505055"RH :0! 0RYKp|,lpA009xP! 00t8@K0 0 80 40 00 ,0 (0 $0 g0 S08 K70K ?.P ,㲠 B⭠00[S S/0[0S S Q"[-K04"48#8 0 .K0Q/0[0SИhz00 0-L(MtP9@K0l 0 0KS00 R00$6 0RK0Qhz p-L`!\P@ pR00 4 L6. 45$ph5# 5| p-L\P@` !\ "1Q0 0S- S ^T)0 R ph5pN 00S S 0004"48#8008 ph5 00Sph58|  p-L@\ `P5TN  00ESX:L:::::@::4:500CS::::::r5o5l5i5f5 R R |ph^5\5 RxphV5pT5hQ5`N5XK5PH5HphD5@B5PD`4<(d 0-QLMP@& 0S S Ux0 R h 0K0h5 U04"48#Ƞ08h 50 588l x0@S<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<$4  4{ -PL$M@C !P- 7T H ldd \\PP L1L 4@1 R;41 R2(`00CS`05X0  X0K  0|4@ 0@p40 R KhS||`4X Kha8dp|(8 0-LM@0PS$ @K BL@@\ H@@X TQP 0v K0I000Ԙ -L@M0r`@0TP 0   \KP201 0S0C000 R2 R X0 R 0RKP0SaD"0T @ \@T`T E0 ><0 0XS0[  s( <34Q<a30S;00`  B LR` BX0X00K @ @3<1 R 4Q  30S `00CS`0,X0  X04P P `k30S 00 LR Ny0 R00p0R PTWX Sg@Nhz4ؘ 8 -RL(M0@``PD0  0CDK(K, @ 40 0 <  08P @@P}(Pj pPz  0@@yPt(0`'W*@0@V0SU0 0 R0@VDUU@@BP 0@ 8 DP < 0@ 4@ @@Dp2 (P- P? p 0 @@4p2 (0`T'W*0PS@ 0PS r01@Vt<'UU@@ $K&0*S D<( DxT|,hj r |0000 W0700c00B02p  4000 W0700c00B  -- LM 0P Q KP 04 -0PLM 0L -dL @uP H uP 4 uP  _P -pPL `P 0@0P +R %R0s 0D 00s 0D jP P@ Rd  0-@LtP 0000 hpP%T r 8000D p 0D00 -0 CR 0R0 S00 -`?L\ϟM080 0 P<0 | P" (s $ uP2@p  tP@p  tP"@p`r ,"/ P 0S U  T l 0  S2  0S` UT, PB B UK0P/S4P 4 40S 400ST   0&P00S2 s {8 80Sx8L tP80p 80 tP80p , P " " W 0S tz0\/S/00LP 0S00@ㆊ@P2 0S/ PP:|P  0Sd OR l*PH  "*08p @008:Y*  0@Sp "" V 3< <@t P02 /<K]p0@0KX,<@T 4,@ @0S 4 B <0S; 3?@ 0D0 H0 #P D0SDH0S H y[0D0 @0l@; _P  ,fH`H :R0@@~p@4 qHwP P0P0`P0 P R 0S *0S ʟ0S#g# 0`0S0S**<>P P H90S/ 90S+9R&Q$90OTS 90S9#-9#x90Sx9  d9 T9崳P@T Td,90SDPN0[S ],2P 0 :SSp`  :2@P00 K7T00 00 7PK0`K 0ܧpl70X p@K X'P0[ 0˧P  $ 0P0lK<0 B 00   0)P,ǟ0S' %~ < <0s# < Pb#0S ^#<0@5Y#T0@<0  00p@K00@ 0PPU0p<0S [0<壌6  0Sx6 } P`@*P@PUPl@PX "P00  0@PUPP8@T 50S58 }"R ğğ $ 0nEğ ğ$ 0d;ğ$ 0 \:[P AyPPP %QP@ 4$0H# 0@X IP0 #5ß3 #.T40S@4 (  P hp@P "  P K(P K0BP0 P R  00 S S  P P,@K ᜘LK> xL0SPKPP 2P "0 S00`ڈ`"0@LK P KP 4|0BP0 P R  00S S S  qPP@1qPP0 xL0"S V  kqPP2x @N[Pd qx@PP #ぇ1PP0S|1, | \ P<0s<4 'PQ,0Pt4hfX<lx, Q,\Hht53$$DdP(f mL$Tlx0D|d00 S 4|| @ @0S 4t00S0<@ 0D0 H0 P D0SDgH0S Ha]P0D0 @0a@ AP L0\P0 CDpǏH B: "b0@PP @ Sp@4FH#PP `P`U"0S 0S 0S#=#H"0pÏ0S0S*ȰP0SH20S/ 20S+2R&Q$20OTS 20S2#3# 30S 3 43 D3厰PQ h.x3qr P0S0S0S 30S 3`{30SDP 0P2 2 P \  <0s <X`*2 P8(K -MLM0X ,0 \ `$ @P 60SZ,0T QPH  0 S H$ PD  0SD 6C.K B0 BT4 d$ ,0\:縅P ,0\$v0PP4 , ( oP P {oP Ɵ0PD`$0YpZWP ko@PH$R P`$IpGP4/pჅ:`@@{PT/ T-*P0#03V0S& H@ hP@@cPTT*T8W P$0S,0\ pL  L$ 0[S]?P P0#03V0S @T 0:S(0p0@T! :&/P"0U0PU P:S V  R0305P1 :P: Pt`PL PW 0S V @@V 0S /-P@@@`@ß0S_(#U0 @0 P 7r00S40S80S  F[p[`[[[@[ q 0[ [p[hlHq [L!p[P[ 删[[[@D`X d\1,xq (☀[P,$<@p[ 8T,4Ɵq &< Dp[., 01(*t$% 0 pK@|@Pn46D@ 00CS( Kq D$1@ãP (5q+0[ [R~[Q}0[S t5 D[04$400S pe@T (ş 00 t`(E  PP0S)(0K  # P`K` ğt蔟p$\`ğpaH4 4@P00LΟ@P 0 , 00 (8 X` Tp L zPD D0S = 0RS 0S  R00-S 8> o0S> o=0S D0S  `= 04 S< 0@ D00S0H0 0 ~PM{0SMP00<0S<80S8<=P`P0=`*0<0  8 R|LzPQ 00|SM P>0S 0 S ( <8< /"@P000T  T T/00P;0S|0 S!P;0S o0 S \;0S  0S DQ,;0S  ;;0S| :P P.D0S :0 PcPU   PP| 0 00S `V%(yPL:,0 :`) 00|S @ N, ,0S  ,*P0S00:P9 )f, ,0S9t 40 90S,0,.KP0S;0 `i0 SPI˹P0P0( P0: S 0)0S00 9  V80S O0CSL8H0S 80S,0,K.\80Q (40 S8P x8P00pxP0JQP0S,0,(.' p@|0 S YPdU<W0/S' g0S 70S0SK#3&0XKPo@0X0 T@ 0XKS#0S*0S000-f6 -`PYPPv000 - 60S3 60S 60S+6R&Q$50OTS 60S86#$6#50S6 5 5âV ` V mP%0@U{ YrtEu0E 0S , gPP@",<p50S,00#30#,p3P 00 P@T@, fP0S @040PS4`P4` 40,V TL00L0 Q N0Su#]QX0K 0OX0 T@ #0S #0S @#0S 0XKS#0S*0@0 P@H0S 0S,00#3 ,2PP)0S, 3, T t T 0S,#, 0@R刂尢`p0p@`20S000@0P ,20S,00@,P  L0S BL ll10S. 10S <10S&XK0S0S *h10S1#p1#410SP1 <1 ,1喡00S000#3 0PP 0 S l 0@00S3,00#32l,0pLkmH.08  $4<80s$|<T\ܘD,UPP @Vl \340PSl0`Pt0`40,<W8T@0S@ O0y0RnD0Sk RQ810S` 4 (1R\ pP V e`0` P0`K\0 PpKt1PK@PQJ;9 0k?@0 S1P 1P@   10S1<  #Q01@P@@40S ,0S40,00S0NyH"0S0S<8(K -\4LWMPpP` X@K8忷 ỷ$4X  00KT P LP p!xPKEvP @vP#xK 06vP#xK P0Xx0[S xKX K00KŔP pd  PH3 004`Q,,#30P ^K E000S  < P,0S2  k`P( PG0S* 0S 0S  <P(,_ O,@(@`PUV@1 0 ]\xq 0040 @]4 K0@ P&B0S (0K  # PLH`y@A@[y00QS PJ 00S 00 jqPP:xP 6x 80K8 ,T0<0 (K\(h<px@ |xl, 4$L -,0ML  0BjM7zl 0-LPJ10S 0P 00S*@9w00@P/?000 t00S h0P \00S)D@w00$0 (0  @P0@Lܘ -L׿\ -4&46LAM (&(60 ͵&P 0S605+ 55PP5uP5eP5܅P55P5PP姵@P 0S tPP tP x~tPP dxtPPPPBL5LntP5  4|0%P 0S50T0S 40@T$@e@P 0S JtP EtP @t@p@3@40SB)Ǡ4P(4  h4p0Sh4T42)PDTHDH\R( $R"00A S0Q0  CQ 010AK!l0SH$  00BQ T   @R@,RR ]RR @\S0S0S ]S014g<0,S ]S& L 00B S0R0  CQ 010B@K!l0SH$ 00BQ QP< 0S`0S0S2Kp@(| -L@Pt00}S h00S`0`fTP40 @0R80 P$0  |&t 0-@PL0S 0@0PYt 0  0@Lxܘ -Lt0t0S 00CS0 0  0  0嗛0  g|X -AMLMP44 0P0004 @0P,4 1  Z Zp6 h10S' \100S<1BK0`Ns 0 r 0 R0 @R 00S" 4,4 04R Q|00s344dX 0@Y ᑫ800S (K (d -AMLM< 1BK1@@ @@, 4 0 eP #8 巻B^KPEp`ȐȠ PE4K0S0 0S P0 e 0S 0 0 0@ (KTH@T0D|Q`$8L@.A| -LMH@0s 0 Khp 0S耙wt@ -L1@P 00s%@T -LANKM @D+`F}DPlP ~K pG@Pp(8[/S@ VP K08SS/SK0( 0-0L0M0@S DPK0 ֭ 0[PD0SH6 40=]P K0P -AMLM4 p@8 T2 0S2@ P 0S 0S4 00P0Sx:PP 0S`R~0 S0/R0 S?ia0BnK`F@+|(0K 4R/S@/04B+d|Ph9!X0080 0\0 ,$ 0BnK1儑儡4D`FP t1p3\\ PP 0P @,100CcSX108P 0p30$0, BNK0@DGX P X000`P V@Phn@h U00(KP..`$xpxL$|T| -LM0脙 -RQLMP`pF,20SB K"@⻬,^KⷬyPP뷐PQPOK@D^K9S0!kQ`$dPP뢐P PU  0O`t J`Pd!UP TT(0KP@x0[SPF-0x@KU @p TPV`JPT@@pP 0w03T0S 4P X0 SpP h00S`0  (KX! || ,4@H(p@ p-2L0PS 22 _2 p2 R22PR x2P 0S\p/P 420S 8P(20S 12 _1@ @{1 @{1 @ {1 @{1 z10S1@1 T!0`0PV | Aj@Ph 00+X0P4Ov P!%'*A @,ą0 .ą0 t @pZDUpZ (Koz(K4t -LAMJ_K, ,KOK٦ p`P#0S @ OP @T T |% R 0SR( K0ACp 8 `V000 JKp, w(KH  0-L P&p@}Z8= pqZ 0h00 p-`LP㺟P㷟P  $0PS( U@ph觟@P -L@qpP`7 0 0  0 0 0 0 `P UP P UP$$HP( ($ @TP P@`$ -LM, P<0<0S`A(K$( 0V 0Vd18S_8a@$0S(/01$00Ea@$0S(#, 0p1$$P(B 0!硩0($ (0q`$0S(,0@1$$ТP($ ($ 兩( $ 0!a@$0S1S $00絢P( 0!hPU `X,;P`,H  -LM@P4K p0S   Kp0 0 T 0S 0S  4@K$ $`K P% P 0S `pt @T `P64pK@0PS /@ UT $1 1P #@j`40(K  7p (P,`P ( Y(O  X I@4pK0S  X>@ T<0 80Q XKHQTpH 04 -L$M@rcPPT ppd @@K$ ƤD s8 p 0Sk Xe0`ɡP, ]  ҭpXQ,P@QKPUT@D0 sPwX`7,ɝ`@0 sP,)Ki$4LX4| P-L@`Pp\i.  r 0000SR 0 ?``P'R"R $R `R \R `F0 `F P@T:V00\ o p-0L0S00@T,``0@p Pp C@=00\PD8, php -L Mp@p P lhWp`} \2\D庢@P<p ǚ,R,,Ka( 0,0 0 2K p 0S W P 2[ pW `P "0S tA d0S  pjW 8a0S D@KP k r0X 04 000 I@T00\0@U0H0@L5W tH0s T#$K.4( ,<@Xp tD  -L M`*1 PA1@qP0!0ˢp PZ*0pSZ` |!忢pPN*P`p0SK P!峢pPP`0p0B:?$0S $ A0 坢pPpP`**` V40 S'P @`P 40 H'P @`P40x ='P @`\ qpP 5:@ `(K\Z4Q(D`| p-ML M00@S`0 ZKPE*ၢ\P *tV P%*NP  K@*dV P\%*TJK@D\ 00i/@"Kp@ p-DAL0S8 M$1` P @00S  0S 0  P U@T00Q P 0Uh@p00S0@ @8P ,000S0ph\z8<$L -LMMH1~K pG`pG@P+PK^-ۡ1!0x6 p& V !0K@QF t6 l& =8 46 p@ 06S r0 ; ;KSK?;05 050%50_> 0 &%%%  qK<H l4 -LMMA~K pGPpG0`+0K僡^-~0Kt6 ,0x6 d& <0@h6 0S1!l6 p& 0SS0 ;0& 6 0ˇ0S R0 0 PK @@_p@ 06S 0 ; ;KSK?;050 0505  0 0CS_>0%050655$0 K<H 4 -MLMq`KP @@+@@K^-d1V 0Kt6  0 &%%%  }K<H 4 0-TPT0L@  @04 48#8 0 0h* 4@  0-LMA0KPH@0SG 0S+C 0R @0 0S00000c/00$ 500|/ R 0  00  R00S  00 00 000S UPD@QH(0@ 0040 00 8<4PpH  -LM(KJHA11  (0aXy[$PUt10$0 @ $!$88Q` 8q$0@St0 ?$ 0($0 0S0l0$0X("(04"4_.0 _>`_> P010@? 04!4$@8#8LD0 G00$ $K<H  $ 4@  0-TPL@0v 00 00@G 0$00hk< -LM KGl2  0QQ pc L2 H20W008 Q 0\ R 2 X{1 00s$PU1 10$0Ӡ1 @$n$1a 1P$0S@ $^?$0S $0 0S00`$00K 10SS 0 0S00,0 0/0KC,000K"K0SP_>! 0WP8#8 $#$_>_> l0,@u [@04 48#8DL0K 0,0$ K<H  4$\ 0-p@LPY000!R00 ,@PF 0$0 000h4< -00L RR R R \h0SHh4@<0 00c 00h<0  p-LV | 0xP0t @00S 0` 00ph0 00@F 0$`ph8<0 -xL@QPPdL"Mp0S. 0 `(V  2dFP  w 0 GS R 2 P10 ( $0p W@p1 h101$@T 0R; 8a1 S800 10T0S AP@zo*@ T⺡ 0@0o@Ph@1S 10p`00S ÜP@T  □ 00 $PxH < -LM`A\aXpX0$p 0, P$Kl00X $0'<0S p @< K\0 0X E0T@00@T ni/0@p50P 000p 0000 0# K4<  p-LM 1`0@VP` I@TPV0@x@KlE1S0`0 0= 000 00}=00  00'<0 0 00_x 00 00 0 00$@jx< -H10LpP`  iT@8PP> @T ~@Pi?P,1S 00 00 0 0PP000 0 R@ 0S@@DUi^$iw< <H   p-2LM0P0SS S S  x+`PxA0`Q0@P10 C\0 0S100 0;S<000@1S .0?0000@1S   0S  B!  KD 000000 R100 00000 R100  00 000 R1 0lx<<  -0L OzlP -L,MpP( $T+p@0S P0T0S0 0CS  S0 %S P P l(K } P 0 S-Dc0P8CP0P0?0`0@C@` ?S(pK -@*0 7"0 0:"P00| t2@Th200S 0P T  0$@ 42! aQQ(pK 2@0 ~d 0 0u[a 5R?0 (KgM:@K nP i@P \ \00\041 40T 0CS00S wT0T0S 00@  0S 0%S (K 00P @T  0i/@Dp` \(K48<08Thp  -7LM`7P PG吗pK⨠ ;iP8 cP dP`71 LP.qP㨀 + uP$ lP&0(' 00p 0: S+Np 0: S F&00w&.p6@0dSl`㚗pfPh- 㒗X6PP% H劗D6P< 0S00&{p FR6  P,, O0u0005`C<0PX0Xp0X@>'N |Z Id姧pp -0SD )N4KpN3lKR,Q*d@#T00SM0l  pM Px l0Sh0S XC)PPPrU  MZ垂00PUʛpc倃s@0P.T0 UڠvM &3pMp pSl4~pPdN  40K׹p~M(>4 40 0044ZrBP& R0|" p`@kTM D|2P@[DM X- 8BpI2M(0K* #P PUp8!M,a0X0 PEp(M7p 填p  "pp  p\  ĨpD |880T0S X0 00l`(KzD (@(4<4H ( @ 4Xp04Tldp|(\z(Hlx.@  -LM⌀`P$pKKPl N蓗@PTI $00 00@0 ,P ;P  8H , -LMpt`,K  ;PV`3 0P P0pP%,P@0@P @T T| V l R0SR@ ` ,P ;P (P `( -LM@$PKp A?@0CS` A@AQ 0#$Vʁ :P` :Pd0P` $P R`8ț `<\| -LBM`,KD  4@P P0pP,Pp1@dVP p WRB.K@ B B8D H$ < 0K84@4 AQ XQ IQ4 BQcLQB SQOlQ= bQY fQesQE tQH$+hb,K1 2P,Pნ@0 S H4 S <$ w4KP 4K @ Tl H4=c,K <"@P 03, 06 ,K 1@P, 0(  ,K !@P, 0  ,K l1@P Pp!pP`< ;TI ,PLq?P 8l?P0  00Kb?P ]?P  0K @$ @$ @4QD,K @$0AS,P9 ;P<4Q`D$P@t BKA A ᴚD4p(K4H`hp 0-LM@PK`  @@POH"$""""""""X"""""""""!h"x""!"""<" 00 04K9 0P*0)UP"$/P848z8v8Q8M 8I8$8@{ K ;P r 84( -@L {P t] id=PP\ P!; 0 0  0sB iq}S ` 0  0R0Q0 0PXp 00 P0`0S @@>T0 0Sz 00 0 000PH$`x< 0-LM@  @@&P<&'''''''''''%P&&8'P'h''''''''% (' ('''%%&'' '&2Rp 0 1hRp 0 1(P H0S L0S 8P $0 [ K040 -LM K@P @p+0`V&P^QP  0S 05 000` №0D0S 㢑PPTX  a0DP@T$0D0SH @4XP -L\R\\r\M,Ks`0SDg X@WT,A0S : ,0R0``0c!S0/0S (qA!0 D <0 0KKK40 0S #K DK⤲pF0#S- B0S) >'F4 3[ R T0S (0s3[ 0S2[ ⪉p2[ 100@S 0S 00宻p0s 夻L(K4L t  <  -LMPap00˒NK 0$K $0^. 4@ 00 , 0+s( P4pK0, P@K '0 L0 0P` Hp D0 0 p@E K<4  p-LMP0  ( ,  p@D` 0K`pDT0X0@ `pD 00@Kp4$ < !X  -L4MPNpK02 ነ <`PP 0S DXgP@P0D ڙP @D@0 UKt  4lB  p-LMLS8 SS<7fS7 bS4 eS49sS- tS% lS-&TJp +4 $ 0s Lp0 QQtx0:p@p 0 P p 0 @ @@$4 (h0ST3 0T00w0S 3 0W pWڔR t30< @P W@cXP pYH H bQ IQT BQLQb SQqsQj fQ lQTtQ xQuT0S"PE- r 000X0SR 0x"0eP``'R"R $R `R \R PE0\  PE `@X0T:T0Q"  PE0O < 8#" Ş n\PY   0!pPKP`@. 8C8 0@!pP9P`@ !!0ьpP* 0Q   3\PP`@P`UP:Q X` 00ƴPE XDYP PE ƴUY)ٌ(K`z|# ##$$$L$p$t<@`h$5 -0L0 S 00CS00Ӥ0NtN \00! P 0 000p0 T0 p LPQ(0  B000X d b -LMlllC`Ppp 0  0#Pp P "P 3@P2pPppc UP\P P "P @ T 2嘂7\00A S-Q5`"d2PX"@HTpPpc0%xP00S P0p 000D1 T1 @ TA1ā  !0^\JqH t0 00A \!`1PT!xTp Pp@B"0 -P_P p 000 0 T0  p 000D @ T@" 0PT0 PL0pd0 00i\4@` h T  $$ $0Ix`$ -錠0LSt`tP 0lpl@ 0\P0 H0  0 0X,0000h T  d \  -L@\ pp00S`0 \0 X0 T0 0000 (0 T(0 00h X \  T  -PQ@`Lp "  0|0 `t0Pp0pl0 h0d0 `0 \0 X0 T0 P0 L0 H0Pb d \ ` l  T h X  p- 18MLA10 P`垊   PR^0۸00S H@ @0P80 D @@ P궏K/ `b \2Xp"K"K( Kp2 友@2(K 峠0@C $ 0CSL@v$K+4<8<P<h<<<<<<p@-<@< `P 0000PQAp  -$0@LP A c К -d@LP APH<Df0,0K( 0@ 0  К=   -L 0LR RP 0R =x = |00-PPp0Ll Pd8>> -LLrLLL`~@0S 00CS00PӤ0==PuG  Q/0 Q@L00zy PX800CS0^A0w0V S0`0CS@ 0 L!0d800 S0!00 U`!00000 +0S0#3 PP 80S0`006'` 0S0`00,'V @V00 00 0 <0 `  4 l (>>  -3LM, 0 0 S@`TA9P, `3@, P00T$ -LPp` ] P  |@0UPh0S \0S@ Pp `0U0U0S    -LP!\@`ze%P@6 pP0!S;P u6H;<0<80P ,-V0fD>\>`Ql - c L@p)"pW0 WP\00dw PW 00CSP 0 "0a00 R0 Ch"000S 00CS00Ӥ0;;x0S0  P 0S0@ P X R/ڈa刡0 RP\00 w P5d00CS0J@A0 0B u?0P0CS 0P00d X00p 00S0#3 DPP 5yW d0 00l0 pD0 00@00S <00SWpGp   4x>  -L M4 pTŸ`2 0BP00 p30!00P `X`1 P00CS0\A00T Q00CS0 P!0q> -0L!SPpc#P@4K`P0!Sn9P 4D80840P (,$00g$>>`Qlh @-P0 H  @0S@ B0R0\0S0    P-L 0QA\Sp3 -LM@*d@D0T@ KFP ![R00 B ![R 0 B @Kht@48 -40L0SQ @ 0! 堁$\  0-L@<0P0S ,D0 10P0  G(d -X0L0@S 0!S 8c6P /R6P Є> q-L P 0 008,aA1S 000 ?   -`0L0ST0P0D0 @0RR,00Q    = -0LM0@S  D0`2p00S  Px0Q 0/SANK @D+FLPP @+D+P 0㕂$ ?`  ? 0-L@:<0P0S ,D0 10+P0 -$L` Q-Q0K00tpPk3100CS0/@00' 0@0CSp0@0w0\d 0\S0S0`  R03<@4 0-LPu@P#3(0  00 @04 p-L 8 0 00 01hz  ? -PPLpx00pPý`@ }P 0 PPP@T= h  -0p0`0L 0P00CS07@00/ P,Ġ0GP|P y0@0S@P0 0C0f00h0@B`0T@ 8P00 $  h   -2L2@ 2B0PT@ P0 P00aS000 0 -1` F  P 1 0R P00CS0MPA0j0E B1p0U @`` @000`000@p U0 00 b 0 00Sd 0@Cd0T@ DP0(0    h    -lAPL\1@T1 TpP`dU0de`$A=000PP ZP  P00CS0*@00" J0 0CS0 p 0 \ 07p`V*40`bpV  h   -2LM 0S0 H, Er娂@`7P "00S&00000 SP\{r PY1D00CS0c0 0CS P0  "0p0 x0@`, T R ڐQq0 R@L00Cr P!1d+0@0CS 0@A0=0q x 02P3P@0 J0 0;P  3P00CS0@00 0@Cl0T@ LP00 m(K Dt 4|h   1-qL`!0S+PP^ 1@00S S |1|0S0`00U@0SI 0 R0PdU0.S0 S; 0P00@P V O `P 00CS0@00 T0p 0CS0T 0 @ 0 h      -5LM 0R,0 ,KR5P^ u,0 QtUte0 Q@L00?q P" 0@0CS 0,E0=05 dp!00!S3 %S  Q0 Q@L00q P 00CS@ 0 t$0`0{00@0 0\S 0 0@ X& #@T0 TP\00p Pr 00CSP 0 #00G0  l#0S 0ST;P00 Q0 Q@L00p P@ 00CS@ 0 "00"0 0Pp0L0 0P:Ox"0Sl(&\Pw02 , Q/0 Q@L00kp PI/ 00CS0oA0h0g 00CS@ 0!0Tt0 0P0p,00Cs,0 @00p 0 S  R$P`0 R@L00p P.00CS00@0CS 0@00X0\@ VvP0 p000%S!S> HL = ((?4d  -"LM00 S1 100 r 0 R R$K!P` 0!S 00RPXp1$ \1O$0 SLQ@ Q.4Q4q0K00o`Pw. =00CS03@00+ 0@0CS`0@00|0\0$0 $ 00$  Q000P (0  0S p>0`>PrP0 nR pR lR 0P0P00PP 4=  Q =0S ==~PH==QP>P0 nR pR lR 0P0P00PP d<  Q <0Sx <<JP,0 0SS0 x<0S <0S( p<0S r ;000 8@P P0 nR pR lR 0P0P00PP 4;  Q Y;P) %P]PP0S!SH +>0S, 0S @P ; ::;0SZ rc T:000] P 0!S4  P0 nR pR lR 0P0P00P\ 9  Q 0S+ L> T9`V 9sP`GTPPgTPWVTP P0 nR pR lR 0P0P00P\ 8  Q  P(00090SP0 nR pR lR 0P0P00PP 8  Q ) 80SP0 nR pR lR 0P0P00PP t7  Q it'00cS0 `'0S TT;"70S. P0 nR pR lR 0P0P00PP 6  Q 860S @7@c(7PP\0 nR pR lR 0P0P00PP 5  Q H60S 66P| $0h&@ 0R P0 nR pR lR 0P0P00PP 45  Q 5'@5ZPG 0 nR pR lR 0000P 4  Q $5 55/PT`pP40Se @Tk40SgV`pT P0 nR pR lR 0P0P00PP x3  Q j30S= h3P( 0 nR pR lR 0000P 2  Q >d3 \3H3P 0 nR pR lR 0000P 2  Q 2 220S:P0 nR pR lR 0P0P00PP x1  Q 10S |1 Rt1 d110S  0 nR pR lR00P 0  Q L10S d10SqT\ P5q 0000 10S1  1 g@P! P0 nR pR lR:0P0P020P  ?? dLSl@\ ((?(@=0`\X?=  ?((?x D@p?4`  ?  h   (tP 00  Q X00S+ 0S0!S+;0S0S @0P 00P 0 @$q,Q`0gS  S &:00C S#pS rS` 0`0`0`0 1@sTP000`00V FvV 00 S 20S@ p02  1 0 S 0 Sp pRV000|2@  @P00CS0LB0y0D ART P ʈ)e 3 @ #00CS0,C0[0VPP>PT3h#0$S0000W0#00#0#00# 00 0nS pS lS0 00 00 0 0\ 3PP0 nR pR lR 0P0P00PP X4  Q N40S! 444 }g4PD{P40S(0pW50SH'P0 nR pR lR 0P0P00PP |5  Q 50S #50S+P0 nR pR lR 0P0P00PP $6  Q PSQpqW QWPd6 Pt60 r 6000}`P7 60S6 R6 6  68P%0 nR pR lR 0P0P00PP \7  Q 0S0!S+90S0S`{7WT7 70QP7(0P00 0S 80SqWP<80S0 nR pR lR00P 8  Q D B8 8 P010CS  H1@s rP00 0 nR pR lR 0000P x9  Q |9)00Q0 mP0 nR pR lR 0P0P00PQ $:  Q D:P 0S4:\:Mh:0St PCP0 nR pR lR 0P0P00PQ :  Q \;K;W|;0S( A0; 8; P P;  PPp P -LxM  Ni5 nPڠ0000SrSh5hehhhhuhU@sP xP pP00 @ >0  5+6%p0 10 00b0 0S 000-S 0@S@ʠ000 00C0 zTTP@KP0: S  0${040aTP 3s 0s-s*sr@P ?7,#000S 000S 05P 0pPX30S 000!S 0+L(80S 8000S  20SsRcT0S 䒟䢟"P QPB-"0S& <"0S"p820S  p2Rlh2 0gKP20SH"0`008*"0@0;"000 S 10S!@0`00@00@P @P  @Pt t t$ @!00,,00S  1R 1 00 S  h00Sc 0R0 0VX@` `@l\ ((,x@ `\ @@$(@400CS:0 2`2 0hQ0 QP\004d P5 0l0CPdS 0T"00@0,  2 0P0@ 0S0!`V&0 VP\00c P"00CS080t0CPlS 0 \!0H0^01 00@ 0 0c SC R/`p0 RP\00c P"h00CS0@00 -0P0CS 0PP00(0 00@(K | t 4x  -LM  @$" (2 P  Ld0S  0@_K  0 B 廢P$" b  ," (2S  S ;#rPU0 U@L00Oc P; 0ß0CS@ 0 h0LT#00ß0S 0D i K 0P 8"RpW$0 W@L00c P!00CS0U0pŸ0CS@ 0 X0D"0t Ÿ0S 0 DiK`0S 2S ,\    ?KPk  "向0pf 0 Q2 /hQ`0 Q@L00b P!<`00CS0AA009 %60@0CS 0@00W "1 $ 5p00S 0T@ h HhQ"(K t | 44A| -L M0P䑟0C0 4 , 0Q000 400pP^A RPX|0`00pP[`P UDA  LPP!00CS0:A0+02 /V00CS0  00 P,00,0 p@0d 0b, RZPP  P(K h t  d? -L0  0%Su0 SqB 0Sq  Q.0 QP\00a P \0@CT@xR00 !0<0CSP 0000  Q@ 0S.@D/\Q)0 S0 @!!0S 0S0`00 xtQP d!000S SPFq@a$@00 S R0 a䀟0 RP\00CapP! 00CS0#@0@0 0P0CSp0XP0-0$ H0@00  (@p 4  x  -@p@@0LP` U0@ P0 R00R00 10BS 1@s @@ gR0000 x p? -`吀L p Q0@P @~\T00Cs0,0 (0000 0蠣h   -2LM0s22080  20s0xB0Sl2  .`"0X0 @0A0 S6 000  0' 0 00 0 00L000 000 000 0000 0 00   00#0\L 1   @Bp4`K07# @D0 0C0n##0 C0?^NPnʬ00S=t0x@C d0 \0T800@ \P00 l(K褣h  PA   -PpL0` Sd 0 _@P 0 P 0 5$p 0 5$j0 % 00(Xw[@@蜣4g -/L@P  0 ST @T 0/S 0/S @T  -L|M  P  ) ᳯPP3 30CSddd0SB 80Se 0$ p0/S0`c,4@ 0T/S/000h0 S" 4  PPƺ0S (K@ 00   Ӎ00PKBp4 3ST D0 Sp * R2 0: S  R, T Rw  RV QP  0S. O@dp  P$  $ p3Sj D00* RT2 RH2 R` 0Sg ]~PS!F$ 0 pf0: SF1 Rc0S? D0: R5  R+  R1 R q3%P) 0S h@利D 0: S  U00 1 R q3,P -@ jq3APv^  000 0: S 00tP ܉H lH DMPT@̉ ɉ묣lA{Є    AAA{ -LM@PԓE0 1 p0#Qp5 H0@*S*\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\"p2`@fT"0Sa 0S !001pw2`D1x2xB-Q+/ P*JePDd 0 0!KpPwC0SkVu8  +!00}1 yVK1 1 q1 1j00g0p 1 b p ! ] p ! X0S 1SX0 0S0S 10 BK 1: S0S BK. 0 . B0 )kp 0S pBh? \Lj P70: SQ  B(      BPB B 0-,@,PL( d `klzBB -0 L8}P藸0S 峆责C p-0@L :#:0$ ?RP@3c0(  ,0c?B3c 0qP`[U  WPP0U* PP*Y0U0. LPP.p fPP0 B0S ^`0U<0ޑPP N+0U`0dL4qPP 0-SL0S 8(7`p$1` Mb0C4 R, D$0S PD00CS0 0`0 Pp@@ 8$0S0($0CS00 Pp0@@yVYV k`v<{0S 1 ,k`v BKⳇPP$1:( SPP@P0?8 0 o .  p  0T00(s@PU 2 ]P/0op8 t  00 dP0?PX  0@0@ 0@)0S&Q$SŘ˨0000 P`p e d0J8@P e 060 <(K NO qTtGtTZ vTo`0H8 nP (0@DLH g9dF,K ,00SZ |/~00?l&BP 'L KL 0 0086 @%P=035 +' P 3D( 51:~5 *E,p 00.S.0@0KX8,0 , g b'0,0 0%00Il%000 BT000ML $,0P! 5Pp@K5@XmUP 4@0D(R 40TS4T 0DST 00 RÀś$0s400s030 P CK.KI B BI`T( H(00 @0-S 0SD8SCC000S30C S;l444d44l30S\ .0S.KP,  @K|P @KT(#0W P *TDuPD00: S   JD00: S S0S2P" 8TH0S h"0SP h(D8S)0S D+&!0S  +P10SP @pK !0pDW P: V`<d!0S x0S810S "  D0x\0p10  L8 P P`0S00S 0S UP 0Sc~V`PPT00S zlPtPH(xPCPP(PPDC(P Q(>DQl`QQlQQpQQlQtQ 0-D0LS@ 0PUPHP)PP0D00 0C0 0 -L`pP@@PHpD@ R-LP` q@0@P T@T O0 0VX1Xq 00 @0D00 00 0@T:p VOp@@0P00 V4vpV00 0P00 d@ep _]8 000DP  ZO00 DH@L@ -鈁LMPpH,  F@T A@ )PD p` p. 00;P'  gIp:0P  010P 000 <@PD`  (PD0S0S(@  g0, cP@L@ -PPL`p/ (0S 00wSp rSppV 000x000p000 0 0@00@ =W~p~NT@H@P@L@ -L M`q3H p0rSwS ?R@@T Wڑ00}RPw 1,@@0@0@4@@@@@@D@ 1嬑0 PwS 0 !@0n`P NTH0090_` 0HwS:XW@ W@@0 #020Kt0"̠10K"$}000K- K0 ` )0KX20K/K,K+K*@KD0 . K@  < (Z 08 0X  DKdp  05P  KP  0(P(KX@H@P@T@DRL@ -RHL`p$H X 0P @@ R,B BQRQ0Q@P`Fvd2TLDX@DW00 0 0 0 0 0 0 0  0  0  0  0  0 0 0 @^PlVd@VV}VmFP0p0`F@@ VV1E0\\0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0 @`FPV 0 0R@P`Fv  xV@tVP[ -PpL 0[눀H`$H\V%XL\8@#8P@'XPfTPLD@DTLD@D(0U[E>^E0PEU\EPE@- 0S  00 0 0cRÌ`@0  0"0Q1 P0 0S踧D  -0L0S货  -`QLp@00SP(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 #货  0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K 0@-@P $^ 0 SΎ809P  L0  ( , 0 8 < lPP0P- $P Q < ^018 ,<8  Rp-PL@4 0@Q1S``.Pp(0 `S00`(0,0S0 ,00(PpUE20Pe$00E`S0,0$0p040$PphpLL0%0  -@PL $Q ,0S 4Q00$,0$0P $P 00  00 0@-@P \00^ ^l\P:0 -LMpPL $`VI 0S<0S0S < 80 0(K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S @ 0 0P 0@P0P $P 0 S<0s3 QP-Lp@T $PUQ (\N ,0SK 0,! `P 4P $ 0(P0, ULS.Q :%<,0Q P0b0bS.00 L P0l0S.0b0S>0Xl0 $0 #4U4$`0% -$@L40pS` $P0 (P47 (Q$ 02,(000( PcU4:b ]U (0,00 0e0`U`1`!  NUPU 4e GU(0,00P00( 0S00, (00PR:0,0 -pPL`P4 $@T1 0S 0 S+0 S  C @0P P 00( 4UbU(0,0e T,P0 0 -L0MPP  $PU 0S 0S0S0 S00D < , 0H0 8p<`@ 0S񟗓9FFFFFFFF98:::l;;8=?x@AB CCXDDF 988< u<   ;< 0S  0 Z  0RJv`V0'RP0S'r0$ 0S8͟`F 30 `  0 0p8Z  0RJv`V'4<'<,4<0`80 00p 0S < H  D00<`8p p 080P\ 0S  07s`0Z  0RJv`V 0 S;;H;P; 0 0T0 0+X0 00LP 0|; 000!q`F<07s` Z y 0RJv`V0˟("('8,R_`0@ 0p@0Se DQ01 S@1 @!T\  HS@0D H0d d dD H @0Z I 0RJv` V"'5d  0 0Q\0`d 'w`FR0 0h Z ' 0RJv`Vɟ00 0'hq`Fh\0Q* h00h0S S.0L T0l T/p l0PVP< 00<0h0~T03L@ C01QZ  0RJv`P Z  0RJv`V:7q 0`ah TP  Z  0RJv`V:\`a7q, 5 00'q`F(P   Z  0RJv`V:71a q`AZ  0RJv`V:71a  s`AL  0S P7 000 h0 0h P*d `0h \L y:0S" S>/΅T 0 l@L0T l0p` 0P< Hl0X P00X0` 0  0pd P0< 0 `6 03T030CL01 P0 Z , 0QJv`S4  03 @C403<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ D% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`8 03 @C803<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D @,0DD 00`R004 hD Rp @D0 bSH @c 0 bR a(00b@40bRD@0 Q !0a@0 aD H 0 R0@0HSH 0= DQC @0H AD 00H 10S4  Z 3 0RJv`V@0Dl00@0@0Q00 H0 a8'4<,'<4 <S D@  00D`@ p0 0< H00D(08pS<`0S 0@P @P0< 09,0@ pc`b0 00@ 0@0 0RV0 f z8 QS@00<`P  \ 00R40 <P<  < <(KdPDFD DG-|M⠀P00\ 0 S |@0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q | 0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B00|0 02S0C8#(@  P P@@a800@|0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010p|ЍMLKDKDR 0`M#EJz -0L R0 R P0 |P0 |@||}0SX@` @PQT0D0L m0S 4fzĵlRxuRS8S -L M0@SKP.P K0 R 0plS 0-L M0@SPK00P K0 R U0p|S -L4MP@ 0'匧0儇oS000 `gR   0P` mS000 @fR  pT` H` '֏p= H0@0S0Q`P`P`PQ`P`P`PQ`PQ`P`P`P`P`PP`P`P`P`P`P`P`P`P`P`P`P`P`PPPdP`P`P`P`P`P`PP`P`PPPPP`PPP H $&嘏p 0P0 0S 10 -R# 0bST0SL  H0SMWppV00Lp L0 `QV< '  8 000CSţ004K 8@ὣ0S440 R, @ D 0@  T r`pop`lp`ipW0S `:% P p @ ` D < Lz`Pp ;PP+ 30C SSRRRRTSRRSRSS@Y ђp0S Z~ 0r\P ~qPPpV0S Gs0SH 0!R0S0S Z@Xv |P P R 0S0SH0SZ D@ HhPP PQ@  僒pT RI 0S0S@000CSU 4K` JPPl0S40 R| @ XP D d8K0K, KgPl0@0 ,00D ,0 UD0 L00L0D, L00L0D L[PM tD@ pP D0\l0P0S0L00@ D0 $8mP\ 1 0@0 D0 .2pP@  p D @  @ `ꔢ"00rO|nt8 nd8 xrX8 n Hn 8lrQzS( {SSSe@- 1 ,0^:*\7 /+0;;0b p6!  p0p0t@\E\%0\Q) p0! @p0t@(%(5\%R 00OQ  44\%R 004OQ  D08 v+P` wFp6 Sp4^  & |6 00P @@b b3a R`QR|6VFU 4@^  850L 0 0 0@4;D$+4 0@0-1 0( R  0 OK,JHß00 0PSc,tJ3 L00 R  hJ 0L0 R"0 0\2^ pF1 0p & l&R0 0@S1 pBJ d!`2 R T0 0fK A ?p6 S1^t  & 6 00P @@b b3a R`QR6VFU1@^  850L 0 p1 0( 0Ox6 tF 0 h04h000O    p l& 1 0(p6! (0 h04Ch000OQ  p 1 0( p!1 0( ( |& pF1 0( 0O6 F gP*P z & hzeTSħDDE -LP`J0pS000000 `S8#80 @0c 0 K)0p0 yI 0-P L@ EP 0 00 0)0 00 -L@Ah30,qSP: !0S2 0 !: S0Q  @ fU0S V&0S P*P 0 RG*PО0S 00f0hd0 PHh 4r tlEE,EhE\EEDE -LM\%EnK`F `F 0,            d$ `$ h P0: S4X@. 4ДP4 R 0$\Qp  00p 0S#Pm)P t0S!` 0pL4 P4T4 0$KHt 6 @D40 0S   G, 0R(Ki0: SP+ )P 3 pP@{ 3 O@t M|#004KT$ Ht 5(A-(37&(0S  00̢0S20S BKNN"1A\0A 2 0!00c000l\#0 0@Pb%Hǝ4p!0S" 2 WPk 1 PN 1 R] 媝Za`'0X0C0W )PI  h4s `!000'000,)hp h'0000S Ą$WBKNN+4K@T 00C0 , 0 S 㧄hzElpETEtxE|EF@HF|ElFEEFEЄFFT -MLMp0P@AnK 0 `F9`F s 0'U0 U| 0RK2@(P 0D: S40P ( hzاFElFT  -X2LM (40p  h, ;;S  0SSYPPV 0SJ, Y, P` ,,0+@+PU`RP ` YV4 P,$/+0;;0b\c/00S@\,0 @ ( @,0 T0000 00S0SU$0S xu( @,0 TP0PPP4@ 0,0P<  ,0~F -LM⸑40Qp,0 [0P (0 4P* /00S@0 @P, 0R(K0Q`0@0 P`0OO 4D;$+4 0,P  KLF?K0P  },0@ hK9F0 0 0< 0SP0SPhzTF 0  H p-d`L0S TPT 0@1@P|;0Sw;u;000pdp -@LPg;00 -LM@ 0@L %00CSltXtDt@t@t%,%00%00PWG -X0L@DH0 P 0S P 0S d4G -R00L(MQp h0b43X^u  0LQ OTUi H 8\J0@O /00@@D @ /T<9 H 0Po 0:D0O<0 8@ H, 0H< 00 8<  5ɯ @0O 0 @T40 0@ 30 ,0O$!D@K0@P U`] S1 R(K  0@OP`0 @?P SWSH@DPK`0PO` 0 @VU1 R 0 40<0O0U1 0U00吔 0R00@ P""\4P  P  oXO 0& D0S 3S 0S 3 @?#0@\000 1000 j B V V  V p(K! 0000#@ @$#P0(#\Q &pt"0"\Q t0p  0S00"00"\Q "0"\Q &Pt",K0x"\Q00d0X0<H"0P"\Q,00 ,0O 0$@"0 "\Q00!0D00!\Q,00 ,0O(0,@!0!\Q00!0@00!\Q,0 0 ,0O004@p!0x!\Q00$0H0L1T1\%R? 40O0@$!01\%R404h0 404O0@ 0@O\%t1R H 0 RBNKL@D@D08!;410SP8   HH<0  r 3Li!P 0\Q H8! 0@H0 00H"00 0S @0 @lHPH08(ALD hz0qT@IdItIp I $T -LM$0|S 0, $0000`6 \6\Q 00 @8F0P: S S\ S6^K 0(ŕ /R \5^E  0 RKAA` ,`1?($R>Kh d 0 T5 PE 0BO`E?DE @h\ X T8 4 @E ($R>Kh d lBNK @D@D0$P_"2\%R 0 L5O0@#2 O @E(0/"08 t2( l2\Pk 0 TuP21COpW<2PoP `H% / D5 0  R+ 1PX0OD0 H 0h!H5DE0@H5 SDE t0w O\&.x1P`pWPX0 S R40S00X 0 BNK @D@D0 -k!P 0Wh0SN?hd%T P%  0\Q 00S@0@p劓l0 %0 L5O0 @W<k00S@0 @hzT@IdItIp,T 0- L8M00 < L0 H0 D0 @0 80 40 ,0 (0 $0 0 0 KP0 LK@4p0 l0\Q \,=ubH  0@K0 =@T -Lp@PST$ @0S  0`@P``0 0\Q ,\=%00i2rP 0p : S`0P T @ >=0S ITIEl  -LLMDH RS, @ ȟ 0S 0Sp P ǟ'0S0@0 G0S ǟ0S7 R \堒h0@S 0S 0S 0S YD 80 | | O   Q ?KP``F0`_K`P`P`B2 MP`K 0v;2/R 0O? 0@l& @Ācp 0c; 0+@|B K2@壝şU0S %0 0C@0S@Q 0Mx5 R E0,P/OQ o 5 pPş@@_@P004@: %8P|o% "2"_K`PU`P@`P`D0`ğ0S Kx4@T D@T +y|T0S8 p9@T \3@T y*#0S4u0Dp a00Dp a00, 0R(K " (?Kp x t jPS3P@@@@0S3 R2 (ß 0S. p, R*@0 O  & _? d0 0< l21 \>Q,ʠ0p, @RʬrD"0PBS400q0, R|b tb@ 101Ÿ@ ,0SDR@0@0@0L00 20!0S pA0S 0Sd0SPx K:aPf 0S7 F|XA3|=tl7 0SbX 0S`D]<N @04@0 0S FPԐ!>ΐː 3峷hz hJJXXhKDYLDLlJl.Ldp\xtL\ `JLL0!Sd咛00!000|1 c 0|t1Pd<@1 T 0bqD1  8l0!000 1!0000z0pn@P`g h@0 Ra@V 1P@@ 0T0P lI@\TYzY(4JLY`YmI(  J -L`( pIP(X-t"1> R.#P 0@ 0. 00X000 0@P`Z  P 00X000  0!0@0@Q 1 R= R / 4P1 `XQ 00D1 R R 0S0S R0S 0S0 0S P 4PP8<| 0ip 0@0@QL] P[\,Q LLLLL Qt\L -xLlM,0SPڼ0@Pt@ pP D 8OtP0, @tPK`P`RtP p` 8ڼ0p/t@ 00T 0 PoPpǏ`pT 0/ X|P`1> 0P@`UVW4HTLd@U7pǏpX30 -=@PmP -0000-m  ,0 `0 , K\0 X0 T0 L0 H0 D0 @0 <0 80 40 00 , Rg|@ xP |0 l 4-x|0 O*| Ql0`  0ǏOP`L 0<\%R  l0SN < RJ ,< R\00S 0C1 0R' sR"QX,|@0A@ @,@0\0  |P,0 @|PK`P`Q|P x` k00H(Kp P`0@0@0A@D`ePT@ [`|0V ` l1`Pa `  H;@ P0@` S0 @ `+ h d *Y [J`0\0ZE:Q :Q 000hK@ h d R0d@SlZ,j00 R:Y l@QA:$Z@c0T@? Q Q%Tn1pP RL:)@00pdt)00PO/ 0\ux9@W 0T P9W 45S:  Zu I0S Z 9W 0 0BO?b9Q6p3@P2 Z Z@ Z6 T1!(0p  P P0S  \X8W00S0S @8 R (80W 1100(pg @8 R 7W 0Y  00UP@; Xg@ 0|'\Q ,&7+ s(L7W_ 0S0s,7 R 7WV  %(0 Z3PN  hPV 0&\Q ,6P&O?@0\u`6@W807pd` ,3PP &3P0S 00 U0x R ! :S5WX 3P0S 0005S: P UD5\uW (uU` 00%@0T0+0 0d + DPt@P4PPU^1!X0   0 S PUKX4W00S0S @4 R (4`W1100Xg < J6%O( E6 F3W  (Ř Q \3W+  0 0 0@1>@ T DR @Ӝt0 BR @P  0@" 000S00S Z 00 *60"2@P00`KD ~H"0 404h20 \ő\h0O0/S 82$B\h 0 l , 0S Xz Q!0\Q00h0 00O0@Q pq'nPw1W}0 0@#1?@|W1> 0P@`UV& d 0`\%R\ 40O0@10X 9P0 c1P 0\Q<  0 < 0SR +00 ]\(TU T`Y|MNI\M Mt<lMZ (ZLM0YML QXZpZ 0 40O0 @\=P$ Mp ;0P 00 00T+h0SV g P  [  U ߱ -80LM, 0,   0P(Z -1L8M11!00, P ,0K` \ X T L H D @ < 8 4 0 , R"ڸ0 @Sp`T`@ PP D@ o0`KS . @0S,  R00(K,Թ0 -80LM, 0,   i0P0Z -LM(`X0,0 90䠟p,0  @,0P0T,0 0T @T 0S0S| 0T0`0T R 0R X 0@P`0,0 ,,L,Q@-0 0 0S@TTS -MLM0,0 00CSr\p|b xPqlP} 0:0090 006 $6IFKL0%ş Z%@%0㴕X$ 44K%50h d i0`00 0S_ S;;SV~KpG,/L%0H%\Q@5(K05$( Kɠ0%\Q 0@X5 TE  R01 0#SP $0$\Q 0(0 0p0t@  R01 0# SP R P\\$0\Q0X000@\0FKL4  AH$ Z#0P0#3Z 0@00 R 0S 0R s S{ #PMPPZ<ß40@1`8#0T0 *PP 0S P0P0@V$Ÿ, 0R(K< 0PQŸ"0\Q6 0@0 @C 0@`5 \E [BNK @D@D0` \2 R@ LB 0̠DD1 0S@ 0?044 0 R P!0\Q 0@0@ !3dP {0P00u00C0  }ZXt HA 0̠T@ 0S <>Z(g $ P !P W PIM  e70P0CZ0:PuhzNFNp4`8TONZFhEOЄZ\ENhNLN(N@N QLDT -LM$$ @0 @.P48 [ -LM44 0, @ .Ph;348<[ -LM0 pPR0,0 `'@TM,04 KK,.1K-KR0-A[Sh00@PUnʅT6(K MK@1P 0 RH0S|, 0Ry(KQ0.S 0 0T&000QP8&94PU 0 0vPT lP 0S ^00P0  0 R0,-1KP0KKl.1K4 -1[0 00R000 P8#8D c(K 00  0 30 0C0(K -(K@@@T0ZP00 0 Pv 00C0q00S0SX$ T4 RH4 R<$OPPv @0: S00S00000CS񟗄Ld3(KPMK 100@e 0 00C0 !-@P0 0 R%Q 0.S PPP! 00S00@0S "H0X0P00C000SP"3P0S 00Sڒ^K PEPE0RNK@D @D00!1 R :V bPdIP 0 x0  8P,@0S <,P!00o t0(K MKH0XdP 8P  00hz`O0NhPxP,OHOЄPPTPPPPP\[PlOOOOPDPLTO -|!|01@phh1PL08X0S5 0pGS.000PP 0S0S `P @ 0 R@ P`P 0S P 0pGS00h 00000C00P0@00p<t -LM$$ @0 @+P<h[ -LM(p`W0,0 C0,0  P0,0 "1> R*A R P) R 0S0S@00$T pW 0@P`0:0 @   0@pW,Q\ -h2L8M```"P0 0, ,0K` \ X T L H D @ < 8 4 0 ,0S{ڸr a0S:ڐPTD@ 00CS5dPd00v$`K  P0S@0\!\QA  000S. `K$d P0S,0S3ڸ `K NQ R Q0S R`Kx 5A`KP 00 0S 00(K@<ET(QPQ -LM$$ @0 @}*P`@[ -MLM pTO0 KPK(J8!J,0 HK 4Q*> R K0(K8!Lqt QF ;hK8aXQK0 ŢK8$UU`~UUL~K8Q$HK8AQ`PHK8A`0\3  BB00B"1hK18a0 000S]0S  xK8$PQP`ӼhK8a`0^3  BaK80@%0 B 0HK0B!8A!L0   XK0H͟ (K8! LqHK8A0XK  Ba 0p@WHKATd7  R\0?00 10  B\ hK a Vʜ (K8!$5S.p`l h0Vp0&P P U 8K81$%U  1P01p`0SVU HK8A$%U  101$0XKXQO0@0@0KOX0@0 @P`(K,!  /  0`O0@K8L#P [(P8K01S XK8QHK4  De+0 0K8K,,KL0` P@`R`ZK8``L5HKsKD!8KP%81X?^ )(PTD, 0RM(KK$\^K8 K8!Pp(KP `p$41> 0R#4  R`0?00 1HK08Ap80P@`PW8 W#$0#0$0QK`08800cPKϊ/.Q00b\KK8T!0K880O8K 1 SHK$ATXKQ`XKa0XK008Q$%RK8)l 0 0 08S8K>C`(K8!8KK 4L!'P2 RQXK4Q 2Q\01\XK4QHK4A\0KH!n'P KP8 P K41 XKR(K4!\0t1 daR\0H!\'0 0hK4ax0 R0R0 K)KP P 0 0hK@aVK4p 0Q\0?0`0RXK4QHK\04A0?00SF P!hz\[E\DHXT@Q\\x\\`\TU <\[[[[XTPU 05 D0RK4K\040?0S5K8K0品!K4PU 8K@1pWHK00LR p-LpM/Pᝌ@P K՘P0: S Kp0`rS@* S% P0-L@P0 R 0 R 00h55t0 R0h0l eH0 R <0<މ808ډ㱥0ԉR7zR --LM0 0 㘥 --LM0 0 K --LM0 0 K -L@} h<# -LM@08K0AP@`AK:9P0: S VPP SV H`@%P$K.3P U @`0 R000]K@ P l1: S 8N((}C .SR S --LM0 0 . l -T L@Hd-P4T4}Y LedAC0, ,0 ,0 R R2"!5(K00@ S,"#, P 00C 4,  Q0 0C#4 4 404P8080 00,4 徐`Bⴐ00(&|, &8<0 0@@,@@8@଀@D ?%4%P%402,P$e<@ @ @ T 00S  0D0 00<%40A%40 0%, %0I % Z 0,d 0S d V`0P3  B  B00B11@ 0008ST0  000( ,0 R %ehT\lSdX P-L@ 00 R$hnS7 - 6LM , RvfFXS$3S Pu _%0ȟʠ 0 Pş5 \5 SS SU us :0,\ڴP\%85R h0 S0 0B RR40NRR00^td0OS),`% ?_%t$0ttS} \%h4R& 0O044D $0O84 R  0S> N/0S \ϟP>.`@P00`` `` `` & / O ! 0_Ss Pq nP(0..<0000P@n = R0  TIM0S T^m 84Q ,h\`žP &R^Pb F06 00`pW V p0OO  Q^Pa `0O?0@@ c@P5P f0,5P 0%?>T 0 5U  p5PXE T5P k|ş 5  05,5  z+h4 H]w 唃 , 0R(Kx0Sß@T" 0YßP@C0SI `_FDp+P, $g(`STGL3-K B BGP [P S@Td 002P c\54 S0 `5S|@>xEKw4 X/2GLß<0%,,o%P cS  0<0 iVfV$:RFTS8*06w1 Rb BR0 0 0aw1 R lp"0 0 0L|w1 R 8B ,<K0K40+Q5~@ R*0 4 N@ ` P0@_4 0K@P + <0K0@ h~0@@ T (KoZ(K4<Kt <KoXd@YHYDY8Y -LM 0@S `V 0 V p̐ pp d T 0`V0p8d HDLTL? 0<` @\ l2>4Q,h\pC00p`VXQ|Ya -LM,00K, K00 0S3\%RX` B2 R7Brv @T T `U@ | PfdU`Q\"\0Y00/H2 RB*Q}H pP4 q   0KH0**Qn 9'}Q4 Y 4 0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA`$ -LP`  PT  P P@  P8  P( $ 0 @5 h/ t7 : 4: & T$0  00 0( RD6 0  -@LP P { yhv 0-L@&@0PP HP6$P@@^P*$P0(b -\0LM@(0K( 0 @ K$ K0 P K$K -0L@ P  h{Q --@0L M,K0,K  [ K,b -`0LM00 0@0 K P @m KHb -t0LM $0K 0  $  K K0P $0@m KXb -0LM0S P miX@0 @#00P mmVhbb -LM  K K0K p@Lm5 aKb 0-LM 0PS    KK0p @(m0 ;K0b -L@=0#`c 0S00\ -p-LM@0`P0 RlP0200  0S CKp -0-L$@KM0 0 0P@$0 S000 @ & 00 0SK0 --LM0 0 ]] K p-PLP`   0[p< rP@ @p0S P P@PpUP@ 0 @pp (c4cLc - 0LP`p) 0S& 0S# ,[, @\0 0pll 0q[p\M< PP@ V0(0(0$`@(@$`@l( -T1L 00 0(Q,p5@p 0`P0 (@T" 0 0R 0 0Hp 0 0S 00 0IP 6 00 0t 4PP3@ 00 0t (@T lccD6 0-|0L@0S(@TH0@?PP 40PP@3P P30< D6 --LM0 0 \\" K -LM@IEp`PK! "P4 0|u 0 ccc -LM@㸺 0pP,K pl PEp`dP U` (@;,K P ,8;`T,4;0[ 1S00 0KU% ,); !pPFk0S Bk0S >k0S (`F(;* (YF( ;;"W0`SʌU!0S o!0 $K$0 0t0 ,NU`Kd4dhd p-`L0S* @P'   0P00 $0( S ( ( R$0$0phSp, ,0 p phph/ T -LV0@ 00 0(@T Ip`Pspj0S P! vp0Sj0 Sj0 S @ T Qbd< 0 0-L P8 0@PU 0sl `0  0妹(@TKvp b@0S 0Th/ -L@p"!p$ pdd -X2L$M0  D2$ ,0 (@  $K,K0{p!j0-SQ1@ 000 0s(@TU!n6p/ Cp`+ P#8@K P 4` 0` 8P &# "#P U<0!$14`lu,$!1") Ku 0 @p`P#40S 0:0rpi0S P  up0Si0 Si0@ S TP0 #@KX beQxebd< 0:0PX0 KX -L$M%CpP*0@K sP ,p (p 0P " "10aS1 @0 8 <` 4p @KFs w PK l`T!f 0uP 3 'up@ =T7i0S  0S( ^rQ 0 0R0$0 $@K5<\ |p G"4 H0xxx pQ00 SKP8exDe`e|eeT& e< ЙQ0 -LMCnKЁ+~K +tPÑyBPP|(K 0@K(P 7 tt0p ,P 7rX<0 ,P r<(=u tP 00p$`K tp@ Th0S $0[Sxq0S p0@T$00 S\XKD0 @ K\fTPftfTf< fgfPH: -LDM@i;P >H Dv-P 0(    NYP r7P l fVP sVp bБЁqP !Sp`10SQ  + P 0 P0T  P< (@K `$ ` 0 p , $(p`0P 8@KF  4P 0P 8` !  77700=wDglPghggggPT< g(g, + h& $' 8 20 "P: -LM@pPg es`P 0S nS0oS` = PP00 @ǶP @Q  0U0P P00 00 X 0000X  3U 0 Hg00,K ㈻,0@S00?p8g0"S4 03@Pb$4Pl -LMp`ᓽP@( P(K,K 7  0mP(0SK$K -000 0LS    㹎`zglh --LM00 @t3P 80 W WWIV㗎z p-\0L0`SP@8 ,P4php|gdii 0-t L@hP\PP P 000`@P 4,4$@0edA|@ -MLM0@<0 8@ =ɟP = = = B P |ː =x* P-] p4`Kl* hz -N0@&S:G G K K K G ,0 \  ㌳P ``rpWZl50S EP @^P  e  㤐| p* `  0P| Gd0  O| K4P;d$  tC40S 0: Sd 9 0: SP Sd:@`Ppj  P`P`0P00@ S| Ypz 00A Sa>@0 @@00@0d  0 Sd*p: #H0Sz(0@SdPh 0@3C 000p30SuH3 8cRT0@PTPd 4K  ? 00C02P2 R @4Kd  ? @ @4Kd  Xp? pPUo50@0 p2P%R, 5d 4K ?Z p0O<0 8@  0P0PO`&,ᕃ< K  x < K ` F!P8,` 0OP## ?a @00C0laD@00QH 4D A X18 8 04  ` P80 $0`ï @ 04 D0$ 80p00`$00 8040`!40 040 4KoQ`0ς`0O1>Q`0P0 20D080U00@ d O0 0H4K(KU mmm - L0R  P, n -`2LM0, S,0l,@P(2(R@ d  0? 2Q), 00C 0 БP\01 P\0?0 0! @ d 1 0; 0@4DX1 00C0p帀,0Z ! #,%],+ * 0 OS d&0OP ` x `0d 0@@0 0P`x00S0 x0, 0 x0,, $000 (00(KoU m,nP -LMK@,0 K`_0@ P A P @ P K  0!C Dp  0 K4 0@ 0 @ ^K`pL =0@0O$+41 ! d K,04 0D KAxP -LM@`pGK,PE1@ 0 A SA  )0K p P  0K ?K O ,K01B00@S  0K4\P L=EK0@0O4;0 dD04 0GKDK`AxP -:L4M` ?P L0 X @P T@ ɯ08D,;P,K[;0S ; 0t{Wd\ 00,: @P0K#:p   /`;:Q: `: Sr\ mQ (:  S4Z@ ,0G(x J @P@PPjɟ 00T 0L59 0$: 049 0B90A  (`0UT X0PD RD: R48R0'Y00 8 04 000cH0 400cL0 H00O85`qq4qTTqx ht@{TPrDY <d`8rHr ĐY ~H400S40|  00 00 ,00p0$@QPU``0^3  Ba0B 5 =0 B110L 000@x0`S(0 0OH4LD ,L=2 000`1PH P=LV>00h0 h0 S:h082 0<0H2 0\ T2 0 0R0PT0XT0P0P0HU 00 ,00@0PP40@0, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0 40S0 8<H4@P _4 -d `p8<4 00@ Pc@p4P`@ @5P`80, 0lc@@ < @K8 K00K0 @@&P8PK`VP ` Uap` p 5嬐K8 4 6, 帠 8d 0A@@c00@ Zᴐ 尠 0Y @K$'J F%*0)ZTPF70So@P'D*0`\%7R7\5*0'xG*0P7'8Q0\570S W 7PLP H L8X@ K>p [PxP PP\80X0 h R01:0P&{ H *T`p㤐K9),`0S-80O ,00 /@_d x)P0d PcP@c@t 0 S >  b `pP0I,0V0S z> :0S :P_~ :,0S=P @< ?>0 ?0 ;0 4 D0P  "J*0`POTHLV0Od F00 f0 R <000`P pV0 008P40 b @@bA@; 0;0(K 0-LM4VX0@K P0,L 0P< P I1VPK0Xr -0L Ű}zlr p-LP`@T ㊻0@T *0P/S @0P/S00@T:/MdP@0.S P@Tp0S .S0S`V (0  0S03Er -1L MС`V( p1 R 0: S "P8( 0RX$K ddZ\a\qp0SB@F00CS0A0P0 Pp 0S0!0CS0 0 Pp0YUyU8VuU0 S7K'. [0 R@@%P%0d6 KHP@FP2P(|hzrlQrtr -RLM`p, $0 W @P   ,T0P `VpW V@ PVQ -LMq0@QP(0  0: S ( 0R9$K 0St \DoK(P`% @ #$41  $ R p` K%P  2S 2S T00@/|2: SKEp 2 S!3 P 80eP G.P}$ $hzr |r,s -LpM`@T PK'P 1 R T0S "0 @TK0 Q p0S  Q 0 RnaP 0S x0 RhCT0  P 0 QR0 8s -bL0Sp2 R p JPP H@P# 0A S5p  WZ 0Sj P @ pC1 H@PT0SchQE0SD *P +E0 00SB 0AS) t  t P t t P @Į 0?  0S P 0S!0 0 R Q AD`P 0S S0Sl0 RpyvD Pt ## { -L@PaM0p0!?p- P0@"S"̓  ē                     |         ē = >p0 bQ!@+;0S j0W 0z0 0|0 t0h0 p0000z(0 RQLs( -000 0LS    z뜮Tslls-0 CR 0R0 SB00 -@RLP 0S D^ 4^TH UF 0@SB 10S<p `(<B0C3@ R 0S, ,B0S|yB@ l R @0 S0S400S(>h>h^Bhh 0-PL@0S(0h\^BQP xU^t d\00SP e <2B 0>^ (0h9^꠮sssss - L gP3"m @s [m -LM@/`"P0002嶷Pp2 lR dr`XT2T"PPPfP tP  =p2 10 bSP PP P 0@SX :qP!10S Ya@a,@ pQl 4  PP `@a0<S 00K@P Q0S 1 0S0+0S% 3KP ,K  04 P,00S 040 8K[P @00S d! 0X|!=DyHܠ()T( t(th$t( 8tV -0L &yzlt -LtMp  Y6*V0/00|@^ 0P K S``k0&p3 p 0: S/00 V 7P X 0: S &Q0 0 (K *P . -Lp`Y[[t!<p mP2 pP D!<p81 ApP@ @`u 0@S 0P/S @0P/S00 R:X  rPPxPO@P P UP#c*PH` 0>P` Qt((  -`LV@pPq \V Vfb[RC[VS  0 ^S0 0]S0 $0[S0.P =P:P 0SE  0]S0\\S0nS  0S ]S00]S*@P"\R0[S  S nSP \SW0R0000P R @t u@ -`RLp0 . ..arch catdatechmodchgrp cp dd df edexprhostname ksh sh ln lsmkdir mteject mv pax tarcpio rmsha256sleepstty|sync ... ... . ..miscԥkeymaps . ..termcap ...0@P0@ s0@0S S ;S s0@0S S\ 4F0gPV@v @ ̂r`P y @R"2 0  PP@J嚥 0ld"0S 00CS00 Ӥ0{W r@ ]a00010S 00A,K;1P0S00#3 WJPP h1@mJ0S hJQ 0H 0 , P4! 0qa00!干0P 0 0S 0lPP@7J  0| 0S 00CS00 Ӥ0ݲ r@ `!"|"(>$t"x" -@L 000@$ 0-PL @ 0P@000  -LM0S`p00S; :SiP 000S S,"PP 0@I嫤 0l0 00T2 0DD"oP<< ٿ$"0 00001,KY@P# Q000 ,0S:, , W,0  RO0#SL0nSt1 G0H00ڱ@$!0S 0#S0nS 1  0,0 ,0S ,0+;, a0 @\ \0 0 0^0^ d 0000H000 0 00,00C""x"$"|"!0"y" -鐁向吡L`Pp@)fP aP eP EPrP uP nP 41 @@p 1@Q婣1 4p0 00@pQ @0S@Pd0x@&P H壣< up(""""yl z(p",z --LM0@``0 ]0DSL0@ D0D0G  s 8TJpKl8zx"|"@z -L@PyHb   -La@PiHR   -P@Lp`8 0P 0 "Q -LP`p/0wS {S& sS'0 p P 0@.H 0p0 pp P @H 0( 08`swAQ<  swAQM`[~ [~swAQ`@@<@TU wwAQ``bwwAQAtwAQ`\tuwAQ uwAQ ^AtwAQtwAQtwAQ }CtwAQtwAQtwAQI= ƑXAtwAQtwAQUntwAQUn Ɓ5AtwAQwwAQ+wwAQ+ AtwAQUntwAQUntwAQUn w]wwAQ+wAQq9wAQq9 yU%#@G]rB.Um}K<o|,T墥G/.#%D ?anB_pǏ[x} \Do*LQQquQNN.S y s#cDi܌vM$}4G4fݘR!g,"@UtXP@]bI Ts'RJ^ޣXꄰJy W&HL1.0ƪ4 zDB W a8'l3 dQ˱#7-KQsU.$v>ֹKL}&/D6uXwکsmcW&T䞡%f!U &*6=V XN@DgQ\#Λ 4D\DC@=f=&lP7,Ă$MKUHKO!dm7,* WC2Nkmh",)f]Â!b+v2?Y5pbglҞvɔonpPU茖 -P` PLpK y@ W00   0 0 -LM`0PPp@0S2 T 00S S@D 0@0V l0 l00 T00}+0P S  0Q$ hl"Lz""hu-0 CR 0R0 S700 -L`zK((MP$pG!0 0R R0奙@P *0U P0ϯ` P0V00S06#3 d:GPP RG0S MG6<  00$ 0$K`""$,zh" - /LPM<K0t 0O00l :.00l0Q0Sm l@PT 0" R 00$P RXΟ 0SL0SPL l 000> D R000P RM 0S͟0SP) l0QM 0S|͟%!%*ll000 R000 R(͟ M 0Sl0 p3Pl  g l@0=0C>S񟗮  d $ d t T p l 8 p 8 [k0SK0000P 0 0 0l0 0 @l @ 6Sl  l M00l@000S6 ˟0S> 10S@ R  B ePd 003d 0` c E: J0S 0 ʟ 0 0 l 8 4J`0s$ P e P KP4[S 0y號艟PD9< 0U OFPVp )000 \P 0S5P" P 0S\ \x5@V 5P 0iSD4w5PQP`0VS80S$$b580S  W5X80Sd86#3 VEPP nE0S iER r<80S0S 8 ~P 00^ uPX70S0S7 l0SI 7C0S@ R  B kPd  00bh@ 0 07kd\h'70S0S 6Z xlƟlf 0S\F 0 {P8 0 0 0l@0 0 @l @ PP6l 0p0 @T\@ X 50S  0S0|l 00 # \X0P= E0l0  @` `P`0 LX0T 8 0S 00 `0S{l@ğ0@ `pZ&Up% \U 000C SS p0&S\SpP0@0S :K@ p0@` X$P0001 @D"0T 00tu& qr ßPd0@00S :K@ 0@` #T@0X o`000PUl0@0S :K@ @#0@` `0PS@`@  ß0 X0 `A` "0XSX00X0 0S @X@0 SS S X0` X0X0 @`0 /Y00 \X 0P&`@TVYXX 0PK  @PK l 000S 1l @P- PU* 0s<C' 0xl  [0P? l0 @,C 0~4@0S 0 t @t 0,  00S@Tl0\ 00L^0Dd !Nl00l0 l@T10S0S 1- K P(Kak00 P0-LP 0@@S0S T R0000 R000h 0FN0, 0-PLP @T000 0-LP@P 0R0 @@0 NP -LPp 0LP`@P U@@V@hNP -pLP`@ Cpp lP) mP ?P`@ 3ppp0AP` @=˧0P ++P`Q`0 +`Q xWl -RLM|"@o?P>@ 01p@Wk `PVk 0S0M Kя0S2 TPr 0S0PP 1S0S@T 10TMtA ppo0_? P .U?0#K"0KR0(060@ ;0-Q6  㽓( #K⸓0@ RU t3oMkM0+0#0K"K!pK  0\ , 0<T<MzAxWD`XpXԇWp 0-PPL $0$@QRmPP0WpX -LMPP 0-S- `pC#4op lP sP ?P`KG`PhM`PCP#oppV OA0' #0@| 2  0 `Px @T3 妦P @, 0T00S&R+PppT] 01P` KqP@ pKIP=@T 0%SSP`yL`T; 01P `K0S }L@T' qPw !0LSLL 2Q0 dfLXyL`@唛 8pL```TdL`O0 R @[$ R @?LT:L`@p@ fp`0QU Dp`0@ R V"T PWDpd@P `MD\0p8z4WDp m@WxW8(XLS`X< -L0M8dP0D($Vfp LP PP ?P(KC#Ffp0S $DAƈL ÈH X PU 0S x Dl3p0S\Dq@P '`$T @gT 3p"P  "0 @T0 D P 2 ; 80 4 c80 0x@0 < o΋0pK@`K,K0 < ,0@uP)00S "0 CkZP<j<@aU CD0Sh !b7崒 C .t10S<<@0/S4ZBT0 tlL 㶉P  3D0S> !D7 r1P+ 0D0 P0 *PHc0P DP P |QCCl<@H ㄉECx)C l@P<@X7CWxW8`|(X`X؋HX@D4LS0fP -hAPL`!(e`pp mP <1 8 C0C@`P- @pl  ep01 PR @@1ST TVp ?X /b@V ?XB@0 pR@D b@xW hW -`L0 R" p@@ T 0P P0 s 3T R @0 0S  @P T 0 0`XW -LM@PKp@b0@0  dp ?P pP :P8B 0008B@0S  ڄ`P@ PR1S0 01 0S00S 000@$K`X -LMQ@  WϠAl  Ko K`@H _Re$àLWO( lFFd $@ P2oꭋhQ 0 -LRMPp<K`!KKGKHP`y @@@@@@@ .`0SY DK!K,YK)0  c0Rc=9 =( (0 (0,  A, B, Q=9A =C, ( , (0 0 c0Rc=9 =0 00 4 00 A4 4 Q=9A =C4 0 4 00 \B ^b A, K0@S4 K0@K_0DKPf!KYKW 00!X 0R=9B( =C , (0 , ŀ0! 0R=9B0 =C 4 00 4 \@ 80D c<0Rc=9@ = AD @0 D ^ @D K0@D K0@t, KX0\@4 K0,Mj$KHVV?B|TtV\DLdl -LPM@lPK`ሀZdK 0lp 0I 0 0$KDV| -LPp@ bp fP/ vP ?P>@@ bpp01@T `eP0 [uPᧃ@T Wy,@Tp@xWx| p-LM 0S@P1  KifP/0S"  D 1`0P @e0P0fC10C0 0S0 ,0 R$0xxx`XWX| 0-hALM`!Pcb?PA 0AT00  KheP5 \51 R= 08S9 R 08S S\ 000 R\ 0 S Q0000 lp0?0bPZK0@@ (0?xWD`Xh 0-ALM Pa?P80AT KdP%  0 0 rR P0S @@ZZCP0@0d0 R R 00C8S@ 0  b?xWDV@X`X -<LM4D0P$$,0 app ?PA DSP#pap0aV #0p6 00LS001 000C0 LR\u<0-W0  =W10h0 0 +W,UP (PU Q?, 0R(KM<@K<P pUv P a0E`S                     PUp ֘XIP `@PU ʘP X0E S)               X        L   @   4  (  @II @`@`*C`@` @`A`p 0S>pbZ;@;W" >KP`@0 0=00 0<00^L@D,00tP@T@B>FD}>AhzxWX؍H{ȍύ̍LSЍ p-AL!``?P8 0Q@P yP# PyP@ xPp@B^ 0S C> _l>>T @pTM>pP@U 0-S0S>@pxWDZX -`L @I`?P@ hp1M0T 10 00PS<0< BY@wxWD`XWXV -0L8MT0 0\0 0CPX0 PEH%`p2 rP ?P pP,KI<PT ,=(KsP uP@PT  , K<PT , =D0$X0 _p01 `Rd40&T=X$Tl?@wPP 00TP =X0S Tp 0 40 0 540P0<0 8 `0IVP0 8`u UD 0S C0 P0U u0  $0S}vP 0;0 0S C;kP0\0 hX0S L0 cRLK]pPp<0  cR<K}]`Z4 UJ uPu U0S8V  Vp 00S 0V0 R`FV00ׁ0`D2 R98 ^PJf0\0\U00Su U 0!0  80S 0SPr|1$ RPkTYP KH1K PE][  0fP0<fX0S@x@3uX# T uP0  D0 @ ZD0p0H L0 p` 000H4H@T;xW$,,#V `XXW@xP4  '<xDxWDV`XT p-0LM` P@*^?P 0AT K03\0\  00 0l x4;x;`XxWD  R4 5:0QJ -0L` Q\p 0PS @0S 0SᇕP00@S|| - LR@:Q0AS Q 80cp3P000 \} -LM0P@ @ P&0 pP#0:0S0: pP]  `PG00< !@@p@3|0@ `P4!@ \P `P  P. @ 0@@ @ P @ 0@L @|4 @u @n<$ p-L@PY0PP` p P P` `V`p p-LP@0PP` p P P``V`p 0-L@0P 0 P 0u30 X p-LpM`P%@PT0 RKpKNIP@ : S I@@W -LM`PP@p/ 0A#SG+ + * * * T* (* ) ) ) x) & L) ) & ( ( ) ( P( ,( ( ' ' ' ' ' T' T' T' T' T' T' ' & D+ K`P0#5 KKIPBKHP6p 0RKHPBKHP 1R 1R$K 01P000ʓP0  ^p30  ^᱓Op3Ip3KP05 R  K^P 0 00 KP\0S0 KP{3 RuKP04m k p3fKP`@T[KPU0: SPKPJ0: SEKP?0: S:KP40: S/KP)0: S$K|P0: SKqP0: SKHp3K`p30!SPPU@&\P0 0 g1U b 0p03 0 0s30S!BKGPKGPp 0R] ŒPῒp3(K 00P 0ES񟗱, t, \, D, ,, , $ (0Rӣ$ (0R$ (0R$ (0RÑ$ (0R$ (0R`0SWWt@@-0S0%@0#0%*0Q00 @8 @8ꌖ  -L M@2@"P40 0 020"P,0 ( @ @ @@1SHP1`6 T8` < >@T\J`@pK T; 4P` @TJ4PP*T 04PP<<00C<0 4P`<  @D1`P 78$K@pK 00 RP @ 0, p3p3@pK 0 0  ,@0  , , <W 0-LM@P$K $Kp  ?<7K0 Kpq7T -@LM`ᓑP@Q $K 0/P $P 0 07 K0C4pK}4@ 0P ,@ (P P+@T +峆$77갏XЏ -LL0PS8H 0 S S0 0   0#  A0A0 S00`pB"wYp?@C "P3 1 1 1 1 1 1 1 1 T3 1 1 1 1 1 1 1 1 1 1 L3 1 1 1 1 1 1 1 1 1 1 1 1 1 3 0SV0SR 0RQQ  RP A!4Ypp?@0!R 7``(WhA\!Yp . ?0B"S3 2 2 2 2 2 2 2 2 h3 2 2 2 2 2 2 2 2 2 2 h3 2 2 2 2 2 2 2 2 2 2 2 2 2 h3 6W |Q @x6QQ@T  8P$"p}xW ,}0 U0@-@^ 0#S^ 08 S00S0 0#S 00 R00^P P0 SPR R^ J0Q S0 B00Q B\0AZ# 00000 -L@`zV~T- p@PP 0`pc@W P`P P@W Ȑ$̐ -LM@R00?P`p@ 0pUWlŸ (0K P{ T0\\S@DLT\"0'P "P `P =P :P @DL^m0 g'Qe "Qc `Qa =Q_ :Q] PP^0 'Q "Q `Q =Q :Q \QP^TJ q7 1  01 0D@q* 0' \ZU-0/S '0/S PPpp0PdpU@{ Wl{y0Sp(  0 0 008,PpP< X B  Q-L@' T# AT *0Q/S 0/S@T:0/S d 0R /S @T:0/S QdZ p-`PLP@OVP 0R  0RQ^p^p -PPL`@p 8p@@P VThO`X -@QL.0  \00X p`@[T*T ?T $T P(U /TpU @\T0 SP` U~X 0* 0 rP W`X -RL|MJaApPC0pp0F P PV4`$KP10Kt!( , 0 0(0Q*PP, 0` 00 @P/ ``QUV V& @`, @`DA A@(@ , 0 KP0 R7`T (0`0@`XW\X  0-@ 0PLݍP 0c0 -LM0K` k kPp   XP P0xU*%YP kPp  (K @`DA AP@P`X -L,MP L T @L 0 40 0 H T40T0<0 8 p P:tP8@w  YD  0< 0 bR<KS@Y R   P /00D00D0 H<0  cR<KS@PH T 80 T0b CAT00jC1T@0 $1`p@pW` 0,0 , KWP LPQD p@ @`WT 1 00 R P80(K,0S 0c`X -RLM<0 ; @P`4`KH#8#000 40 , ##0@T T@T"0 !wz2P 0 0p400gCz @W `2  @tY8 @ ` P X`P @ 00kV 0P vP XP @  81  80 1 RW 1 !0 04 4,0Q8*00040 ` 40 =<  (K !UIZ0 P`` VP @APA0<x 0X0@` DA A@,@ 0 4  40 8`XW,W,XV D? ` -/L`4HPDp`@P_P@ T iW~ -!LHMp0W,0 H PM dpK PLAXK@0[?[ 0H0[XL0D[1EP[C`[@b0X KX L 70K`:K9K8@K`0S0S 0S0 S0S0S  +P H, 0R (K40$ ; # _M"hzU^~ -@TLPL x0S C x  Tp0@ p0TP`\@V(x R p0 Bx p0`\V -`RL@YPPT^ Tp ppTPW oU 00 S/R  0R B/S PUW10@  `1`0V0 T@j DA  1A` 0V@0T00  oP@j DA  A `X=ZtV 0-LMPK }Q@P8%0SH0 R k iQ@PT[8X -L M0S 0 0@Q@ K0 K0P1[S S|ࠁ ࠓl 0@yP[w1[S < 0yP [wUlXWht@X{ 0-L@P}\ 0S0S @p00S@ @Wd0 -@L! @@@ @@44iP, 303 0 h U4 ^ZU P@p 00   0-0LSP @P0PS0 0 l3<0404 00, (0 222222-l 0S ^S 0000S$ >R@0̗?R!00*0 0 2304 -tLQhd0d @pT *T0`VPUzTP@0022222 - 0pL`P@0 ^000@S@0C@0000`P  r 0  @ " 0p-Lp0s TT 0RHHr P@4bU0c00D0c "S00!000o!0PL 1pW)a0 S@10`PcU]0 0CSX@0 0CS@ TT 0R( 0R <qt Q!0@TtP0S:00 0R>*@DVt Q00 QP=d\@P d0 R} X0 =w@2222222222 -0L `R0 PhP0@z|0 p d1@`0@TPT0T @@@Th WdX2322222 -T0L R D0404 00 0@2W2WdX - 0 0L23 -0 LA32 -0LdX -0L|W< P00( 0S P0CB4t30@ Q-L@!00@0@ QP =D0 @<0 40V 00022p3 -LMpP` ȀȠ04 <0 8 0 00 , @@@@94 0 b00Z<08 040 00 ,0 0D$JY Y (K22222 p-0L@`0 ^P :ϠQAQ 00S 0U^@*pp2222 -|p|0LP R`*\@  `  0 0 0 222 -L@P嬀`@P0 ㌠ 0 |pS030#0j0V 00@0Ttw0S:0022222 0-1L @To 1 R@0S S S "S 'S0S  R0S"S 'S 0S S S S S "S 'S0S R PU "U 'U PU U U00~P0; D0T'* P P "P 'P 0CT: P P0c0 P P "P 'P 0CT:"P 'PdX22 -l0l 0LS`\00000C0P 80 40 1$d33h323 0-PLM T@00Cs0 0K0KPK00Cs0882 p-d0LX PT@T`0PP88 1?1c"10c Qp22d33gfff -tpPlp@LX`d@D0 <0 40,0p p2222223 -`PLP LPD < P0P0f 50%QA!V0Pfp p@@Tp e` PP0 0 B cRW@@T P 5U@@/T00T0 0@Pt 0S:\3222222 p-0L MP 0 K$KK a0a(@K @`PKp0 %$0 `xV P0APH ePU$P2220e H p-P`L@T @00TPc@PdH@p32 p-0 LQ 0Q` 0 pl`tP0P `0@d0S00CP 0p3h Dm h3d3(32 -0 0Q tt0 `L X0R 0`@RJ@d22222 -LF -L -H0H 0LQ 40Q0222000 0Q 0 R 222 -T0T 0L Q @@0R `=222 -1L Mxx 0,K n0nP(K4@K0K @`P3 U (4 - ($K,00 (pcVW00S@ X (0  0R/S 0!U00SQ((4 0,-(0 !z222H0e -L -L -L -Lx -Lp -Lh -L` 0-0L^S@P TPe0@U {jP0 -0QLp @aT`*@DT:PPX`0@.@0@^SDR(0P  3W2dX - MLMKK I0 , -1KZ<t`P@1p@0T-9K.yK@ ^KPEPE@T9 ᐀P0V 3 p1R5 h1R; `1RK-0KS20Zp0'81 @nP 0i-![ ^R@Z 3`P, 0R*(KV Z ^Y *00hY ND fZBhz,s o h 2@$~ -@0 PL 0px@`00Cs0 V U PPPPZ2222 -L,`p 9\ 0S  2 1C AP@T@T 0U - P0@T @W0@0 Pp O00  0@@ %L~,32L -p-ML M` 0 R0 $ P#  $ 0SQNK@D$ @D NK@D$@D $ 00\ | 0RKp$ @Ahz4~ 0-PLM00 @R 00   Rp0 RP0 R<0 R$00083o n i N O -h8LM \ T8  N@P 8P,8  $ȟ@0 i0 d 0@^ b0@X <0@R0 M C0@G c0@A #0t@; 0`@5 0L@/ 08@)0 $$ =0@0 0  0@ 0@ h0@ d0@0  B0l@ L0X@ l0@@ >0,@0 0 0  0@ *0@0  C0@ f0@ g0@0 <0 \ ?0L@ ?08@ 0$@0 0 0  .0@| _0@v0 q 0@k0 f0 |a 0l@[0 XV0 HQ A04@K U0 @E u0@?0 :0 50 0 y0A@) [0B@! [0C@ [0@D [0@  O0@ O0@ O0@D O0,H`@ [0`FP@ [0,P@ O0`@ O0P@ 00@@ 10(@ 20@ 30@ 40@ 50@ 60@ 70@ 80@ 90hPE `F5p@ [0@ [0@ [0@{D [0H@s(K}P 22 30wW,N ] _ a ] [ U Dr r r q o n n Ha [ a (] W lo [ k L] (_ ` n $r dr q \U `V f _ c v s `O \ a [ hN h Dm Hb h -0L @ 0S ,<"',h"!0 h"|p - @R0 000  0L PT h;,2 -MLMŸ帢@^(@ `Pp: S B_ @T Q 0d @"T( 0R$KP" 낎KHH0"嘽V^ 0S2@T@S `|PP0"1@T r@TUpAp t1@T @S =|P0}@ 09P9U @8 P '|P0@T @S |P0[21C 0@T @T |PP"|XP L"t@=<$"m2hzL~LS ,i p<~ -3#ML M3#3#3 `3 S3#帓K@A A@`, 0P48#`0e0||#Pp@@Y0c00 F cDCD3  00S$C\ 3" #0l0cCP00쒟002 `-(K GP40( Ks`(0K A2B"| R# @Z@Vm PF Pb PQT0, $2@ $0 -8KR000``dP01@T p@T PVʂKAA PVpW@Z@W00S 0`!Q P0 0c, 0R'(KW5! R 0S  <\<gN4b0 0C0;P0J<22222hz2dXX3P0̘ @ H  \  Z   0S PD0Q D0 D >ZXP  _ Q    00 ZPY 0 0 "" "Z  R Y ZJ Y 0 -0  00C0 40S  00 Z !  0儠 0C0 p Z mꔣ T < , Ԟ Q D@ BP ~ R0P00S Qh,0  R `Q !0J]S~| ` | L 0 | | ` ` @ R 0 B 0Z ZV PRJ  000 00 0 R 00   00 䨐 0 00  R0 S0    R0(  0  x0 t Wx00| 0 R  pn0P/S@g0P/S W :S 0 cR ڀK< @ 0S 0SS|p0S +S -S YT 8)U0P PX8U |tU 0S 80 cR 8K<0S0000STd X@ / <`` X> S`S0@P {Z @K 00 Ep Q)p |0〠 p D00 p 0 p 0 A   00#0CS8 H 8 H H H H H H H H H H H H H H H H H H H H H H H H \  u@TQ #T  Q00  0   00  000 RQ5@T*T000 #0CS #X50S&00 R 0@T@@@  0 @PD0   0@ : 00s03S; 0-S=S ?S@ 0S 4P 0S0   Sl0S 0 400c0 P 0P0 0#0C S ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 4 (  p , `p  & P $00(   0S 0@80 cR8K^;0Tp00S) 0  `p  0 $0( 0 0S @80 cR 8K7;0Tp00S)00 `p p Yp 004, ` `@enSP 0P0U*   PZJ 1 ( 000 ``, ^000  80 4  p Y[  3UzppezP KI0S p A x0S  Q   P0UK*` ZP(K400c0 =0+TXQHWWXX,0̔X@DW|P `Xܔ40StepP 0P0UD*p0 P |GPEP 0@` DA AP@P0 @`DA AP@PC@w  0S>0 0R900 3` 0 P40@XA -   40` 40!0@P `a R0 00    00@"00@040apsP0%S #S `V0S   0S` p   o>P6PEW0<0 ` l<#S(pp@`Ph3 `P( 0S K H`@|P  |y 2U  D` 00   s` ` &4 0 | dPK@K0 r Aa0S @80 cR8KT900 R `U` `PV' 0Sr[rP 0@S*S0]S @V*Vpt5@ 0Q  0S00S T  8%00 "> P  LZP?0 00 ~0 :S 0  00S     0 [rP 0@S*S Q  =R  \]P`@ F7R 0  P@4U @` @0`'Y`l0 R0@T  0S 00ST\ 00POH`PG @ 7Q00S+P@ 0]S  #0BS  #880S$8pZ\PP@ `0 T l@g DA A`p@B`PUg0S(0@S@@P k 000?0 0`A 0` (  `p0` 0<PF`EWS|t*@0  R Q+R  @ @\_P;\_\;@P@ q 30S -\_PEPP <0 00p`0S \t_P g >`p(Y\(< 0@S@P R  P@V :|<AA  Ap`P Dp 0@@S000 u e0 ,W ] Z p-L Ml`0@P 0$K 0 $0 $00`0S@@cKp`XD p-L M`0@P 0$K 0 $0  { $00`C1@@ S @ :Kp@`XD -L M0@S`' pY P$ ( *(0  (0 P (PK EP( 0Q*00$ 0` (0 M@K  E $ ( $ @`DA :A@ @ $ ( `X p-LM0PS` `@ᤶ`1T@S0 17KptVж p-LM0@SP` P`ံP1V`S U T ?Ac Q0 0( $0K$@ ` 6KpgffftV -L@ 0 ;E  0-LM@P0 (EK0d p-LpMPK@`$P@@PU Kp : S  S @PV 0S I -SLM@0 < @ 00@/oP[ 1P  000 , [00T080 4 1 `:{oP4P7 X pf80@ cR8K5P@ ᬴/00P80  cR8K5P  ᜴4<@ P 0S4,(K` :BoP4P᩵4`, "<@  cP `X p-LM PK`|EMHM@P  V 0 /R 007M@PKp DXW p-L@`P0=S\ *SZ +SZ@M M 0 ` p,X -0L@pT`T P BMPT@0t03V0S  M 0 0 `X -L`L2p/@nPP`F  U  Q22p 0@P 2U @ | :X  l2-000Y @ @ ("00P00 ^Y\2P 0 P 1 P  0 @B&1 ; 0 8 TP5 0S0 h LP @ 0  P PU00SP LPP 0 P 0 00 0001   /PP 0@pXV\h0P@@  0a 8L0P0{WtWV3W`X D,XDX -LP`000K  @0`|;X P0 00P;000 OXKv30l -x0tp00lL @`0PPC0D03 @=0000hWDVX XxW 0-@LPK ,K@P 0h  ,X0PR000AS D 0-PLM0( 0 , i AF/$ 0 0 R<  1 0S41  W.'@PA, R  (=- BpB K041,Qk"( 0 0$ P !0 00 =$0 P0R@@zcb0  0S A h0  ->`5$0@W@b 00`XWԕ\X(t -0LM  00  P,0 0P, K  0 -? R:0 R< 00 0;0  0S N@Pv 0 @ 0 R\ 0 RW `(X p>$Q \K@0P04>X #,QT@ X 0HS񟗡(   0-S 08 KpP*0S WJ= P @0SP YQ  P1X W 0S 00CS4h  @  0 p 4 4 | | ( x X < R  ,pWw 000 00 Sl<  0S0 00@,0,000S 0  P 0S!=M; R0(K|p}; R 0@H  VZv @t+\0KR ` bG\K0@07Wt +&AoPj 0Sg :Rc0 ]0 R  0&0 R 0 RK P0: Sh`0S\z L0 R8: @@(:  A4 0 $9# R& 40 R" =VY >40 R @440 0\9` 0x>40 @R8 :40 R 40o |0 S0 0 R  G0   (\0K Q@~g` 0X NXH |(|8XX@@hQ` 0P0 0 0 0 0 p30 0<P0 000\0  7X 'P0 L 7'\KH0 D G0 0 0 0 0S00Q0#S0<\0 000 0 080K 0Sj 0 h64 00T6o@P 86  O0DSLT0 t00@ 0Si 0 Re0 4 40 R 40 yP  `5Pi40040 4 0S0 0SD0 R@ 0 jP 0  a0 04 4@P 4  0DST0 0%0 0T00 0 @0 @0 R@@K <0@0  @.000 00 0S C0 0 0  @c00 0 4 00 0 @nX4 I0*04 &0Snh@4`TWPP 0S0S8S 0 0P0 @^0 8 Kj\2 n@P6"0S 0S>Rb0 @ 0 @@`K@PUPBP<0P0PS *8K 71 00 0E |0 >n*4K\0K (!O 80!)Y*W*0 00 I0 q0  @0  @Y@0 0< 0< 0 0 P0 0RPPM|POX`XW VܔtV X 0,0 ]&t'<0@[0 , 0,0 K0`H0 <@ K<0 RS <0[ 0 ~0,0 7<0  < 000<<0 H< 00<0@  8L1@ H@ 00 0P0@0 0S @UE REy < U<0 VRkQ   0,0 , d0 &W   xW@LtVHl X`Xp|PX3VP ȖpXZy 0-L M$Q0 0 @R! ^0\ 0A|3SQ/ P 0R+K00ep3P000QP ^ K K  L0S0K\ K00<'hz -8@L %?0000 `X -LM0@00Q   0 & a& &0BS l    | 21Ch 0 X 0K 0 K 0K4ES0ꌖԗ$ -0L(S 0S     "(0!B "0!B $ -`L@t `2  @t 0T(0`0< (Ÿ00:0R _T{ 000#T0Sq 000#P0S _PqPA f 1@;0<000 @ RPP "'0`0`@0 [T5 0S(Q ` 1@RO&00`Pp+0 0pS T21C   MP0p`040)00`kLP`(   X`X$ 0-L$M@8 0 0K, 4 $@ @ 6%1@P  R050$ T+40S)K00PK1(0(S }#(0(S8 0 :R4 8iP$ [R0C(0  %W  `XD -0LS@P 00S p `QP @0u@050Q0 050p c -`Lp@T  00@@0A   P  QX @PX @ - QL M`4 ,@!0DTPPTST] #Tq Tz&0DSpQZ(K4!T 0p0 0 "TP U 00c 0400C00 @pPDU%21C0 40RcT  , \ 0D,0 S, p RSTT T 0D0DTST U \ p ` P @ p ( \ ` P @  ,0 S(0    Qp@PDU$21C0 40RwT ,    0  ,0 ST  0S 00 00: P 00C 0 0Rö 0R 0R 0PSPUr  p0%SUv 00 0  00C 0 0S 00 00 0SH 00C 0{ v %q 0Rl 0Rf 0R` 0\ 0"X 0T 0RP 0L 0cH 0D 0S 0SI 0 0 7OB 0S2 00 0  0p0C 0 0S# p<1p 0Zp- 00s03 0& u0p$S 0@p, 4   $L\@ 0-L M,P0@4K4 0@ (00K003-D0D 0lCQ  /10 00dXW3 - @L003 -L 2P8 -LMP@, aP00PT"QaA0 10Q*(K 0100CQ*00 0!  BRп 0㬴P!` pP4 ) P 0@0pP 0 R @40 c0 0C0. 0PP `E̠E-K0 ED,K+K-0K*@K)PK }0  0a$0{W3hXdXW33 -RLM@PB `0S  U@PER \ L < ,  0U `0 d0 h0 lX0 p W:0FS 0bC1AVV0a1,0 PLS @%,,0  ``  dXWW -ML3M 3R, , 0R(Kl#00d#dkKNXP L+P -Y@P sTܾ 0㸳܂P  0@P0 p` 0S0SZfJp J@ @0S00P :S  P0*2PI P PEV.*0S PEV:U&  RU! BKAA! 0!]5- P$ cP@f @d T/ BpnP[@t000^@0 J0nJ 0&9-P 3IKAAP$00P8!Whz33h3W 33hXlXt -<@L0S (0}/ }g0 @ WhXWdX p-0L R PP _P l`PdphpL0@D@@ 80( ,0 B @@33333WWdX -`PLl0V ``p0`C!VQA8 +0`0Qe @ڠhXdXWW 0-L L0L@PG P 0dCPB00P0WdX -LMQ@,0 ``ps PhEQT00?@AP*Z:a@ HP X@0fPZ :,0S 2P 0hCdXW -D0D 0 LS:PS0C  0dXW| p-LMPK`@*P P11 0 b! PU3 S'x0P?S0 b@@0 @{0P 1xS*U xVSTxD 80 x x3dXW| -$!$A0LS`: q Q0 R 0B0 00C0 V pP D^P@ 00 R0 plP@u @0 ,TP 00DWdX3<WLSW -:LM$ `R pp p p p I)W&pV 00@CS          | | | | |  | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | $ | | | |  |  | | |  P]PHx(&p0XA P YW pW 0S㴀 Q Z0S0S  @TK X  7  000 , C004 080 pP ^00S  8  bR#P@ ᗢ ᓢ0 Pp1P `g 0 .8KQ}yu(K6 m2^ # Z 000   $6@  v* prRW  l0S0l Z o S[Qo @Y@X *P X  "X Z 0 r 3 Yy H%H5^ppQjZ00 ` & 0  fB!A(0@%0@ \PP0 d 0Q00`Z  X 3R ,h|dp`d\^ 00S 0Y   ZJ =v\P 3P'00c  Z  `0P3F/P`U RoZ00 @  $/0S00@Z  X 3R1pZ F HBWPqPP 092PP K ?Pp0T20 (0,0 00@ `4 8  v0P08 @d\400c00b S8K_"8 @` RP _Y   aZ  @0O8Q 0004`"4`$@%Q 40'80`@ cR8K"P@ 4, `>q@Q gb40 '([@ WxW`X$ؘP3dXDVXLS8TWؙ`0     W(0$0PQ00W -0L`0V`Ppᷡ@@P,@ p0PP 0d P 0$0  00W< lX -@@L 00 00 D0 0 DV3 P0-LtP lPP 0SPP@0  0,@PG00PA00W -(@L0SS 200W -8@ LP0SS 00W -0@L0SS 00W -@Lh p-0`0C QL@ R pS0S T0P0Ppph,PP0&P00S 0P0&10P0` T 0 00P0P0T0P0 \,D -LpM|KPt0: S K --80LM R 0 0 M+ ) K3tV P-L( `@T PU pBZPp0 -R  -@T PU 0 S0HL- 00$0$  -R  hx-WXtV7| --LM4@0 0 * *d)KtV --LM@HHS-0 40 *( *K)TK 눚tV --<0LM R$0 0 * K XDV --LM0 @0S)0 0 R   p0  KUP0 R 4@,0 0 * =* XVtVXWhW7 --LM\0\ @0S<()0 0 k* * XVtV P-L@ ]@P W0 S@ 봚 -LM@KLP0P0PKԚ 0-LP@P00 S U봚 P0-LP@ T U  0hZ0t(T0hRtV0SS   0SPS00Q00Q R 0S 0S R 3 -LM@K 8㰙00 R000 㦙 0W33 0-LMPKD ᗙ<00S@ @0@S ㉙8W3 -L`\M0V,0  0d#@00X3 QP# Y+0x t0  0 S 0-0t0 0PUP  p R  `   0"20lK@ i@VR 00Sm x +Vn VG ŸR2 T l K0+p PU  R0SVa V "Q 2 0 +PUp0S +, 0Rk(K0 0@9V0@50 SS@@l K.l0[S t!Tp1 0xl Kw+0p0 V0@l0K 0S/lK@@ h@00S $ t0_+V  Y+lK@ hz 20lK@ hs @Q 0@ x P@=+lK@ %-@ R x0+4hP  )+Thz3Z D8HPtLH$0H``-0SSS 0PSP^(0000S 0 R00  p 0Sd 00C0X0X L P000P00 $r3 4lX3433| -LM pK` 7@T P 00CS0<0@T 0S 0@ d X& PT 0@  3WWtV -Q@LP 0= S; 05 @`p40 0^@Q Q 0  P  0RQP tH0^0   ^  <00,h$133333ܛ -@P#0L0F%T0?S[l                                     l      l  4                   h>2P 40S 0Qk R0S Q PZTʜ1`@T P0 ?PUSP@TU D1P->(1 P 0R@0R P0PU p0@T `)P Wp@TPUW |0P P00Q 00Z 00Z 00X3 -LM,Kp`P\ ɖWpV@ 0K@P> U4T P@T ,40#00 W  @ 00CS0<0V 0P T 0@  T  ㉖(KU<0@  {0$0!WDV3  0-0LQ2 0 @P ^ T\ Q  P 0S R pp0R`  0  H0H0 P 0S 03lXWWQ -LM`00̂000pSp Q  Q2 R  y4P 0@`00@ 00.60@00 00/ 00 R 2 R 0S Q[ 1QsPБc 0SY 1P 0S4 ! 0S0;004 S 0S- (h1, ` 0$ 0 P@ 0S 0S $!$3$ 0S 0S U 0S0  dPP 20 5x0jP0h;00< 00HP@I 00WXXX44^VVtVZ -L M0K pxS,KPP  RI Wx0@T `0S0C00$3`\# ~@Ty#V @GW. 0SB0SU0000 U00 0S W@ 2 R0x">0@  (K @Z@ 0S㣥PW`A00 R ܑVQtPY  ؔTI 0@0 t- hYP0 -  㺔0@ hPPG0I0  @  ⧔,0!@&#k괐< k0S0n  bx \0S T0P@H 0LWDdlLDV43МD4\h ^ -LM$`K@p( WPTP  KP0 0S$ @ AT0d0K0P 0 P 0S 0S %@ @  R@ $0!n@WlXܜ3  0-LMPK x0P h  }@8008, @ 8W3 p-0@LTP` `@T P M@P`Tp -LM$pK` P巓 K@P'  R 0S ZP @ 㢓KP-H \@UU=  ↓ 0! @W 0000 R 40S0 3lX -LM@K 8]40 R 000 PW3 -LM 4@, K:%`V00 0 0000R D0S $p0``0$ 09VPP@0#SpTn 4@ RivDPP@@ v T$0S Q  $4 R 4Y0$(33 ST:V @,K ے#pW00x 3P \1 0S, R 0' 0H3, ( $  ,00008 2"0`p` ,K 㛒2A>0@儩`YI2    | 8 0p00% u(" 0S DD $0@T $($@T  4" @1 1lLp!)@p a^ E ,KGX!0S = @!0S 1d`1@!@ 1@ @@81 v$Nt 0S 0 0_@P  wㅢ@` PD@D 0TW 433$XW443lXVP\WWtV$t3|ZZ Z -RLQ5 0S^ܢ܂P0Br `D@D t0T0rS Bb0S PxAP d2 00U P@ P8mj} 0 "S Br `D0@D2 T 0S m8! 40Aq `D@D )0T 0Sd80Sh1 R80P0Hp00寡aP @20S#  00R + PE MP00lE B00P`Ex 600xET ,P00KW4 ZW4@^^00]Н -1L@TX pQpqpa@T 0Q 0S S0% P 0S @TPB 0R 0S 0SP 0S 0 R0Q`0  hT@QH0BW P p `3lXWW@ -1QL@P` @匐0Ǡ) ;/Vpp 0S00 Z%0 S0 R @` PD020@D /T0S80 R h6h{3XXW]8 W3 Z -LMt R `4 R 0S044 00(KtKڮ,K  PPڼpKϮ`V 0@T@T 0U0,ß Q,=A A¼ ,(p0(c(Q=9 =t ,,00$b @(( Q$  =A A$ h0 cl Q=9b @ = $ $0H 9,00, 0S|0C0 0SS0000x 00S  R R 0QS4 0S 00 S000000 00CSX@Q0S2 q 0Sf 0S& 0 S" 1 R  0S 0SA RpA $  0S 00SA> 0S; 1 V ) 0,0 000,`V6H 㯓$ p @0V 8 R 0R 00CS0rTG00V3lX3?BW`X333XW| -!MLM$̟, l( Pp8 d ; 0 ST  @T @0Pd( `( \8 , `\b TQ `X( \ \Pr !P- @\XX00SH p8S `x R p0 Bx p0`0, XQd( d( Pp8Sl\, 0dR(K0!S@ :LPK 0*0&#9X@ Xd@@hpQ`(\0" XQd( d( @ P P0d8  `X8  P T8S`,`X ` `X \PPU 9 RZ!0EVSVC A C A A A A A A A A A A A A PC PC PC PC PC PC PC PC A A A A A A A A D D A A C A A A C A A A A A A A A A A A B A H H A A A H dH @H A A A H A A G G A A G A lG A ,G A G A F A F xF 4F F E 0E KJJ0 8(dp ᘓX@  Xd@6@hp\`\(0! X8Sdd @#@ \\d(`00`X d8 X @p',`Xc L'"`(\0" 1!MK@D@D6 KJJ0 &p6K J0J 0&p p00BS00ASwKJJ0 p&X6K J00J0a 0&p~KJJ 4pv @h( }L{@T@P@Tp!]KPEPE+h5]}LP@!MK@D@D76/ KJJ0  wh}zLpI!MK@D@D#6 KJJ0 ,%cp8!MK@D@D6 KJJ0 $Rp'=7:@97:뺒PVLP /7:NLPKJ~0pJL4KKK t 5LP  0LP KJJ+ \ $LP 0p0KJJ +\p!MK@D@D5KJJ0 #pK3JJ +\pKJ 0J pd( L4KK$K`3K JR# $ 0pJL$KK4KKJ 0J pd( L4KK$KPu PKJJo + m\pKJJ0 KJJ 3 .KPKJ0 pJL4KK$K}!MK@D@DW5OKJJ0 $"plKJ0 pJL4KK$KcK0J\8 p0CJL4KZKJ\0 pJL4KK$KQKJ0pJ\8 L4KIh_69@\[69zKP+ KJJwKJJ +\p.KJpJ)KJJ +[p / 1K0J1J0  wp'69 4P0/SX6z9KJ0J0 \ ]phzVW<WĞtVԞܔ|X@.VXWȞ,( 0 0 0-0LMPP)@5E9p0 0  ޕP 0  K0p00`P0P40P(590lW`X(WQ $0 f.P $0N <00$ $ $@} 00S44000 00  0R 2 .<@@[2 RY0,00e  P `> 0R, SK 0 , b  nR,PL 0 R _IPq 2  0 <@@$00$0"<0Q0$ $ $Pa $00$0000<0@ 0  $0S `1 R, =*,P`0S7 W@5 * RH  00S< 00S60 S6$00p p0S Y)0t |0,n<0 呚 S @WWVPlWtVDLH`X XXK*.KH! 0  B 101 ? @  p@`00`" l `P/ P\P= 8ϟ0S007 P P #P> i? $0 0$0.0S! 奟Kb  P\P Ο0S00 X V V0(.01 cRK-p VHX X \ ,\ [ [ `] \ [ d[ Z Z Z 0S0C0  P\P ͟0S00 )P \XR `X $X 00p4= R T-!X  $01 P\P $͟0S0@0 @ TT T !TM 00D-T Stt  l 00  " PK@K T T T @-0KU p  P\P X̟0S0@0 r@TPK PL+1PUF 0 !RB 0(r0˟00; 0 0< 7}Xm |X (Xm @X*X ?X+X !X 'X \X4 "Xm000 Y 0 p`0)X |Xk (X 0 0 0 Y p 00"X \XP* P\P ʟ0S00 $X> "X; X9  \00 p2\X 'X "X, 0 `0 p(X000 )X p}X1 IY 0`0p"X1 IY^ `00 p'X00p1 IYR < 0`0 p B `X0n \X  P\P ɟ0S00$P "P4 P \00p|)X (X000 'XK0p0 0  Y E 0 p`0c0S] ] ] ] ] 'Xt @T1 IY( `@ pL"Xn \X@00@0C0(X@@@ K"X 'X  000@x' P\P `ǟ0S00(P 000 Y\ 0p`0&(P gt 00 [[X`  -P [00 p P\P hƟ0S00P00pP00p0 Y 0 0 0C%00 pS  `0S CCR 0S BR 0S0C`0l% P\P Tş0S0P0 P(U{ {U 000@ X0 0 1@ cRK @P P\P ğ0S0P0 P00  0 X  p`@$ P\P (ğ0S0@0 f@$T "T  1 cRK pT= 0\  p@3 0@0p* 001 IY ` p 00 p1 cRKd p PA<XPP>X V`  Af V` 00 !`М0FxbSOL@T04"0P RA  `;T0Ss  p "@g  '#@Pa 0^ 0S  0TV   0TQ < 0S (  @0 <0D1 1Z 00 p0W S WV!(X  ;X |X%1 P\PG 0S00AXZ |X&PF 000 p`0t\TA `T?  $ ;, 0R(Khz WV$W,WX\X`XWW 4@WTX8`XW40 Y 0@ 0  p`;00CS0hh0 P\P 0S00)P1 IYa `00 p P\P? 0S009(P:0 Y 0 1 0c0` p  1 cRKD p X00p0P@0  $PR p(P +0 Y 0@  ` p 0 0 0 Y  K0P0P`| @T\T 0S00 @Vh h i Ti h #T`6 3 0`/`, `(V&004p P\P^ P0S00X:PY %P#Pk0 Yw 0`0f#0 1 cRK P@P0$0[TKP @0S @1 cRPK P00 R$ⵚ4 P\P 0S00 30:P@00 P\P 0S00p%P#P \0 Y 0`0\P `Pq\XC `XA X? )X@@D@ \X@00  %00C0@@00 X &Xg@000& P\P 0S00 P Pd00C00S0&0 d0`00C06 P\P\ 0S00VX >P00S00 &P Z00 0|P0@00 000 0 7E` KPj 00p0S @1 cRKp00  0pS (ٙO0S pH\@00V  K\j  K  Km$0 0 p(  K  K?  K:-p0S  6  0BD)000@9 < 1 ! 嶙1@0 1  0` pa P\P 0S0P0 PU W U p0U 1 cRK@P@` P\P0S UU  UZ 1 cRK@P@  P\P 0S0P0 P U 1 cRK@P@L; R, P\P< D0S006(P㐋 ` Q@ d00( 0C p( B`0    K  K K0PA  KbUS  KY.BP00  KM]  KH;XȀ |Xㆀ <&XK  oPP> " =R }R5=⑘ (0(10@0 00 <  K  K0`!幘0 00C02 S " :2 d N.℘>X00`0  K`>X007 `00 P\P 0S00 -P0 00!!"U000004 -LpM`P`U @TD P $ 00 `P> K:]@pP000T\S/ %M@@PPD0 R 00@`P NP0: Sl0 0 0 00W0P `?'@@P 00$K4WW 0-LpM|P@PpP`T 0T  KP 0 0K0|0: S\0 04W p-LpM)((!0S00cS1PU3 P K`P0: S 0 0PUKpP L0 `  `  0S h0R|O* @8,0S\dPW(`  4*P 0 P,4044@LS84 0-@PL 4P@T  0R @T0lX -$0L@T @T`X p-l`LPU R @0@Sڹ @T0 0PU 00p`X -(@L0 01h`X -laLPp0S  0R/ R @@ T 0Q A@ T 0S 0S W 00h躖 `V0 Rd0 xP0@CTT W4HP3@0 P42 R`XtVWVWZ -P`LpG㲖P@pPu P00 Q @`X P-@L 0 RP0S 02n T000eញPP80 R (wP@rP@W`XZ^ 0-LM( , (00#$ R 0 0  ,0S3  $ 0S2  2a@P T$ 2  q2 R=(0< R? 0SJ( @P- 0S0SI 42 RE 00C0  R?$( 001 R (0$   f10S 0S !0S001 R 8(0< Rh1 R( ( $0$000$0$0 0S P!00(0S Q0SsP (0  ,P/$0 0K004J 0S T |0 R (0 R0S( 00(0h ( i^ $ (0 ~4iWW@X`XTX`VUDL 0-00P @L@PP0h`X 0-L M, 0 40  00 ( P$ Y 0 R100 0  0 00   1o@P P0 /0S D0  0 T3 s00S 0 0000 ,00P 0$ ( @ 0@ 0S 0 0K04E     4 R $0 RZ 0`X|V -/L@P@P"=P8=P (=P =p3舟 -LM0S( ( 0)OK0 匔G/X~8(Kx"K⁔@-S-i   @ 8P @Pl8P @PDhD8 0P(' #)'@000<P{g'00  c7 0! S P @  0+Pǟ@P0PP t@+hdW'P*0@/Sz @70S807T  (@@'b)<' (0FS 0S 0S0SV%'0  0S5 L&6Qf00|'0@ 0S 0P 0P 0P3`PV0S("R@T1 PPL5 0  hPTEABKP1: S 0P0+ 0Sğ0I pP;P("0f0Pє4p 00`0P4 R 0TS@T  0PR &00V00 0S$4   (K 0S X&)F0S  0)#;Pi0S)EP` '0P\@T0VV1S00 `1AS`A0llG&):PW (0F@c&2T   11 R!0P0g[ 0@Tx 0m^2P@Ÿ0Sx);P~ ᅁP0Ra|@P [P\i^ 0S G)gP P$P$  $ 0 00 KPBKP{ 1Rw 1Rrrl  00P  ` 0dA0D :P x`#0P @*0 *(@XW`XDX,WX,XP{ztWfTWx\ WlX@H|(XDWgV(Wܟ0hD <\0Vğ -@LoP@/ 茖 -LM0@0cSz bSz  PK  0`S R   0S PU  40!Vā lth,((0 "4P |P@t/ P- ` 0T00  R000 R8 # 000 RX -L  4<0< R808R;\0;LD<4 ,@$hXdСܡP 0-0@pL@P`J}00fU}@P4 0 0     p-0`@R0 000 LPs0Pf 00 p Pp-L ph*XPXI@"`P   phRp`X - L@Z P  QP -LPp L`PZ 0#S@Pʢ@ -@QL eP PP@1*@U0S pd e0P`d  @zU z@j00 -LMxP8 < @0 @弐H14 8 |P``H|TXp V8ʕ `|PVPW0 ,P V @PV@PX4 80<@ , 0|  V  Z YH4(KoB 40 00 V0``ppѿ`XX$D 0-L^ 0    0 0 S0h@P H0S C H @0 @0^ '^ Uh\PH0S C0 ^U0(evP0hqX V(O) P-L@Pp*`@U0S)Q |Q00W0S V  ,"8@P`U`V*踔 P-L`H* p V0S@P*T ?T [T ]T$ |T' )T/ VX00S% z37P XpX0S pX Y 0X0Y0S X Y:0 !S ]SppZJ0S0P 긔 -LM@PTp p0 `V Rc @-Q@ 000#+Q0Y00-SX `SR 0-Q  0 p@ p@:V?V@ ,V;V00,0 0:S0?0` 0402 ,2 `M 0? ? (K#V H7P :P& ;P$ ,P5 #P0 `@V4 !0`W ,0@000@@ R0p00p 0 0Q  0Sp0p @@,0010 ,0 0 @T! 0 0 0`@0;P :P00 0hP0 L0 H6P 00(6P`,QDXD6 p-H`LP@@%T 1S 6Pp&@Dp蔃0 [ -RPLM@ D - R*D @0ZD @  ҅< @< S@ < RD Y@0 SD0SD ?SV ?[S S D <0RP (KS:SI0CSD  "P D@ 0PpBSP DP  Y, 3 Z@!':,0`C@Z!: 0P   0P *SD0 S @@@ D  0P T@:,PX< RD  P D @0R`@S DP  Z8 :p@@@Z: 0VP  0OD0P C  0V EP@Z*8PXuD  Po @p@Zk:`DP  @ 0D&PPX  0P`Z*O< RL D0 RD 0 040 [Rt R R QN <0R < 00\00S 040 QO  R [R 0  S   R( 0:S R@@`:{5P 0S 0S l 1pf@T P P0S$ @T0-S 0S0 \0]S4 00R D DP0:S<0S 0P0S40  s R0[S#0:S 0 @0]S  S  0cP   0ZP 0]S 0k< !R: 0 8H -LDM0QPp@$0 P$ 0R) KI{`F{UPP0dP@Ud`K 4p3 0 0⎌`hz`X 0-LM@P Kc#0S  P00Q0Sp008 0-LP@P0踍 p-`PPLP z@R PEp 0-L,MxP0>Kp0 @Q X0 R%\<000 0RK04hzW`X p-LMH@P4 `0T0 @ KpW` -aLMpP0Pp' PPR 0000p U0HS0 0Q$pP PSQ U00R0S00QR R @K$ p%0 WlXWW -LMT0Sp! j W4|1  DK.x t DK|!!p@ 40AT00#`9 oT" ?T WsT0x1  8$PP%U 0T0  s%U (K<@T  PS0S 1#0  VV<00t1 VGl\S@0HS LQ@%T80(  DyB* PDy܂Jψ0S 00 Q0W002|1 t0-S /P 0-SXRDŸ | b`8[PpA `AT y1(K! 0 DAHQp1`Pp P%Up!>KD40D !R 0-S-S+S 0SP h!0S#0D0 \ t1S Q D0! R  t1S 0S "0S  9x\ D 1  Q 01 0Sl t1SD! D  ! tD1S1 0D S H<^444WLԨhpDVT `  0-@QLPb0 00h$0@-@Q$ /Q``V/Q P Q7 .Q \ /000S/S 0S/S/Q00/^^ 0 .^0p/SS0&\00S \/00 0 P0 \.00\ L U*0/S -`2QLM0< /SPw .S8 z < pW 80S40 00 ,0 * 0S:S00S,0   0S:SS Q ,  gP00<R04 0 ,  0/S4  0  000 4 ,0 Z 0SR0,0  0c0@p =x P0 bR1@  w80S<0(K40@ cR4P@4 v4 0 Sp/R/00/0Cp@80 00< .S0S/S000#80 pW{8p 4p 0p ,p w0@ cRP@ v 0 S/R/00PD -MLM0 c1\, @ TPA @/T@/T T9 /Q1P `eP V9 V:  @/00 0 0  cR@B^K pPEzvPEp ΂P@'( K0tC,$[/R0  0a P PZ, 0 R(K.T.T0.S Y0y/Sw0Sgw`hz -LM@Xw0     师00 K 0  fP 0Q/0000 `จK`X -`PLP$ -w@0Tp uU x0U p0hNPpT @咈 uU0PPPpW(XD`XW 0- L @   0 0S[ :Q0 a/ 0Ѓ0 0 P0  00h p $0 0$ -`L p 0SL;z ( S , 0P@aT#T ٥PP@`0S[` k` 0Q$ 0% ` 009 0`j`0i `0 ` q000 0= S, ؇@0  d0d`0 0 `I$008 -P L`pM WP@T 0P Wd@ t0 0 dX`0 WXDp X0Q@ =s@`Td#T! *P`@`0S#0 ;0 00$ \WL zX t 0 0h0 0L` 0-@PLP u 0h0 p-LM @`, v  0`KS' PK+ ӤP P0S  ;00`$0x R 0 B `0xT H $0`0p`  x -LQ,Ml0P ,0 @ @ L  P %P0`H0 D0 .  R 0 B 0@@ P0 @00@0 , 0@R(KP0P0 L0 P D0 L0SLP aH0 P H `PU 0ELSL         d  ܽ                                                         н    w0 A @0E0 P 00D@SP 0000 SH0D E  `L H D `@ `| 【 `D w `t `q `n `k `h>A0ESD0P o 0Pc0ES            @    0 PP  d0EP P S񟗺8 8 ` P P0L0 `L ,pK4!000c00R0guU L R-00gg|+00ggw 00ggrgq`H V0<0 Hf< P <  = b S< @ P0P<0SV@0C00 @0T  0S@1T@  @ <0S@0 B @TP0  R@T@< @ r # 3,pK0  g \x0X0 G0GpB00g0B,pK0000g 0S000gg  V@H` ʼnک30#P0 `,pK0倐80K3P0#P0P 8pKq 30#P08PK8pKg P0pP0 1Wpvs30#P0X -P+PI PG 0P 0Pa0SS 0C0 00 @`FVp@ 0xS0SB 0C0 00 @ p `F0P@ =@T 0 B P0T @ 0T  RqT @ 0T@0<<@ 0a@0 0S 0C0 00 @0p0`F0P@0 TQNhzX̤̄ --LM0 0 K 0-@LP! u  :? P  &P0 : @0 P@ 00 00 0S P0 Xf0PS 0@0 0p  Ĥ - L @ 0S# & -*  P 0S0 0S0:0x  $00p 0+ r0 00$ 0ܤ - L@ R 0 B 0,p R -P L@3 T6 pD `Q!   xXP 00a0S@@ ppW   0Xd0P0 `\p Q V`T` -P Lp! X `$R9p R V@@ p 0`d d0Vp0 V f0lX ` d0 0 0-0L@P 0P  0000   ,݂00 0- 0LS@P P y 0P 0P 0 0- 0LS@PP bPP0  0,娂0,壂0 -L^\`pP@%T㼀& 0W, pE <  p0$ (P PPPB0BSU@P?ppE£k(0l◂@`XD --L4MD@K0B 0 0 VK -p-PQ L4M`PP 0L@K0 0 0 P6Kp\ -pl`LP@)# T P (0V0W< `0``0$     _dbT] QP PPp P PPpPpꜥ| -l`LPp@% T9 V`+0 0,0$ (` p ` P   PPP P PPH[́P 0\Á00@0`X -@`L#0pᭁ00 0,0< (0P x@P T00ӧ2 0 o3Q00 㶐X@,L`X@- 004W0  4 -<0@L ^  @     `X p-LP`@@P`p p-@L0`S 0 P p00P@0T * 00p00@X0T0@` DA 3A000 0@@P44\XD`X -RL0pS@3Q0@A0T2 P- T<2P``V 0T0 XQ P@0T*00T+ T4 T- T: 0DSLQB`1 P1 R|1@` DA ӀA000 0@@P41P``(P``Q 1(`p`3)P``0  0(`p`3TEP0  0BS Q` L `P H040R@0@ `w44V`X\XӅȅЅͅ -PPLML H00@!@1  Q@ - EQ5 Q 1P AQ 0 S P0AS0KK0K@K0  P 0  QP 0x  X\ 0KT  0p @=~ > @0@40 8 < 3~@0l S` 䝟0P0=URMUq0KU t tt 0KlpP `p1@U@PBPU$=p}t Pt 0SS<@40T*``8 ` <@ }` t0X\*` g }tt(KEUR 7|<U 0U6^0< KX0 T Lt  t 00K00Sb 7 7P_ {P0Cd0 N0 Sh \ i d0P 87@~|`0pSr 7 (P0@@P0 '00P 6 |P  U:@f DA j|&A0P@0`P5|P T1@0@ f O|)]%0S d0S  O\Q\ hp p0\p S5  l5@f DA |A`P  %h t0K 05t P<@40PT*$ + <@ <@40T*4lp  `<@ S P0  ylpP`t E@P 8${  0 0 ,43  PwU*00P3@f DA {AP`@h3  u&0U0;0g0S7<80 0c0S7`3 R@C0S!,3 P<- `X :2@g DA v{A@p`@ 00Uap0P#Pt, <80 0c0S2 R40\C*P00< Hd P;Pppf0S=TBp f 1{` Q81@` DA ${A @4@ @8 < (8@1@` DA {A @4@ @8 < 81 @` DA {A @4@ 8 < z&0AA  zA`P)P806`t 0Ug"Ps "Pn |"PBh`X44  <  W@  \XVօWt vX\H -LP@Q 0  *=Q&0  "=Q QD1@P U0`0$ 岀00Pp  000{ 0 @Kz0@Dz P0P0 :00 0p0 p@-z 0p PXW`Xp4 0-0L0@  PP0S p0P0S 0 P 00,00@WTX4W444 0-L| Gt0@T P@T 0S  ,0 00 0 0@T0WW܄ R 20 R00 00 0BS 0 0P0 00BS 0 0-0@Ly0 S@P0SL 0 0 R0S0eCA 000`X 8 ! -L\ P0L `01P@U 1pT@P4U 0S z!P0 -p@L 4yTP 01 R1 0d?A1cX0@ P. Z$` $ ` V AT 0 K 0B0S 1 P00S@0`0C V0mxxgfff -LMZ, 0 , 0 0J @01P`U ,  1pV`P6U 0S,!P(K0Szʊ xw,Hg@x000 @0 0P, f00C0PR    T8 0S 0  0R 0Z^T0S R 0S 0  R 0P Z^ 0- L @P 0Q0   Q Q 0 00  0<  0Q0    0000 p-L M@`!PPP4  "   0 R)00 `0`S 0` $K$` 0 0 sKpT$ Ks$ 0R    W 4P 0\ -P@L1  !R 11Z 0-D@LB^T @ 0 ! T @0Z1 0) 1xZ -0L 01!"Q0  !Q0 $4($B0TPt`q40000嘠@0P`0  B@phTPt`q4=  L9  @5<  o0Z 4 40ZZp\Z 0-P LP@$w0T̃ 0 0R0q03 00S  H0 R00 0h00Q00 0000W W 0-t0p@l l0LB^T @ 0 0S 0S T @0XZ$XX - pWL` % 0S !RRP, 0@Y@   p <00l0d@PJPLv  @ 0  $ 0  VX"0@0Sb0"0 0S! 0!@ T! ! !0PU 000 !  0S @\)| t!}0S00T!uPU P 0 d h`X 0 Rj괱 -L@9 $P 0 4 -@L@P    0 <            @P n00@Pn0tbh躧d\0  @JP hhhQWWVtWT4 - L`p(0w036 @T000W<0 0 OnLnU@ 0PBnU@ h~ 7n ! -@`L \P \0p0Rn @[=00 @@ b   [Y  on -L M`@\0P  0S0P`2#np }  F T*Pq 2  00Ps 0 @T:d^0an@_!0P@v8 Q q d1  0 QT!00ӑQ Kq 1  00 q. 0 @= Q q 0  0 Q 00ӑQ [0H 0< 0Q00S `X pD`Xd -LM@pP` 0[S P 0㔐0 @ @=P,m g  p0,K⪳,  R* m`Xx -LM > > > > > > > > > > > > > > > > > > > > > > > > > > > T> d> > > > > > > = > > > ,> > > > > > > > > > > = > > > > > > ? > > ? X@ > > > > > > > > > > > > > X@ > > p@ > > > > > > ,A > > > A > > A X@ > 4> > > > > > > > > > > > X@ > > B > > > > 4@  P@R Pz@R 00hOx7 @h7@ pW0`P@T `PP T P @W0VP pPEUk V@TZR @TX 6  @TJ0s 00As 0@TZ@TPR(l 6 @ PLT X :@U0s 0@ T0s 0 @D5 P@@T@Dkpx5 aRX0 T5 @  TZXX:@0s 0 T0s 0 TC0 \0@s40 BP9|5 |4  0@-0s! 0 @TR oTR 4P @ `TX:N@ T r 0ȣ0  @^00 @D@^0 q 0 @DR4 03 @ P`TX:p 0 ' 0 0 Q3 0 | 0 @T  0 Q 0s @| 000 | 0Q0<Y ^@€Y~ \@{00S@@u1aP,\ P!.U@g X*I@Ua 0 \ ^@TZXYV@U1 Q7N0  RMF0  R->0 RH80  RX00  R(l0  R L0 R^FPfP ^@D@TY00S@ رT5 pEX (0 R00PP0W P-L@ 0 p-D`L0@ PR  aM e 00b 0pT5 p-@QLP! R `0 Q 0Q 0  M 000pT`  0Spp0 alM 00 0T5 0-hPL@T\@D P0R  P 0,0 0S0C0000E\5d=T5 0 0  8MT5ME 0-4@4P0L +M0 0 0T5EM `,0R- 0MlET5l=P0 0TEE@ET5EEEWEEE -`0` \0@L fKT ~ ~$0$  0 EEEEEE -,@L0S ya0000EW -Ln~h~ 0- P@Lba0h^aW -L0L @R TT^P~@@$hL~ .~@W| 0-@P LN 0 00h p-X`@L^aPZa N0 0 pW -LM@Pa0SW P 00|q$K(K0 @,K @}y`PJ (1 ($; $0V0 P,0APO #yP#U0( bQ P0P00Ť0 00 @@ K lP P4Q (0Ph@@6P̱85T5G EEEExEH -L MK0 K @KK @y@P }zK -L$M@PPb0S S P 00唢U0 ,K0K4K8@K @xP U@ `EX80SF40qO`@0,0,  !xP00SP 1T0 S/R  P4y1!1|1|!@@R(K40X``p|y1 @ 40!A< ?yXpPPU U 40A0yWP40< pꌐPz CP00dQp X0P@@^P[8 4|4`yP̱<5T5G HEEEExE -PQL@0 U ID`V TlNtp@0 P0C 0 I D0 P\M$0PET5E -LM`PP 0 y|? R) 0@yS\c d[ Z Z d^ Z Z X^ Z ^ Z b Z X^ Z Z Z Z Z b Z Z T[ Z Z Z Z Z Z Z pc Z Z Z Z Z Z b ^ Z b Z Y Z Z Z Z Z Z Z Z Z Z Z Z Z \c Z tY c c Z $] \ Z Z \ Z (d Z Z Z Z ^ Z ] Z d] [ Z P` Z Z ` t[ Z Z d[ Z Z ^ Z |^ Z |[ |[ Z Z \ Z ([ ^ b Z Z ^ Z _ Z ` 4_ Z b 0b Z a |[ Z Z Z Z ` l}  "30#`qX͟X-0S00DD=  Q ?Q@@NP@$ = ,00CP00S̟T 0 PP@^R pp00 `PWXMNIP|tM@0 P0C 0 H 00@,00<,``4<P x< R 0R0Bࠡ0(K4< @6 ;+;;;" R% |[y0S8cP` 0 @c\Vty\ 0` cR@0S0C08J0 9@bl9l9X)l9V<94)`Y89@@ < 5P`FVT P9 0S0C0V) 6HXPn0 0 08! R;T8(@8L( 0S0 0008 0PI)V QB P8  q 0 QrQ8 \, 7'x7@@\ 0`l7@D7嬧4'@7 0S0DW0դ.Pՠ^0l0ŘnN cR0N 0NRlN dN`.0ZH.Z  BD  >D0  c > B >. =-@@PwQ4  P 00 S w@t) R ] 0S 0S 0S# RPl o n (n m lm lm lm Tl Ho m 0-0 0 @_00,QB T00^@  T  0 TPPU Q` Q < R B 0AL c0  CH< 0S P&0S S S00l000S 00OPm|q r Xr `r T00e ˟0  @0 000D SX X˟QT;P;  @;  @ T " +0000010DS 00D 0 1:ʟ @ T  *0 00D Sh 0!0000C00 T T`` 0 *TT 0T 0T :'Q{  9@ 9 R 0  R'd9@ M0 0 0C0 TT50  R> 9 ^0 0@0$0  00bv@t v vv R8 0 R0[ 8PȟȟH |P 0S cQsQ CQ \8P'P8 pq 8   0 B y T TPP& '10DSP00D P 0iǟ`@` P 0 S0@ @@|G l u u2vH0 SD Q B6D 0 0 (Kl&0SDƟ00*Ɵ0 ( 000v P)tT@T[ H6 D 00`0 0Ɵ 00@m5@T5 R@0T 0T (0STS %PTdu u u u u Tv Dv u u u `r u u `r u u u u u u u u u u dv u u A 1 0Pc 0/T PP  XPzbd.10cSsS8 CS6 2 xP cX )0  cA 00 0;Ed=EEEE`=\=E@5P0+@, 0R&(K貳dCtreoe keheeehh\e|YethpVhQe+?0Jehz\`$ԫܬ4Px̪, 0-L MP@P Q 0SP R:00 0 0K00e(e  e ee<Pd -LD0"3 00Q@0P 00lL_ -LSM✀0YOKp $ Hp `IKPK@dK 0<@F$ 0R KJh徿hzܱtd@Aܪ -L$M@0P0 , 0S ,S0 0,SS af\ n\ 4@K X XdS 0R KS}d }hz -GMLMȑ0Pp,0 h 0S@`LS@( ,S0 0,SSBKHH j  08pP< IKAAhp: g41` V,0@SV1S   Q RQ\ ^00\0S ld`, 0R(KD d 8gwg $gdhz`@, p-L M`P 0(0P`0,P 4@0 0 0 ?400 PPKpc|< -P2"3K2#K3K<:c8宺 ,_0 _hzh`ܱ%B|xh p-LM@a0_K@/0 : !0d0C SD 4 4 4 4 4 4 4 4 4 4 Ȕ 4 Ȕ Ԕ  q_0$0 0 &CP-K30gS 0R||۞ 0RKp0$0 0$0 0$0 0$0 (b$Ghzh`ܱ#BLԈ -'MLM,0OK /,0 9 & Ɵ0 3 B@P 0Sm 3ş, 0Rl(K;K0SjKAAI  I / 9t%tş0te6 9lu4 (K0P)T0PB@PE)R KP9S (K06PKsj@K 6K $19( K0S3Sܙ ԙ ̙ ę dA?KK $93s s 4 R K K5C^ c^ Kj@K6K 0K8K @'3S c'}KpGpG`/)9#09 9 g 7 KBP' K@W 7S꬙ , p G 3CSL GWT3 Rt  K5@#(K<0( K0#(KFK#86[SW V@K 6[SI PK  0KχKŝ2 RK3`S)0 S) ,x 7K d"83CSGWK@<"<2w840,($ bEaC bAb?a=a;PK V@K 0K@!PL8  0PlOK0K0@t!P98C^*h 0KKjKP!-8HHHH!H1O 3S0C9 # 0KKK6KjK:3S9 =a:a7a嫸hzh`ܱ B,."B(`d`!B 8``Xܱ80L@( hQXp̰$ -0L 0Ƹzlx -H&LM0@Pp,0 B VC P`C C B B B B B %|p> C0@3S3 Ԡ d < ԟ l X L  ̞ $E|p$0cP1 @ P`T ?K U1tp0 Q"#U U U U0 @ 0@0 0@0 \4 {#0 @P`0# 2 q3 m1 K@"3R_ 0\ Xl3x#SX#8 @P`# K8303 G0@P`B(3 >0@P`92@ P00@ S` . 0K@ 2S8#82 "0 @# P `" `"0@P`D" 0@P`02 02 " 0@ P`" ! 0@P` 112 1 /)x, 0RB(KAV=  1V08L%Dp= 8..K0@ ?@P2K1" 0V eV" 0@0 P #[[|[t[l0 D0[\4 a_hz(ܱ@``(\`d`̯Bh`4hTد -LA -0L zl| -LM@P6@!zpt1` fRAP !0000CH!0?A1cS @PQ.Q00A   S$K.Q 0 U0S,K,P ( zHP ꜀`0`( ?Vᘠ*Ac 0VpS0C P0V0C0pS0 C RZ00Q (gfffA 0-,@,PL( v r}lz -LM  bP: K 㑚p* 0#4 SP; K ゚p 0#4 }}K}}\p\d@dd d0T\@ @,8 ,0P$p X -LMp D B`P= -BPr (P< @ 5R វ0S㘂 ¨@P *p2JiT ` >\ %PU] ](KH0 04P@)\@D#\< @ d]@0SO ^PG00L ᵖP4$, x1ϠA/ 0(@@lN#b 8K80 4 0@ , kFP ]P  [ [] [DǚP D[ [갍0-SL0S [ [ꡍ<@@  l0 R \[D,[r <[p`l` Mb\̵t`h -LnMxoKH0H`,0 p`P%L3Q YP03 R;$3 RAÛP, 0R(KO0S  j[e[6: Sl KAAN`P 6: S ;PPv6: Sm nYP, ("~YP KAAᮧP;K_2 [1 R |A@m] Px1]0: KP`렑0SQA00CS0P0P0 Pp 0S0P!0CS030 Pp0yUYUw {aNK@D@DܙP! Kn]PKWP#|c g^ZYPP|p |JL@\PyPhzt`|`x`ܵ ClQr -GML Mp2 P@, X"xp fP. iP% ,"xp 2 PbaU52IKpJQAAP4: S X1 11 1tBKAA +d P: DXd"8$ `0V/S /004`04 X p5 p@/xPP 0PST @T 0/S 0/S @TP70 S`]{pHX  3lPp᧳hz؜(x`t`|`,@-0@S00-\Q\ 0 00L S0 ^!00 000C\0LQ0c0 -LXX -LM0@S K( zp 0 [< -LM0@SKP + 00  -0LS@0s30 RP 0s3 -0LS@ h++ -L@H1P 0C[ 0-LP;1@P P 000/[ 0- L0@T) 0P0Q 0S =S 0S <Q >Q !Q0 0l0 \0 0XPP <0 e 0,0 00 0 0 0```h 0-\PL0S S0@ S 00@0)`` -LNM`0\(0 0P S:NKXT1*D1S8 @1Ho@RPN0P Sv` MP V?K^nP 4P=@hF@( 0R$KP.@JOK \P <\00S \ 0   \PP:40[S  5[0Sl|wt `@L0VU D00S8 W $w(K(ȶж  -0L 㯯zl, -0LAM @Pp  {sp sPp  qsp0` fRAT 3@PはNKCPP W1.;PPWWhz4U(LX -LM`8# 04 48#(pP @0$ß000P0 0@S PU*0"4R't0# 4s ,  7pz0P@@P,K: 0(3K 0$4R SR @ 0pZpP}0P0x @S *P0 03 0P đ4 pe,0i\ , JT:ZT 800\0 \FP18  >41JoKKʟK0p`\  7 0@ P(K@T 00N S 0r03.^0SRU  P,U0 p`h%PaT@0 8 000  0 (K0de`edd -HML M.0p0~=@0pYS@>(PK  (0[S0 +bS fS ,PP 0 Ƞ8P & @&T(S@P `V 0S@BKHH`(K$K8t -BMPLM.0<#=@p R@,PK  ,0[Sr qmbS fS`ZZ 0 Z0CR"$S& !00,4dh!00,48<D!00, 48<!00,+PP& Ƞ 0P:& P@2&T  00P00S  tR@PpW , G 0S@CnK`F`FpKP0Cd0Cp84 CP .bS fS93'@P4 Ƞ8 0P8$ 0PP%"!""   @ 0X0 4$0  *0 0 T0   @PpWU, G 0S(K80$`jt,e -tL M.0p`j8p6`X X   #00剁`/00 2 .PPp@00D S/0PU0 E&0S.S'  Pt2 ` ՔlB,PbX"X<,0 @P P0 ,K("2P{.U R0t 2000D :P 1 0:T,PU0R.S%  lP0`0Q`A,GD1L!L`P@P P@u  0D:U .U 0@K  c00[S `P0K$ !bS fS&@P Ƞ 0P  0`!r`PUV 0S(K80e`j\f,ee]j tt 0-.L0@\7P1p0hJ0  P0h08G-M  T 0 (0@,@ P 0P`p4`08@T` $0<@P<0  0(,@4g0  .,@P(8P 0 0<fP \  .,0 "f.,@ 0 @P<4( 080@ `p(0, 48D`(P,`4Lp8pHPX`P@0 @! 0@!0Q1@`P@!@0`!!LP0hH. .pI$HPD0&E$ H`D0#j0 0 0#j 0P%@@X@ @^0LP@D PpX` DHL@PPTP00 `0 00D0 00H000 000@000 PL`000$P0 00Ѝ0 -LM@ D1>?  08^P0Q8 n< ?^Q@ n< &<P@ < 8 &<P8 < &<0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(Ko 0-PL@U  0#<00#800#400 R0 0hC&0 -RL`? D@A1>?0( @PcXPp: *@0!0@@0D@e)@0!0@@0D@~@00 @@0D@@H@?X X  P)@0!0@@0D@ 0-PPL 80P %@0@0D@00 P$S0S -L0MpQ`N 0S SI0SSSD CA$K0P D$0S("(04"48#H~0"S* 0' R@ R@@HPK %4 K0p ,@?X 0S S00@ Ktp -0L@ `ph$PP P  ^% 0 0 00000  &) -0L"@ P  -L0M0`0p40 PP0G@P, 0 KP 0R R@0 KP4   ;@P 4@PP0K0S40@0 @4P @ K -PL M.4 040 #pP 1` _ ip@ @>l1@!`QP0000,0 8 p0 0y`P(00 /`P0  ., 0>P 0 04"48#80@T4ZYT0 Y  Y  00 ` `(K80 p-@MLM0P`.C4p0$ AK@T@   PP 0@ K4P.SD@ 0TT @$ P80  AK@@MKp80 -LM(M:K@$tK P/$Z Z Z]K p04"48S- K]K K(PE-PE: `4e 0!@PtP ZZ:K Z]K(PE-PE(P KTT0 KZK@4'TT @4 tK  4 @ KPTKK*Ki 0 PP ,PZKTZK@`}PzUp @K\Z4V,KXß4 P`PKP K KK(PUU@*K$0*K4:K  K⬔ {ZVV O VMV ViK P ZK\Ÿ%4TK@"5V00W0S.V00W0S'V 8K '80S40S00s KQ .(0*K⬔ZKV ;P@# KKPKK KP K0S*K4:K4@S ?"ZKTZKKL~K  T0#03P0SKQ *K$R P0 K$ K$XX ,0  0K  (Kl0 -LM S`; KQ *K!0SJK1ZKPZK ꂭKK(JpKK0K(J  1 ZKP@T40SV`K40 `0 ``4P[K 00pR` `(Kd8Dtpj0$ -@LP $00q -@Lz.hw.q -4@LP Pq$ 0-L@([.P0P@ PT.0qq -LM8 Y< pP xwp4 2n wP!P20S002 .wPP 20S00#30#6wp3Pq Nw0k,`  P00CS00 Ӥ0 R r ,Kp80SWS P<,K0,K@P 0K Rg00S p00RQW00S < P,0S  ω R ,0,SP SS SP00P,00,0 00v04  0(Kq p-LM@d`P-P@ 0  =,0@0S -TKpqq rS-@L`P"@3:vp 0P@v@vp p-LM@d`PZ-P@  0  ,0@0S I-TKpqq rS-@L`P"@3:nvp 0P@cv@avp 0-@LP 00 -,@r.0 - 0hsqqxjtj 0-@LP 00-,@r.0 - 0hqqxjtj p-LM 0`|,0tr.@l,PX,\00SiP  0`P@,Kpqqxjtjq 0- 84 lC > H4 H? lC lC 0 lC X4 ` @g@H )0[S ) Kl705ꌛ T 1cR@`00C Q$S@0SK|H 0@ F@0`SAp `:l'l7 l  @0S!l@ @0S 18#X `P `l@0  SQ`P`  S 1P` 0 P` @0S10P`P`x0   H *0K@P㊡ D D' Dw   28Wp\Dw  PD8WPaDFPP0L7 )0Kl' l' l7 l  @0S1 `> `:ll l  @0S!l'@ @0S 18#X `P `l7 @0 SQ`P`  S 1P` 0 P` VH l l  @0S1 `> `:l'l7 l  @0S!l@ @0S 18#X `P `l@0  SQ`P`  S 1P` 0 P`lw 0  *K 0)0K88Yl0̣l 0Q0O/KD' I R OK2D 5 :R3 l58wPD7 Lw NOOK!1 D>A0  `P`D l+ 0R000`D & 00 0d P`V U00 DD' 0DO?KD7 Hw %2 D>&B lP`D DO?KP`dU8L x Y 0.K⠑K)0KL7 D' P)0[LYS*0[Sl70t7 1PKp 8?@cT|nPʱp'(` \0 0R\0 p7` 0p7 xdK"PpKpw @DT0p`@` \0 0R\0 ` ҌxdK PKp 8Ql'V Dwd0p1K01K>K000` \0 R0\0 ` PxdKPPKDT'0B0` \0 0R\0 ` PxdKPPKTw87@gTr`2H` \0 R0\0 ` PxdKPPK@DT0p@` \0 0R\0 ` P pD0 `  \0R0\0 ` PxdKPiPKXK\' ` \0 \wR0P\0 ` pW xdKPTKp l. <@iTaP'p'(` \0 0R\0 p7` 0p7 xdKfP6pKpw @DT0p`@` \0 0R\0 ` xdKPP <'h1 R 0`R\0Sh  xdK>PK0p `0 \0S xdK1P0`0 x'0@0h7 1dp 00hw PY h@P 0KP DF?h(K  -DpL0`S@PT 0@STQRP000S0 -LM0p (0 ^PPUoK0K/y~KP@'L1[S  0P,KKL1 H1 D1 @1 <1 81 41 01 ,K0 d >K/R~KP@ 3( 0R$K hz -L@,00S %P -LP@ @R0000 0  -@LP3p- 000s00 (p-"HLPp p`p -LM  PS0  X0  !K  @PK/c@"00 K p@$ -LM pW@P 0\8#Ƞ0`P W@PU ("(pP@00 p-LM ` Ƞ,H@PPx p 00hx -1L`PV@   0pA("S$:V: 00P  000x0 z VT0   @a  ,0 @b"0 0 ? -02L8M $00b@ R[R0:4R005%0\, 0l\9c%fRx'x )8HR@J*RJ@@bQ`= 8#8R0`F*R`F 0SS:4\00< $ࠃࠓ0^,  VY0!#*0H D0 HK(KRPU:4U005|#0\@e(%x8 2 *Z 0j6C93%x40 < < (4!8HR<0@0C<0 :@b`48#8R`F:@b< h8`  )8HR@J*RJ@@b` 8#8R0`F*R`F80 S00<!ࠃ ࠓ0^, q ,0,p# 0c5'6C93( 00 @ ~x@ 'x0!8H,0RS@@A@ >:@b z `f0p8#8R`F(:@ b.Ƞ%8 8"H 8R:,00T00S+ N0(U 006R 00R`FRA@@ R`F]R0C@<0 FܴR0@-@P l^0,00 nSBS\N_0 0- L@0@PMP $0z00A -@`p0 0V@TL u 0@P 0kvsP 0@0 <0@ `P @0`p?A -Q؅L@P,MT@ PP @PL S0 KUH `pJTzT:4T006X%0\, 0ll9s& < X%X )8HX@*X@@h  y 8#88U0*U0H0eP < 31P T0 T0KL0PS0KUT P TK0 , L0S 0Kp0 , (KU:4U00<#ࠃࠓ0^ WY:Y pH R T Pp PT0KT6`VW:4V006T#0\@f< (&x( <0 0&@-/@d4xB 02d @-M)Ѝ@4=> 0~ f*x -L 0KM#O" -LMK  KP K -LMK  KP K -QL M@ K0 0#0  ;0p03T0S00#0K -@@L0MP 0 0 D 03000 K( KP(KN00 88;* -RL p@@@pT `v%  P DP 0AS2 0SQ0S 0S .P 0S0 .SQ00Q0S 2 0S .PQ00áP2@-@T   0000S  0P0S  0 RR00ӡ? 2 -LMp0 S( @0 ( 0R$KP !ᥠLZP2`P8@KE X`PEquhz -PRL@`pP@ 00PPPPPP p- @0PSL`R p0S 00 2  10 0pQ)03 0 00  P    ( 0 8 @ H P X ` h xtplhd`\XTPLHD@<ḿD,l@ܿп* M0-LM0 0 0@ P]5K0\Q0@-P0@  % < ^94 < < < < < < h خ < < < < < < < < < < < < < < < < < <  ^@7!10# ^00S10# ^00S3 @\^` 000  RE C ;@\00M00q 2  0  ^0^0@0C@0@000*^?^: :!20# ^00S  0D ^Sp 1  0~ ?^*^ #^[^\00!0 !@00 00 0000@@000[^#^ s @1  0y0\  @  0\  @  }\00 L0 R,0C@000ĕ@p0\  @  i0\  @  b0\  @  [0\  @  T0\  @  M0\  @  F0-  @@  p-0LQ`P @0 Qf`00p R-Lp`P@@D 0T0C 000jR -LM8  Bp`4 -PK 0e@YX: p`WGQ< L VJ*\Q  Q *Q?Q< [Q#Q9 q! X1  0 *10# Q00S10# Q00S @\Q @Y7@*20# Q00S  0A QSq 0  0  @80S00Y*<Q @-PK0 B0eS`40c(K@ * -@LP 00L p-LpMP@T ڝ KpdKf`P P L0  0: S \KO0 0儝 P L $ -AMLM0唣,0  H@P |v`PW B^KPE PE` XsP 0#S 8 (  P @ @@P BnK`F`F0 P萡0DT P 0 P耡04SBNK@D@D +D @P PO B^KPE PE  qP 0#S   P@ ]P~  @W1P Po BnK`F`F0 `00DT`  PZ 0 P!04SQ%`(P& `"P `P `P `PX `y@P00, 0R(KT` <qhzLL~Pbpt4ܟPd 0-L@P0PP دP0P 0-L@P0PP ïP0P -80L R PP LPP@- ^ 0S^@0 S 0SS00@0DP0 l -QLM@<0 zR| P8  h0 p 0Q `pY:%o$<0P  0Q0` pY*0@0 0Q"0h 4 ,0 @ 4 080 R@4 0 R0PI@Y :&D! 0 R0P@Y*U p P8 @<0P  0 R0U p 800 R4, Y4 8 (K_I0 0@< PpPp< P@`**yy*QQ*vv* 0R -0PLM 0 K0K0 P  Ku* p-L`IPPp@ @ IP T  0RpH0S p( ==G*iiC* P-L `hQH00::2*)).* -0L MK , K0 0 0 P 0S$$$  K*FSS * -LM KPwt@G-Q M 0@90P@Pe1A 00.b q($?P @RJ: 02!!b?P J$0  \0 @Z) 0 0 0 0 00 R0P P:02.2"!0Z  01%3 0 =00@T* 00 Ѝ =00ꫪx -LPp@Q qP <2  0=QK bᐭP T l W6Q@T W@W @W@ X*0f1@0 Z0 fB10# @  Z0 fB2"0 Z0 f00T  =QQ q 0  0s 0 0SW 0S Q q D0  0q 0 0PS x 0-LM4P [[@[0[ P@-K0p* 0-@PL PU0. @ 0J @T *0P/S 0/S BT:R T*0RB/S T*0p/S0Pa U*T@ 000/U$0 @P G@?00ꂂ -L M0 0/ K @b2b 9000GϠP*""L*jjH*++D* % - LMK0 @ @ &pK..)* -p-LMP0U0  @ 0 v0Q a0N`PU 0  Kp` 0Pd \ ,K K$0K@( $@ P, PP 00ꄆz74 77** ** p-LMP4K@1 K70! K,@ Gp`( P  K0 4KMPI$K@ *R ` K<9v$Kp K pX 000 P@ 00ӑP 00ӑ 0 S000ሎ p-`L^P%*00@ S!@ T  00@ S00S !000V0@CT  \00S p@ p@-0p@T` P 0 0  00a^0200C S  00C 00S 1>3 01 -L@ X 1:%\" \0PS0]S0phPU ` ᥔP0S PUW kfԲ 0-L @\*0S:00[S.QPQ*0R0.S :06 \:00]S p-0LSP@p `P @ `p p p-0LS@`P\ 0  !p0P  -L M@ 0S-: @0 0 T4 `4\ Q| ?>   cP"T001 X   R!*0^SE ]S6 -S000 -00-0 -  R%*0]S PU-S [SY < PR*0-S' @ 000 T   R: 0Sk 4 0u 40@^Zq9  0$@TfJP0` t4 ]040 4@ @00 @(KoL-S G P0:S% =S0S0* 0-S]S =  000  R*0S*0=S  0S0*p0-S]S P r dǟ00   r 00  PPg7@T ` P0S? @T  R*0S*0:S  L0]S -00-0 -  S0҅>]S00:<0 P  ߒP  000(K0P  000   P`0S  @  eȹ0 `R P @P@ P @ q mpZ hQ d 0-S]S* \& X R|*u P R,*%PPP 0!0P 0T ^001  ^0 f (040 >00  0 R (KoI & 000Y 4 Y& ^J 0@ @ 000`000^Z040 40 0 0  0 0C0 4 40^ @ 0@QT 4 0@2000  T, 0*0,S  T R# ^x p0`P  R00!S  00 R0#SP0^V 0 @R4   bB"(Kor 4 $00 ]00]0 ]   R !*0P0]S Q*-P0@0 @P#:T0]S/00 0]Sp'P 000   PD u040 0 8 ( p-LM0K KP` 0 ^00K K0C B@0K K"P`x -LM0` @8P pw 0  0  0S04  4pP 0KP00K@ 0]0pK0K K@P  -`RL@PpP  0!000 p-L`\P p@  A$0S0$0L0U0L0 P  1 e! B 0Ap -LP`@p0 S#T TW0 W000S (  hf`  f00   fB  f" 9 B a  h/@0 fy  f$  f"  B a   BpG`@  f0T  fh/@DpG`u(@D`o -LMP\@, *0^S) `.U ^*U Q*0*S  ^\S $U`\?* RP%*P U5 \U $ 4U* 4Uy p>E0CS<0pC!`H0S   H   0H0^p0 0D4\U0 SP,0X [UG JU0D  D D` V1 0  j R *0Q0\S \) j V1 0H  S@R*0^0\S0)Sn Ti3UbLa G\NXVR #Rc [R R @0^@@R@P(@a P<@ @Q  >3S \00QP(@F40 00 4 Q 0眀MQ @00BaVP 0R 0R0\000XyR R RL>310>#R R "R (@@(@0>3S  S S 0>3S +R@(@7\ BK.8K K K 0R:K PPSEe -t0 LR  @T P0R000PKPHPE<PBh?eEY*U*Q* -QL0 M4 0 0R000(K00* 4GPP- 0 P0S p`@dP `@ ]P$ pW21C0 R4Q  000W |GPP(KY  0W0021C0 R 4 R 4 0W00, p- LP@P` x`P T,03040S000 R   R0 \00p0*** -LMpx`P 0SLXQ0LL!PP00P00@$K(K vP (0 RP@Pʐ T*LP0SMR kR mR gRPAxn*GR KR R Pc*L(P8PK,PFxQXELD*@*uu<* 8*4* -LM Q00    K Z K  10BS)000C 00S 0 0S0 00Q:  -0L)S@P 010CSQ   1 0Q:`pV`` W0S P`P```00 p-0L)S@ p010CSQ   1 0Q:P`UV P pP 00p P  Q10C 0   Q-L@pRPPX`VP V V P `0 B  d00GPP00 Q-LPpR`@@, P 0S @V000 B  e00 0-PL @0 0-PL @0 -LR0L0@@PT@ lR0  0 R B0 0  -LXpP`@@ R0DTST0S: 0 P` @UTW YPP Y I00 W P0 0 0QQ00 A00 A -PBRU`L@0R Vp Wp00j] d00`V`p P j0@0@@b00P0PjQ0PE0P -pBRWL@`0R XP UP00j d00`@000 R0pp00P   j0@@@b00uP0PjQ0PE0P*bb* 0-LM 0@0 @P K0** -L8M4\( p& < R R S @vWP  ᧮( 0R'$KR Z@K2 ᙮|PU`@ PU PZ@K024 Z@K2 @_hzԵ<4(99* R  #R , R R R  R "R, \\R0 0 R00A0"S0 0D0  0 S S S0 0 0Aሏ -,@LP a00茏 -4@LP SP茏$ - TL0S D ׇP  VP q 3  00 qQ#Q cs0 0n0@S0000 0PU L 㾆P q 3  0 00 0y 㬆P q 2  0 00 0g 㚆P q 2  0 00 0U ㈆P q H2  0 00 0C< vP q 2  0 00 01 dP q 1  0 00 0 RP q p1  0 0 0 0 p @P =Q ᣜPP@Um0#S+ #U) @0PS0 ㍜P  000 0 R r 00CS0̟ Q#Q 0P  0 S S 0@S0+ @(ꌏ p,P 0-LP@P OP0 -LKM䡟0TK(0 p@P4KP@P/0j VXW"( 0RV$Kx `l 0@8PP 0l Kh0 0d `0 l` 0dK\ K @P X 0GR8"o6-@P QP 0R 0GR 'SKPPP L1R H1R,,,,]\ hz 0-TLPA/H0P@ @A/kPP06@Pꔏ0@-0PgS6 -S@ XS4 +S6 0oS6 uS= # @ @030 010 000 T 0301000gS80 400S 0 00 I@@-gQ@ oQ uQ =Q! /+Q -Q"\00  00  00 0 +T -T =T000`0R0- 0+\ 00XQ000000 -L$M@`Tp50 0(K4@K00K 00 2>P0> nP8 P00H S 8P p0P< 30D0 a0H@SX                 Z@ =XR@0=X0 W@0 :<⌑ < `P 0e0 F pP8 0D FpH R W:<00⃁<0 v`P 0e0 FpP8H0XD *pX ,X +X -X=X>@ =X @ D0H0 @D 0X0C S񟗦t                                I@D0S 0 Ď@D D R  @꒠@I@Z W:<  ₑ < `Po 0e0 F pP8 0D p=X @ " H+X00\0S W:<  ₑ < `PI 0e0 F pP8D H0X pH W:<00⃑ <0 `P. 0e0 F pP8D 0w@p_I @H [D '-D DD D0C>0D0 DΌD ` [  ,KI$,0P R>0SK J4"0 0`0+S -SXS S P0`+S0 -S0   +S0   XS00P^ -0 0 `Q +0 0 `\ X0 0 ` W@1 :`/@Pp C808 =0 0830 01 4!!* --LM0 0 -H0@L`P8 45T  _ #7[zl7\\*;;* -Hp`LP1@P 0S 0S0S $ -|pPL@P ᑂP 0P `ሂP P@P0S $ -LMr0Sm (K ބPm ( 0 S RL0L(  S*A (0`` #RᘁP 0P`PP`Ņp7P @`0 S S0 S S 0(`P< 0P0t!0U 9 P@` 3P 00@T P P PPP@ 0V*@PPąlPX00XXP:( 0` `ꘐ8$ -(@LP 00 0 蘐$ 0-LP@LP 4 0000$$嬄 0000蘐$$E-,1M p 0R  ``XRxR `R,! B00BP@ S0A Vr 0D A0a00c BR,! 00BP@0jC R17 1RЍ.R0X r 0  -PLM@` 20 0$KP0K(K 00 , PP^p VT(0 (pP  0 PPIp  ,1@'1 @?* --LM00  K p-L@P1X0` PP{T  44 0 ᣌ phizl7LS p-0LM@P0 ' 0S$ =S" 0 S =SSRPd`K P X0 ! 0S0 P x}1 00x -LM0@ =SS=S$  0=SS=SP$Pd$`K P! q$0 A$  P $0 1 0S0 P :10 0p R`  0S0a`LPP  0(pS PP@0 0 < -0L M`Pp,0 P 0S =S 0 S =SSR@f, KjPH ,0U00PK00  00 0(K TP 00 1 0S0 FPP,@P 1 ,0Q! =Q =S 0S0=000S0 ꐀ R4   0S0aC140 P PP < 0S \ 0P P4 ,  < -L@$Bx@P0 @<D -pLP/@Tx` *P00 @ƥTO R<",N0 蠶DH 0-`L! 0TP80!@PP@T 0*0P00H@* ~*- 0-Y+ ̌!00@  0 --LM0 0 -L@Pp/\0` TT姊T  88 $05ϊ  喊Wzl7LS -LM0  K ?0-Pp1@ LR` 0S ZP P@ 0S@D0S 00Z0 [耕|lh ?0-Pp1@ LR` 0S ်P P@ ᨥ0S@D0Sヹ00Z0 #蔞h]]*Hꔧ3*3IϠ$*0 ! -LMşR!  ,   e! e 0@A0!S1S UK  xş@K0 K0 X0 T0 P0 H0 D0 @0 <0 80 40 00 0 0 |0 t0 p0 l0 h0 d0 `0 \0 0 x L ; K7 K3,K / K+ K' K# K KQX0K1   @0PC⅀K  rIPp0[ Q- Q+ T*00K[q 3  0  Q#00ӑK[ Q #00 ӑ K[  AIPp 00.L0l XKK, PHK K K K K K K K K Y=P@@!T 1S V7T04@P!TU!X}w Q (Ÿ, 0 R(K  KpG.0SX0S p !RK   U X K!  L ?0KK1 \PXK L00L0 60[X KS060KI0@K0 1 K0 0 0 K, K(,K $ K  K K K K-~-0 A 0{-0  0u 7Uhz(# 7| 0tꔨ p-L0M`0@0 P HK@00@0 H KQ Q Q -00 0R Kp0$Thzt,t,t, : Sb00 ^ Sl00  Ss00  Sv ?00 r0-000w0-000!=@Sx00 > SS00 ! SS r0-0t!00w0-0 00Rx00 # RS00 ,1R8 r0-0!00w0-0 00Rx00 - RT00 0R 0 0 R-00S-00 Sc00  Sd00  Sp00t00 00 s00s00R-00 00 -00ddS*KKO*K*%G*%ooA* <*zz8*R0S 0S0S0  R00ZZ *''* -0CLMs,0 @ Q* 1 RPIf 0R) 10CR 0YS!Z0s3(KZ 0S  T1R@Z TK  ,0PD0PSpYW P0`U00S00 P0@U 0U 0R W`P0@U00VW:0S`#@ P0 S@T 10P`@0YS?*!]:-0P P000P R* -`LP p0W 1@PPP@IUE00Q R @1@S 7 R100 -LM`qpP r 0@r   t00 ( pDW PAbRP P  0  R 0S 0 U@R 00P=  t!, Pc 0Sa 0 0 0S0 g@00PP  dPk0 0Q 0@0A   0, 0STU 0 0 ,P% 0S4 U, 0p 0  R=*@0p@GP  00p  001 0  g0S S1J0 R0(Z0 0Q0S S1J0 R0)Z + @m] i+0 0d -ML M,  @  pT2 /T ` 0 @C@T/TPP  0 W*Plğ, 0R(KRs/T ` 0 W:/@/T W: 0@ 0  0 S00:*P/@@BNK@D@D+PA 0@ ^KPEPE(P5 0 0Z/S 8: S S 000 0(PNK@D@D+bP( 0S B^KPEPE+VP@y*P 0P W~:Pj*P0SNK@D@DD+㍠ 0@x $ Q 0P@ 2( 8 P. 0  0 S00b* .R2 W4 @R  W.0S0T(*  @0lP  D0@ PP 0@6 $ |Q^KPEPE_0.S @P+P^ 0@" ,PU8: SQ0S /0 0IP! f )P0/00nDhz0PN, -LM M:K0P~UK4  >KK0C*K080K₎KU, @H ?U@B [U4 *U00! PU5P(K R*K, Q 0 ` I/*K, 0b5 (K*K 08 <R 0 XT5R L50PP!U00S !U[ @DP 0 %< 0 P`].P 4!Up0:0C0Pp00-S@= ]SH P`[U8#80@0:S0@ : P 0]SLğ0i^ 4DQ:0 RR0SF ^ 0 8#8000 @-S@]Q 3 00p]S@ 0#< 0 PUKLK*KA KKA(@4 0 Pa*K, QJ 0x :KK0 4 0Q"0a1 0 0P[Up`]0:S  0  nK`F*PK*KV8`@*0S /S  *K/S 0 R@ 0S00 R 1P* 럳P*K0 P(P" U R^ 0*K S C  0R0S0 U L1 (KP\ PK0P ]U@Nc< S *K, 0pb@qP@ W(Q@00 \  0z 0 0P@Pu  00bD**?[-]:X@D -LM0@{SD {P T႞KI p KI0pPC0 P\ @ `{Q` }Q Q [Q]QQ 0  0]SSS@Q  0(KV `F0}S0SU0[\ 4,\ T:P[\0]SS   0]SSST0*0VU  S:0S0  uPp00{\ }\V`F` -ML Mx@,K`pPM P K0 000  <R 0p Qr q 10bQ KK @ @ 0 S L \S0N0|S BL.0K^: X0 Q  R00   K4\@姌夌p 00  p 00   P Pp 00   p 00  p 00  p 00  p 00  p 00  p 00  p 00  p 00 D P @ 80 R00CS000?_RR*R0S0  RR B0 0Q0 0Q*__**A*//*aa*P0  -$0L! 0-$@LPrPo$mPj0hg p-LM$`0PK@.0⿄ቄP ᄄP 8e,00SKp,0h -L8M$@ 0PR 0`00\pK@` 0` 0DK⍄ 1P 0 \0 1X00S$K,K,0D0 \` X0 1P  -LMpPW $K$`3S Sh 3S\ S S WS= S S S00> QS0PW @ SO V&Sv S1X 0PS DS S>400 2Qa A0B !>3 S >3 !>3 SQ!1XX 0PX >320  0P0PS "S>0!># R0\PSu0S qXn 0P0A >Q>30Q,  0P,  0,0 ES @J`@` 0p3PT 0Q @0 \ (K>3!>3 S,  0`,  0,0 FS0H P0>3@ P 1>3 @!>#"R@D0  @V 0 @b|zQ& .Qu,  0@,  0,0 DSP`J  0`tP 0 `7Q 0>#" 0c OHQ QD 0>#" 0c O0 @9G-Q` $P @>3 S Sw 1S S S @XSO <S S S0>#00 00@0S0   @XS xS S 0>00l0 S00Sl@@ S G&Sr S1Z0   @\ p!>3 S >3 !>3 S 0@00Z >320  0   @!1ZZv0   @"Sl 0>00 1>3 S`  00@0Sv @USQ0 S @MZI0   @h80Z @=3S` Sf NS >3Sp SC S S =S S0^Q>3S V + >320 " `0^j&S@ S0S  R r 0 _R 0S* Vr 0_R `(KS S V `0Sg 0 S0 0^20Sj 0S0V S ` RZ Q0V Sa R* Vr 0_R V* r V 0R`!>3!>3 S0^yS SZ Sh @>32@d00 _ 0 0 ,P `0~x00^N0r `|0 00^<00 V0C 0 >3 a 0c  P A>30 @C  1>3 SA 1>3@!>#"R@D 0  @P `+> 28 0qH D i @ < H  R4 V 4 0lS:@   LP 80P 1 0P 4 10 ` @>32@d,0 _ @ P 0 wPJ0,`0  0cP6>3d 0dS0 000`0r` V`  -L,Mp P@6Q >3S` Sf NS >3Sp SC S S =S S0^Q>3S V + >320 " `0^j&S@ S0S  R r 0 _R 0S* Vr 0_R `(KS S V `0Sg 0 S0 0^20Sj 0S0V S ` RZ Q0V Sa R* Vr 0_R V* r V 0R`!>3!>3 S0^yS SZ Sh @>32@d00 _ 0 0 ,P `0~x00^N0r `|0 00^<00 V0C 0 >3 a 0c  P A>30 @C  1>3 SA 1>3@!>#"R@D 0  @P `+> 28 0qH D i @ < H  R4 V 4 0lS:@   P 80P 1 0P 4 10 ` @>32@d,0 _ @ P 0 wPJ0,`0  0cP6>3d 0dS0 000`0r` V`  -LM`< 004 (@40 0P8 Q p0 0 AϠ0 @0 S0 0,, ,0  XPy  X| , p R@ ,0 S T  0  Ppg@TP2W  X* x| p00 00_X00So 000_X0S 2WX ,0 S sS 0 , 00_R00SHA?G0CSE@ 00S 80 < ZP]  4T0 8O, 40 P0 S,0,, ,0  XP00, ,@ Rp0 0 0Wpp@vp 0  PpP,  R r h  0, 00_R0P Sp X x $v0O0(K  -LMp S, TQR Q0 Q Q Q Q  \>0A >Q>30Q,  0P,  0,0 ES @J`@` 0p3PT 0Q @0 \ (K>3!>3 S,  0`,  0,0 FS0H P0>3@ P 1>3 @!>#"R@D0  @zV 0 @b|zQ& .Qu,  0b@,  0Z,0 DSP`J  0`NP 0 `7Q 0>#" 0c OHQ QD 0>#" 0c O0 @9 -LM 40 \  ?R(00 Sd 0 000 $   0  X 00 00_W00S1 000_W0S 8U  Y y 0  00_Y00SA?E0CS <80^  R@ 0l`  ` p(K x0`  `p` \ |   0'00_\0Sp Y y  0 l0l't7Wpp@0 ,@8w\0\0pH 0S x P H0S `KH0H0   0PP ^u X0S `0D R X" 0@0 @`0D PH0S\0  LPD0S H  0aH E U 0 \PP 0 R HJP P( TH0`0`O/\ `PX`^  D0"P0@0@0@X`VعDPչ<ӹ" u{D L0SPX忹 H  R @T 0`   Y y   0#00_Y0SP W w ` 0 00@#3UPP` 0 ,@lS~\0y` \0z` hSH  v ^H0S `KH0H0  0 PP Q X0S `0D R X" 0@0 @`0D PH0SV LPD0Sp H  0*H E U 0 dPP 0 [ HP R8 TH0`0`O/\ +`PXp^  D0"P0@0@0@ ` \0  H 0XXpW޸DP+)H0STH0X``0`O/ H Q ` H0SaTH0Xp`0`O/  H 0HeE `0DPP`X M<嗸 ED L0SaP_X剸@O`0D4PpX # XyDw<uXqDo@0`0 R T`0 CR` X0 X0(p0R RXH`0 CR` X0 X0p0R RXU* -L$Mp0`QP 0 " @@K|0#" 00 P 0@0$0 @0 <0 80 40 00 ,0 (0 0RKA㹽P `+?hz -LMX0@K`P$0 p᭘ a$ 0R K ?hz -MLMK@ , p p`錘PB@F XN 0dQMOKHHV !+  2pP#  $V'0OPU`d@ <`@ ph, 0R%(K U 1pPL@ $HW@UVKAAp X4U0eʶW$>  hz 0-@MPL 00}K0 -pa`LP @>`P` 0`5P0iIV1P Uj!0\1 X -LM ßß0 4 , =80 p^|P `hy @TT PPBT  ePPV 0Q0V0SyOPBTy3 2@ ZR00S0BSmRJ 80S R 0 0(K1 R 40:S  04S11    0:S:? RUp1 R 4 0:S XL1 ? (1 R 4 0:S  J`0 R0 R 40:S 0S 00   040C0 :R:?Q R,0 1X 000 <0 , 0L0(8$p,T( -LMR4 , 0 80  F0S0000s %0S40 -R 0S+R 5 0R0%0C00%5  `uPu` P@t  00 e00b 0 000$0S0 R#, `4V ]0 4A@-QPpU4.{P @t x$0s`U h$-Up 80Sb L 01S[ -Q V :Qr 4 {Pm 048 0pPF 3#040P -Ru44 v+Rs44 o-U30S5P(KLsL3PHu0 , @00*#@d00d00P00"0P@0̂0s02`p@P:U@30S0002 R 40:S x|p2P?P0Sv,r,"P(2u a  000 d0b01 s-U0S4tzP 8 0R0WU0S0 0;S7 :S 0S000|D00 R@!0:S 0, 0R01 !1Q  40:S 0P40 :R:P?PV0 100 0 0L0S0,0Q0 x0h  Q 4 0:S010048 0P (<,(40Q8($,0 -LM@@\K -LM@@QK -LM 0F K*7*7tt**$$*6*6PP**33*- 0L0 0 0 0 0 0 0 0 0 0 0 0 0 0 0  0\0 V* -LDM\\`, 0 \ /00@, 0R(K^PK2 1PY@(00P0Qp I00A SFs@Lyg P!00@T8Q 00A S`V:/QQ@ .Q(%00A S"P00A S  Z R r@yg P!00@ TQy 00A SP~@00/y@P00 aPT@ 0@dK id0S@} ^@00x0XSxS r 00 D~ V pp QP. ,q* !000D$  Qx!00ӑhAxdPG0W02p0 `VI:00p:v ! 1DW`F/Qm Q@Z t 0h1 T!V00h!( 0T 0Q 0S SS 0h1P@@8e4 80$ 0 hz T@ -LM 0ymhl -LM0 mml -LMdOKPp` <, i.P @, 0R2(KᑾY  ῈP 0S S) 0KK CP00?@T00V: KK C %0 0 X9 00SKKLP W@ 00S Shzh -CMLM`P@, pP, 0R(KQ#T$  Q  2 P@T$ T0S 0RU@X4 & aKII (3$C.K B B 0P L pK 0S 040. S  @P P,g P #$0:, $0 Pp0( 0 0H7T,P303 D $@ 0@0 <0 $D0 T0 P80S$$0BP> P0$0:, $0=,(Ko; P 00T0S0,0 - P P T0 P X RP0 0P, 0P, Є Q Q-L@PP` 00p P$0 S U U P T$0@:$080@S0 /R $0P P pP P>:0 0-0LSP@ I0T@1S00 -`LVp$0*-0Q4X Q#( R> 0`VR o80Se 4S S 0$  0R/S@/00(  HE`$0  `# 0B8S P$0 qP 303Q $@O 0 0RK 3P 003P80s 0$ `8QC$0 0`S003P$0@P( H$  /P XW @᣶P ױ(P00 00 `\P  % :$02P| `e34 $0 PX Z HP6 04N 0P k 3 03 P 0  Q 3nI0S  0zP} $0P:$0dPt $0 ᰾P 303$0`:$0n+ ``' @ # @$0P:$0 0 #0 0 #00Є -0LM@p`  00 00(K(PP0P  0P `00$@0 0$0 P aPW jPO 080@T . AT% ȵ P5 T@PH 2 080 $  P03VY`, @, ,@ ATVX# .P  03$0 X ک 00 ҩЩΩ 0 *   P$00$0Q0 -PL0@S0( 00Cp0姩 奩0Sᠩh6,h,`e0S a -LpMpK`P 0: S < 0P0$KP@'P PL0@0P  0 ( `(0@`( 0 `0`0@,``$`?$ pLP 0-LPp" 00 R00S 0p  @P  u0@ 000q@0 0-LKp@P  PP 00 -L,M0 P 0"pT0 4 rpP W ZD oP0@P0PC$@0P(P@Z%0`)T0PcT0P`@DQ000 00 00嗊(H , @@ H@ PTu*Y ,0j 0lS0P`S& DQc0X 0\0 0h@dgQ!Q D\a= 0Q0 W:WF*ᇱ`d0` 0P  P0ZD0 0 ) R@100*0 Tg`g $ 00 `0 0R*@PT0PDP DQj 0P0 `0 0R:  0gY@(K0T0Pg`g " 00 g `0S @t:0T P0D\ DQI 0\0 DQO,0@H , 00 ,, @@ CDP0Ř 0P0 .DP @0H@ 0 0 @gDQ 0Q0 4 0P0 4 0Q0 ư T003DQ,ł 0P0 P01 T  `00PL0 T P0i<0 T P T PL0i0c80 T PT PPT0PT PPT PP@4000 0P 0 ! 0^0 #000 0\ 0 T P`h4,0, 0Q 0 $P0 H0)) S@10*00Tg`g $ 00 `00Q*@PT PD\ DP 0P0 `00Q:  0gY@4 0P0 4 0P0 tT P\8T08PPST P(0T00`P`T P)<T0<@P@ 8T 8PP)<T <@P@ 0T 0`P`11* M0-LM0 0 0@ PJK0 p-LM`PQ @Q |UP0fCKp000C S0 \ -L(Mğ PK<KP0 L@ Pe/h`< @ 0S0  @ 0|S :S 4 R@ :00$$<: <P#DKX00X0< ZpD0ß<(0 <QD0ß00 <JD0dß,0 <CD0Hß<l@ K40P@Tv3 D<1p3D00 ,0Ÿ  80<%2p8 40D0Ÿ<0 <pD0Ÿ:0 <pD0xŸ:+K0 { .K{ 1K{ 4K{| 7K{ hb'aP`@HK<  6PK3PK0PK-PK*PKp00% D04K <0H0<1K 0p H@T<<7K p3 H0[S0F <7K@ K'P@F@0PqU``0D p 8_{dQ0@ < *@K0pH @ 5T P(1<00\(K00F<.K PpHEpF  @@A@F`< ypD080#80;@ 8é@ĩDȩg$$4HL\PPTX\`dhPl WEV 0 @-@T' :T@0@S S S 0S@ S@^ :R ^0@S :R^:^-^  0R R0:S|S S |S 0R:SS  0-LP# P 0Q @ ..0 A0 SaA\A0AW AS7 AT0XQxQ@@0 -Lp= @P@d>P`d 0@:SS   P0Pfd⭨P `d P@f ᠨP` D`V _ -Lp= G@P@dP`dP 0:SSo ^S \S0@ PUPfdqPl `dP0S:SX 00@\:\O 0L0S 0/R@ 7R 0 B1/P07P0 @10@0B0L@2SD|LLLLLLLLpLLLdLXLLLLLLLLLLLLL|LLLLLLLLpLLLdLX00U@f P`VD`0T0 00} 00z 00w:00t00q 00n00kᬣ -8@LP k000 0LTHP 0-@PLpPP㋣d0@@0:LP00340P (0@ @00D@H -MLM@d  ^, ` h8 l p( @0S`WP loPm  P 0pS LH T hL(Q\(  h .WT80T8 X 傎KHH`YP 0 S 0Z@PY+h8ZP `0 SU0U@E\S 00 HX #RR l%Pp^ 0:SP P0:S0@0pIhP@ P( = @Pr P0S :SP:0C0EK0@ @A\(h8@c`P vV v:0P E0E 4 0S :S00i c 00 4  S`D:R:0 00H0f c a0 X0;0g@צP H0g gg0 0H( `pPH @ e|40(x ሢHDH ;Pg᳦P: 0g@pPPX(RhjH8dg S0A0:P`@^@pß, 0R(K3 Rfh(02@X8S\T 0h8 0L0SL GT(R@@W>X\K@ 00BNK@D@D"孨 P)*2 R% h 0名P l^K< ѭPE@8 PE @D 0 p& P$ D0Sh@8 0C<( 88 L SPh TT X hjhy@hj@ 00TT a ⏧0P  pd000\H H8 X Ph H(X\!á@Z@WWX(R2 ᶡs@ 00JPp@Wn ᨡkᥡ@DQ? `P0`?SP``L0@p gom@pb@ h {?0YP@p s?0Y@P0 -L M⼀0`P$0 ,pK  !62 b1 R<0Q0^ph ~?@ Q R $ 0R K hz 0-PL@U 1  !1P\ 0h-0##*<<*(** 0FQ0  F$hhs*$%%l* p-LMa0PS-@T 0S00S @ R0S)xT! 00@0SL_`K pP 0S xDx(@00 | p-LM, 0( rSwS@T 0@0Kp 㞜 0S $K7P2 RROpPB P#1@T 0j@T 1 R ), 0rSU Z$P[(0!d1 R6, 0rS8 , _@$@0(a@ P0S00  0 R$+ )@㍖WPS 000Q0 IFC$_@  @$T `[$|x -0L  -BML Mß0P,0 T$  0S 00ß, 0R(K/x[PP0P4 L 04  T$Lu00C=S  X      R  1!S  b-1A L401!08T$BNK@D@DP  pp0 SP&1KH4 1D A  @d < 84 4 &\5`P 0SHa QBNK@D@DPQ P 00UBNK@D@D 8(0K@/04L  8(K 04BP70S<8ܛ0P@@"00 c-!!R0$ 0  MkBKA@@DAPT L 4 00hzxd0Tf0  -0-LMP0 S  @     0S0! b-1 00   0S0 0  Q 0RK00 00hz --LM@0 S       0S0! b-1! 00   0S0   0S000  0RK{ 00hz -0-LMP0 S  @     0S0! b-1! 00   0S0 0  QL0  0RK03 00hz@-@P  S 0 SS00N0 --LM0  0 K 0-LM@PYPK0 [P YP  YP $@ 0@Pw -LRp` @PU  PP@ -L@`PYP pW0S ` WU W` @0@PW` P0Sד00@T T`W {PP  y 0ȁ`l` `      P 00 -(0LSP< 0S2݂0 ! P` 00/`VpP <0O`Vp0S R 00cO`p 0(p`p 0q 00`p0 -LQ W00 p R* -2MLM|$@0TP,0  <S   0/Sk @P B.K B B, + h X030#` V0#ScVH < VD / ?XP< PP#@aTQ~KpGpG u(K0YC`d   ə,@B0 /S ,3X5/00,8[S XP XPP0XP /,0VbPX A0/S/0C0@0@0S_`, 0 R{(KX?00,R,  咒0<  +>MrPKAA VPPh<: S Qk®KJJ  [pP( K`\F,<[/SD XP /P0aY 00phz0Є  0-@PQPLTP Sp 0@00 㝗P @P@ 0S S*||* --LM0 0 廁 K -L`P , !0S*0 R r 1S0C1@pT0@ `0@V ,000MZPp`d x 0S f ᆚ   0f ( 00S  0-L M0KK O\0PS$,,$@ AK0"000@@@ 0$0%K -LM< t<0D @  Pu 0-U +U 0P8 80 D@ t 3TT0U RUD0 ?4 00 8 RX 4 K <4 K `kV0D0@`c`f,` `p 0E Qࠑ uz \B000t W070cD^mR8Q4 YNK V0_ , ^00SD041 ,/@`p`Vp P0U8  @@RD@ 4 0 4 K 4 K ,  W# 8 V0& ,@^00S0040 ` `Pp XT"00P`q VJ"00P`q W0 W0@Q RJ< <0@ 0(KP8 A0XSxSEP D 4 0 C  -L@'T`p@P  @00#:k0cS:UV@ 0's`p -LxMXOP0 U80   0@D0 @@ 4 40 -SX!8"8"8"8"8"8"8"8"$$$$$8"8"8"8"8"8"8"8"8"8"8"8"8"8"8"8"8"8"$8"8"8"8"8"8"8"8"8"8"$8"$p@`PM  | EPeP Y|0x@0`V ptp 4 @T400t`VDK(K@0D`t` 00Spxp { /Q9Qp@`9Qʇ!000T0pCچ!000T0`C@4 /QP R 0S H0SE0 RT4 | r 0@ Q  |040|0 R! |0S  P 0BSpچ0R`|PU 0 CR:ʇ!00 p0|0 04 0t0 4 0So 00Spxp 0XS xS 04 00S S`  x s4 @t@ |x 0 O 44 0+Q -Q,A    00@ S4 30P404 0P 10@S&40P@p p 4 /P 04 0@!00/PP9PpH*0aUS RaY T @l@ P 媞 Z@PD@ @P @:H A q@Pᘞ 0BpD @ YPP` 0j@T 9 DKqD @ 07 MSphp lp dp `p )0@ D0 h\ 8slsdshs`sZ"00 4 sBdPD@P` < pdP5t8M `8 0cPh l d `  0`0 d0 h@osPl  ! DK, K00KsP8 tPd P`, VPpPPg00ࠡ࠱Rb  B alR 6c\ PbP @0"00C`\0 \ @0` @T00 S 0S p pc@c`cU dtPd d 83tPP` 8r8P T8sP8 U XltPl M VlsPl E WdsPd = l8ysP` 7 0 0dtrPK `db 1@PdPKYe u` X T @5 Z 0Q0jZ0S XKx%x5dP XK萛P zX T Y X0K`pk6pjDKt 0p 0DKoD @ P@`\050Zp 8trlrrdpr`nr 4epX T YXpT@@PQ_P`p 4n`p@D0SH@ 46SE 3vdPA44 9pX T X`A0`p | _I0@%Sh.!!!!t.!!!!!!!!!!!!!!!!!!!!!!!!!!.!!!!t.S@  2r` X T0 I0P|@  |@ 04 |00P0|0 10@S 4|0@ | y\2 X T0 BCbVD@K0@1 ` o@PVD@ @P @05&C@ ! DKoD @ @"1 R6CR0!0 5&0C@@ D0 @ @ @4@KdaP 40 (R D @ 4@KLVaP 40C44 NaP40\!04 @ D0 Qt80K4K< K^0S@t 4  S S 8 RL`K L`K ?4 00 Z4 K ϔ, P` 00D S t= 0007 W070c Z1R V" U0& , \00S0040 Po P` @0T   04 0 Uh"00@P` V080R00S Pu`@Q RpG <2 R] 00SV0 R r 1S0C10B <000PD `0S@0PL {pP- @ Γ0 @p000CC000 R0@ <08 000B 0C B0S lxP, 0S01"0 0R0 R*0\SL 㭎P 00π0;0B #A03@ #0000W,0@-@$ 0@0 0 0 #EgvT2ܺ -L@M@ hKQ ph( 0 @ 00# d ,0*0 0#`a0"00# \@dȟ0! 00#X@Dlŀ0 0 0#T@$(0, 00# P@ b* 0.0 0#L@0"00# H@ǟ`0! 00#D@̀0 0 0#@0n)+C0,0O B0#  <`G' 0.@0 0#@8@@dE0"00# 4 0$00#0`ǟ` 0! 00#, ǀ0 0 0#nd@& 0. 0 0#  -P@0" 00#<@|0!00# ` h@\Ɵ0 00#lƀT@<0,00#@@& 0. 0 0#  +,@0" 00#aX@0!00# `D@ş0 00#̀0,00#\@% 0. 0 0#  b)H`E0"@ 00#@@dF4@0$00# ` ş0! 00#ˁL0,00#n$ P.0 0#  T0b&P"H@`0"0# ğ<0 0 0#lȁ0! 0#d@d$0, 0#  HX0b. 0.0#L@, 0"0# ğ@0a 0 0#4@ā0! 0##h0n 0,0#\@  * 0.0#P0`0"0#D@ ß0 0#ll΁0! 0#P#,0 0,0#`@ 4 b( 0.0#h@000# L@Ÿa0 00#lˁ000#T@"0 0 0#  % 000#\@|` 000# @@\Ÿa0 00#d@<ȁ000#H@"0 0 0#  ,Ab- 0@00#@@PQdK0P00# PP4aX0`00#``Xe000#<|` 0 00#` \lˀ000#D@? A10N@b@P, P0@ R?W@pG 0 _?W@P0 W(K (Ko誐@, 妐 I,0!pc?WP -L(M< 1>?0@0c@ S80 D ,;?C0C0V`p Vpp@P 0C P00@PP00T0#S 00@ P00T0#""S T % * 00@ T4>2":c& :460V0) Vp0pS.Z0p0GT0  AT,K 0Ee, ( 0 #2>;bp.p>Qdl.l>b@ P]X.X>Gd 0b@P] 0oXP,\ࠃ|  >  `XP0L࠳|0 | 0jS SaB0Ct U U Et0 E\t t p   Q00 @  x Ps \00S ^ -01NB0H D    ̟ b0`p@0 T P< HKP cH D  @H K lbX T |^ XK0< WP00Q00S ROXK; c0X T 0L0 8 4 3]X K c; -b40@S UA ;XKb 0`pVP 1WP ` \   pd \xe`0S d\\`oehme 0S00 p` p0 0?\0Sn ^00ӡ!  ^ `: Cc 0RP ` \ p100 d Q @ B¤ Ť0@S\\```|` x x 0Z J∠ ӄ 删  x 0S00 0 0 x x ,00 0C Q 0A63@ a 0aCA֏J Al  4 8 Ex\@` 0tS\t0tS0ct @cc Rx0S `fP` \ hfPPX hdhP kfP\ P pQxP R00Sp Vn46Sj70Sf t0@0t0 p\0\t00t 0 t @Tt0S|\6 R`U XY` ` d@P `0  ! "peP `` pd ` ` L <hdPdd Q U00S 0S X^00S \W UbL 0`R h  ePh d`\u d  ePd `  eP` LL \hdhc`\d@P 00`S dP Q  0 cc p [0 _P00C0 x\ 4@5 (` 0u`@ < XKZ@[ 0XKi`0@ pP`@@K 0TP< 0X` 0@KTPv4Q jL`@ K U4 P 0jW` @K 04a $4@ < a`PZ@D[ 0-`0@@@ K `PUP 08 -P0@ pP0 a@P 03`kZ`[ 0a 0`000 0@PP 3 P\P  0`@P  0UP  0P 8  w9R W8008  000800 h:ePh 40 8205a  XKZ`Z 0XK_ 0@P~PP 400 p\00W 1aP@Y`Z 0_ 0P@^4P00 000 <1K_ 0+UP K q_ 0TP0w0S 8p u408`0 \0 @nT/X T   ba 0cS0Ct @4S2+  zdP` T d '?aCoc?`(?yPD??$@@@?\0  `Db 0@P0 pH0 p `@P `X@ TP p@;dPh  \h0`h`h0  \0Sڈ T@d hecPh \bP0w9S{ W p100  h\bPh  dPh UvN  \010a 0`l^,0CN@6@ccP` t @t E0SS\ cP\ \h\aPʕdP\ W\cP\ x{hcPh ms`bP` rkh0S0SU%`rd p9V00l90000fz0w0S p^ X T p`  cP` <hbPh V \oaP `:V `?9V X1``9`4 -LVp3 -LVp3 -L0MP T 0 R` BTL X 0X@P0T 00D0 噅PPH , 0 ITP(aPAH0H 0,@p, pP0 `PU`,0D  PU `@R P 0*L@P 0 R000 CZ *0S 0SL0 B@^L :L P H(KH @ <  8 4 8 14pN$P @0`PU`@KPU`D @R @ < P*XP0 R0 0BP *0S 0SL00 A0CRL0 :LP@i 02@ ` P-L@ @ 0S@`P@ 0-L@PP 0S0   0S0U 03P񟗀s$s4sDsTsTslslslslslslslssssssssssssssssssssssssssssssssssss tt,tr41 01L P 1 1 1 0  10 10 104 10 10Hl0 \0 P0 @0 00  0 lQ 0-@LPP@P@0 080 0,@P$0 00 0pxtQRP000S p-`PPL . US@  0PP@ @00\ \ @UR!000p0@T00p00pU  RR@PP @T@@-@P RS 0P 0 R! Q\00000@ P- L Q [T0 0Q 0S0S QbP0s3 -0LS 70 0P  0  >0S@  ?0< B<R0LA0 0!88S@  ::S T0 0@ -L@\`0P0Q`  RP \  P p|3U 1R 0 S 0 S?0 ^^/0nP  VPPPPT00p0 P 0S 0Sp0CP 0Sp0CPp0 PXH06+@P00 R ! 3R$0P VPP Q -LPp SR 0S40S1s`T000` 00R` 0SJ0S`@S @Z`0 d 0Fp> p P` P@ 0 0R @`ZWP0  d 0%p p P @`ZW0P  0 0`` -LM`P4 8  0P0(KZA 8\S00P0P 3 P S0M 80P SV#4pe00 0@SW p@40 0P00,K@p,K W: 0 40 0008 RP P @Q 80@TP 4 0Q,K ZpP4 0 0-0LPM@ dK P6@Kp O 0<K <0 ~0 dK00 HKD0 @0 H0 埑득Y㴊hz p-0LM@Pt`U@ T%$K 0K$ @ PPSp 0 S 00 0P0PKplz -@L8iႊ -L,M0PPp,0 `1  9@KR0! 蠟 R0!  0Ā 0P0 0    0@~pV@@, 0R(K00 <NpW00 Uhza|1( -0L@H $0㡎P H h̫ȫ Q *0S00S0 Q -LMTp,@KP` 0  l~  0RK hz -0LobfrgRBQ Alnn  `` @`Väp"d@`FT00æ?d@D`R ?V00S X W  40W  $@0iQ -LtM` \, Pp *: 0 0 xtp*l: 0 p l 0 U 00\ %\z^ꌆ܆$0<(lĉ<<HlЊ<<\ PtԌ(8 , 0R(K 0So$@ T@d Ϡ0l" 0S` 00P0SP@?0/0U40 4P T4@ 4K  KP" KP- 40S% T UP4@4P0P0 P,:P`00 ;0`0 40S0DT@40 PS4P @Ql0Q4 ? R0#S4K  0 4 P004L1XH1H1000 0 ^ 0 S J"10^=0P\ 0PE0S0 J@0S J"10^=0@0  S K0K 04 n0 PK XPl @0R @D R J@0040 ꫪ*lQn@04 -LM@P`pJ0S 0@-H01=0\J 10S1 00- -MLMPP8 <( 0S` `,0K,0 S (K `V 08 2Q22Y PBKAA 01 R0SJK=0 0( Q(@K1$0HR1(@KA 08008 04 PZ0HTڂK `LLD 4 480H0S48 48DH! !H( 0!L 0QHL8DH @( 1"10 p 縀^8<(,0K @@`v`3d `G,0 S@0 ` 0`v3 c` 0(Z0 0n@04 P0 0 PH P0 0 IH -0~03?LQ00Ӣ?Q 1!0 @0S d0 R0 R0 R, =0^3p3 -LM|0@`l,0 qpP@ 0T00 PP P:U /U .+3P JP, m, 0R(K:UP/U y P*/\K(PEPE+C+p(+l(.2P@ @ԙPށp@ )P:PUK\@ $(2Q P P\K\^2^*K\?SSTT1 !0C  K0\000, E0RK, H/\;:KPKHK`*KP/H0*KP?QKHQ0d?KH 7 KQd  XK dT7 QOK`0*KQH?Kd\ 1^KT00 S8 Kd*KT/H0Q*K KT?HKHf*KH/0S0/?2PdPT^KH*KH/ 0$& ^:KH0 S5ڶKL KH1KH,*KL/KH0*KK SLH Kd*Kd/R3^-  0 KH?K^d  :K\?S0 KH0S0^^-  KH:K\d T@ KH0S0 K`A 0Rb\0S KH 0gcPKH00QXPM0 SN  K` K`P=3@PK`@T 3  P P 00*K`/R JBT3K- KP@X XPE@DJ*KX UP 10P 00l4K` @0 S 0*K`?Kd0 S/\K(PE PE @P0S 02S@@0 0 \0 0 @0R P;0*K`?10 Rd ^[ 0 S1K-0 Kd @*K`/KR" K`0!S:K*Khd/`?*K0`?1 KhK`:KdK`:Kd?^ͅA2@@^M@ PKdKd2 ^^K(L P @*Kd/00 Kd/hzHqhx.Є+ -RLLM`@0<S p@ d0Sg(K@>0 >Sp@ dv(6p@ P1!@,  "pP00PUJ <Ua l@ d0S,Sl,0>C00 0q03W0Sh;Q,Qe QpWx5x%0  00@T H50D%  00Q ^ W ş^ @0^M^͆0@, 04 a$0` B0P0 P Z00 P 0 0 Sv p @Z o l @g;S 0KP_DKPY 0,SVXKPQ Pt Mß^ @0^M^͆0@K=`0 |30 h0 h3, btp \#0l0 BP0Pt03 p`  0 ` dp \0 0h dh@X Kd00T\0` 0B0C@0B0hpp0h h0Ϡ"2l10!0h R0 3l20!h0Q008"1$#Bb20ad Q\0\KS`00`0 \ Sh0,0h0 d 0!0Ta !0!100QP0@D0M0 >Sl@ dn\0@`00A\ 00A[Q -L@ P  h4d -LpP` 0S@ t@ 0V X0(0T=H00(0(00005m@P D<4d/ H - @L - 3LMPU$ @ 0S" 0^( 0^N010 2 b B/#b0Ca"`0c(0 (0Sf%0S$\>^- 0 SP 0Q^M@  0$K @' 0 !0 1( K 10 ^( 0^!0n0C?t3c Ba`1"`( 0^\  0! 0^ QA!01"1,010 Q(K ^X $0R0@0@!. B2!Nc0@0@!. B2!N0Q"Y` -<1<`8!VL C 0S^͆®]P !0"100 !0S X @pP-P_0@0XZ]PpZ0^=0 @sPpD-P00Z$0000+d -tL0Sd@0 0R  Ph,0pkP80/ -@L~~h{~@ 0-8LVn@PA (Q0S9-P2 sPP+P0S. \0   B,=0hE PxP 0:S  `P 0,0=0h,xkP880d/ 0-4PL@~  @~0@@ P0 0 p-8`LP@~ *@}p@ -@L}th}@ 0-LM KJ0PK@@%D0@`TK0@@@ 70@`T0C@@D@ *0@`T0 -LM K@0` -L,M@<KK -,L@, 0}P hH( -,L@, 0}P h|H, -Lh -PLU@`rp@P P P@D -xpLt[}0SdPd@]n`T00@XPC/00zmUEO$+W00h@},tЭ`V 2-C PbLWlPp 0@`U0p(@J0e1PDX !q00P00P0C/@m`VX@E_Zx -L\L 0cP R@P $| 0@@h| -0L R7 | SZ RX@J0S|0 000000D0000PH00C/lQ<| ~@P $|$ 0@@@I, 0-p+LdM0@0 P`d\hhhpxxxpp0$$t#K0 @KtP 0 00 ,  K0K0Knp  ! ++ A/,000 = 0, (0 0 00 , "P@p K00K0K,  @0P @mpD @0 0K$ K0K,  @@mp $@K0DU ?m p0 0 r.0 00 , @KP@KpW QKVW0 0wX!uO @ H@P h!ed c@K݇Ph@Kp% Qrp S0 00 , ^0K K0K$@0 ,@ smpI PF :0 00 , Eq 0pQE PC: &q " , 0,0 -0L80 -AQ,@X 0$0( ( $00  00  00  M-LHM@0 l p hPh o   p0`dhPPhM `00X04KN0Slp 0l"PbE04,"401(0($0\` Tpkl0p `d X0 T `` \ 8@ X0!dK| P <0P 0S`+0h0P (K 0@P 00I00hb@ 00?00 |0|@|P 003h00 @,@ ܛ P! 0, K Er@ 0l4~f M0-LM(0 00 PJK0`" 0-@L0PS <00S85b0h2bɑ -LME ` , (~   0  0$H0 @08 4K@ 嬐 080P<0X0K00< P   0P  P <00 0 @X@ 0Qx PX^, 3唠K 0PK 0 : x3#A!B La! HKӈP 0 43Q0=A0 AS  R0 0,0B, 0R(KP p$ SX40W ] 4 `T0bs4JP.U \UPn@kP 0D R0 0<? 4 X0S8 <0c\40@ QL L4=a4 #=0 p0S .S` < R(K0S 0D R0 r<0S D00L@P*00L b@ R$ .0A Aa0ARS00A-Q S_Q\0 .Q .S \.\A Aa0ARS00A S0*S 0.S S R!0B]S,.R00S \\R R.R0S! C ]R00 <8 < 0 <0 Ƞ 40P 00<(4"4 <SQ1 S -LM@0.m0pS80 S S  `P/P K - P Q |` X1  010S0 Pl1l1 0 0l!l10S S S S 0S SS P  P0:0  P0;0 | P0;0 \ P010 < P0008 t8tt -H/LOM@0P.0, =m($/$07mU 0>NK A Ap/ U $!0S000 S000 =0005< 1l100  l1h< ],PP    0 0 PP  I,E.K B0 B4 % 5 \4KP `$ R*E~KpGpG``4(K 0@4DCx5 P@\4[S \ PV4[ S Sx 8 P7V4[ S S3Q S S0 S S SSPP h@,+ PT  P1Q$k$1RgH̟, 0R(KATIH PV4[ S Sh $ PV4[ S S\ S S0 S S SSPPw h@,+ PPh0L@SP  dR *R* S S0000 Q@0S0 00Nl1Q 0 2l1h0Sd Qh0hSLPP@T T .SP0SX`V.VPEU00 P0:0O 00kU1Sf1S b [P h@,F+h0L@SP4  dQT %>* ST  Q7* S0 S S000 0 R 0@4 0S0 00ENK@D@DqP.nP ,h + [P0 0 S S 0S S PR4[ S S%R S S P P0 S S SS Q `8  q 0Q@\@K0[S\pK  (50W[G.K B B@@@@@E>K@0C@ 0C | dD D 8PddddQ Vd a@|`Pl   0S @0 S S S 0R0Z0S@`  lP0P0  cP0P0 5 %0,S \Q 0 SS S S\ bRyR00 fR0! 0PT4[ S S \@ Q Q QQ ;Q PU`p |5`  ;U  u 0PU TlPp GKI0 I0 tPr D pAVP PQ;Qp` p`4`  p q 0Q;Qp00 EP 5 4t1"10%0 #$p $ t!# \x@ PpU4[ S Slvh 10   r 0R00 S 0S S00 00   R5]d4 R ]%dd % I%5,Y0" 0000\pK (Phz8<h4 D$td- (HT0 h|8t<t  0-L@PPRRU@0 -LM@   K0K  @@\pKE-M00L SJ20\ p` P0 @ 00L @  S4$ 00L @ UQ | 0D A0a00cB.\! 0W @00L S0\p PX\x\PPT*0S R<8@%Ѝ\ Q| 0 0hC10S |T0SQ R<84@Z,<$!$$, T*0SL  -LMKnP@ -0LMp,`K,0K@PT FPe 0!00P XZ@`PTZ .T00X0S Z  ,K b\d -LMdŸ0P,0 PD P /000, 0Rx(KD@0:T<0 80 40 00 # @P op@pw@ 㢁p  wt0sPhz P-RL@  ?  000 -- LM 0  M K -ML M@H,  P, PL, H$\4#0$@K$K0 S2d, 0R(K蘧D 0KN@N0,$P JN 4HPP,Qk`p H<VF``p  @ R@ 0#)NVF ``p0S V`FV:000C0`F RBKII ! BKII KT @D R %RP0mSL %S00T0S0 @D P R@@ L<V 0FP `aC0S: P 0P`pm 0j , }[pPdP > PPKn@1AlA 8 4< <\ 0L ]vNH^6 D 0!MPD@`P  0@,d0a0cK8< 00< @<AA 4 << ]k0!MVF``pY 0 S0GQ D<pMꮦ07S^KPEpPE p ~v00@ ~^KPEpPE<< 8L `P 0&@P07S v8hzQ 4 |<zD 0-LM@00 P>P8 -LM] K -L]M@NK`Pp KC/$@ d @8 4 DMVN_KPEFh0 @KX 0KO@eKQ Q 791 $0Q K hzPP0\ p-LMP` P P |P0l L`0 0 Kp@4P0( @L@4T -Lhl -L  hLSl 0-LM0@ K Q0!Lp@\ Pڔ!~L|K0@\` 0S-IIIJJIITJIIIIIIIIII0!\LpP,P{0 KLpP0  >Lp0 P0 R@` p01S ` *LpT0< !LpT4/I|X( 4 -Lrh l --LM0 0 %A K p-LM P-Q|` 0 S 0K,0 ( $ 0 R r 1S0C1,K30@SԕKp̕ -@L  4 R-L" 0S 0S \ @`R 0S  ^00NSa00P@0$0 -0LL0 -Q Q Q0  0  00  0-@L0PS P00SLD0hDxt -LDMP pJP dJ`Pd p 0S, R00U@ @@0K-MLP` 00 X T P \@ `K~P0S =tDD0d0 *0  0@P04,"40DdDd@ P0P H0S00A0@1HP! d(K }P ckP00  0@c2 0000@ 00 00d@ 0000p 000@0F2 000d 0@TS$l -LTMp \ 0Qt x0 | 0d@ `0 0 @ L`Ro  l 0h0 $ L |00C,̠Č| 0("ČP@|H # P] P0\KPV p0  0PM xt PF l&PN l0SO `Pd RA 0A尡L0LPK0<0 8 XpKP P$P (KX0Y$7$P) h00Csh0 p  0 P$`0SdPl $0S0$0$0$00$0p0 0P0 $0(  H0S 0L0$ P$0S0$0w -RLp`PU =~p@`P` 0$0(  -LMpRP(K !31C0Ϡ @l1@8K00 2Kណ@K 0K@j` ᓎ4 <08R@0= Bc 0 B ABS=ɌBa!@B ͌B31C0/A#b1@TV0p$0V v  Pp@ P06 p$0( 2[   00墢0S 0p($0Ꙣ 00ꕢ 0$0( pMb -40LQ < 0( 4 p-LM@PU% <\ Kp00`K0 @ 0 0(,0<,00S @[FP P4<0S \\ 4XX4XXXxXS 00  0S S S00   \00 \ 000 S00 0000  00000 0 00 00 000000 0-0 0 0LS@P 0 P P P  P 0h 0-LP@P 0SP0S0h0h 0-LMP@P8P 0S 08P  0-LP@P0 >0h 0-LP@P0 P 0S S 00P 0h-  @ h@-0S@ 0C0@ <(4"4!<0  -0S0C0 <(4"4!<0  0 c0 Q0a0  R %3 a 0 0% %  0-0LS@P*00b0 K 00 00 0-0@SLP*00b0 K 00 00 -LM0@S0C0K< 4("4 <0!  K 00 0 0-LM0@SP0C0  K~K <(4"4!<0  8 -LPQFM0`,0 @] TC TR0 41 8! 0)p@S810(KOK 0< GW@P! M?KW@P8!V@jTK?KS N/K?pP]8!A@, 0R(K081 4A 0p 0ZWP<@.00<K_K<N/K81 pp 8!+A[#Ghz< -L,Mo,0nD 0Kp0 ``0 庒KPO`P 0@p 00< 8 4 * K0 @ P @0K P2[Sl0  00poD0 [(K,000LT(za 0-L@PP0P P  0h-0 S 0Q S0 Q(,0^ 0a(00 0Q<@\ 0-L 0Q0l0CP< (4"4!<0 @@b T 0 0 0@-Q @0S 00@  0S* n B!< 4!4"<0 0 0  0- @P  0SL 0  <4("4!<000 0P 0 0 0-@0LS@ 0, $ 0 P bp 0,0(P0 p-PQL@U  0(0PbU (,0`SPppcP0à - @LDP`Up$P  bLP"W000H$P1 H04 X0T  cP@ X0T PX> 00࠱PP L0 R0L00P ࠑ0H<,$!$ H \ QT0PR<0TPU$CP $(0lH0 (0, P$8`-CP, 6<P%CP$, 0 @0 X 0,`H 00`(40L P,0 D P @ T ``0 (KoW+ @08R+oB= 0J+;=o8=\l 0- @LP 0Up 0S S 0 00b0q( ,00bc0 p-L@` Pp 0fS  0 `P0P3 5: pS0( P,0 `R$0R0` #00%( %* -LIM0 P$0  0SQKO_K`ᗜNK@D @H gl0! ES$ 0R  KD! sH,0 MoKK_KQK@ <1 8! hz|| -L@TP`pJ 0 /T #R70! W8?XQd@@0 1T  R#*0B0L!000c00R0nT-0 0@ L 1Z HW@ <"@ 0-LMP40@ L0 @K0 -LM`p@P0PP@0  pt@TPPK p-L@ P  v < ƛ 0 0 p-Lpd ` <4("4!<SVJ@L@TP0? " !BP <4("4!<0cS ,  < @4( "4 ,\,.<4("4A$<U@%LPU!0? " !Bp <4("4!< 0cS<,$ PPe ,00i \0 , 0h5Y9 Q> Qj LQ; R00@$  ,p, W``T0U0S&a Y00 ;0S8 w 3JX00S\00Sl @(K0S @T,0S%@ QB4 @8  T 000lnPP 0@0  0` P00 R \`0p@APPE 0@10 @dP0 ` W0p 0 `0 000  "00 0`210 2!@m210@ B  0T0W0P`0 p p 3q 0@0uPP0`` 0@0j -LMNPpU 0  0@P0 L@  D 4 @p @0 -SNDPPPPPP\( @ 0S@0D@ 40 @p @T@00\40<40 ^  q D4(K 00S    /Q 9Q@`9Qʈ!000T0Cچ!000T0`C@@ /QP  EPeP9 Y0@0\uI0@%Sq<<@ >00 q 0 @ @p@ 0+Q> -Q  9 00@ S@p 0P@0@ 0P 10@S@0P@ 0@ /P 0@ 0@!00/PP9Pڌ*0aUS RaD040 @p 1 @ l 0\ P0`40  P  p3 Y ppT @@ C W@PP@ LP 9H A @PC 02P L 5RYO\0Sk \\JP 09R QH } HK5@`\D9 PK@P L 5T@@4K 0PK@@@P 40S D0XS xS 0@ 00S S  @ @KD0K@P4 x PD @p \ 0g@T ,8 PK9P L 0 PK< K80KPD T 80<@cT< <8 <  0 @n0TiT @  (7  0<P| ( | P ! |0  ! =D0P  D  ! =8P<@Px  \i\\ pnp  0@Pc@0 d0^0j00n`PU00S0ScPc`c\ xPx  @P @ iQڄP  WڀP  VڀP  XxPx  4 Pt  0St0@ p @x+`\`P`V 0 03 0 4  W !0@ 40 X T 倔 <\` 8+  , K00KpP{ ,QJpPt D`R, 010DPD d 0@S20@DT@ T D)PD Q <0C< %A D/PD < 0 0CSu R 80@0T80 Q6` <08 @ STQu "2  @P2XKf 1`p P 0 P[ 0@S 0XK PO40040 Q80 @cT DPD < d< 0x|t@<0 R 00SM SG S D00 @021T0D 40 * 00Q   0 b320PW vtxrtpnP tx 1@PPW 0` 0 ` p 0^0Z0S.   R 0S LN?V瞯!0L0P40, Sa ,  4 0Y000 0Cp,0 p,0 @000 @e P D21 0 " \  Pppp ,  , 8 0, R2 @"00 0,0 4 R 8  0S S2 R/ P000.@r`71PPPG 7 P?W 00S `P T@ 0VP @F R 000@0b@8 0< 0咋"00:1 0J 0eP #8 0,  R, @"0S@ 0bVUE P0S 8 00CS"@21 0 02@"@8  0S: S4 Sh 8 0`BPP0 0@0Pr TP0 0Q0 0U f R!10 8 @0< 00S{J R20S. P0\  0@RZR R 000A10  R*0\0Q00Q- 2R  101.Q  10 P *0 BSP*02SP: -LM@(KPp`,K0( c,0 c R:pI 0m $K -L` B/ bR@pP00RP 0 WP0 0@ P VU  0 BSPP P 0 BJ0PP0 U @980"p@-R`1Q0@  0 ^2$ Pd050 ^2$R  0fC1S00p^0^0 0fC1S00p -LM0 10R@# *P0@ @0S Q @K0 @0S" 0      $ ( ) * + , !-" . # /D0S 80 00 00 TR0Sa@ R 0S0a@000-@P 00W b@-A d0.3Ġ Q -LM4 4@00S 0"! 000 004 APP@Q Q00S p ,  QP- 2`VM Qn,X W0#03R0ST WՕ@ `' , P@ Q0Q0XSxS0 S@QPX\ W0#03R0SgZ1* 0Y0*00Y*0S  Z QZO 0AS (K R WՕ@00' 020@ 8 _800S 0 `0320)QX00S400Q" 0R )RP  R0'O0 XSxSa0 S҅@\00 &Z*4 000S  0 S  -4@L,    hdT -L` -LI`Q Q0!0a0PR- \1,0l00 ?\0 00R- 0bR R ?R0̑03012<000QS@-@  \0l 1<0̠ \ L ?\0 0@@\ P T  0 0-R ,0l0>-S0c012 0 00 S 200 0 3# R02 P0 0 bQ B2c0 @- @0cR#3n\0CQ0C2 d  l0p@-H h$H! Q. &.ȌV2UXP`pP1#3P1 <2\PQP3100QP3100Q#2QPP ;; ;Sq0 P0-9XpTP@ U` V( 0@0000# p-L`P@@@`@p -LPP@`p P B`B0Q40A"A`R0E0U0@ EPU0r @0P 00`04S0`P0  0  Z1 -X1L0ps3X@@`S P S `8?SPQ QU 000@U000#? 0S`Z?45VCq00ࡣ0aS S4#0C@@PUQ @T@P p-`LP@@!aph -L@P0, 7 `p P  0G`pe -L@pPe P eL -;PpLg45^@càU WN^a lAi^<.0n0ðVU, UPp V* f(\\0"?DE iW U0naS S6#0c``< 0S00O@`V`A-;P`f45^@s àU VNŒ^ 2 0N0AA A^<.0n0ðWU U ?1"C 0\ A<V U0nrS S 7#0spp\?DE pWp/R 5/R 1 -p!   PLP` &:::S@ W 0@ 460@ P S460 PXP -p!   PLP` &:::S@ ?P @ P0@ 000#460@ 460 W V  RXU -p!   PLP` &:::S@ ?S@ S 0@ 460@ 460 W V0 PXU0 ;p-@TTLUo Z~T 000p54 "d a3000V `pT00U0SpP |Vp;0 S-L@ ;0S P 0045S P [45S PP;0 S- L ;0S P P0045S -45S %R 0#03P;0 S- L ;0S P P 0045S 45S R 0#03PPPO? ` H !:0-LʠʠAL@N$^?&P@)0\^.0n04.U`U00P00S R 00000\ U0 0H0\6n "30  0000 -;L0M^P( $ 堏' ^ (P=O*1@@^ `0OO0   K\0O/ $K( K,$N$ \0O/@0 P0@00 ,@ $p4 < 8p PK4B0 ^0 ?^1@^ @T@0X0@@` Ѝ& Z Z& ` 0 `0O PO ` P`` ЍG"04C0X0 Y ZnfQ&030#Q0516!P&030#0O/@0  Q ?Q 063UP030#&@Q `V`UP&0 A030#& -顏OLMX`p P  -顏OLMX`p P -LXMt p p`| x0 x&Jᄪ.J`p E媪ZoO`&l` t@|`8@ 4 , @` < 0 P d^  ^P 0 0p(K |@K0 K<0K,Z48l p0O჏8K, K40K,8@4@<0*6々/00 E cXh 8@ 4 Šh0O⨀8@ 4 h  @ < P< Ƞ,Ƞ"h @0#H!\0 8ᑃ.\ d  D X S.D@ᑜ$&.(40D V 20gUXP,8C T0C28T0CR0CVbP0C X`SfH ZH\X 03#Z # 30d  B\H0 d X H ;#;S` N<0P0 @@.#P` $8 " q(Ƞ,ȠT@ a$8P^%L0 !$(H Q 2LV 0ch`(8C U0C2U0CZ0C2Q bP0CWxp`Sa `ZP0T 3# 3 # `0`0CV`0 `@0 0@`@ d``:ʠ5lh%p ` ^ l 0O/@0pl p 0O჏00 T030"S* ! Fpl /O p -LlM  ` 0 &J,JJJ@ 倠D `^oOP`&@px` P`8@ 4 , @P < 0`  @cT ^ x 0O8K, K40KY0^ <@ xP0O@K0 K<0KF0`` @<0 *6D0 D4086!#((*Ƞd |0 `  (|`"( XDpu'l0 `0*h.6#h@ F$H X0 t HP@ d@,p X\@ P@ ȠH ទ)L@ A$pH 垥*'Q2dT l P XR,8| ^,dx&"L`p 0T02T0P`h@*T蠃ࠓ`@\2XP\`T0蠃ࠓ VT%(  Y 2Y 8 S 030#p,0 Q@@0\C)*DPt`|x 0003<0S00S0 0-@PL  QXP0SL 10A00h4҇(10 AR 0hȇ -pL0PS U AT01 0S0 00媇 U e10 P@ @T囇0eD!<0 0c1S10@0` -LM@Pp`P# 46 Z(0 6(0 T$@ (K(0 0 @UC>E0C05 `0  C>@0C!0 B@`@ K$KP(0$  `!30$0 0(0 (0S@@0@ -LP`pP@ 0`PhP5 p0!1 0 P`0@ Q Q @P` XP` P *0 @0S@P`YP`00S 0pGS B p -P0 0p -0 0BPU`Lpڂ UP" T  0R0100@10 d 040 \2.R P0E00\00\0 -LMD PpU0D0 D 0Pp0 RD0< P@ O < 100Q80 * 0080S10000 !PD0  4 "*, 0S D ,pP`5 J$40  Sp 0 R,00,0 < R 8 0S 0 BS<00S<0 <0@ 0@(K -@Lq P00@ -LM0 0pǏ,0 ɯ0@*"P,` QPp 0, 0R ,0 10p00  0(K=PP0P  00  ! #00P 0-L@ODa TAPU/ ` @T P /@P/ `p0S ˅@T 0S ąPP@ 00p0S |居PU 0S \媅LgPP 00, 10 ePqd -@L ,0( P00 -P(0`6s!LW(`0 W#ArP. 1!0 (1! 0P10D! D , V00  ,0oꂁA-P  c d)oء P-L@ 0At x00 -LM41S(K4 0   @0 @ @ HA X <   pP`D! 0 L1 @0PA pP8@00004 P<Q#t8000(K  D0g P 8 @0008 000,p  f P8 0008 000 T P @ D0P 8000 0SD00 00b0 -RL@1  0h7r00,11r00,1 0-SSLP@ 1 \ 00hr00,10r00,1 -SL0@ hq00,1Q  0Rdlt|0 0" 00" 00" 00" 00" 00"0Q200" 00" -LM@p`@!  0, S,0K80 4 ( 0 0 R r 1S0C18K0PS U 0`@$K8bU0b -LM0 0pSV  0S 0 0P60,0 K U& , R  Z `1`!@P00V0S V ,@PZ 0 00dS0 PdUP0,0 PU  U 1+#,PP`0 00`S0 (KPU B<B S@ <  ) U@1  `!`1!10 0f @`0 0 00jS0 PdUPPx p 0 00PUb UR:,PG @ `@U0@`` 0@T:4P3  00b0 @@0 |0 @0f Z0 c6P, ]  P0h0,0 8 _000PF 0 @00j P0 0e `@0  C0 00P `t p-LP `V 0@f00T`0T  ,P`@`ʼ0@00pp p-<`L0PS0@S`p` p-@PL ``0S0 P0S`ppP 00`phP -PLp`PS J0SX@`PUZX 0-1L @R 0P  Q-   0 0c0 00000=  0P @0P 0P $000  8#8 0B< S /0, p-LpM@PP`0+0 KpKK@P0@: S  Q;  0  SL ( 0R  ( p-LM0@C 00   KpK K`cPP h 0 SPP P 0000C0  0|PP -L MpP`0S=@T@0S WP" 0S$K$KmY 0@P0h6p x0 F@l0!0 0@S000 p *0S 0 -LMp`18 R P!0L!0P0 U  ^00U#3   0 P\0 p-0L@0  0$RP`@$ J2#($b!.@1QS QS 0N!QR QR\Pp80\H -L M 0`^J~^r@P p10鎠x*p@PJ PL0 00 Q 1p\ ""(30b,>0A!0 S00Q)>P% 01C0 0 @0 0 2#8# cN(. 0B 0S   00C 0(K ` -LPM0d(0  @0P ,0 U U  UXh@K? P$ K0DPCM0SJ @<0C>S񟗶TXXdXXXHXXXXX8X,X XXXXXXVXtYXhYHYX0>0L MS`4 0  (KoG24, !Q, p0B0c, R,c0 S*0r 0P#R R * 0000#22Y1 (",0S* px 0t0 R!p00b b0 p0x 00h0Yp ,0S0C 0Q@t0S x0G<P t`1, R B0 A0t0SP Pt0S P00AU00, p0S(K0pS( 0S 0 0t ,xp00p0, U S(Ko04;Ph 400a0ym40 04 30 ` -sLP)`P *"*R@ R@  B0B Ts0STD3 R8C0 S*(3  0 ""! ttXPUV P 2@` 0 S I00C:#:30#" 01#e3! Q1(1"(@0@R!o 1S$ R000 !R 0S c *t1S1100S00@@( 0b SP1:U xiR>0N@ TK: X>0N@4 0( 00b00!S 0S  |i7ic Vii(  b R 0@@. @0N(@a P 80Dt\8, -L`_Vp P0S0 @0T  @00S0 h0 0CR0 _p <0< @80T 0S$h]  -LMX`0 0&P,  8E>0>0S <p(K80\>0>0Sp0(VUeB0 Ss*0帢 0p#r R k* ,0000#22P~ @ 00 1@tpW x t0R% U0QZi 0 0e6RpAC0SJ ,0 e Sp00ep0<0S 0S   0|S70S=xtp0, 0eRp000S 0S  (1@P0,&pp{ !000v  h 1  Z 1 h0@P0%pD p000p ,0RA$z=H  - PL M8 P6(0:CZ*`>0N&@8 ppd 0 -PP6(Qt0PSb ( a R^*0S88:b0Qp 0S(K0 0(RC '0JS1p00@`V 0R 1%S@ U0 S*5 00#2 @T0N@$20!0RPp"@^@Z p 0 #2 p0p080Q$0S 80Sa (0c f85#Ƞ@^@0000!1 B("(0,R1!Q000$$00c02!0QB !R 8p00Q00Sh Zf a# 2]p 00Ra PxlP3( 0000mj(  b= p4 p5 W:370#2000,0 < 0, <0 `00V00 u Q000, r0V 0a WI< !q114 4 P^  ,20 B0R ^ ,"   0 ^ @@Q@0`4@00@`0#4 0  a%(0 c:37 '8#8!1q14  ]p 0044*p@ 0P0I$p@  0,003 P 000S0@00P@0,@0`a4*[Q0``x<`RHD8  -LM@8 `\DppTPPU4 @#0SG"0S2 䒟00S0 \@\4  (K$0 T,0 p(0:CVH*`>00`  Tn`\:WZ0TP0 02pP$Bf(Ql0 "S- ,0SV (00 c be", p 0dPP `< ~7P<]phw7PS|!U00d0I\ 00D1 0R0C0U =\4 @ 80P 0S  0\ 00T V!1PHPwo(  b \P 00a *P`( 000H< , 48` -LP`[Lq0S<<.0 N. @T, D *Q#Dp,0pdS@@p <@ 8 @0 ,00@S|0<0 t@ Q0Px0640 6Pt8px p080bp0x040h0PpW'  4@P PUX0 0CR0T ZH(Kw00TY! Y Y K+P)XX@00X0@0(K P uX0S @ X- p@hX0S `@^X0S@@ 0 -L @P  - L@}p -lLMd 0R,0 Tq Lq0   R8,B0 0 㬀K%@ 0K K @@j0P0C `?<   c00P 0@ T0 LD@ 0 0 T0`<, 0R( (0 (KHhzj \ -0@L0S0Sh -L<0 R00 R$ hy 0P  -L0pSP(U `@P0 000  000  eU 00CS0F0Si  -8qL0SH(!00C0p @ 00 P@0  0 0 ` @P 0  0P `0 P@0 0  Wp@@Y S  P0-LP `B@T<00 - LM0, S*0 R$ p00C00 0 %P, `@0@00  Z 0`,0 ,0Ro @-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -L@h^+ "*+ -L@\Pp`P h\bQC0S! R0 0% 0S! 00CS14tdT$DR<0 0 0;S < 3 0 01 00 0RU0 0p0 0d0 00 0; 0 0 00 05U0 0f, @-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R P0Sb22\ *OOX *T * 0-LM 0 @0 @P;K0JJ; *27 *2NϠ8, * 0 0C0S2-S0!1!@-0@0 @0!00  -LMAPTpm V R0 X 0W@ P   0AV0P -LMR`  PU 0SPR U< 8 % ͆0! Q0pPP(K0 13 B1 00 0<0 8 010s0380 PU4 q 1S X!0R00S,  0S X 0SRQN 1SK 0 @ T0{ 0S00S\t@TG 00B Y > 0 1P0  @0 @, @' Y$0 S ಐR 0IP |0Px  p Pg  1S0C1, 0R00001p0q =W0 pU 80x03 PJXG<4 001A  0 <30 BQ 1 11  00q ͆0! q0pq5 !D00^ 0 P Q -LUsage: %s ..., where is one of: instbin%s: %s not compiled in mount_cd9660dfmountmount_ext2fsarchsyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigsysctlrtsolping6datelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfscksha256mknodreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shbioctlsleepmvexprdmesghostname̍ĜTDt̜@@ԜL؜4ܜD @@xconv option disabledunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qd%s: illegal numeric valuecbsconvfilesibsifobsofskip%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) skip reached end of inputmainğПܟhu usage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsext2fsprmountmountfsmainnfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s%s on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95direxecnorripgensextattprocfsversion %dlinuxstatfs %s%s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %sforceAadfo:rswt:uvrqnoautogetmntinfounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbinmainğПܟhu usage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinearmisharmOpenBSDmainP@@T@h Xp\p `p d` l@ t $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] %s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/track/dev/%s is mounted on %s%s: block devicewarning: %s is not a character device%s: unknown standard format%s: can't figure out partition infoioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs=%#x bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u160180320360720120014402880 ؒܿĻȻ лػ   ;l:Ľ ̽ Խ#ܽ3#3233 #@@$?@$@,4<DPX`hpx  @Ⱦ@оؾ (08@HP\ d <pxȿпؿ @$@0@8@D L X d px@@  C$CC$C  (08@HPX ` hpx@@printmainoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sillegal option -- -%scbreakcolscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZlinkitusage: %s [-fhns] source [target] %s [-fs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).Ffhnscmplabelduid_parsegetasciilabeleditxmpsavehas_overlapgetuint64editor_allocspaceedit_parmsedit_parmseditor_resizeeditor .<  D  @L  T @@ `  @l (@x  %- @.  `NL @ _.@d. | $08@PX`hp%gOa*Y]M$7eLH:YI{L_SNoer'm0 Zgjֵ5Ʌ`/O2yKerߝһx N)V[( )62Ga_*8j뭳% iA !Ro-6AL/60ΰyUFæ bZt]WZE$H XL&5+UoX*e~Ъfq% lWQu2b@1uЋo{Uw8tdٰ3pF< deۂZVgvVӽF?>0O~":7 +}BdFp'_X,2=Kdxsg? 1uUߨڠ&xc&{%Ǔ &X.q?ʵA]E ӽ7BK1ۥɖ`[270벺-yo doz4 8$3٩eB-tUQb{VTpeFӹ5͒D'fI(g1 &&M ^6_VV71\U+2ֲ2pz=f'&6Bz_t a*}lA(J#\Pުk_g QR傅o?o \c ZچOܻoYUII[LiM6 cfMaizbj&߬&z܇ĸ=b&K_syPI@M'@!#VDzGC]Gռֺ7#Z1#VP"1>h¶j>$@h WӉal0.|+662FI}ByPyN'38D:: rT EI܅Z=o}Gg#k8SYjOQͬ~SȀ>tKH(4.|d>Vnt,v";*+4f9kHߺպA禶MzvRb>@VAb{oCal0yfj-9+Ъ'%*ǍvrY q6!p,Z)l";.A+Urِו:b@%cpW]& ZeKĊBaq0ezRp`V# Yv~%lZTBg骵oϑ.&Bx!bFz X8 #  O4=ˆݛ5m0 &Fs;JJe9А eI++m>l $c#DE`ـV]|EEI՚հ0nY I I><ɼjk8=L-܀Zs37]ER6h yA+[p'`5jIj9;e*Oٗ ]G?X&glݘb5sWEsqT8`'L7*'teՋx.?R (Xb ~ LrTy,`C@ &{dC]oui jёf* V-}|`c,չj*´.'p8&-iGղny%@Sk|wV&@.c2`W[=Fޚ]v[b0ΧblXgbx5V4Qp,HpU|C`wgRjZ=99{(k8QIIŨ\]]EFgf$bh+姺vl^>iEP[\`ZպRq]%]Dag}Kؽc]kF`jQmlVP"OZ #c +LzsUP` w}aWMvەm;Zy@K\ '7 +.ܹ2NssޫEr8&"!%EIq42 Ӻ USZ'y#d0 1y,ܙa+4?.@Ņyr_14g]X7*84ξk2g(W1Ȓʷ8PɭFW( ήa}])L#~ P.Ӵ^/rdAz.va˃))a~+$N^RR$#2,kpB~2~\\S}Jb4 ]يR8 JQ`2RnYI|*Bb @b< Q}}kXy\Ey=LpqK Gm'@A]Yq !  x1rZ Y bR# Vjhr+QYr<bu?,#g;2o~8300Jbl’%oAC\.qsrN%$dbpu3t^-O/vf dhx*hĈU/LC{=!/ʪܧv(as J0H!o[~4 HYP5 HU uh!~Q˩+2 QFXnd|G R3fϵYֳT>\_ <x'!OɧHY0.$%=:X˜\CȤ`3cF잧WlISzS;u]OBIb@Q͛!(C9j(0 ]np &-@-Q=/,R7LJoBy sVLDAL. B8 MZ\ In["&Cfʮ_ebF+Z13r YUG+is3w+-X8%OīԿFq"wyW$6aֲh5mmOP]pvҗ_lt8l}pI؆pF _ ({iX[71* u[M]CAL;.A],Lf5BcLkx#٦4͛,u=vޯ\ON2~(B."I]jviB ȤPj}~efkí]8Jȓsl l hTm.[w t]+mQTvNKIG {|Ֆ=>vHLx0lf<ֵ !''Q3?S:S b* cL{(b+C]M9*u+Q]Õ¤u)AbGa81j#|DGd{mLJy(unV4"< "}^I0"hBblf֬9}z~AƔ]H?[ 9l:{ `i0.[3~*ϕd d"Fc!ZүpfFxu?hﬔ5?:0d ΜΛ㚖rw4 &9<ߞ\$ܷ%6C9 lhXn#f AVª+ rpsCh1xMG>oy`E| o7n/r%b$`t(z'A:fX' JhQԏ;38ϓ3Ayp[86SEKf4eÒ$N`hcE|4SeR0ke>jŠ.$U˸ҏYH) ]^"N CU߂D&|C%a'x0qT+]pnhߩ@dX+9 F#%FtY]ܸj\/H\|FI)Yװu$(פ򎡟jސ`Y,}del!~8o|0{~6O_O q0|֙p=rz|ZW᫐<ČIp'0(9Srrgχd+_gGOnնa=8ż&ͳ߮sJ^ooͿӝQmf<A ftujjr"{kÜ~!}rx' ᭎ꖐQ3x&S@a6)_iOO[5=wS]Ni1\5xi;Ud!\ʯ(hw'Wދ~yueã]jL}|XVT~K`1kl`B+!a\=+dF"ٳ7zi6Fon`ǎ B\vVt4PL/ϻuqs͘Z~VMs=vP~#0Ư RM {mo\թ5^%J0-6dkprc]@aJxBU9F`ij$c_3-ȸ;$B[4O#a[a=%2hZH?(m/[rDA>--/>zV;(҇TҨqiᆳ\@T0||JXH>s6,?PAM+M%%&OAajLsb~H~*׋Kwx7-/ӕi `F_Mkf&uÿhwꆚUzyO=2IMӣ@#8+IRusage: disklabel [-Acdtv] [-h | -p unit] disk (read) disklabel -w [-Acdnv] disk disktype [packid] (write) disklabel -e [-Acdnv] disk (edit) disklabel -E [-Acdnv] [-F|-f file] disk (simple editor) disklabel -R [-nv] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %lldpartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %lld offset %lld # line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi%s %s/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:Bootstrap doesn't leave room for disk labelioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFOunknown disk type: %s %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: bckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:tvwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cTreating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. %lluOpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.Command aborted BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. noneWhere to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. can't get mem sizePossible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Invalid entry Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. A multiple of the ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu fragment sizeSize of ffs block fragments. A multiple of the disk sector-size.Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. partition to modifyThe letter of the partition to modify, a - p.No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions You need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.cannot open %sOriginal label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdrzwdFLOPPYxdhdCCDVNDsvndar_revar_drainar_nextlistextractcopyarchiveappendbcpio_wrvcpio_wrcpio_wrcpio_endwrset_crcnode_creatls_ttyls_listabcdfiklnoprstuvwxBDEGHLPTUXYZ0rep_namemod_namerep_addsig_cleanupadd_dirchk_ftimeustar_wrtar_wrCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive filecould not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot chdir to %sCan't fchdir to starting directorydirectory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot mix current archive format %s with %s%s: Reading archive to position at the end...User specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sCpio link name length is invalid: %quCpio link name read errorCpio link name is corruptCpio file name length %d is out of rangeCpio file name in header is corruptedFile is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %sFile is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %s070702070701070707TRAILER!!!File changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sUnable to obtain file stats %sAccess/modification time set failed on: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %sCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to create %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %Y%b %e %H:%M%s%s %s %s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == -> %s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: cpio -o [-AaBcjLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfjmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern ...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list usage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory These format options are not supported %s = %s Invalid block size %sbzip2compress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578-IUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPEUnknown -H format: %scpio: Known -H formats are: abcdfijklmoprstuvzABC:E:F:H:I:LO:SZ6Destination directory was not suppliedProblem while reading stdinInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cbcpiosv4cpiosv4crcustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sCPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.LC_TIMEUnable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryCannot canonicalize %sUnable to store mode and times for created directory: %sUnable to allocate memory for directory timesCannot allocate space for directory access time tableCannot allocate memory for device mapping tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableDirectory access time reset table ran out of memoryDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryHard link table out of memoryFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %swrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %susage: ping [-DdEefLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qrs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommakeentrylinkupfileerroriblockckinodemainpass2pass2checkpass5setup$08@PX`hp cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%uDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%u (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%uINODE I=%u HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%u (%d should be %d)UNKNOWN FILE TYPE I=%uROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUP%u: %2x BAD STATE %d FOR INODE I=%ld summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device ioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead returning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %ld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld),deadlocked buffer pool %6d usage: %s [-benstuv] [file ...] benstuvTl|tttttttt,}ttXtXt t tptpttutuuܦu,u(8u@u$iHu\iЈPuT}pil~\uXduluxuu@u}u}u}u}iiuDuuuuuvvvv v,v4v8v0t@vHvPv Xv`v@hvpvtxvhvv̌v̌v(||}vdi i@3438t|Xi ix3X6 v v`vvvvvv#v#w# w#w$w$ w$(w$,w%4w%randommalformed link-level addressSIOCSIFLLADDRSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYmedia mode %smediaopt instance %d"%.*s"0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %smtu %s: %sSIOCSIFMTUbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xSIOCGETVLANSIOCSETVLANvlan tag %s: %s vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%i%i: bad prefixleninvalid vlan tag and device specificationinvalid %s %s: %s%s not allowed for the AFvltimepltimenwid chan %u bssid %s lladdr %s %u%% %udB powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restoreunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sstrdupunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %s ieee80211: nwid chan %u bssid %s %u%% %udB nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_NOPRIVACYMPLSWOL rdomain %i metric %lu mtu %lu lladdr %s status: %s %s: no media types? media: supported media: physical address inet%s %s --> %spersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupinterface name '%s' too longcreatedestroyinet6'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevgroup-groupanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacypowersavepriorityrtlabeltxpowernwflagrdomain-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downusegroupwep40tkipccmpwep104displayprintlong %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%*u %*qd total %lu %s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufoundwarnmsgrtsol_timer_updateifconfigmake_packetmainrtsol_check_timerrtsol_inputsendpacketrtsol_inputsendpacketsockopeninterface_statusinterface_uplladdropt_fillinterface_statusinterface_upget_llflagdefrouter_probedefrouter_probesendprobeprobe_initmultiple interfaces foundreallocprobing %s<%s> %sillegal interface state(%d) on %sstop timer for %sset timer for %s to %d:%dfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %susage: rtsol [-DdF] [-O script-name] interface ... rtsol [-DdF] -a usage: rtsold [-1DdFfm] [-O script-name] interface ... rtsold [-1DdFfm] -a adDFO:adDfFm1O:kernel is configured not to accept RAskernel is configured not to accept redirectskernel is configured as a router, not a hostfailed to open a socketfailed to initialize interfacesfailed to initialize %sfailed to setup for probing routerstimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %ld:%08ldselect: %srecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%zd) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %dsend RS on %s, whose state is %dsendmsg on %s: %smalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %sunsupported link type(%d)ioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...socket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedlo0ioctl(SIOCGDRLST_IN6): %sdefault router list contains a non-link-local address(%s)probe a router %s on %sshutdown: %snigrouppr_iphdnsdecodesummarypr_rthdrpr_icmphpr_nodeaddrpr_packmain0،@PX:usage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops ...] host ff02::2:0000:0000-%uVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->\%03o --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) NodeInfo Supported Qtypes, compressed bitmap, raw bitmap???nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: sendmsgping6: wrote %s %d chars, ret=%d IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) No Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddrunknown qtype, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply, %sBad ICMP type: %drefused truncated no address %s(TTL=infty)(TTL=%u)invalid peernamefailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%g ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luinvalid socket buffer sizeMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dEefHg:h:I:i:l:mnNp:qRS:s:tvwWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> pollrecvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefusedusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many arguments?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) .?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%tCannot allocate memoryLESSSECURE-G-L-XLESS--WARNING: terminal is not fully functionalLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_krklkukdkPkNkh@7kDLINESlicoTERMhcxndadbsgpcticdcmsomdmbvbbc|^srNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek error to 0ch_ungetchar overrunseek errorread errorESC^%c*s<%X>less %s(P)+Non-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found& [Press space to continue, 'q' to quit.]There is no %s optionCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some edit commands disabledWarning: some commands disabled"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%c%s %s %sLESSCLOSELESSOPEN...skipping... Cannot seek to that file positionDetermining length of fileDon't know length of fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbersInvalid mark letterMark not setUse "h" for help-" must be followed by 1 or 2 charsquotes %sTab stops and then every %d spacesless Copyright (C) 1984-2009 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less #Invalid column fractionInvalid column numberHorizontal shift %d columns.%06dHorizontal shift %s of screen widthjInvalid line fractionInvalid line numberPosition target at screen line %dPosition target at screen position %sValue is required after %sNumber is required after %s--%s-%c (--%s)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sThere is no %s option ("less --help" for help)LESS_IS_MOREBe less helpful in promptsBe helpful in promptsSearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file namefakeInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchmainğПܟhu 8,08D @LTxtX `@h usage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s: %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acmainUSER_print_diskUSER_modifygetuintask_pidask_numask_cmdMBR_pcopyunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB NTFS AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 'Win Recovery8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT XwriteXreinit[[S~UWf)_pvHv9!LRFݞV7[KRlLjc鋴7)ou89Z'/z%ߩD-tv`Pqkky/_w+b0A]Βs|et2K2]&U,\yiӕWi&2K%giYRe #`A Mr0L4]^y <&Nsӵ%Z< b5r腔MQfRqna=jr1 uE`Cn @JEgu—7w2NUhW 2ҫ4:Zu"uJ̆^DIENTzJ3Q)̶viİxz2O3/y:8h =0 TͶ`/^ UrDXp\ fB݊38 :OEfK6  zbbrJ"d4/bb\lluN >ԏnڛC"IzNx%Fyq5{0S㙧̅S:Hzg-U,![[hMmv i`mb窈.,4⠈Kuch/Nެ Jr ƪ!g`%͹h_rnT*Ѻx₝#T8ҦC` T+OpipL6l7gmQY+u|cNV] y$fKâ 7Wg`kw`T\MT˩x?גoz*^5[EAuoUӳYw)(aDq '}(ⴏ?,ڂ"725$!5; ;uq䑊! FdR[1KA5|H,aZE+FiBa_v׸SH֒Kc7 {'yG/K$ <> .< ī=% "h1k$ :ɣ̺n~ :g-%[/ sGBmE^CV*Q n]ϣ D֡W*^J{NfhXF `K+ HsLby֪H=e Yq-ya@- DoCeŸB#D ƺ\)[Xun>0.8BRŴ&yM;PrZxiD@o%d?Yņ2H3gUX9Ykw5E!fltqf=k ˗ eH`j)8XG)-0K/6MS6m? OT{c8I) dzjI WPxeֱ>5톟j/D J}/[VWx7Y ~'m4Ģ&$v,zv%ʟjvwO5;dBqF48xlhفeos!=;o6xNtG>P˷//~OB®s%;y,ݍ-?- 7Y郢J|AI 9Ga_~GHx|2wQ׷ []Z?|9vYXr8:9&9O'Cq]k*?_՛@t_&{;noillZi\(9Bgl&Khz-efeԝ%2:F0="_&GtQkfU`S zv_ŐlkW:]]?@: ̶0:DFRJ#]㱊\M᳉v=M^T}e/nLs mǤX +oʰL)uUB~GaF=}.eQҬ+D #Hfҗ)FY a>,J#Ӿ&Qٖ#L \*~Dxl/,wwDZp?3Oqp`[L8~xrs%&3훗΁i;Gv3—@sH,=W4@L-[naϨ[v)a9$2K*9G[-"Ò+GkvUߘϣ7jFYLQ,3E9]̋$^6qWot)3=u$=Pː >%_ȻNñjXk^߯7迺;9E"FMFz> Ǔd>tynzV/hcS^ˏd7`;@Tj|ts/jQ#HTpѰ^OW˱ZRolkB(e/[>Wvrn~Kgj~?? GD/4Q|29eJ0ӳdh8r#FITZ@if1249LItl8uf0>;φ%p|r20:I NN߃͢-Qh4:@.fyцRIat6[&h@L\)ݡ.'NM>/͵f2NAwK0<$iz0g rԱ<YTT޸hr' l9e pN#o;qZ蟕؝›*ٓ[m&^S~od({jMRƷᾙZ~d\ sS& vTW*w_|R8{>:YW15s2usage: %s [-eiuy] [-c cylinders -h heads -s sectors] [-f mbrfile] disk -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].ieuf:c:h:s:yPlease specify a full geometry with [-chs].Can't get disk geometry, please use [-chs] to specify.using builtin MBRUnable to read MBRerror initializing MBROffset: %lld Enter 'help' for informationfdisk:%c%d> Invalid command '%s'. Try 'help'. Aborting changes to current MBR.Do you wish to write new MBR?Do you wish to write new MBR and partition table?Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s: [%u] %s is out of range: %c%s%c %s is invalid: %c%s%c %s [n] Partition id ('0' to disable) [%X - %X]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: %s is not a character device or a regular fileDIOCGPDINFOdisk too large (%llu sectors). size truncated.Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d marked active. Partition %d flag value set to 0x%x. %s %s Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %d. error writing MBROffset: %d Partition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsPartition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorPartition offsetPartition sizeIn memory copy is initialized to:Use 'write' to update disk.invalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\((%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionCan't use small fgrep with -wbinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsets0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxyLine is too big to processBinary file %s matches umountfsusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s Bad MNT RPCafh:t:vmainğПܟhu @usage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %sunknown user id: %sunknown group id: %ssl9xu:g:m:o:stat %snot an MSDOS filesystemcheckfsfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't get resource limit to max data sizeCan't get resource limit for data size-b %sInvalid option stringusage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] dvpfnyb:l:T:t:%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%susage: sha256 outfile usage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:sodumpinet6_makenetandmaskgetaddrprint_rtmsgmonitor {G{ {${zzz,{,{,{|4{netname6routenamep_flagsp_rtentry0123456789abcdefUGHRBD M@dmCXLS1@2 3cPTdefaultconnectedstaticospfis-isbgpbad label: %s is %sking bula sez: set_metric with invalid keyset_metric: %s is %sinvalid table id: %slabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; 128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtable sockaddrs: locks: inits: route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8d%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8d%cso_dstso_gateso_maskso_genmaskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketmust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %snetmask missingnet: gateway %sentry in userouting table overflownot in tableroute-sysctl-estimateactual retrieval of interface tablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)got message of size %d on %sno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:vrouting table %i/dev/nulladdblackholechangecloningdstencapexpiregatewaygenmaskgethopcountifaifpjumbolinkllinfolocklockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s %-6u/esp/ah/ipcomp/ipip//use/require/acquire/deny/bypass/dontacq//in/out%-*s %-5u %-*.*s %-5u InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesspd-sysctl-estimatesysctl of spd Encap: KMGTPftp://http://file::/Can't allocate memory for URL decoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy URL.Malformed proxy URL: %serror in base64 encodingCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%s %s%s Writing HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Extra `@' characters in usernames and passwords should be encoded as %%40Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin: %slocal: %s: %s%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %s [-o output] ftp://[user:password@]host[:port]/file[/] ... %s [-o output] http://host[:port]/file ... %s [-o output] file:file ... %s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dEegik:mno:pP:r:s:tvVnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiimageebcdictenex%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. mainusage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): mainğПܟhu @l8usage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreload5t%"$%4%<%D%$P%%D?X%h%t%'|% $ %&pv%%#%Й$%%%%% % %!&& *Q*+T( ++ + + +4+ +H+ +T+ +d+ +p+ ++ ++ܠ++ܠ+ܠ++ܠ+ܠ+D,D ,0,4,L,\,t,,,,D,,D,D,D- -0,0-DH-\-Dt---D-ܠ- +- +-tw- + . + .4.ܠD. +T. +h........ܠ//0/D/ܠ\/twt/tw/tw/ܠ/ +/ܠ/ܠ/ +/ +/ +0 + 0 +0 +(0 +40 +H0 +p0ܠ|0tw0tw0tw0tw0tw0tw0tw0 +0tw0tw1tw1tw1tw(1tw41tw@1twL1twX1twd1twp1tw|1tw1tw1tw1tw1tw1tw1tw1tw1tw1tw1tw2tw 2tw2tw$2tw02tw<2twH2twT2tw`2twl2twx2tw2tw2tw2tw2tw2tw2tw2tw2tw2tw2tw2tw3tw3tw 3tw,3tw83twD3twP3tw\3twh3twt3tw3tw3tw3tw3ܠ3tw3tw3tw3tw3tw3 +4tw4tw(4tw44tw@4twL4twX4twd4twp4tw|4tw4tw4tw4tw4tw4tw4tw4tw4tw4tw4tw5tw 5tw5tw$5tw05tw<5twH5twT5tw`5twl5twx5tw5tw5tw5tw5tw5tw5tw5tw5tw5tw5tw5tw6tw6tw 6tw,6tw86twD6twP6tw\6twh6twt6tw6tw6tw6tw6tw6tw6tw6tw6tw6tw6tw6tw7tw7tw7tw(7tw47tw@7twL7twX7twd7twp7tw|7tw7tw7tw7tw7tw7tw7tw7tw7tw7tw7tw8tw 8tw8tw$8tw08tw<8twH8twT8tw`8twl8twx8tw8tw8tw8tw8tw8tw8tw8ܠ8tw8tw8;Zx0N/etc/resolv.confCouldn't open '%s': %sCouldn't write contents to '%s': %sShort contents write to '%s' (%zd vs %zd)warning: hostname %s contains an underscore which violates RFC 952write_file: path too long (%zu)write_file: imsg_compose: %swrite_file: imsg_flush: %sInvalid option name: '%s'fcntl F_GETF: %sfcntl F_SETFL: %sUnable to clone leaseUnable to apply defaultssearch %s no memory for domainnamenameserver %s no memory for nameserver# Generated by %s dhclient no memory for courtesy lineno memory for resolv.conf contentsegress@ . ..GMAKEDEVHconsoleI ttyJ memKkmemLnullMzeroNstdinOstdoutPstderrQksymsRklogSbpf0Twd0aUrwd0aVwd0bWrwd0bXwd0cYrwd0cZwd0d[rwd0d\wd0e]rwd0e^wd0f_rwd0f`wd0garwd0gbwd0hcrwd0hdwd0ierwd0iA ...B . ..chowndhclient disklabeldmesgfdiskfsck fsck_ext2fsfsck_ffsifconfiginitmknodmount mount_cd9660g? mount_ext2fsg? mount_ffs mount_msdos mount_nfsnewfs newfs_msdospingping6reboothaltroutertsolumountsysctlC . ..D tmpE dbF runemptyhashtzlistD .C..E .C..F .C..socket errorno interface in group egress foundioctl SIOCGIFGMEMB: %sget_ifnametoo many interfaces in group egressInterface name too long: %sInterface name too longoption_as_string: bad code %ddhcp option too largedaemoncannot forkchdir("/")%s [priv]no memory for priv_ibufpoll error: %simsg_read(priv_ibuf): %sCould not unlink '%s': %s%s; restarting.RESTART FAILED: '%s': %s%s; exiting bootp; %s { %s interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; option %s %s; renew %u %Y/%m/%d %T; rebind %u %Y/%m/%d %T; expire %u %Y/%m/%d %T; } offeredcannot fit offered lease into option dbcannot make offered lease into stringeffectivecannot fit effective lease into option dbcannot make effective lease into stringlease file not opencannot make lease into stringoptions do not fit in DHCPDECLINE packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDISCOVER packet.DHCPDECLINE on %s to %s port %dNo acceptable DHCPOFFERS received.Trying recorded lease %sbound: renewal in %lld seconds.bound: immediate renewal.No working leases in persistent database - sleeping.DHCPDISCOVER on %s to %s port %d interval %dDHCPREQUEST on %s to %s port %dUnexpected %s. State #%dUnexpected %s. No active lease.dhcpoffer: no memory to record lease.option-dhcpoffer: unknown option %dBogus data for option %sdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.Unexpected %s. State #%d.Unsatisfactory %susage: %s [-dqu] [-c file] [-i options] [-L file] [-l file] interface No memory for rtmmsg%s sa == NULLbound to %s -- renewal in %lld seconds.%s, not %s, added to %s%s added to %sActive address (%s) deleted; exiting%s, not %s, deleted from %s%s deleted from %s%s downLLADDR changed; restarting%s departuredno memory for errmsg'%s' is not a regular filec:di:l:L:quifi callocclient callocconfig calloc%s.%s/var/db/dhclient.leasesasprintfsetting routing table to %d: '%s'/etc/resolv.conf.tailCannot open /etc/resolv.conf.tail: %sCannot stat /etc/resolv.conf.tail: %sno memory for resolv.conf.tail contents: %sCouldn't read resolv.conf.tail: %sGot no data from resolv.conf.tailShort read of resolv.conf.tail%s: no link ... sleeping got link cannot open %s: %s_dhcpno such user: _dhcpsocketpair: %sno memory for unpriv_ibufcan't open and lock %s: %scan't open %s: %ssocket(PF_ROUTE, SOCK_RAW): %ssetsockopt(ROUTE_MSGFILTER): %ssetsockopt(ROUTE_TABLEFILTER): %s/var/empty/chrootsetresgidsetgroups/etc/dhclient.confexpecting IP address.no memory for reject list!expecting semicolon.expected option name.unexpected option name.too many options.expecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal dataexpecting identifier after option keyword.unknown option name.expecting string.option data buffer overflowexpecting number.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.semicolon expected.out of memory allocating option data.expecting interface name (in quotes).wrong interface name.expecting lease declaration.expecting left brace.no memory for lease.unterminated lease declaration.expecting a statement.unterminated interface declaration.Corrupt lease file - possible data loss!get_rdomain socket: %sgetifaddrs failedinterface %s already has the offered subnet!Can't create socketinterface_link_forceup: SIOCGIFFLAGS failed (%s)interface_link_forceup: SIOCSIFFLAGS DOWN failed (%s)interface_link_forceup: SIOCSIFFLAGS UP failed (%s)receive_packet failed on %s: %sInterface %s no longer appears valid.no space to remember ifpNo interfaces availableInterface %s: rdomain changed out from under usNo live interface to poll onpoll: %spipe write error to [priv]%s; restartingsend_packet: %ssocket(SOCK_RAW): %ssetsockopt(IP_HDRINCL): %ssetsockopt(SO_RTABLE): %s/dev/bpf%dCan't find free bpf: %sCan't attach interface %s to bpf device %s: %sCan't get BPF version: %sKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %sCan't set filter-drop mode on bpf device: %sCan't get bpf buffer length: %sCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %sCan't install write filter program: %sCannot lock bpfcScoption %s (%d) larger than buffer.rejecting bogus offer.option %s has no length field.Can't allocate storage for option %s.Can't expand storage for option %s.Discarding packet with invalid hlen.DHCPACKDHCPOFFERDHCPNACKBOOTREPLY%s from %s (%s)%s from %sno memory for info stringRejected %s.pretty_print_option: bad code %d%s: Excess information in format string: %s%s: no size indicator before A in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: expecting only %d bytes: got %d%s: expecting %d bytes: got %dUnexpected format code %ceof in string constantnumeric token larger than internal bufferstring constant larger than internal bufferappendbackoff-cutoffbootpdenyethernetfddifixed-addresshardwareignoreinitial-intervallink-timeoutmediumprependrebindrenewrequireretryselect-timeoutsendserver-namesupersedetimeouttoken-ring%s line %d: %s%*c^ default route socket: %sRTM_GET of default route: %sget default route read: %sno data from default route readdefault route read rtm: %sDHCLIENT %drecreating route label: %sadd_address: imsg_compose: %sadd_default_route: imsg_compose: %scleanup: imsg_compose: %scleanup: imsg_flush: %sdelete_address: imsg_compose: %sdelete_address: imsg_flush: %sflush_routes_and_arp_cache: imsg_compose: %sflush_routes_and_arp_cache: imsg_flush: %ssocket open failed: %sSIOCDIFADDR failed (%s): %sRouting Socket open failed: %s127.0.0.1failed to delete 127.0.0.1: %sSIOCAIFADDR failed (%s): %swriting label for host route: %slabel for host route too long (%zd)failed to add 127.0.0.1 route: %sdelete_addresses getifaddrs: %swriting label for default route: %slabel for default route too long (%zd)failed to add default route: %ssysctl size of routes:routes buf malloc:sysctl retrieval of routes:route cleanup failed - %s %s (%d retries, msize=%zu)opening socket to flush routes: %sDHCLIENT RTM_DELETE write: %sshort RTM_DELETE write (%d) %d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-server 08`swAQ<  swAQM`[~ [~swAQ`@@<@TU wAQubwAQuuA twAQ`\tvwAQO^0vwAQO^0 ;R9AtwAQp twAQp twAQ eAtwAQvwAQkvwAQk lKȿAtwAQUnwAQ41wAQ41 :/~CtwAQUntwAQUntwAQUn H]AtwAQUntwAQUntwAQ |DAAtwAQtwAQtwAQ !vwAQMU,vwAQMU,wwAQvóavwAQMU,vwAQMU,wwAQv5Ż!vwAQMU,vwAQMU,wwAQv6avwAQMU,vwAQMU,wwAQv2!vwAQMU,vwAQMU,wwAQv!avwAQd-vwAQd-wwAQv 2kX!vwAQd-vwAQd-wwAQv BavwAQd-vwAQd-wwAQv  !vwAQd-vwAQd-wwAQv [avwAQd-vwAQd-wwAQv N!vwAQd-vwAQd-wwAQv qOeavwAQd-vwAQd-wwAQv в!vwAQd-vwAQd-wwAQv  DavwAQd-vwAQd-wwAQv g!vwAQd-vwAQd-wwAQv 3ravwAQd-vwAQd-wwAQv_/!vwAQd-vwAQd-wwAQvU)*avwAQd-vwAQd-wwAQv-<!vwAQd-vwAQd-wwAQv깲avwAQd-vwAQd-wwAQvƣ!vwAQd-vwAQd-wwAQv:XavwAQ=F-vwAQ=F-wwAQv!vwAQ=F-vwAQ=F-wwAQvvcavwAQ=F-vwAQ=F-wwAQvC:!vwAQ=F-vwAQ=F-wwAQvavwAQ=F-vwAQ=F-wwAQv5!vwAQ=F-vwAQ=F-wwAQvQ0avwAQ=F-vwAQ=F-wwAQv!vwAQ=F-vwAQ=F-wwAQv}avwAQ=F-vwAQ=F-wwAQv7!vwAQ=F-vwAQ=F-wwAQv~avwAQ=F-vwAQ=F-wwAQvZ[Tr!vwAQ=F-vwAQ=F-wwAQv}avwAQ=F-vwAQ=F-wwAQv$݁!vwAQ=F-vwAQ=F-wwAQv-@avwAQ=F-vwAQ=F-wwAQv$!vwAQ.vwAQ.wwAQvavwAQ.vwAQ.wwAQv!vwAQ.vwAQ.wwAQv^LavwAQ.vwAQ.wwAQvR!vwAQ.vwAQ.wwAQv%avwAQ.vwAQ.wwAQvc!vwAQ.vwAQ.wwAQvfavwAQ.vwAQ.wwAQv8!vwAQ.vwAQ.wwAQvBavwAQ.vwAQ.wwAQv:Z!vwAQ.vwAQ.wwAQvDavwAQ.vwAQ.wwAQvpX!vwAQ.vwAQ.wwAQvavwAQ.vwAQ.wwAQvqM&!vwAQ-/vwAQ-/wwAQv-avwAQ-/vwAQ-/wwAQv``!vwAQ-/vwAQ-/wwAQv72avwAQ-/vwAQ-/wwAQv !vwAQ-/vwAQ-/wwAQv֦avwAQ-/vwAQ-/wwAQvWù !vwAQ-/vwAQ-/wwAQvEGavwAQ-/vwAQ-/wwAQvW !vwAQ-/vwAQ-/wwAQvavwAQ-/vwAQ-/wwAQv !vwAQ-/vwAQ-/wwAQv>tl{avwAQ-/vwAQ-/wwAQv;!vwAQ-/vwAQ-/wwAQv 6avwAQ-/vwAQ-/wwAQv!vwAQ-/vwAQ-/wwAQv<avwAQ:/vwAQ:/wwAQv!vwAQ:/vwAQ:/wwAQv!zavwAQ:/vwAQ:/wwAQvȿc!vwAQ:/vwAQ:/wwAQv0@avwAQ:/vwAQ:/wwAQv .!vwAQ:/vwAQ:/wwAQv .!avwAQ:/vwAQ:/wwAQv t!vwAQ:/vwAQ:/wwAQv PXavwAQ:/vwAQ:/wwAQv H !vwAQ:/vwAQ:/wwAQv @avwAQ:/vwAQ:/wwAQv eR!vwAQ:/vwAQ:/wwAQv ")7avwAQ:/vwAQ:/wwAQv :/!vwAQ:/vwAQ:/wwAQv ,FavwAQ?^0vwAQ?^0wwAQv|!vwAQ?^0vwAQ?^0wwAQv avwAQ?^0vwAQ?^0wwAQvˤ!vwAQ?^0vwAQ?^0wwAQpAiU!vwAQ?^0vwAQ?^0vwAQJ8 @t@Bu!vwAQ?^0vwAQ?^0vwAQ9 'BuavwAQ?^0vwAQ?^0wwAQp7!vwAQ?^0vwAQ?^0wwAQpT#avwAQ?^0vwAQ?^0wwAQp⌻!vwAQ?^0vwAQ?^0wwAQpG!vwAQ?^0vwAQ?^0vwAQ?^0?e!vwAQ?^0vwAQ?^0vwAQ?^0?lavwAQ?^0vwAQ?^0wwAQpCe!vwAQ?^0vwAQ?^0wwAQpravwAQ?^0vwAQ?^0wwAQp'a!vwAQO^0vwAQO^0wwAQpO+avwAQO^0vwAQO^0wwAQpa!vwAQO^0vwAQO^0wwAQpz9WavwAQO^0vwAQO^0wwAQp]0!vwAQO^0vwAQO^0wwAQpJc!vwAQO^0vwAQO^0vwAQO^0<f;!vwAQO^0vwAQO^0vwAQO^0=VN!vwAQO^0vwAQO^0vwAQO^0"D!!vwAQO^0vwAQO^0vwAQO^0"E`5!vwAQO^0vwAQO^0vwAQO^04!&!vwAQZ1vwAQZ1wwAQpf wAQ41wAQ%:wAQ%: ( 0 8 @ H P  D'gɩNY0auʆ?4]jjY6I٧iŸX'Nrg]4lpBnntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81relay-agent-informationoption-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143tftp-config-fileoption-145option-146option-147option-148option-149voip-configuration-serveroption-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251autoproxy-scriptoption-253option-254option-endBogus number: %s.Bogus number: %s: digit %d not in base %dvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dno space for numeric aggregatenumeric aggregate too short.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.expected colon separating minute from second.numeric second expected.expecting a network hardware typeExpecting numeric lease timefilename must be a stringno memory for string %s.dispatch_imsg: imsg_get failure: %sbad IMSG_DELETE_ADDRESSbad IMSG_ADD_ADDRESSbad IMSG_FLUSH_ROUTESbad IMSG_ADD_DEFAULT_ROUTEbad IMSG_HUPshort IMSG_WRITE_FILEbad IMSG_WRITE_FILE (%zu)received unknown message, code %dcannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp fileline too longcannot seek temp filecannot write temp filecannot read temp fileunexpected end-of-file& no previous commandinvalid pattern delimiter\  \abfnrtv\cannot read stdincannot write filecannot open output filecannot close output filecannot read input filenewline inserted newline appended cannot open input filecannot close input fileshell access restrictedinvalid mark charactered.hup/ed.hupno current filenameinvalid filenamefilename too longno matchnumber out of rangeinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableHOMEcrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s usage: %s [-] [-sx] [-p string] [file] unbalanced brackets ([])trailing backslash (\)no previous patterninfinite substitution loopnothing to undocopy_link%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory lchown: %sutimes: %schown: %schmod: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %soverwrite %s? QQQ%#D $RRROO R,R n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScsLR\RQhRtRRRRRQusage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfhlNnqrtVv] [-o filename] [file ...] usage: %s [-fghqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimes: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gzZgzz123456789ab:cdfghLlNnOo:qrS:tVvcfhlNno:qrtVvfghqr1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... group is %s: %suser is %s: %sHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %smakeentrylinkupfileerrordirscaniblockckinodecheckfilesyspass2pass2checkpass5setup$08@PX`hp~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%ubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %d to nextinode %d cannot alloc %lu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing %lld,conversion levelcannot do level %d conversion usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:cannot alloc %u bytes for inoinfobad direct addr: %ld bad indirect addr: %ld INCORRECT BLOCK COUNT I=%u (%ld should be %d)too many inodes %llu cannot realloc %zu bytes to %zu for inoinfo phase 1, inode %d/%dphase 1b, inode %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %d/%dDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %u bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %d out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK %lld (%lld),   delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcannot disable lid suspendcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %lld sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %d out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d sectorsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemwarning: fsck_ffs will need %lluMB; min(MAXDSIZ,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d checkrm_overwriteusage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %u): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:p\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s' ..."usage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] Eae:f:nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtv d  <  8  ( 0 8  < @ L X8 d@ l p pB t|c_umask4 8 <0- @< H  T< ` h p x  $  L |   T 0- Ď ̎t1 Ԏ ܎ ș( -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$ H4tHfXcld|slmnpx_modex_search_histkb_addx_bindx_emacsN a ܑr r Dr o $n <o Tn hi |_ a W $r tlo @U dP` i h  n Вl ܒdr q hN Dm ] ] (_ <(] LL] X(_ h\U xHa `V O a f  v ȓc s `O N $T_ ,\ 8b j[ Hh q `k p[ |[ [ Hb U dbteste_isa,#++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():hist_initj_printDdoppromptyylexIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }HTDgmatchgetoptionsaĢТcآHeik$l,Xzm8CnDfLTb\udpxprx(>shvȡ̣xdo_phys_pathshf_vfprintf؜  X v  Ȧ;̦{Ц}Ԧئܦx ݅Ӆ]]<>!let||&&()str_val{ Ȑ T(.h 8   8DP\dltD@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'ls:usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directoryCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tainvalid file modeusage: mknod [-m mode] name b|c major minorusage: mknod [-m mode] name ptime: -%s unknown optiontime: -%s requires an argument:p%s%*ld.%02ld%s%s%*ldm%ld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numberugorwx%#3.3o augo=+-rwxugoXsbad masktrap -- bad signal %sprsu,nothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unsetmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited unlimitedinvalid limit: %sexceeds allowable limitbad limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS"#$&'()*;<=>?[\]`{|};|&()`+@!fileglob: substitute errorFPATH nothing to yank yank something first I-search: duplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return codebeginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $() input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlcheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id\%c%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextracealnumalphablankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s unexpectedtoo many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{}[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --derive_key_pkcsbio_diskinqbio_createflagsbio_parse_devliststr2locatorbio_changepassbio_deleteraidbio_createraidbio_blinkbio_setblinkbio_getvolbynamebio_setstatebio_alarmbio_inqmainInvalid keyInvalid saltToo few rounds: %dcan't specify passphrase file during initial creation of crypto volumeinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: invalid AOE dev list: use nic,dsteaddr,shelf,slottarget not specifiedunknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKTarget %s: %sBIOCINQBIOCVOLBIOCDISKDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEinvalid alarm function: %sBIOCALARMalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuild%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s FailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial%11s %-10s %14s %-7s %-6s <%s> %7s %-10s %14s %-7s %-6s '%s' usage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:svu:need deviceneed -c parameterneed -l parametermust use bio deviceusage: %s seconds do_movemainusage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longeval5syntax error|&=<>+-*/%:()non-numeric argumentdivision by zerousage: %s [-M core] [-N system] M:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFmainusage: %s [-s] [name-of-host] sethostnamegethostnameIN-ADDR.ARPAbf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpagethostby*.getanswer: asked for "%s", got "%s"-_//etc/hosts%x.%x.ip6.arpa/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[ptptptȺغܺgethostby*.getanswer: asked for "%s", got "%s"# /etc/group/etc/spwd.db/etc/pwd.db/etc/ethers%02x:%02x:%02x:%02x:%02x:%02x  0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad baselogout/var/run/utmpimsg_readmsgbuf_writereadlabelfsQQQQQQQ8 QQQ QQ QQ  /dev/diskmap%sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in label%s%s%s%c%s%s%slogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%o%s: bad entry: %s@BKMGTPE0B%lld%c%lld.%1lld%clogwtmp/var/log/wtmphmac_sha1pkcs5_pbkdf2\\#tgetentTERMCAP/usr/share/misc/termcapTERMPATH.termcap /usr/share/misc/termcapOOPS5MS7) longjmp botch. inet6_rth_reverseargument buffer overflowunknown/invalid errorno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failureinvalid value for hintsresolved protocol is unknownfstabscanxxswABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/%u.%u.%u.%uLX\x`dltx|  Signal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2THRx[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL (4@HTdl ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaqueBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocksregerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***/etc/ttyssecurertsctssoftcarwindowttyname_r/var/run/dev.db/etc/networksreadpassphrasetcsetattrglob2authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problemauthunix_create: out of memory L,4@Tdp|0H`xL,4@Tdp|0H`xHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread ASTSHA256EndSHA256DataSHA256FileChunk0123456789abcdefunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %sinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d ip6_parsenumericgetnameinfoasprintf%h %e %T b0b1ncdtscsbpxbxfxoxtxdxgetentcgetnext%s.dbtc|:/etc/protocolsSHA1TransformSHA1Padexecvpeexeclpexecleexeclexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathؗҜ<3#I9=D2[%Cod(hinityanMD5Padinet_ntop4inet_ntop%u.%u.%u.%u0123456789abcdefInfinityNaN^[Yy]^[Nn]yes646NONEUTF8  $(0<DLT\dpxSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y%m/%d/%y%H:%M:%S%I:%M:%S %p__stack_smash_handlerstack overflow in function %sasctime3JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat??? ??? ?? ??:??:?? ???? %.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s _conv_fmt  $(0<DLT\dpx$-0%2d%Y-%m-%d%03d%H:%M%e-%b-%Y%04d%a %b %e %T %YtzloadmnGMT/etc/localtime/usr/share/zoneinfoposixrules,M4.1.0,M10.5.0abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual pageclntudp_callclntudp_create: out of memory __hostaliasres_queryres_querydomainHOSTALIASES%.*s.%.*s __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~_res_init/&ndots:insecure1insecure2edns0LOCALDOMAIN;#inet4lookupsearchnameserversortlistRES_OPTIONSenvinet_pton01234567890123456789ABCDEF0123456789abcdef  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/etc/services,/""too small ((((( AAAAAABBBBBB connectlog_r__vsyslog_r/dev/log_rsyslog%s: unknown facility/priority: %x<%d>[%ld]Error %dvsnprintfl|0Ll4L`|RPC: (unknown error code)%s: %s - %s ; errno = %s; low version = %u, high version = %u; why = (unknown authentication error - %d); s1 = %u, s2 = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory bindresvport_sa<xdrrec_create: out of memory perrorlibcUnknown signal: Unknown error: _catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGl 4H\Xx 4Thd0Tp4Ph<`|(<`t 4H\t,@Xh|Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supportedL,4@Tdp|0H`xxdr_string: out of memory xdr_bytes: out of memory  !#&(*-/14QQQQQQQ0QQABCDEF7yACnF?O8M20HwZ> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is not a regular file (use -f to see it) is a directoryab@p (HBhcxdA,eTD`tfF\Ȣg8dhXiP أj#8HJ!hXxKLؤm 0n"t<ThpH!P qLr" Ds!`S!̦u"ĉܦ$V w"<`x(`̧اXA y|,Dzh"~!lШ?\#4"A d8\... (interrupt to abort) (press RETURN) \444 Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUؙtv(̞(0<8PtX |vht 08Ȼl LXE@AB0ChDEFGH0UjVHabDtc e$f(h4i@LTlhntq|qrsvwxut$  , 4 < @LPv8tT܌\dltz t!0"t#$%$&'pi(u)*+,-./01234567Q(Dh @`, priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHMPLSUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC SRCMASK LABEL<NOOP .$0< Q( 0(EHC P E(  0(EHDHC x @HQG ... ...<PUPUPUPV< ğПܟhu @8@@@%s: can't read disk label; disk type must be specified......LtPtTt\t  `tdthtptxttttt{}abcdDgGhHilnNpPqrs tw xy !:#="", PHPH\TX@HhHh`lttР0HXl|t8`,Hpġ@\xȡ̡Xԣ(DܣPDxDDDDE,E TEm|EEEM _ xx:xx:xx:xx:xx:xx0000000000000000 ԣ0QܣpQQQdQQ,QHQ QmQQQQ # $,0< @ D x H L \ ` l p  dm !"#$ %&('4(H)\*h+t,|--..X/h/0123456789:;<= > ?0@@[T\`\p]^^__`{{|} } ~(@LhtA$@L ht   4 4@dpQԣ(DܣPDxDDDDE,E TEm|EEEPGTG`IdHG?Q$08@PX`hp?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~pԣܣ  m@tt0vvuPxHw8zdw@| (((X((((X( l(((X(Э|PP$MLLM(MlV$VpVxVVhZDYh]\\X\[[P\([,[[\X\[[(\([iciljlmhak\$HtxPЂ~.shstrtab.init.text.fini.rodata.openbsd.randomdata.data.eh_frame.jcr.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident ppPPddb%hzhz$9zzM?INHWH$\:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E)0:ec=\E[%dX:ei=\E[4l:\ :ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:\ :kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:nw=\EE:\ :pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: ives right/Indian/Mauritius right/Indian/Mayotte right/Indian/Reunion right/Iran right/Israel right/Jamaica right/Japan right/Kwajalein right/Libya right/MET right/MST right/MST7MDT right/Mexico/ right/Mexico/BajaNorte right/Mexico/BajaSur right/Mexico/General right/Mideast/ right/Mideast/Riyadh87 right/Mideast/Riyadh88 right/Mideast/Riyadh89 right/NZ right/NZ-CHAT right/Navajo right/PRC right/PST8PDT right/Pacific/ right/Pacific/Apia right/Pacific/Auckland right/Pacific/Chatham right/Pacific/Chuuk right/Pacific/Easter right/Pacific/Efate right/Pacific/Enderbury right/Pacific/Fakaofo right/Pacific/Fiji right/Pacific/Funafuti right/Pacific/Galapagos right/Pacific/Gambier right/Pacific/Guadalcanal right/Pacific/Guam right/Pacific/Honolulu right/Pacific/Johnston right/Pacific/Kiritimati right/Pacific/Kosrae right/Pacific/Kwajalein right/Pacific/Majuro right/Pacific/Marquesas right/Pacific/Midway right/Pacific/Nauru right/Pacific/Niue right/Pacific/Norfolk right/Pacific/Noumea right/Pacific/Pago_Pago right/Pacific/Palau right/Pacific/Pitcairn right/Pacific/Pohnpei right/Pacific/Ponape right/Pacific/Port_Moresby right/Pacific/Rarotonga right/Pacific/Saipan right/Pacific/Samoa right/Pacific/Tahiti right/Pacific/Tarawa right/Pacific/Tongatapu right/Pacific/Truk right/Pacific/Wake right/Pacific/Wallis right/Pacific/Yap right/Poland right/Portugal right/ROC right/ROK right/Singapore right/Turkey right/UCT right/US/ right/US/Alaska right/US/Aleutian right/US/Arizona right/US/Central right/US/East-Indiana right/US/Eastern right/US/Hawaii right/US/Indiana-Starke right/US/Michigan right/US/Mountain right/US/Pacific right/US/Pacific-New right/US/Samoa right/UTC right/Universal right/W-SU right/WET right/Zulu Africa/ Africa/Abidjan Africa/Accra Africa/Addis_Ababa Africa/Algiers Africa/Asmara Africa/Asmera Africa/Bamako Africa/Bangui Africa/Banjul Africa/Bissau Africa/Blantyre Africa/Brazzaville Africa/Bujumbura Africa/Cairo Africa/Casablanca Africa/Ceuta Africa/Conakry Africa/Dakar Africa/Dar_es_Salaam Africa/Djibouti Africa/Douala Africa/El_Aaiun Africa/Freetown Africa/Gaborone Africa/Harare Africa/Johannesburg Africa/Juba Africa/Kampala Africa/Khartoum Africa/Kigali Africa/Kinshasa Africa/Lagos Africa/Libreville Africa/Lome Africa/Luanda Africa/Lubumbashi Africa/Lusaka Africa/Malabo Africa/Maputo Africa/Maseru Africa/Mbabane Africa/Mogadishu Africa/Monrovia Africa/Nairobi Africa/Ndjamena Africa/Niamey Africa/Nouakchott Africa/Ouagadougou Africa/Porto-Novo Africa/Sao_Tome Africa/Timbuktu Africa/Tripoli Africa/Tunis Africa/Windhoek America/ America/Adak America/Anchorage America/Anguilla America/Antigua America/Araguaina America/Argentina/ America/Argentina/Buenos_Aires America/Argentina/Catamarca America/Argentina/ComodRivadavia America/Argentina/Cordoba America/Argentina/Jujuy America/Argentina/La_Rioja America/Argentina/Mendoza America/Argentina/Rio_Gallegos America/Argentina/Salta America/Argentina/San_Juan America/Argentina/San_Luis America/Argentina/Tucuman America/Argentina/Ushuaia America/Aruba America/Asuncion America/Atikokan America/Atka America/Bahia America/Bahia_Banderas America/Barbados America/Belem America/Belize America/Blanc-Sablon America/Boa_Vista America/Bogota America/Boise America/Buenos_Aires America/Cambridge_Bay America/Campo_Grande America/Cancun America/Caracas America/Catamarca America/Cayenne America/Cayman America/Chicago America/Chihuahua America/Coral_Harbour America/Cordoba America/Costa_Rica America/Creston America/Cuiaba America/Curacao America/Danmarkshavn America/Dawson America/Dawson_Creek America/Denver America/Detroit America/Dominica America/Edmonton America/Eirunepe America/El_Salvador America/Ensenada America/Fort_Wayne America/Fortaleza America/Glace_Bay America/Godthab America/Goose_Bay America/Grand_Turk America/Grenada America/Guadeloupe America/Guatemala America/Guayaquil America/Guyana America/Halifax America/Havana America/Hermosillo America/Indiana/ America/Indiana/Indianapolis America/Indiana/Knox America/Indiana/Marengo America/Indiana/Petersburg America/Indiana/Tell_City America/Indiana/Vevay America/Indiana/Vincennes America/Indiana/Winamac America/Indianapolis America/Inuvik America/Iqaluit America/Jamaica America/Jujuy America/Juneau America/Kentucky/ America/Kentucky/Louisville America/Kentucky/Monticello America/Knox_IN America/Kralendijk America/La_Paz America/Lima America/Los_Angeles America/Louisville America/Lower_Princes America/Maceio America/Managua America/Manaus America/Marigot America/Martinique America/Matamoros America/Mazatlan America/Mendoza America/Menominee America/Merida America/Metlakatla America/Mexico_City America/Miquelon America/Moncton America/Monterrey America/Montevideo America/Montreal America/Montserrat America/Nassau America/New_York America/Nipigon America/Nome America/Noronha America/North_Dakota/ America/North_Dakota/Beulah America/North_Dakota/Center America/North_Dakota/New_Salem America/Ojinaga America/Panama America/Pangnirtung America/Paramaribo America/Phoenix America/Port-au-Prince America/Port_of_Spain America/Porto_Acre America/Porto_Velho America/Puerto_Rico America/Rainy_River America/Rankin_Inlet America/Recife America/Regina America/Resolute America/Rio_Branco America/Rosario America/Santa_Isabel America/Santarem America/Santiago America/Santo_Domingo America/Sao_Paulo America/Scoresbysund America/Shiprock America/Sitka America/St_Barthelemy America/St_Johns America/St_Kitts America/St_Lucia America/St_Thomas America/St_Vincent America/Swift_Current America/Tegucigalpa America/Thule America/Thunder_Bay America/Tijuana America/Toronto America/Tortola America/Vancouver America/Virgin America/Whitehorse America/Winnipeg America/Yakutat America/Yellowknife Antarctica/ Antarctica/Casey Antarctica/Davis Antarctica/DumontDUrville Antarctica/Macquarie Antarctica/Mawson Antarctica/McMurdo Antarctica/Palmer Antarctica/Rothera Antarctica/South_Pole Antarctica/Syowa Antarctica/Vostok Arctic/ Arctic/Longyearbyen Asia/ Asia/Aden Asia/Almaty Asia/Amman Asia/Anadyr Asia/Aqtau Asia/Aqtobe Asia/Ashgabat Asia/Ashkhabad Asia/Baghdad Asia/Bahrain Asia/Baku Asia/Bangkok Asia/Beirut Asia/Bishkek Asia/Brunei Asia/Calcutta Asia/Choibalsan Asia/Chongqing Asia/Chungking Asia/Colombo Asia/Dacca Asia/Damascus Asia/Dhaka Asia/Dili Asia/Dubai Asia/Dushanbe Asia/Gaza Asia/Harbin Asia/Hebron Asia/Ho_Chi_Minh Asia/Hong_Kong Asia/Hovd Asia/Irkutsk Asia/Istanbul Asia/Jakarta Asia/Jayapura Asia/Jerusalem Asia/Kabul Asia/Kamchatka Asia/Karachi Asia/Kashgar Asia/Kathmandu Asia/Katmandu Asia/Kolkata Asia/Krasnoyarsk Asia/Kuala_Lumpur Asia/Kuching Asia/Kuwait Asia/Macao Asia/Macau Asia/Magadan Asia/Makassar Asia/Manila Asia/Muscat Asia/Nicosia Asia/Novokuznetsk Asia/Novosibirsk Asia/Omsk Asia/Oral Asia/Phnom_Penh Asia/Pontianak Asia/Pyongyang Asia/Qatar Asia/Qyzylorda Asia/Rangoon Asia/Riyadh Asia/Riyadh87 Asia/Riyadh88 Asia/Riyadh89 Asia/Saigon Asia/Sakhalin Asia/Samarkand Asia/Seoul Asia/Shanghai Asia/Singapore Asia/Taipei Asia/Tashkent Asia/Tbilisi Asia/Tehran Asia/Tel_Aviv Asia/Thimbu Asia/Thimphu Asia/Tokyo Asia/Ujung_Pandang Asia/Ulaanbaatar Asia/Ulan_Bator Asia/Urumqi Asia/Vientiane Asia/Vladivostok Asia/Yakutsk Asia/Yekaterinburg Asia/Yerevan Atlantic/ Atlantic/Azores Atlantic/Bermuda Atlantic/Canary Atlantic/Cape_Verde Atlantic/Faeroe Atlantic/Faroe Atlantic/Jan_Mayen Atlantic/Madeira Atlantic/Reykjavik Atlantic/South_Georgia Atlantic/St_Helena Atlantic/Stanley Australia/ Australia/ACT Australia/Adelaide Australia/Brisbane Australia/Broken_Hill Australia/Canberra Australia/Currie Australia/Darwin Australia/Eucla Australia/Hobart Australia/LHI Australia/Lindeman Australia/Lord_Howe Australia/Melbourne Australia/NSW Australia/North Australia/Perth Australia/Queensland Australia/South Australia/Sydney Australia/Tasmania Australia/Victoria Australia/West Australia/Yancowinna Brazil/ Brazil/Acre Brazil/DeNoronha Brazil/East Brazil/West CET CST6CDT Canada/ Canada/Atlantic Canada/Central Canada/East-Saskatchewan Canada/Eastern Canada/Mountain Canada/Newfoundland Canada/Pacific Canada/Saskatchewan Canada/Yukon Chile/ Chile/Continental Chile/EasterIsland Cuba EET EST EST5EDT Egypt Eire Etc/ Etc/GMT Etc/GMT+0 Etc/GMT+1 Etc/GMT+10 Etc/GMT+11 Etc/GMT+12 Etc/GMT+2 Etc/GMT+3 Etc/GMT+4 Etc/GMT+5 Etc/GMT+6 Etc/GMT+7 Etc/GMT+8 Etc/GMT+9 Etc/GMT-0 Etc/GMT-1 Etc/GMT-10 Etc/GMT-11 Etc/GMT-12 Etc/GMT-13 Etc/GMT-14 Etc/GMT-2 Etc/GMT-3 Etc/GMT-4 Etc/GMT-5 Etc/GMT-6 Etc/GMT-7 Etc/GMT-8 Etc/GMT-9 Etc/GMT0 Etc/Greenwich Etc/UCT Etc/UTC Etc/Universal Etc/Zulu Europe/ Europe/Amsterdam Europe/Andorra Europe/Athens Europe/Belfast Europe/Belgrade Europe/Berlin Europe/Bratislava Europe/Brussels Europe/Bucharest Europe/Budapest Europe/Chisinau Europe/Copenhagen Europe/Dublin Europe/Gibraltar Europe/Guernsey Europe/Helsinki Europe/Isle_of_Man Europe/Istanbul Europe/Jersey Europe/Kaliningrad Europe/Kiev Europe/Lisbon Europe/Ljubljana Europe/London Europe/Luxembourg Europe/Madrid Europe/Malta Europe/Mariehamn Europe/Minsk Europe/Monaco Europe/Moscow Europe/Nicosia Europe/Oslo Europe/Paris Europe/Podgorica Europe/Prague Europe/Riga Europe/Rome Europe/Samara Europe/San_Marino Europe/Sarajevo Europe/Simferopol Europe/Skopje Europe/Sofia Europe/Stockholm Europe/Tallinn Europe/Tirane Europe/Tiraspol Europe/Uzhgorod Europe/Vaduz Europe/Vatican Europe/Vienna Europe/Vilnius Europe/Volgograd Europe/Warsaw Europe/Zagreb Europe/Zaporozhye Europe/Zurich Factory GB GB-Eire GMT GMT+0 GMT-0 GMT0 Greenwich HST Hongkong Iceland Indian/ Indian/Antananarivo Indian/Chagos Indian/Christmas Indian/Cocos Indian/Comoro Indian/Kerguelen Indian/Mahe Indian/Maldives Indian/Mauritius Indian/Mayotte Indian/Reunion Iran Israel Jamaica Japan Kwajalein Libya MET MST MST7MDT Mexico/ Mexico/BajaNorte Mexico/BajaSur Mexico/General Mideast/ Mideast/Riyadh87 Mideast/Riyadh88 Mideast/Riyadh89 NZ NZ-CHAT Navajo PRC PST8PDT Pacific/ Pacific/Apia Pacific/Auckland Pacific/Chatham Pacific/Chuuk Pacific/Easter Pacific/Efate Pacific/Enderbury Pacific/Fakaofo Pacific/Fiji Pacific/Funafuti Pacific/Galapagos Pacific/Gambier Pacific/Guadalcanal Pacific/Guam Pacific/Honolulu Pacific/Johnston Pacific/Kiritimati Pacific/Kosrae Pacific/Kwajalein Pacific/Majuro Pacific/Marquesas Pacific/Midway Pacific/Nauru Pacific/Niue Pacific/Norfolk Pacific/Noumea Pacific/Pago_Pago Pacific/Palau Pacific/Pitcairn Pacific/Pohnpei Pacific/Ponape Pacific/Port_Moresby Pacific/Rarotonga Pacific/Saipan Pacific/Samoa Pacific/Tahiti Pacific/Tarawa Pacific/Tongatapu Pacific/Truk Pacific/Wake Pacific/Wallis Pacific/Yap Poland Portugal ROC ROK Singapore Turkey UCT US/ US/Alaska US/Aleutian US/Arizona US/Central US/East-Indiana US/Eastern US/Hawaii US/Indiana-Starke US/Michigan US/Mountain US/Pacific US/Pacific-New US/Samoa UTC Universal W-SU WET Zulu posix/ posix/Africa/ posix/Africa/Abidjan posix/Africa/Accra posix/Africa/Addis_Ababa posix/Africa/Algiers posix/Africa/Asmara posix/Africa/Asmera posix/Africa/Bamako posix/Africa/Bangui posix/Africa/Banjul posix/Africa/Bissau posix/Africa/Blantyre posix/Africa/Brazzaville posix/Africa/Bujumbura posix/Africa/Cairo posix/Africa/Casablanca posix/Africa/Ceuta posix/Africa/Conakry posix/Africa/Dakar posix/Africa/Dar_es_Salaam posix/Africa/Djibouti posix/Africa/Douala posix/Africa/El_Aaiun posix/Africa/Freetown posix/Africa/Gaborone posix/Africa/Harare posix/Africa/Johannesburg posix/Africa/Juba posix/Africa/Kampala posix/Africa/Khartoum posix/Africa/Kigali posix/Africa/Kinshasa posix/Africa/Lagos posix/Africa/Libreville posix/Africa/Lome posix/Africa/Luanda posix/Africa/Lubumbashi posix/Africa/Lusaka posix/Africa/Malabo posix/Africa/Maputo posix/Africa/Maseru posix/Africa/Mbabane posix/Africa/Mogadishu posix/Africa/Monrovia posix/Africa/Nairobi posix/Africa/Ndjamena posix/Africa/Niamey posix/Africa/Nouakchott posix/Africa/Ouagadougou posix/Africa/Porto-Novo posix/Africa/Sao_Tome posix/Africa/Timbuktu posix/Africa/Tripoli posix/Africa/Tunis posix/Africa/Windhoek posix/America/ posix/America/Adak posix/America/Anchorage posix/America/Anguilla posix/America/Antigua posix/America/Araguaina posix/America/Argentina/ posix/America/Argentina/Buenos_Aires posix/America/Argentina/Catamarca posix/America/Argentina/ComodRivadavia posix/America/Argentina/Cordoba posix/America/Argentina/Jujuy posix/America/Argentina/La_Rioja posix/America/Argentina/Mendoza posix/America/Argentina/Rio_Gallegos posix/America/Argentina/Salta posix/America/Argentina/San_Juan posix/America/Argentina/San_Luis posix/America/Argentina/Tucuman posix/America/Argentina/Ushuaia posix/America/Aruba posix/America/Asuncion posix/America/Atikokan posix/America/Atka posix/America/Bahia posix/America/Bahia_Banderas posix/America/Barbados posix/America/Belem posix/America/Belize posix/America/Blanc-Sablon posix/America/Boa_Vista posix/America/Bogota posix/America/Boise posix/America/Buenos_Aires posix/America/Cambridge_Bay posix/America/Campo_Grande posix/America/Cancun posix/America/Caracas posix/America/Catamarca posix/America/Cayenne posix/America/Cayman posix/America/Chicago posix/America/Chihuahua posix/America/Coral_Harbour posix/America/Cordoba posix/America/Costa_Rica posix/America/Creston posix/America/Cuiaba posix/America/Curacao posix/America/Danmarkshavn posix/America/Dawson posix/America/Dawson_Creek posix/America/Denver posix/America/Detroit posix/America/Dominica posix/America/Edmonton posix/America/Eirunepe posix/America/El_Salvador posix/America/Ensenada posix/America/Fort_Wayne posix/America/Fortaleza posix/America/Glace_Bay posix/America/Godthab posix/America/Goose_Bay posix/America/Grand_Turk posix/America/Grenada posix/America/Guadeloupe posix/America/Guatemala posix/America/Guayaquil posix/America/Guyana posix/America/Halifax posix/America/Havana posix/America/Hermosillo posix/America/Indiana/ posix/America/Indiana/Indianapolis posix/America/Indiana/Knox posix/America/Indiana/Marengo posix/America/Indiana/Petersburg posix/America/Indiana/Tell_City posix/America/Indiana/Vevay posix/America/Indiana/Vincennes posix/America/Indiana/Winamac posix/America/Indianapolis posix/America/Inuvik posix/America/Iqaluit posix/America/Jamaica posix/America/Jujuy posix/America/Juneau posix/America/Kentucky/ posix/America/Kentucky/Louisville posix/America/Kentucky/Monticello posix/America/Knox_IN posix/America/Kralendijk posix/America/La_Paz posix/America/Lima posix/America/Los_Angeles posix/America/Louisville posix/America/Lower_Princes posix/America/Maceio posix/America/Managua posix/America/Manaus posix/America/Marigot posix/America/Martinique posix/America/Matamoros posix/America/Mazatlan posix/America/Mendoza posix/America/Menominee posix/America/Merida posix/America/Metlakatla posix/America/Mexico_City posix/America/Miquelon posix/America/Moncton posix/America/Monterrey posix/America/Montevideo posix/America/Montreal posix/America/Montserrat posix/America/Nassau posix/America/New_York posix/America/Nipigon posix/America/Nome posix/America/Noronha posix/America/North_Dakota/ posix/America/North_Dakota/Beulah posix/America/North_Dakota/Center posix/America/North_Dakota/New_Salem posix/America/Ojinaga posix/America/Panama posix/America/Pangnirtung posix/America/Paramaribo posix/America/Phoenix posix/America/Port-au-Prince posix/America/Port_of_Spain posix/America/Porto_Acre posix/America/Porto_Velho posix/America/Puerto_Rico posix/America/Rainy_River posix/America/Rankin_Inlet posix/America/Recife posix/America/Regina posix/America/Resolute posix/America/Rio_Branco posix/America/Rosario posix/America/Santa_Isabel posix/America/Santarem posix/America/Santiago posix/America/Santo_Domingo posix/America/Sao_Paulo posix/America/Scoresbysund posix/America/Shiprock posix/America/Sitka posix/America/St_Barthelemy posix/America/St_Johns posix/America/St_Kitts posix/America/St_Lucia posix/America/St_Thomas posix/America/St_Vincent posix/America/Swift_Current posix/America/Tegucigalpa posix/America/Thule posix/America/Thunder_Bay posix/America/Tijuana posix/America/Toronto posix/America/Tortola posix/America/Vancouver posix/America/Virgin posix/America/Whitehorse posix/America/Winnipeg posix/America/Yakutat posix/America/Yellowknife posix/Antarctica/ posix/Antarctica/Casey posix/Antarctica/Davis posix/Antarctica/DumontDUrville posix/Antarctica/Macquarie posix/Antarctica/Mawson posix/Antarctica/McMurdo posix/Antarctica/Palmer posix/Antarctica/Rothera posix/Antarctica/South_Pole posix/Antarctica/Syowa posix/Antarctica/Vostok posix/Arctic/ posix/Arctic/Longyearbyen posix/Asia/ posix/Asia/Aden posix/Asia/Almaty posix/Asia/Amman posix/Asia/Anadyr posix/Asia/Aqtau posix/Asia/Aqtobe posix/Asia/Ashgabat posix/Asia/Ashkhabad posix/Asia/Baghdad posix/Asia/Bahrain posix/Asia/Baku posix/Asia/Bangkok posix/Asia/Beirut posix/Asia/Bishkek posix/Asia/Brunei posix/Asia/Calcutta posix/Asia/Choibalsan posix/Asia/Chongqing posix/Asia/Chungking posix/Asia/Colombo posix/Asia/Dacca posix/Asia/Damascus posix/Asia/Dhaka posix/Asia/Dili posix/Asia/Dubai posix/Asia/Dushanbe posix/Asia/Gaza posix/Asia/Harbin posix/Asia/Hebron posix/Asia/Ho_Chi_Minh posix/Asia/Hong_Kong posix/Asia/Hovd posix/Asia/Irkutsk posix/Asia/Istanbul posix/Asia/Jakarta posix/Asia/Jayapura posix/Asia/Jerusalem posix/Asia/Kabul posix/Asia/Kamchatka posix/Asia/Karachi posix/Asia/Kashgar posix/Asia/Kathmandu posix/Asia/Katmandu posix/Asia/Kolkata posix/Asia/Krasnoyarsk posix/Asia/Kuala_Lumpur posix/Asia/Kuching posix/Asia/Kuwait posix/Asia/Macao posix/Asia/Macau posix/Asia/Magadan posix/Asia/Makassar posix/Asia/Manila posix/Asia/Muscat posix/Asia/Nicosia posix/Asia/Novokuznetsk posix/Asia/Novosibirsk posix/Asia/Omsk posix/Asia/Oral posix/Asia/Phnom_Penh posix/Asia/Pontianak posix/Asia/Pyongyang posix/Asia/Qatar posix/Asia/Qyzylorda posix/Asia/Rangoon posix/Asia/Riyadh posix/Asia/Riyadh87 posix/Asia/Riyadh88 posix/Asia/Riyadh89 posix/Asia/Saigon posix/Asia/Sakhalin posix/Asia/Samarkand posix/Asia/Seoul posix/Asia/Shanghai posix/Asia/Singapore posix/Asia/Taipei posix/Asia/Tashkent posix/Asia/Tbilisi posix/Asia/Tehran posix/Asia/Tel_Aviv posix/Asia/Thimbu posix/Asia/Thimphu posix/Asia/Tokyo posix/Asia/Ujung_Pandang posix/Asia/Ulaanbaatar posix/Asia/Ulan_Bator posix/Asia/Urumqi posix/Asia/Vientiane posix/Asia/Vladivostok posix/Asia/Yakutsk posix/Asia/Yekaterinburg posix/Asia/Yerevan posix/Atlantic/ posix/Atlantic/Azores posix/Atlantic/Bermuda posix/Atlantic/Canary posix/Atlantic/Cape_Verde posix/Atlantic/Faeroe posix/Atlantic/Faroe posix/Atlantic/Jan_Mayen posix/Atlantic/Madeira posix/Atlantic/Reykjavik posix/Atlantic/South_Georgia posix/Atlantic/St_Helena posix/Atlantic/Stanley posix/Australia/ posix/Australia/ACT posix/Australia/Adelaide posix/Australia/Brisbane posix/Australia/Broken_Hill posix/Australia/Canberra posix/Australia/Currie posix/Australia/Darwin posix/Australia/Eucla posix/Australia/Hobart posix/Australia/LHI posix/Australia/Lindeman posix/Australia/Lord_Howe posix/Australia/Melbourne posix/Australia/NSW posix/Australia/North posix/Australia/Perth posix/Australia/Queensland posix/Australia/South posix/Australia/Sydney posix/Australia/Tasmania posix/Australia/Victoria posix/Australia/West posix/Australia/Yancowinna posix/Brazil/ posix/Brazil/Acre posix/Brazil/DeNoronha posix/Brazil/East posix/Brazil/West posix/CET posix/CST6CDT posix/Canada/ posix/Canada/Atlantic posix/Canada/Central posix/Canada/East-Saskatchewan posix/Canada/Eastern posix/Canada/Mountain posix/Canada/Newfoundland posix/Canada/Pacific posix/Canada/Saskatchewan posix/Canada/Yukon posix/Chile/ posix/Chile/Continental posix/Chile/EasterIsland posix/Cuba posix/EET posix/EST posix/EST5EDT posix/Egypt posix/Eire posix/Etc/ posix/Etc/GMT posix/Etc/GMT+0 posix/Etc/GMT+1 posix/Etc/GMT+10 posix/Etc/GMT+11 posix/Etc/GMT+12 posix/Etc/GMT+2 posix/Etc/GMT+3 posix/Etc/GMT+4 posix/Etc/GMT+5 posix/Etc/GMT+6 posix/Etc/GMT+7 posix/Etc/GMT+8 posix/Etc/GMT+9 posix/Etc/GMT-0 posix/Etc/GMT-1 posix/Etc/GMT-10 posix/Etc/GMT-11 posix/Etc/GMT-12 posix/Etc/GMT-13 posix/Etc/GMT-14 posix/Etc/GMT-2 posix/Etc/GMT-3 posix/Etc/GMT-4 posix/Etc/GMT-5 posix/Etc/GMT-6 posix/Etc/GMT-7 posix/Etc/GMT-8 posix/Etc/GMT-9 posix/Etc/GMT0 posix/Etc/Greenwich posix/Etc/UCT posix/Etc/UTC posix/Etc/Universal posix/Etc/Zulu posix/Europe/ posix/Europe/Amsterdam posix/Europe/Andorra posix/Europe/Athens posix/Europe/Belfast posix/Europe/Belgrade posix/Europe/Berlin posix/Europe/Bratislava posix/Europe/Brussels posix/Europe/Bucharest posix/Europe/Budapest posix/Europe/Chisinau posix/Europe/Copenhagen posix/Europe/Dublin posix/Europe/Gibraltar posix/Europe/Guernsey posix/Europe/Helsinki posix/Europe/Isle_of_Man posix/Europe/Istanbul posix/Europe/Jersey posix/Europe/Kaliningrad posix/Europe/Kiev posix/Europe/Lisbon posix/Europe/Ljubljana posix/Europe/London posix/Europe/Luxembourg posix/Europe/Madrid posix/Europe/Malta posix/Europe/Mariehamn posix/Europe/Minsk posix/Europe/Monaco posix/Europe/Moscow posix/Europe/Nicosia posix/Europe/Oslo posix/Europe/Paris posix/Europe/Podgorica posix/Europe/Prague posix/Europe/Riga posix/Europe/Rome posix/Europe/Samara posix/Europe/San_Marino posix/Europe/Sarajevo posix/Europe/Simferopol posix/Europe/Skopje posix/Europe/Sofia posix/Europe/Stockholm posix/Europe/Tallinn posix/Europe/Tirane posix/Europe/Tiraspol posix/Europe/Uzhgorod posix/Europe/Vaduz posix/Europe/Vatican posix/Europe/Vienna posix/Europe/Vilnius posix/Europe/Volgograd posix/Europe/Warsaw posix/Europe/Zagreb posix/Europe/Zaporozhye posix/Europe/Zurich posix/Factory posix/GB posix/GB-Eire posix/GMT posix/GMT+0 posix/GMT-0 posix/GMT0 posix/Greenwich posix/HST posix/Hongkong posix/Iceland posix/Indian/ posix/Indian/Antananarivo posix/Indian/Chagos posix/Indian/Christmas posix/Indian/Cocos posix/Indian/Comoro posix/Indian/Kerguelen posix/Indian/Mahe posix/Indian/Maldives posix/Indian/Mauritius posix/Indian/Mayotte posix/Indian/Reunion posix/Iran posix/Israel posix/Jamaica posix/Japan posix/Kwajalein posix/Libya posix/MET posix/MST posix/MST7MDT posix/Mexico/ posix/Mexico/BajaNorte posix/Mexico/BajaSur posix/Mexico/General posix/Mideast/ posix/Mideast/Riyadh87 posix/Mideast/Riyadh88 posix/Mideast/Riyadh89 posix/NZ posix/NZ-CHAT posix/Navajo posix/PRC posix/PST8PDT posix/Pacific/ posix/Pacific/Apia posix/Pacific/Auckland posix/Pacific/Chatham posix/Pacific/Chuuk posix/Pacific/Easter posix/Pacific/Efate posix/Pacific/Enderbury posix/Pacific/Fakaofo posix/Pacific/Fiji posix/Pacific/Funafuti posix/Pacific/Galapagos posix/Pacific/Gambier posix/Pacific/Guadalcanal posix/Pacific/Guam posix/Pacific/Honolulu posix/Pacific/Johnston posix/Pacific/Kiritimati posix/Pacific/Kosrae posix/Pacific/Kwajalein posix/Pacific/Majuro posix/Pacific/Marquesas posix/Pacific/Midway posix/Pacific/Nauru posix/Pacific/Niue posix/Pacific/Norfolk posix/Pacific/Noumea posix/Pacific/Pago_Pago posix/Pacific/Palau posix/Pacific/Pitcairn posix/Pacific/Pohnpei posix/Pacific/Ponape posix/Pacific/Port_Moresby posix/Pacific/Rarotonga posix/Pacific/Saipan posix/Pacific/Samoa posix/Pacific/Tahiti posix/Pacific/Tarawa posix/Pacific/Tongatapu posix/Pacific/Truk posix/Pacific/Wake posix/Pacific/Wallis posix/Pacific/Yap posix/Poland posix/Portugal posix/ROC posix/ROK posix/Singapore posix/Turkey posix/UCT posix/US/ posix/US/Alaska posix/US/Aleutian posix/US/Arizona posix/US/Central posix/US/East-Indiana posix/US/Eastern posix/US/Hawaii posix/US/Indiana-Starke posix/US/Michigan posix/US/Mountain posix/US/Pacific posix/US/Pacific-New posix/US/Samoa posix/UTC posix/Universal posix/W-SU posix/WET posix/Zulu posixrules right/ right/Africa/ right/Africa/Abidjan right/Africa/Accra right/Africa/Addis_Ababa right/Africa/Algiers right/Africa/Asmara right/Africa/Asmera right/Africa/Bamako right/Africa/Bangui right/Africa/Banjul right/Africa/Bissau right/Africa/Blantyre right/Africa/Brazzaville right/Africa/Bujumbura right/Africa/Cairo right/Africa/Casablanca right/Africa/Ceuta right/Africa/Conakry right/Africa/Dakar right/Africa/Dar_es_Salaam right/Africa/Djibouti right/Africa/Douala right/Africa/El_Aaiun right/Africa/Freetown right/Africa/Gaborone right/Africa/Harare right/Africa/Johannesburg right/Africa/Juba right/Africa/Kampala right/Africa/Khartoum right/Africa/Kigali right/Africa/Kinshasa right/Africa/Lagos right/Africa/Libreville right/Africa/Lome right/Africa/Luanda right/Africa/Lubumbashi right/Africa/Lusaka right/Africa/Malabo right/Africa/Maputo right/Africa/Maseru right/Africa/Mbabane right/Africa/Mogadishu right/Africa/Monrovia right/Africa/Nairobi right/Africa/Ndjamena right/Africa/Niamey right/Africa/Nouakchott right/Africa/Ouagadougou right/Africa/Porto-Novo right/Africa/Sao_Tome right/Africa/Timbuktu right/Africa/Tripoli right/Africa/Tunis right/Africa/Windhoek right/America/ right/America/Adak right/America/Anchorage right/America/Anguilla right/America/Antigua right/America/Araguaina right/America/Argentina/ right/America/Argentina/Buenos_Aires right/America/Argentina/Catamarca right/America/Argentina/ComodRivadavia right/America/Argentina/Cordoba right/America/Argentina/Jujuy right/America/Argentina/La_Rioja right/America/Argentina/Mendoza right/America/Argentina/Rio_Gallegos right/America/Argentina/Salta right/America/Argentina/San_Juan right/America/Argentina/San_Luis right/America/Argentina/Tucuman right/America/Argentina/Ushuaia right/America/Aruba right/America/Asuncion right/America/Atikokan right/America/Atka right/America/Bahia right/America/Bahia_Banderas right/America/Barbados right/America/Belem right/America/Belize right/America/Blanc-Sablon right/America/Boa_Vista right/America/Bogota right/America/Boise right/America/Buenos_Aires right/America/Cambridge_Bay right/America/Campo_Grande right/America/Cancun right/America/Caracas right/America/Catamarca right/America/Cayenne right/America/Cayman right/America/Chicago right/America/Chihuahua right/America/Coral_Harbour right/America/Cordoba right/America/Costa_Rica right/America/Creston right/America/Cuiaba right/America/Curacao right/America/Danmarkshavn right/America/Dawson right/America/Dawson_Creek right/America/Denver right/America/Detroit right/America/Dominica right/America/Edmonton right/America/Eirunepe right/America/El_Salvador right/America/Ensenada right/America/Fort_Wayne right/America/Fortaleza right/America/Glace_Bay right/America/Godthab right/America/Goose_Bay right/America/Grand_Turk right/America/Grenada right/America/Guadeloupe right/America/Guatemala right/America/Guayaquil right/America/Guyana right/America/Halifax right/America/Havana right/America/Hermosillo right/America/Indiana/ right/America/Indiana/Indianapolis right/America/Indiana/Knox right/America/Indiana/Marengo right/America/Indiana/Petersburg right/America/Indiana/Tell_City right/America/Indiana/Vevay right/America/Indiana/Vincennes right/America/Indiana/Winamac right/America/Indianapolis right/America/Inuvik right/America/Iqaluit right/America/Jamaica right/America/Jujuy right/America/Juneau right/America/Kentucky/ right/America/Kentucky/Louisville right/America/Kentucky/Monticello right/America/Knox_IN right/America/Kralendijk right/America/La_Paz right/America/Lima right/America/Los_Angeles right/America/Louisville right/America/Lower_Princes right/America/Maceio right/America/Managua right/America/Manaus right/America/Marigot right/America/Martinique right/America/Matamoros right/America/Mazatlan right/America/Mendoza right/America/Menominee right/America/Merida right/America/Metlakatla right/America/Mexico_City right/America/Miquelon right/America/Moncton right/America/Monterrey right/America/Montevideo right/America/Montreal right/America/Montserrat right/America/Nassau right/America/New_York right/America/Nipigon right/America/Nome right/America/Noronha right/America/North_Dakota/ right/America/North_Dakota/Beulah right/America/North_Dakota/Center right/America/North_Dakota/New_Salem right/America/Ojinaga right/America/Panama right/America/Pangnirtung right/America/Paramaribo right/America/Phoenix right/America/Port-au-Prince right/America/Port_of_Spain right/America/Porto_Acre right/America/Porto_Velho right/America/Puerto_Rico right/America/Rainy_River right/America/Rankin_Inlet right/America/Recife right/America/Regina right/America/Resolute right/America/Rio_Branco right/America/Rosario right/America/Santa_Isabel right/America/Santarem right/America/Santiago right/America/Santo_Domingo right/America/Sao_Paulo right/America/Scoresbysund right/America/Shiprock right/America/Sitka right/America/St_Barthelemy right/America/St_Johns right/America/St_Kitts right/America/St_Lucia right/America/St_Thomas right/America/St_Vincent right/America/Swift_Current right/America/Tegucigalpa right/America/Thule right/America/Thunder_Bay right/America/Tijuana right/America/Toronto right/America/Tortola right/America/Vancouver right/America/Virgin right/America/Whitehorse right/America/Winnipeg right/America/Yakutat right/America/Yellowknife right/Antarctica/ right/Antarctica/Casey right/Antarctica/Davis right/Antarctica/DumontDUrville right/Antarctica/Macquarie right/Antarctica/Mawson right/Antarctica/McMurdo right/Antarctica/Palmer right/Antarctica/Rothera right/Antarctica/South_Pole right/Antarctica/Syowa right/Antarctica/Vostok right/Arctic/ right/Arctic/Longyearbyen right/Asia/ right/Asia/Aden right/Asia/Almaty right/Asia/Amman right/Asia/Anadyr right/Asia/Aqtau right/Asia/Aqtobe right/Asia/Ashgabat right/Asia/Ashkhabad right/Asia/Baghdad right/Asia/Bahrain right/Asia/Baku right/Asia/Bangkok right/Asia/Beirut right/Asia/Bishkek right/Asia/Brunei right/Asia/Calcutta right/Asia/Choibalsan right/Asia/Chongqing right/Asia/Chungking right/Asia/Colombo right/Asia/Dacca right/Asia/Damascus right/Asia/Dhaka right/Asia/Dili right/Asia/Dubai right/Asia/Dushanbe right/Asia/Gaza right/Asia/Harbin right/Asia/Hebron right/Asia/Ho_Chi_Minh right/Asia/Hong_Kong right/Asia/Hovd right/Asia/Irkutsk right/Asia/Istanbul right/Asia/Jakarta right/Asia/Jayapura right/Asia/Jerusalem right/Asia/Kabul right/Asia/Kamchatka right/Asia/Karachi right/Asia/Kashgar right/Asia/Kathmandu right/Asia/Katmandu right/Asia/Kolkata right/Asia/Krasnoyarsk right/Asia/Kuala_Lumpur right/Asia/Kuching right/Asia/Kuwait right/Asia/Macao right/Asia/Macau right/Asia/Magadan right/Asia/Makassar right/Asia/Manila right/Asia/Muscat right/Asia/Nicosia right/Asia/Novokuznetsk right/Asia/Novosibirsk right/Asia/Omsk right/Asia/Oral right/Asia/Phnom_Penh right/Asia/Pontianak right/Asia/Pyongyang right/Asia/Qatar right/Asia/Qyzylorda right/Asia/Rangoon right/Asia/Riyadh right/Asia/Riyadh87 right/Asia/Riyadh88 right/Asia/Riyadh89 right/Asia/Saigon right/Asia/Sakhalin right/Asia/Samarkand right/Asia/Seoul right/Asia/Shanghai right/Asia/Singapore right/Asia/Taipei right/Asia/Tashkent right/Asia/Tbilisi right/Asia/Tehran right/Asia/Tel_Aviv right/Asia/Thimbu right/Asia/Thimphu right/Asia/Tokyo right/Asia/Ujung_Pandang right/Asia/Ulaanbaatar right/Asia/Ulan_Bator right/Asia/Urumqi right/Asia/Vientiane right/Asia/Vladivostok right/Asia/Yakutsk right/Asia/Yekaterinburg right/Asia/Yerevan right/Atlantic/ right/Atlantic/Azores right/Atlantic/Bermuda right/Atlantic/Canary right/Atlantic/Cape_Verde right/Atlantic/Faeroe right/Atlantic/Faroe right/Atlantic/Jan_Mayen right/Atlantic/Madeira right/Atlantic/Reykjavik right/Atlantic/South_Georgia right/Atlantic/St_Helena right/Atlantic/Stanley right/Australia/ right/Australia/ACT right/Australia/Adelaide right/Australia/Brisbane right/Australia/Broken_Hill right/Australia/Canberra right/Australia/Currie right/Australia/Darwin right/Australia/Eucla right/Australia/Hobart right/Australia/LHI right/Australia/Lindeman right/Australia/Lord_Howe right/Australia/Melbourne right/Australia/NSW right/Australia/North right/Australia/Perth right/Australia/Queensland right/Australia/South right/Australia/Sydney right/Australia/Tasmania right/Australia/Victoria right/Australia/West right/Australia/Yancowinna right/Brazil/ right/Brazil/Acre right/Brazil/DeNoronha right/Brazil/East right/Brazil/West right/CET right/CST6CDT right/Canada/ right/Canada/Atlantic right/Canada/Central right/Canada/East-Saskatchewan right/Canada/Eastern right/Canada/Mountain right/Canada/Newfoundland right/Canada/Pacific right/Canada/Saskatchewan right/Canada/Yukon right/Chile/ right/Chile/Continental right/Chile/EasterIsland right/Cuba right/EET right/EST right/EST5EDT right/Egypt right/Eire right/Etc/ right/Etc/GMT right/Etc/GMT+0 right/Etc/GMT+1 right/Etc/GMT+10 right/Etc/GMT+11 right/Etc/GMT+12 right/Etc/GMT+2 right/Etc/GMT+3 right/Etc/GMT+4 right/Etc/GMT+5 right/Etc/GMT+6 right/Etc/GMT+7 right/Etc/GMT+8 right/Etc/GMT+9 right/Etc/GMT-0 right/Etc/GMT-1 right/Etc/GMT-10 right/Etc/GMT-11 right/Etc/GMT-12 right/Etc/GMT-13 right/Etc/GMT-14 right/Etc/GMT-2 right/Etc/GMT-3 right/Etc/GMT-4 right/Etc/GMT-5 right/Etc/GMT-6 right/Etc/GMT-7 right/Etc/GMT-8 right/Etc/GMT-9 right/Etc/GMT0 right/Etc/Greenwich right/Etc/UCT right/Etc/UTC right/Etc/Universal right/Etc/Zulu right/Europe/ right/Europe/Amsterdam right/Europe/Andorra right/Europe/Athens right/Europe/Belfast right/Europe/Belgrade right/Europe/Berlin right/Europe/Bratislava right/Europe/Brussels right/Europe/Bucharest right/Europe/Budapest right/Europe/Chisinau right/Europe/Copenhagen right/Europe/Dublin right/Europe/Gibraltar right/Europe/Guernsey right/Europe/Helsinki right/Europe/Isle_of_Man right/Europe/Istanbul right/Europe/Jersey right/Europe/Kaliningrad right/Europe/Kiev right/Europe/Lisbon right/Europe/Ljubljana right/Europe/London right/Europe/Luxembourg right/Europe/Madrid right/Europe/Malta right/Europe/Mariehamn right/Europe/Minsk right/Europe/Monaco right/Europe/Moscow right/Europe/Nicosia right/Europe/Oslo right/Europe/Paris right/Europe/Podgorica right/Europe/Prague right/Europe/Riga right/Europe/Rome right/Europe/Samara right/Europe/San_Marino right/Europe/Sarajevo right/Europe/Simferopol right/Europe/Skopje right/Europe/Sofia right/Europe/Stockholm right/Europe/Tallinn right/Europe/Tirane right/Europe/Tiraspol right/Europe/Uzhgorod right/Europe/Vaduz right/Europe/Vatican right/Europe/Vienna right/Europe/Vilnius right/Europe/Volgograd right/Europe/Warsaw right/Europe/Zagreb right/Europe/Zaporozhye right/Europe/Zurich right/Factory right/GB right/GB-Eire right/GMT right/GMT+0 right/GMT-0 right/GMT0 right/Greenwich right/HST right/Hongkong right/Iceland right/Indian/ right/Indian/Antananarivo right/Indian/Chagos right/Indian/Christmas right/Indian/Cocos right/Indian/Comoro right/Indian/Kerguelen right/Indian/Mahe right/Indian/Mald . .. pppfirmware]group protocols1d?passwdtmpspwd.db services1asswd.origpwd.db fstab resolv.conf( hosts ... . .. binmdecsbinԣshare . .. ftpgrepfgrepegrepgzipgunzipgzcatlessmore\sed ... .C.. .C .. bsd base53.tgz comp53.tgz etc53.tgz1 man53.tgz1 game53.tgzip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _btd:*:94: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: _iscsid:*:102: dialer:*:117: nogroup:*:32766: nobody:*:32767: root:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs r -p /mnt/home/$user (cd /mnt/etc/skel; cp -pR . /mnt/home/$user) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 /mnt/home/$user /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | /mnt/bin/ed /mnt/etc/group 2>/dev/null fi if [[ -n "$_rootpass" ]]; then _encr=$(/mnt/usr/bin/encrypt -b 8 -- "$_rootpass") echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd if grep -qs '^rtsol' /mnt/etc/hostname.*; then sed -e "/^#\(net\.inet6\.ip6\.accept_rtadv\)/s//\1/" \ -e "/^#\(net\.inet6\.icmp6\.rediraccept\)/s//\1/" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi finish_up d5b5e814fa1c186fc97f1d95caf0985bd27acd78be93d41d0a2266ff8ec2a8fd c38f4deb82ad78108e70358eede34c192898999b5628e9f3484a8011a5dfa4e8 bin*Binaries Commands and Source//sbin/nologin1bin 08`swAQ<  swAQM`[~ [~swAQ`@@<@TU wAQwHbwAQww?AtwAQ`\twwAQ\}wwAQ\}dAtwAQp twAQp twAQp  9AtwAQI=twAQtwAQUn ,AtwAQI=vwAQTvwAQT w.AtwAQI=twAQI=twAQ <AtwAQtwAQtwAQ %^AtwAQwAQ=$'wAQ=$'v*wwAQs pwwAQ!wwAQ!\o)wwAQVwwwAQVwwwAQVwu;wwAQd wwAQW wwAQW `hpxPR AwwAQd wwAQW wwAQW PwwAQd wwAQW wwAQW !awwAQWwwAQĔwwAQĔ3wwAQ@wwAQ@wwAQ@/tmp/fstab.shadow_wwAQ;wwwAQ;wwwAQ;w/tmp/resolv.conf.shadow wwAQ\}wwAQ\}wwAQ\}/tmp/hostsMAwAQwAQ@cwAQ@c9bT.AwAQnMwAQwAQ iAwAQwAQjwAQjK `AwAQƷwAQH#wAQH#LwGAwAQC$%wAQ5H wAQ5H Mq”AwAQ=$'wAQ @+wAQ @+N1Z׃ U*J;uz%PP:^O\kL9 $>U?x(UmV=uA!$ -)YGGC3R) _,Ww6;k``}UZ#E(W:y7;i?DH&"EM1 C=KfzPLY [ʔcǃ7]σJc$ XRMK )ՌM<`M~#qѾejb\-ȴt/I%/Hy=6!ޡ|`0?;`5ROEa.I}h{C04ad(f'0#)Vmԛ_hk"[Q[#5Z G}ת9okN;q~UOP5E6p"5 C:q:u&Kʑ6u*8zcIOc8vZtrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3]Xdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody vm,'> >operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootQLbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpTFTuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpn`n_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3MPBPnobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binrrootdaemonCharlie &/root/bin/kshn2rootdaemonCharlie &/root/bin/kshn3]Xdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody ul+&~==operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootQLbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpTFTuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpn`n_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3MPBPnobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}#!/bin/ksh MODE=install . install.sub DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) _fsent= rm -f /tmp/fstab.shadow /tmp/fstab /tmp/fstab.* ask_yn "Use DUIDs rather than device names in fstab?" yes [[ $resp == y ]] && FSTABFLAG=-F while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK AUTOROOT=n md_prep_disklabel $DISK || { DISK= ; continue ; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || \ { DISK= ; echo "'/' must be configured!" ; continue ; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == none ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || \ { _rest=$DISK ; DISK= ; break ; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent="$_fsent $_mp!$_pp" done >/tmp/fstab munge_fstab mount_fs "-o async" install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF $(tar cvf /dev/null [A-Za-y]*) >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(ftp_time) && _now=$(date +%s) && \ (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(ftp_time)")'?" yes if [[ $resp == y ]]; then date $(date -r "$(ftp_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $SERVERLISTALL ]]; then _i= [[ -n $installedfrom ]] && _i="install=$installedfrom" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $method ]] && _i="$_i&method=$method" [[ -n $_i ]] && ftp -Vao - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed -e "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed)/" \ /mnt/etc/ttys >/tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; [[ -f dhclient.leases ]] && mv dhclient.leases /mnt/var/db/. ) hostname >/tmp/myname if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f ; rm /tmp/$_f ; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) (dmesg; cat $SERVERLISTALL; sysctl; route -n show; df; ifconfig -A; hostname) >/mnt/dev/arandom 2>&1 echo -n "done.\nGenerating initial host.random file..." /mnt/bin/dd if=/mnt/dev/arandom of=/mnt/var/db/host.random \ bs=65536 count=1 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 echo "done." apply if [[ -n $user ]]; then _encr="*" [[ -n "$userpass" ]] && _encr=$(/mnt/usr/bin/encrypt -b 8 -- "$userpass") uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:/home/${user}:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group echo ${user} > /mnt/root/.forward mkdi . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts" ;; default) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done fi } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local _n _oifs=$IFS IFS="," bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -ne "$1") IFS=$_oifs } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { ifconfig "$@" 2>/dev/null \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' \ | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts (($# == 0)) && { echo "No filesystems found on $_dev." ; return 1 ; } if isin "c" $_parts; then resp=c elif (($# == 1)); then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | grep "^ [a-p]: " | egrep -v "swap|unused" | sed '\''s/^ \(.\): .*/\1/'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { set -o noglob stty -echo read -r resp?"$1 " stty echo set +o noglob echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $cppid 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap _ask() { local _q=$1 _def=$2 _int _redo=0 _pid trap "_int=1" INT trap "_redo=1" TERM lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" read resp lock; rm /tmp/update; unlock if (( _redo )); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap (( _int )) && kill -INT $$ : ${resp:=$_def} return $_redo } ask() { while ! _ask "$1" "$2"; do done } askpassword() { local _oifs=$IFS IFS= while :; do askpass "Password for $1 account? (will not echo)" _password=$resp askpass "Password for $1 account? (again)" [[ "$resp" == "$_password" ]] && break echo "Passwords do not match, try again." done IFS=$_oifs } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return ;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue ;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) (( ${#resp} <= 31 )) && break ;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full user name for $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed." ;; *) (( ${#resp} <= 100 )) && break echo "Too long." ;; esac done username=$resp askpassword $user userpass=$_password if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (( $# < 1 )) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." echo -n "Which one $_query? (or 'done') " [[ -n $_dyndef ]] && echo -n "[$_dyndef] " _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b (($# > 0)) || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [ "$_l" ] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi [[ -z $(cd /dev && sh MAKEDEV "$_dev" 2>&1) ]] } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2 ;; done) break 2 ;; -*) _action=rmel ;; *) _action=addel ;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(vlan$_vl: flags=0<>*) ]] && break ((_vl++)) done _vd= ifconfig lo0 inet 127.0.0.1/8 while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (ifconfig netboot 2>/dev/null | sed -n '\''1s/:.*//p'\''; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan[0-9]* ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | \ sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | \ sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while ((++_vi < 4096)); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan[0-9]* ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan[0-9]* ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if (( _vi < 1 || _vi > 4095 )) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || \ echo "up" >>/tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && ((_vl++)) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && \ ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn ((nifs++)) : ${_first:=$_ifs} _p=done fi done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down -group dhcp 2>/dev/null rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' > $WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | less -XEN ;; *) _nwid=$resp ;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" ((_haswpa == 1)) && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep -q 'groups:.* dhcp'; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then set -- $(v4_info $_ifs) addhostent "$2" "$_name" echo "dhcp" >>$_hn makedev bpf$(ls /dev | grep -c "^bpf[0-9]") fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up if rtsol -F $_ifs; then set -- $(v6_info $_ifs) addhostent "$2" "$_name" echo "up\nrtsol" >>$_hn fi return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -ne '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $nifs == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _f _gw for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do ((nifs++)) if=${hn#/mnt/etc/hostname.} (ifconfig $if||ifconfig $if create)> /dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1 while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case "$af" in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" makedev bpf$(ls /dev | grep -c "^bpf[0-9]") ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case "$dt" in dest) cmd="$cmd $dtaddr" ;; *) cmd2="$dt $dtaddr" ;; esac case $af in inet) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet alone is invalid" return fi [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a X"$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd=";route -qn add -host $name 127.0.0.1" ;; inet6) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet6 alone is invalid" return fi [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) if [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]]; then isin ${_f%${VERSION}.tgz} xbase xetc xshare xfont xserv && continue fi isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at " echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/' echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col echo return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp [[ $resp = n ]] && return shacmd="cat" [[ -x /bin/sha256 ]] && shacmd="sha256 /tmp/h" for _f in $THESETS ; do isin $_f $_get_sets || continue echo -n "Getting $_f ..." rm -f /tmp/h case $_f in *.tgz) ftp -Vmo - "$_src/$_f" | \ $shacmd | tar zxphf - -C /mnt ;; *) ftp -Vmo - "$_src/$_f" | \ $shacmd > "/mnt/$_f" ;; esac if (($? != 0)); then echo "'$_f' did not install correctly." elif [ -f /tmp/h -a -f "/var/hash/$_f" ]; then if [ "$(/dev/null 2>&1 && \ SM_ARGS="-s /tmp/etc$VERSION.tgz" [[ $_f == xbase$VERSION.tgz ]] && \ ftp -Vmo /mnt/tmp/xetc$VERSION.tgz \ "$_src/xetc$VERSION.tgz" >/dev/null 2>&1 && \ SM_ARGSX="-x /tmp/xetc$VERSION.tgz" done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } startftplist() { (( nifs < 1 )) && return set -m ( ftp -Vao - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$FTPSETDIR" \ 2>/tmp/ftplisterr > $SERVERLISTALL echo -n $SECONDS >$SERVERLISTSEC ) & ftppid=$! set +m (sleep 12; kill -INT -$ftppid >/dev/null 2>&1) & } waitftplist() { wait "$ftppid" 2>/dev/null } ftp_time() { local _ftplist_sec=$(cat $SERVERLISTSEC 2>/dev/null) local _time=$(sed '/^TIME=\([0-9]*\)$/!d;s//\1/;q' $SERVERLISTALL 2>/dev/null) [[ -n $_ftplist_sec && -n $_time ]] && echo $((_time + SECONDS - _ftplist_sec)) } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd _mirror eval local _server_ip=\$_${_url_type}_server_ip \ _server_dir=\$_${_url_type}_server_dir waitftplist ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp if [[ -s $SERVERLISTALL ]]; then _prompt="Server? (hostname, list#, 'done' or '?')" sed -n "s,^${_url_type}://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $SERVERLISTALL > $SERVERLIST set -- $(sed q $SERVERLIST) _server_ip=${1%%/*} else echo "(Was not able to get ftplist from ftp.openbsd.org, but that is OK)" _prompt="Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$_server_ip" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue less -XEN < $SERVERLIST ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -n "${resp}p" $SERVERLIST) (($# < 1)) && { echo "There is no line $resp." ; continue ; } _server_ip=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) _server_ip=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done eval _${_url_type}_server_ip=$_server_ip set -- $(sed "/^$_server_ip/x;\$!d;x" $SERVERLIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (( $# > 1 )); then resp=$resp/$FTPSETDIR _mirror=yes fi ask_until "Server directory?" "${resp:-pub/OpenBSD/$FTPSETDIR}" _server_dir=$resp eval _${_url_type}_server_dir=$_server_dir if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi _url_base=$_url_base$_server_ip/$_server_dir if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp -V "$_url_base/") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -Vo - "$_url_base/index.txt" | \ sed -e 's/^.* //' | sed -e 's/ //') fi install_files "$_url_base" "$_file_list" installedfrom=$_url_type://$_server_ip/$_server_dir if [[ -n $_mirror ]]; then PACKAGE_PATH=$(print -r -- "$installedfrom" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") else PACKAGE_PATH= fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" '$MTDEVS' || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitftplist if [[ -s $SERVERLISTALL ]]; then _tz=$(sed -ne '/^TZ=/s/TZ=//p' <$SERVERLISTALL) [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue ;; "?") grep -v /. $_zonefile | showcols continue ;; esac while isin "$_zonepath/" $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols ;; *) _zonepath=$_zonepath/$resp ;; esac done if isin "$_zonepath" $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue resp=n [[ -z $_q ]] && ask_yn "Are you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d _locs="disk ftp http" echo [[ -s $SERVERLISTALL ]] && \ _d=$(sed -ne '/^method=/s/method=//p' $SERVERLISTALL) ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs" ; : ${_d:=cd} ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" : ${_d:=http} if ! isin "$_d" $_locs; then for a in http ftp cd nfs tape disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -n $method ]] && _d=$method sane_install quiet && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin cd $_locs && install_cdrom && method=cd ;; d*|D*) install_disk && method=disk ;; f*|F*) isin ftp $_locs && install_url ftp && method=ftp ;; h*|H*) isin http $_locs && install_url http && method=http ;; n*|N*) isin nfs $_locs && install_nfs && method=nfs ;; t*|T*) isin tape $_locs && install_tape && method=tape ;; esac done } run_sysmerge() { echo "After rebooting, run sysmerge(8) to update your /etc configuration." #if [[ -n "$SM_ARGS" || -n "$SM_ARGSX" ]]; then #fi } update_firmware() { echo "/usr/sbin/fw_update -v" >> /mnt/etc/rc.firsttime } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed -e 's/ro/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _msg _fail while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) || _fail="$_fail\n$_mp ($_dev)" echo $_msg | sed -e 's/, ctime=[^,)]*//' done 0)) || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $sshd_disableroot == y ]]; then sed -e "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config > /tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $ntpd_server != default ]]; then set -- $ntpd_server sed -e "s/^servers /#&/;/#server /a\\ servers $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf cp /tmp/ntpd.conf /mnt/etc/ntpd.conf fi fi if [[ $x11 == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi if [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]]; then echo "xdm_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && \ echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d _xdmask=y _def ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi def=no [[ -n $DISPLAY ]] && def=yes if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" $def x11=$resp _xdmask=$resp fi if [[ -n $MDXDM && $_xdmask == y ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n ;; *) CSPEED=$resp ;; esac fi fi } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /var/run/dmesg.boot FTPSETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && FTPSETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") nifs=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed) md_consoleinfo THESETS="bsd bsd.rd bsd.mp $MDSETS" : ${DEFAULTSETS:="bsd bsd.rd"} for _set in base etc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="${SANESETS:-bsd} base${VERSION}.tgz etc${VERSION}.tgz" COLUMNS=$(stty -a | sed -n '/columns/{s/^.* \([0-9]*\) columns.*$/\1/;p;}') ((COLUMNS == 0)) && COLUMNS=80 : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR COLUMNS cd / umount -af 1>/dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig (( nifs != 0 )) && startftplist echo while :; do askpassword root _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done questions user_setup set_timezone /var/tzlist echo fi diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;H;d;}' \ -e '/.*# total bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs);; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk";; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b 2f2499a049f34e50b5ad499ade3e735025fba381083be5ecba207373d9a9533f 3b9f58dc84dea4e2bb54f2c593ce4035fb16e5b239c5ca30e3168a0bcee6e710 c7558f84f8f2cfca8971fbe9a6617e27279537aa9ebabc0686d2c81903b0fdec d12d20e3c051f3ba9ca69b28e4384cbff282d31ce102e78ad5478214ce138be3 l%s%r%"BXy%8y%pn?&?l'?F(?%?L%? %?Pj?%?%X@x% ?Ȇ%?%b@% 7@%82@%?%$?%,?%4?%) >)>)=)@>)D\)P))j<>ffs=>ext2fs=cd9660=msdos2lockf@` x1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@1@2@2@2@ 0)8)@)ԝ(;*;*8:*ԝ(*Џ**0****0)8)@)8*x**))P*8*0***P*8*p)8*$*P*$*4*p*8*8*ԝ(8*8*)8*8***8****8)@)*4*4*IJ*ԝ(ԝ(*ԝ(4*ԝ(ر**p)*$*4*,**`*4*4*ԝ(****4***0*. .. +++)@)+++)++"+P&+* +(+*+ + + +P+)+L-+ +*T+@+$++H"+h++5+ +L + +L + + ,@+=+ j$j,j^^3333?8++#$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@B2 T3 T4 T56 T7 Tcde@B@B@KLاO[@T6nQ%l7Jpp@@@@j j j @ j`j ,@, +H,, +,;@ ,,j`jd, j*.@.L..-jCt.....t.jle.....|.h.jP;.6.4.8.j -6.4.8.--j.6.4.8..j).6.4.8.j0-6.4.8.p-0---jP;.6.4.8.=.J@jj+ dXjjjjj<8Q @X,jjjjjjjjjhjjljpjtjxj|jjjjjjjjto(@AAA==(A* dd%(i @@@@@@@@@@jjppjj j4j8j$j$jjjDL@/ĥ/L/̥/ԥ/ܥ/0/ N@///4/N@X/$/L//N@8D/:>:>;>i0Hz04-00c00000)010X0)040ܪ00400h10h00000T000l:0H001)8004100<000008*01*))|08*ܪ0040P*8*p)8*$*P*$*0p08*8*H08*8*)8*8*41*8*X0*000\000 ... ...000)1<}1/1)0 }1{1ȓ1@101dF11pz1000\1Q1}1z1~14111D10}1LX1H)0008*1*))|08*{1ȓ1@1P*8*p)8*$*P*$*0p08*8*z18*8*)8*8*D1*8*X0*1P11111$11 jPjjv@>3*383H13-3-303x20j)X43330jC..`E4.t.0jlĊ.h...h.0j|4$4H44440j:3$4H444(3 330j<|30j+g40j,30j).$444.0j.$4440j|4$444X5 @j0j+@,Q3\P3@ X Xdjjjjjjjjjj0j4jj@ E8(@AAA==(A*djpjtjj|jjjjjjxjjjjhjljjjjjjQ jj  ^>c>c>d>|e>ę@q̙@qЙ@qԙ@qؙ@qܙ@q@q@q@q@q@q@q@q@ēq@ȓq@̓q@Гq@ԓq @ؓq$@Xn5,@Xn54@Xn`5hj<@@5055'؛@0Խ5̽5@x5$5,55P555555555 55555@55555t55555armishX666(6(6ʏ(((((((3((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((77t7777((((( r%q%Tp%ln%l%l%(((((((((((((((((((((((((,7*7)7$!78 7.7(((((|6666X6L6((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((%%%%$%%%(%\)ԝ()D))ԝ(p)(4)@66666((6&(((((((((((((((((((((((ԝ(((((X-(x-(0((-((D0((T/(܀&(((((((((((((((&((((((((&((((((((((((((((g!f!pD!D!c!@X!D!(((((((((((((((((((((((((((77ܷ777(((&(((((((( r%q%$m%l%ln%(((&((((((((&((((((((((((((((A+S+TT+tX+H+(D+(T>+((((((((,7*7$7$7$!7(((&((((((((&|66`6,66(((&(((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((x%z%T{%(y%( {%(y%((((((((((((((((x%%L%%%(((%((((((((((((((((((((((((((((((((((((((((((((((((//((X/(((((((((((((((((((((((((((((((((((t%$t%((>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy(A\78t 8d7$8<8 88 8 8T8 8?`)Ad)Ah)Al)Ap)A.AD r8xm8i8i8L/A/A888$88ؠ&P1A  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  1A 8H8 8ؠ&>1A|2A5A*D9099P96A9AX: <:=:X;:;:LKAKA :5hv1! !vvvvvvv3 P q q2vqqqqCW 2D k"{"{"3" dAdAW 2]\ \ ;  KAKAKALAQLA,LA@LATLAhLALALALALALA> J:46%D54<*'hj=$\-P/j ;,3K2X,,Xpo((x:D1P5 X>h+/[9;2:jj #P05:(#9MW-4g|'rl, (0;:X9 jA,\(z)8B'`+,\ %$4d6j=l"$N`9:(]jiА9Lt .}+@A>x*Dd)8< 3p'`ܛj?< hqoq&k2k;8(H\x=WL:Pd-|v:j5,%$6:\&\<48P" !`,< Z3|4-0*x/@7H'Be#0^ -n98|6L jG+<ؑ)po 7 6` @o) *; K"(K o\ $jb 'Xh (Bs `!)D{ 8 lk 1l ؠ& H6L r( B! Q9t *h <- k 5 l22 BA /P .:@f 6{ j 0' :&` 2l 1 Z-\ |j @)L F*T 58 5* ,@ %pS <4`a Doo # /8 8% p`/P ,<,| 6h ,D d"|   7( j(  $9 ` x>  Pj$ ؗ1 j T!0 0rq D. 05 >& lq6 }-XV d,8Tl l: { H;h 1X / .  to 7 ) 8(4 ̝q  P,$)8 ;.:A4R *^oh(lu"hj 9$o@'`#%@:x2 5  ZoFB 2<7&P@t 8xOj`>l,4XzT>+|I)<! ?5l($$t%8 h*DĢ9غo4*3T"&2|0H&DX'hp}6xq7Tp7j'd=:| >ȀBTq(H<%h08X<_.N((p]:0j/7Xs$-L~p&/'P,kk;8$xt#=(Hj-88*$*6>58tX̆%k4>r(v%h8n5 &P<;(6n&@$32 `j48$30*D:A(HJ\|6,O2(',&`N% B4@7> j3a9GqRT)_̹/<p0(<x7(5%#l'x5; hy1d+4'R<`!4 /$(&,! [o-k48G8c5DSD1$e jy<5(d0:, +@::p@K#P4$',`q*pC9 "pq1`8Apr4MxjcH/uS+d~xU8<('p96) DB599< 8TL8 +j5`Y:,C9TT8f-Hnd&d~7DoԢ-de",1d<'dt#p&X804 \k\2$Q81t8;v+\NB+$Xx&lf9sB}hjA'6Lo!4A>Y"8h5Xp-x(*@$+t;t7%E؝qT5fs+pnRoy%<:@8;,|LjPt29 x7/4 !7H& k//>jN4"a"t 8(8ql##x`9t,o7dp$t0|-T $'L,$;l/KԯoWpSo`'0l kzDJo/@$t' )ojt'H& 8(a1+'L86@TpJ%`Rjdt,(j$jȾ, 'Њ;,/X+7(6@$j f"# h/ :> "+;L",2`"70m"qx u",j":"8 "ؤ2d"0o" :"|'\"X7H""#+#;5#:H#H9X#ܾ+4b#jx#p0#[o#>#Xj#t9d#j#6#%x#H8$#tq#'#p'$8$7@$$(2+$o8$\c:I$9W$/Tg$m=@v$:$`5,$T-$$X@,$9$%$%<%8B %+:%Pj%%7T?%77H%؝'[%kd%(&Hp%&X{%`&%P%D%Ȁ$%B%!%`7%|'%&%d]'%'&' &,*#T &j*&$-5&pT*8B&:,M&5`&,.)pp&[ox&&&0-0&ho&&|6<&c$d&(o(&Ȋ $&8&T%< '$$'p;,8'\}!,J'|~;hd'H+w'#:'ؙ9'!'Z8'oq''('h#D')' .D'\#(O' (6%(0+26(%C(428tc(xqq(5(p(p:(`j(pn` (Xp(q(h3(@7(. )De)5Xu)20)J.8)ȟ&()j),X)#')&6)05).)t/"*0p&*:0*Ȱ6A*h;Q*w6Y*jj* 8}*>8P*T'* %*ض:**.4 *"*p#*DQ+*j+'H+9t#+T(\-+*3;+|=@J+2l_+TT+Lg+du%8q+K(Tz+*) +()+ '+@Jo+\#+#|+(590+^'x+(<3+ o+$p ,=$,/ ,j0,%;,pp"LP,B^,5p,0 y,Q8L,$6, +,j%D,,%6t,/,L,,>8P-"X/-)l7-Xj@-(%lK-n(T-$X!^-`67,k-}1t{-+-\8-: -"-dj-ث$8-k-9`-|o-5 .P>#h.| +.X;:\;. jI.|%&V.<\^.+p.?8$.^3X.$-.2.S..@( .*$0.@o/ %`/<2"/p.21/4)d8/ kB/BE/;\X/48h/d%x/Q#P/"/x!/XL l/%'/0*/k9 /(/ȱj/إ"0!0|q(0(2$<0pM09X0+n0)Pv0=:\0(6T0+00"0 0:`0 !`0:05 1%1*7$1H)(01)t;1d7'hG1('R1`%]1 ni1m>0p1t`&(17111ԛj1+'1"1d+1$)1h;D292H5 2:0.2:dA2px"L M27_25w2)02%2`82'`2L2d2"2̲62+X2T\:82g73+3o3)6(3j@3Py4M3&XV3 =Ha3.Lp3:}363q3pk+l3;h3p:d3$*L3o73A6 4Dj4=+X&4l%94$hH4pS$W41xf4,,88v4Ȕq 4h/4<4S;4j4q+X4H)4 4@2,4lj4G&X5$  5L/ 05܀&=5D&@G5t$R5X=6xc58jn5d2p}5qp5<*54"\5X65,I-5pt% 5pB"5$2<6j#6b<862#K6<g6I*,q616dS!T6q606 /\676q6 3#l6o6\#7,B742*87p!T6740tC7?[7܄9lg7ju7Po 7)7#7D#07d#7P8(7#X7ȣq4707<>:@787+2X8*#8)68Ȭ'L?8BE8X0S8k]807@l8"&,8&8883T8(`,H8Tj8 R;8 2 8xo88x8#9/09909l++9jF9h+'d[9;Dk98<y9j9o9 95 96@989r8@9b54:2 :l*#:T,'1:@!9:*I:)V:=tp:hj|:2<:U<(:Hj:l>$$:P :M3H:;*:T5:8:t7 ;&&0;T$);\<0;(h?;x:@K;s8Y;jg;!1 t;j;j;7;hj; H!;r-0;,);&p;##;) <v:<P 5$<4/3<4 ),:<2Q<l-|]< 5\x<ti=<<D3<$<@7<j<j<2l< j<8*<tG/=`$,=@g9l-=5@=d+xH=l%&T=&\=4o7k=/{=X;=$@=0$ =2=T *L=@j=< k=%>>#>D />:<>%\K>6`Y>d8f>*<s><&~>/@>,8>1>|O8D>#>S3>)>&>%p?;,T?9"?55?$*H?8jU?::\f?,0z?,?(+8?j?`# ?O<4?(3?p8?5?&%@(0  @|5P@'%@{=@8@5:C@> P@ )dX@ :,f@%tx@3`@?$0@<:t@ Z9@j@X{1@ГB@Xd9@9@j A0HA)#A4",0A,5%CA800MA*aAh><uA(8hA: A]>A)lAt-AN#0A|6A4(8A,B*TB4! Bq$B-1B*t9B;\QBo9_B'nB"}BH44B4%:8Bĩ6B>B[/PB8hBg)Bx$BܝqB1Cp"C/80Co;C%$lEC/B(OCBYC a9nCؖ1Co/4C 'C5XC Cz8C(+ C'&,CjDl"D?3d"D)2D|2$AD1hKD@#YD%eDPozDhK)( D+ DN(DĀBD60Dt-$D9DDL-Dd#$E0(E~8PE$4 )EB5h1E!FEjQE34cE)kE7({E,,E+PE$*dE|O+`E$&<ET%$EX9<E8EjEoFX'Fb*8"FlK%0)F8"=F=dOF5aFH7) lF{-ttFx+P~F)%<F<7Fu)xF,)F`$$Fl!2F )F4"`Ga pG {G=GȲ"G5GL2pG/ GDoG&xGp},,G'" H$: H*9l1H|7lTI jI0Iq!I(jI2Jм%&J=A+J k4JI$$DJ0y=pUJjZJC6(fJF$hzJjJlA= J,Q;J5J R $Kp5K0"(CKԾ9LKW"\aKjhKt7wK8pK<)4 Ks-K>jK'Kc"lKjK|-XL1(%LD-2L(8LT*EL@jULdj\LjkLjvL LjLH/L 'pL-/XL+8 L|#MH:MT9$M0g26MȚ;HML7DUM/`MR!lM j{M`%$M0!MtL8M.74Mt@*M9M&\MxA,M\"hN:pN`%8"N.,N0j4NL#DBNL>xNN%4aNĴ6kN+H{NLjND'N9NjN;N(&8@NjHN\]*|N&NkNlw:(Nİj O~%O@k 'O$)|2O,E!H=O\jFO\> XOq`cOl5HxO0OhZ!LOnOc*8O S(jS(5S20S;(lSX'S(S`_&ST9d T!d!TT<.T,LET$PT>gT\}8pqTP)pzToT#tT:hTd8T`(T%0TjT#T`6T%T;DU$XU$(*Uo0Uj$FU+\\UXjhU(sUx )xU8t-UX" UP%U(r+UoU8:xUrq U$<U= V7V6+V8o9VL2`KV)ZVԌ)xeV}*oV |%V>$VM'\VZ$Vl\$B1L\$<+\p)9\4P;G\):Q\xSo^\~!Dp\.4p~\|j\lT%\ )\@+\a'\B\4/4\ j\~6L\4]04X ]H6l]Po%]1>]-6 L])\]`; i]<' {]D>>])<]n9]W4] T]ܖ>]9]!L]j^0x^di-`#^q<`:^l8DE^jS^ly* ]^Пjd^%$t^l!^9^S3^o3^2^|=^'\^T4'd^& _};h_r$4_/E_)Xa_L'l_ jt_d6_+_H%`_$7_q_|p/L_&x_,2_(p_'`), ` `\6h.`\2B`P.R`9de`47l{`<9`D k``+`j`0%|`1H`8,`o($`)9l`c 9TJc,+DXc|)<uc#0cXqc%tcؼ#c:(c\7)c!$c5+cq9d<5d!`/d0V&Dd@$\d67(fdc-zdt(dP&Tdod@%d\;;d:d (dH(`d0tdx"e@X!< eu:e@69T.e0?e6.Je1dXe >#0me!e4k4e1eje5e\7e#ez(@e42de@$|e<45f8u>(fof|7&.fh/x=f.8Nf:,Yfjgf ,rfrqf(+f@'tf50fD `fPpqf0"@f 5 f(xg6* gt;$gj+gv46gPK.lDgXp*LMgԕ?Hag>HygT*g4%xg#g+xghl&g$t g9hg`^/gP1h5h&h1'h|j(Chh5<Sh-(ah0!|thd&`h $@h0# hdm=hT:hs6h|9!hj h8&Hh|9h&8ix#D"ip:x-i)D=i`v%tLiB>WiHB*bioxpi,G'xi)i(i/iЏ*$i$$iP: i8$i\*@i> i - ikj,* jj jp-t7jd1KjBXjpY3ejHJoljj$|jH,pjjj"@j&'ju%8j9j7Hj7jqj84 k',kk+l,kj2m@, m`-Lm@'mjn <nj%n(-@:n+LHnxjYn2,dn;Lyn?>n >) nm(tn<."Ln-npR2n`~& n*n<k n 3ob6o$,oԹ+l=o7,ToU<ko&8to2,oJ)ov(Do(ko(o\',o&\o`joT.p p"po(p&.p App,VpXqP_pt*9ljpĦqvp4pT6\p$DwD70wt>wLow9*w *w'`w8owi=Xx"4xi8 xP/`0x,'(Axl!6,Mx3dx*<tx8#x0B@x7 x 8x'xxB%xP24x,x* yTs(tydq*y( 3yTB9t=y|2 IyQ'(Ry+byw(ryj|y$ny6yB}d'TR}$kp^}>0r}X'8}Ll%}tB} 2 }h&-x}k9|}%<};  ~h6~+%~d65~|*A~D$HV~:4a~(:,n~@ju~j~h:`~X3d~**,~?<~DX)h~V#L~"\~4P~hV#d(1x:$'`1x-#DP:|T,%xh%tn x:,I6x@R+t01"8 302~17 +s$\+H#l= H[&lXtE+ axor k28y% X"$|oqĀt18р6ހ\m/#8`D*2l%Dj 6P;,Ih5Y 5d$%Duy%Xq4Ċ5-;lȁ9dف o+L,ıj : $|*X61%d?5CH%8T .tcd2q#`~V:\8H2|lB6d4T͂p/݂o [oh~- 't;@%_;l7> J<Zx<r9}H7T/1pTȦqj$o&ƒDy$L΃4)'d܃0*0&Lr0@)l}Lo%T LP;6`ɇ:h؇c7(BP:`j 4X(T"%ܷ# >BJ8:3`Who o -HTj8 Tjf%<Xm%Ljhq݈S+ذjl%4L2l "@,o#c;/:<2LQ2<hot*HT*$d LX1|)xʼnX"ى5P2hxjl; t<9$x-08|:|jK(9-dhd%x}qp 'p\(8<H9DʊXo׊l)8(*8L*#`"|%#: ./<h&) D|#tX37pnj z9H9.j%,'@͋;H6<jĊ.$ E)>>@B$,V.4t+<P)tH9 W8D+laBmj(Ȫ1& |jlj#*(O;ЌLe98ٌ0*00 *T(o 5"01@?x.dJ8&X8nb!trT*8|T~8442XP0H!(09xˍDoԍ>T+6DR/ c-,q̽jtjh# `dkh8,̐'&ؐ0%8=@pnl]#8#j5)=|;,Q,2_t*xw&4h'4 8sq05̑jڑ\:2ho!4 Do 0($)@.58/ FoP$z4[̼*fonT04w!)8~:(t"#/l3;-tג$4x$6 tJo;%A(X5B?- Ld7)H_h(dn%& z;7D5595 3͓0דX4<&2<Pjp=$L&>H86C,[3pPH+L[(j`x6 j(3<u/HY8 k(J,0 k$oŔ@{8ӔT1<$x)Hq2X1A>:d[+G_8\p"*d1s7'&.)TP$@pXHA8ȕ Εj>d-H1*@% *AP /J74VLJo^*9xh&}!@%$ P&,/*Xs%Ė?>Ζ8 ז,;x8*0p&@&<@;*L`q4lVrq^46Dl'0vTZ/DXB#k48'l˗y;dܗ 9J8844@c1$D'8: }10Hv-@d5<> 2GjN"eo\np7P }-L<6L) "+ɛ&8כ\5DG,(!:( q056D?<5Rpr/bj{2pqP&pG#X[8ʜx28o6(6,2D$*1T|)8,> EkLD\)Y1|e%xmg*<vu8P1ljq! 55o?,Hj[ /,o2:x̫7L'<o*,N%Tp6"̞Pc*מ|j%:A74:4 H90R84$p5'$<%`CL8|Qqat4lm$#jH130HkO\1|_&8hx#@8t5*0/`$ʡ>ԡ$qݡ,D 7-D p8d5/<<˪ (x٪tE#@j`$6 0<+@*d40HBh/V"iP(lw8Nop6X5,rq&'h=ɫ1'٫%!4Q3x(dLj$"i),&5@%?n!Tw2]P8jP6{0d* t2:>$@3Di+4ά> (8q 50l4*8#)D%|i;424C1NLi1\R+Pi'4oP1~/%<%h\B8@(\6$ȭR ׭y(&8PD98R*D`,L!j /+>,hTU;b|kj؇0<uH *Tw+Pq Ц)(0;0|7î26`ѮD/`ۮ=(D|~0! (U0 M*\"4;,/k >88K <5XX/ i%{0*\:6\*T+3 ɯXoԯt(pBB0*%:+#; k,HYpi)$cjs$3+@ooY<@8ܥ/˰9ְhi6,P*T`#,"'% 6: Dv(LVp_*8e7~2<ȓ1L+HLf)9б&3ݱP<4q7h)<!,;4.39'<?6H|:UHj:iX:*'8(5ojIJ;Ӳ*߲%$@}! \,P)`k1[$HT7)T<0gl6<o%6~'84 p=ɳj6$ѳjl+)8P;X4P"{1P/j7#L8L*V\9:b(\t)%XT<Y8,!{+D=Ǵ|;״1L(`T/8. 4:h5$t727p>81Lܯ.[T 98i7z0@)lH"+4*@'p~%Pε$l+ k6,  (88-(/@(CȰ&M̝(X9eD|=t<~l:0<2(%DoE9̶2l8 TC,%0)pj>L((K'4Y`>p>h{A+*H@T$T,,T6Dh60Ʒj\ҷ-۷q&@$'DX$|d0"d(1,ɸ )Ӹ9;(9u8<к:d5P *@l&%+;)lG7N +\};0p9dz$!xjs*48C%% ƹ> ӹt680j4:t5+d1&:!@K2\"\m7ljjP79,480ʺ|1@ܺ+:`8X 6P%&n1dm+=#G<WPjnoxT1@9L+ )L*\.H,ӻl%:Hp 0P,HV,,5\<C%U+$bjk) r$p~<5j7jͼ@)׼̈" ĩ:j$tF2 DoP~6Lj3+>x_8HJx/ [@$Di.sj#X|=pht<,+h 7P6ǽ|j׽,,2D3ܫ6$@9H 5!I23`+|=%TLK"X@9b.(Xr<' 4ja*((,L:ľ%LԾĄ0+ o"+H $!B@ "58/45H3|>:B`)8[(0lil<D 6(40P%%lÿ6)Pο7d׿5@߿0p/L(*lq6,j#j$/$&>Xy%XRx"hk;8T{,8p 0\j;'$;DL8P5<|9'5<()H-_\s:j: z\f*Ho q>P8-h L:9`h% $0<=$H+5p0/(/@1BEo(Kԛ18m'zܽj 5I)l>> hf2$"(< oPn(x8\otBl(j"T104A:8C8L 2`48nТ0xx=@ 8 j5+h"H08)dH2@1Po)`\)!X:,8T*< W$|='4"%%0:",GT<\P*`gh$4{#h:E<|)Xqq20y,x`"< ̩ dr=0A7BDpUjj,,884t/L}+l'4\*!7,`'`#x 8 2DK XBh7S>li2zjX#0I;-'<t*LP)0"@t!58<6$x"55/F*O,#x`=:pp0}l'`! k`(pX3$0;xpj #  <{/%X%% 2X#T< kE\'tO-p_@,w#(p1<-<q|2 8 9.t`+a&"0.t&x4$`@ #Ul8`e5*l+~XBDr7P,1$2%h9d3h3`6<j( ?*,-Uo4.<D 6dQp_%o<9l},64jj'Tt;(l g8 2p>xA0 9.o6> BD> Nu8[@;,g 5oj<:D(Xotjp8))8T+<(,?DR*<2(D #x6<(qJ]3|X\{2dx%8r#5|~1$B(( .5*&<,h$ lr(X:#tj80X9:pFܛ*xX 5he)oa*8y--, $4#@t,h*&4)<9 \)6(j7",H3h\jfXoxt>j +/+<> !0<"($:8%t22"X@?</s6:0dGt.Rs*8])g5z?> \89|j(%`B8r"4"j> #L8,;A9dLܓqXje'u0Fo~"6Hl(T8$J2 0j$Bx-H$<$ZB+|$x50+#A:N:Zqnj|,]'T<6$$j<(X%pt9Uo\:89.$(!@*~%7D:DK@5adjhpM8 }60 5T$P|j(063)< +DD*@Q'<aBds8<m5j|;&t8\q5<1P.tHv+#`J!);H= 6Fp!X:f3 nD9X}`64k& \$$ !\z!*$`$H8tk0T8! )h,j:jJġ&U<9_f9l3zj`JoXkH̎)DQ8/;] /k- @j*6jDk2<67D:8\0 ;86+@(>$-6D6t%(BkN6`[" pP6dp4,<'x 68:6 `,8Dq& q9\:`Լ+l \i:sq%> 2X$;dR8QX-( Y:g -~Dv!!668̽)@.4 6p\E-n7d ć63!28=*PI-pWl+a!|s74X&0x)L%,j0D:t%8X:5d|o 3@q 08h. *D,R9;.6pHpR'@Tk`@/mg*TwA8 qT&@,0)0n1jj%0ص# :X$)j3D1<EH60O*\Tn;Hk8pwj#*@<p4j9d60Uo9dB8"<&*6$9d^2O4)HX&b5x/)lGL'O\~- n' 8#h1`j(u-2TXh:,1pH0 kO8,8H8f+8Um&fjpvp+,6$<-lH,PP8\5-tD+ `2d0'$x7$2A;p>`#K ; Z`('`p#0HkL7D't&%<"L!\T#p< ; \=)B6@#+T.c"CdqLoZ(;Lq0< #P472(.xB@}682jT'd|!"(+";8A:OLN#e0Yor8l7R'('P-| q3$*8L&H%9D71 2<.5,?,4Lx/YPA>j2<4(34:,48-05h1%(7B 9(+|L88CxN9Q<}1L`&n@%8~O$8<Tl+0jP t!:(3R!;5Dq(/5\6*|Bj 0"h6t $D,*J Yqjh.Xx'̂%$G8Tp7|0410 T$80-pp 5vYo98lK3F.@8*:'pL$l*=B pI/$ j 6( Hc3`q!4#/;@tqV)_'&m\};4j:"(:D'TH+'؉$d$j9 "T$!l/ ;D=(I|}'UD8Pa8(mo7s) kjl#LD8\*@h8p'( o6"Dj(4K LE$5S *h^y) m"{ !:|8sq ox@%hBho L3<1` &* <%55*@B8)Oh> aLjm4:Pz,3<#0 +@`o |=4Z+88qq*&(x (Dh>$)"8(p:@G)SP6`0 lb/~),$&*l:$`2toȼ:`H,^t=+mYoz`;p@o/o"(H1:`55:hX k`$Hr(504E;<:Glh9,Q5]+j(r(>`Y+6+-̄0, 5$`)44u, Y*\ȣ''a155E|&l` %j %Tܷ74(o&jk.qHo> v8hh *< +Dj.B90;Kh 8d[8Tf(9u\0j(L;x930w:<955877 0)8,:5sqE0,Y+h&uj "p"<^!/l%$dB%0" BO(\q%T)42T2@GH= VDpf(,e)d5<-*,|5q6 0'8H1t h-po%7 , 1470;!?D5dL$18b/@o,q|x(T>T50%j:49 ktu)Pt/L 9 t'  Ĺ#T2 o@ D*DI #[ 0e 0r M3x ,o '  ' 78 7 a& dH  k <8` 8 l07 !@? )0F =%X H.0c n&u ԓ;$ )4 j 8 2 >$ 8?.P @ % }8 3 :L 98 j. P%E P'tT BY ;Xk $j{ j %\ P6x 6 - -&P б$l 08 \# t'd @.X  t 4k% j3 2< p'G  &xM 7Hb J%pj |L.| j '0 l" q ̰3H X=+ hj 43 ij, '  ;41 t0? :(H d=;,W -Hi p+x о( )< l$ q2P ̥/ -$ (L%qj$Do`0<}9l8$ :j"̻%3oB #tN+]=:Jԝ(Q-!d [9o ,+:P|7$D/'t$).0p'X>,n=pNi=p^@9 ly7X/8jl "4:E8}1d%46;\&0c%?44Q< )XkbdM.r%#4ܴ8jp6@.\*85$#:h& 0H/)_'`6;M`6`|-Xl#y$:6(o$̨< : **D'$!D Fohu+`/y::4HGІ+XV%^5&s,M #04M#"8%Xol+<9 u*H\$A+`6$to0<IT;|Xb5Te jy qt 2pj$ j(4&$6"XD!D:`o!'+*T6j(M6U/4ct*4n8)%L}u+FodlT-oMoj9H(|t{!кo8p 5$0*'B@j<H,j4Pj@_jj% ~\?!tą2l;h,40oHoL[;<t7<  :$\9%H>P528H=0S,;,^pq9pP*08&p!1@o L(܈0),G%;46&d5/28%9\C?,d[T(e\'2\{H+`o"u8x,,@+|5|9(3L`#l552D6X(tDH=(XK piȭ8Dw-H=(q;hV+j=rqMo:hH2 >9xy8@626!DED N p\S4ppoPx@'8~#jL.l% .T"x#: 4,k4:o k"".?Bl9(L@ X8/l`*<y> T~2,/ 7|xn)(0j`"x<Є01( xr8#@+L(88H2\:,>'@J"<Y%<r<:t~s;t<1@:0P.TO,|9>!t W2 \6 L;,  p7`@ -HK ܠ%V Dj` l5s @9 3( 4/ @j ,", O9d \* Dl&$ ;| L#: !P/!x% !+t,!<$7!6H!/T!>b!Dt!r!+!l!x;!|+:d!H)8!$P!0l4!y%!`;\!P"6!'!@No" *l"!+"#5"K#H"1R"@t&X]"qj" #{"m#`"t%"#"`8" Yo"t*,"x,d"> `#H%,o#H9`~#i6#/,#@ #ls=p#( k#ԝ;#h1#*#(#L#;$4A(`$ls/,$'3$d*,>$8%@J$5W$+b$ jr$@D6$10$1\$S*$'$T9l$2$ &$q$>3$$T5$j %'X%5-%_2?%9J%D37\%(h%g&$pu&$&"&P9&2L&$h&0@8&x,&l(8&#'2#'М?2'N;XE'0N'Du*]'$68l'7'!)'&#'7t'H"'Do=',':0')',?>'DV (C:"(095(X#3 C((jK(#9@^(%\z(&T(:(/T(L)D('D(j(ܦ/T(P((P$' (5)03)/ )4 *x.)2XD)H7xY)'!xk)22D)')$m%4)6,) 5),()@#H)5).T)܃%) 7|)6*1* $l*T1.* f*,<*0:TI*kR* 7a*&Xi*X=*>> *`&D*|7*H/0* "<*!|*ܽ+D*Uo+|!+4!+57+q24A+hjJ+38Z+%i+%y+I*,+$77+T`*+Lb&,+xm8+,+\++@'+!,H98 ,,6,j*,4!?,3"pQ,q7ta, 3|o,$d:z, 6d,"L, 5,3:,?9,j,8,,-,=4, 9`-T(-!+-x~;=-3]-%<m-(:}-L+2-X>-q-o-f%-h60- ,D-H7d.P}3.L% .ܔq'.387.K9E.\-P.%(h^.q%tf.?+p.`oy.`x3.,w*.9(.м>.5.*)./{& C/:,O/`n/d/T5v/\-/*l/|;(/5/g=/03/0*/ 4/x`20T-0@,4/0ؿ:@0X6HM0z1d\0? q0c0D|0H'l0,0lg*D0j0 <:050@D4 0 09001/'1k&,)1;=1BG11$71sq1l/1:192,8$23 2d082oG2T0'8V2!_2jj2Te7D{2؆*D2 #202j2Ժo2H8h21l2P*2t%&2Y2 3]<8%34%2P<3{)xI3%8P3Ts$l\3;p3̧'L{3#o31T3")3{<383'\3Tk3` ) 30g 3p;3@=4,)|4d7+4\'P;4s6D4kN48|Z4ju44'~4 7l4D#4*"41;4(j)48T4 !4L h 5?!5j750J55,[5$ .f5-)0o5(jy5,8,5<1%5P(8 5j5j5%85&$H5-h 6686س366I.xG6jX6"l6jv67h60 666 46J86(6'6#t6V!6 3t6)` 7ln%7#l 7tf;27.F78%X7T"f782|7T'797578|7/7_77,7W#L8-: 8 49 8j)8I)38N;XA8>@Q8X$a8L9dt8d (8287t8s(8=*x8=8X8j8@\-8% 9f!9@j'9:49X2'>9LO |O9 9(W94)c9(o7u98~9`*9 j9;D9$509E*9ļ8d9($l9Ё,X91:8.X:`5 :`:0':H36: :O+h:\0:0k%: x8:5\:Xh8:3:p;z%h;@5';'3; k:;%TI; > U;(:(`;3 n;#'xz;1L;X';9x;h8$;xq;,+;6;=>;18<7<:t#<xZ.1<xo8<%\M<(,T<|,<g<@)|<G"<p<l9)<4B<HN#<;<(60<04<\/<:=,=q0=5D=T5 H=d$4]=#t=X4P}='x=o=;=]9=8`=p[>(=Hp=$=84"=z7>&2&>m/\;>@8XE>'dV>ja><(j>N28{>0p>PQ8T>e2>|, >|$)T>aD+@>4o ?Ȣ9<? *l-?L#8;?HBB?h1lK?'[??*,f?^7u? 1<?5?%?+?:?d3P?Z30?+d?` k?O=@8 7 @5@ V*,@(j&@<32@&$9@ 7<?@U;dU@&7]@pj v@ 4X@qL@(@1,l@e7`@6@J!L@<5@p*D@>8TA2<A()\(AhB2A>$DA():PA0VA XbA03nAk+<A%!A&$At , A >A:A`2pA +A&dA(> AjAxj B9XB|j&B28IBt04YB-8kB.\|B" XBxDL$1D",HDt7(SD<3"fDp(<pDz7DIoDt5D%D@<Dt.D h5D8V-xD%\ED! E)E'0$E$2E̛jJEl+8TZE5nE(|~Eܿ1dE4jE}=En6E!XEg/E,t%DEp- E:F +<%F|qDF0)NF /HVFq<|_Fj7uFpF5\F<>4F&F@!FqF$-F3F2 G420Gq#G|!:GjVG$+dG&|G#G,|G@8dGn&Gp!5Gl&G@6 GnG !0H|u-p H60H|4:HtF!EH[:dOHt%WH"mH: {H`3Hȍ>dH@}60HpHF%HD 7H6tHH2LH$+H I6(I6,)I0:9I,5LI(\oZI Z$HdIda;@nIj{I0<8dI7HID-I܌&I@!I=dI =I|9`Iy;8J\u:<Jp9(J.*.Jx P8J 8NJL $]J<<oJ(<J6JjJa&J1DJ<J,Q3lJ8<JjJ4pK'K"'KpB@K4"$QK;*_K4*DjKdF1 xK +KMB(K1K)HK#@K&8 K-LK,K0'8L&L41 "Lp1L#(?L0'8TTL(0^L&qLp9{Lj L(M| @ NDjNX6,N69Nh^"IN4XVN 8\eNd1pN:~N 2,Nt&& N $N!$PN+xNKoNd&&NLO34N8#0O!hOe9 O!6Od:@O 9KOl/YO,tmO(l{O4R|D2 S@10SIJ*P&So1Sx+8DSF(HVS?)cS5oS1xSc$0S#HS0%S <S0,;S!,S&S5S:&T$dTdJoT /TȐ;CT+QTr%0[TR(gTT{%sTD1Tw&T*$T#pTq4`T|4T98T?8(T4"lToU4' pU2 1Udr;?U0JU. XUhI"8gU!$zU:UI,$UP /Ux(U@+U@<U v%TU_6Ug2PU&%8V4"V00-VJ<=V'(NVG'`WVIo`VP(&pV5VX*LV%<V39V7,V3 VT#V5VėqVxj WHc0W4k$W0-@8W.8CW(@LWc2@ZW(plWXpyWZ;PW6W10Wx:W;W5W3hW܊*<WĀ&X>0X)H#XjT2X$"HXlj7(UX6]XK%gX)(~X\(Xpk XL*X-4X8XpX #LXHa#TX[.# [-< \J9<\r++\$B\,[\B^,a^hJok^h y^4^@)^'^L k^9:T^?%^P5^j^ho_s=L_0=*#_/43_4-0@_$jT_+Dg_7lx_pj|_`j_"l_)|_>_88_j_",_T1H`(``Yo)`#0:`i;K`L'Y`88f`'m` v`H6<`$`n=`d+4X`@%D`> `8`>,,a!8xa,0aĚ9X;a,oHa :6Yat;gapra`+ }ax5a$8>av)a4;a\8da)@adN%a5pat9bH3b$B)dbX\&|'bx%H4b@)Pb$:X[b%cboqbjbjbD b:blX3b?>bpob,\ob F(b?:b%8<b2@ c +"c% .clj8c+Cc@1Xca1(fcDj8ncI%@c:&c4cjc(c6,c>c@-<c,0dpd,&d,L.d2;d$#Jdյ=dd%wd 2@d$!Hd>djdаjda&dBd&d;0e`#*\e'L$e 0'3e\#GeS"[e8+meX%zeD<6hx+|?hX"NhDt9h[h`/4ohp)<hp6$hPjh8B h|;h6h`6hȹ2xh$h e6i-(i8/l-iX"9iK.Fi)Ni$%_i-3 gix6ui0qi\5i4e-i:il:di4ni jojQ,Lj(o&0j4 $0jjjg4 j`5 kx6k)<'k%p.kd;d7kj@k7Okz*|YkH 3hkMo{k qkjk%kqkT$4k(8kD; k&l`-l&,lhjm <mP5nL)8nj*n(n#D0n An=#Tn(jgnp+|xn'njn$%nC#n>, np(xn Hnjn%o,=#o$C*-oЏ<4=o6\GoC$L\o6`mojvo&Ho$88o'$o@:o19o,0od)`ojo8o09 p/pt.D #pj0pr=LAp pGp+PSp7t]p.8,kpm7yp0p&<p pBjpG:p8*p"pp(+,pLn&Hp,;Lq5qB0qj =qܺo$Fq/|Tq@?*LjqȺ(pxq47"q,5q&q-q8`oq#qW qx,<qX9PqxG9Tr% r5 %r71r ,(LrjXr2ir9PsrG9lrH8rsqrP2<ro)|r:>$rjrs&r%0s$5sܤ%,s64sR'8Cs'\ss%esklsg=s 9ps|/s"s(s{7s7)sH%$s"`s)'t t&.tȠ& t (84tx*?tHH/(ItYo\t4'xltl-'|ttqtR6tZ(t't/t:<tد6xt28t5tDou!@uo%up(0u2@uL"|QuP[70^u,Yonu("zu:78u\1u(&<u 2 u?(u": u'yq 0yX5H@y oJy)Ry6ay>py*<}yP 8Dyȗqyl2\y p y5$yH?<yHkyky Dy(% z=ztY(t(z8t2zq;z 'Fz%P^z /Xiz(szL:z%Tz8o9zX#zT)dzLozp/zx/8Hzozp)0{P${L:d{D?>){*'T:{d38F{[7hO{5\{0oc{|5v{54{8-{j {q6{,4,{'d{|"\{-3{8{?+ {){@&$P|8j&|L*41|XJ%?|4qL|xjX|sqe|jr|ء?}|h:T|:P|`+P|Ȫ;|5|H"8h|6l|5 |0<}o}h 2 "}50}V#>}8i)8F} b$0`}6lp}pj}j}j}{9 }`X'(}D9t}*}o}d)}<&T}1"}k} 5 ~q~6+~j 7~<2 E~#Z~Ԧqb~4$$x~d>$~ |~b<~/~> ~5l~!~)j7"$=2,p> q+LN\":[4-8jz-\>%4̶#  2o5X}-P%(s!4;@'?8D<])Ch'dO2lj+r<,d(2l`$h<;(+,D*8lҀ* P:\,  pLj-+/9%J!^M;t286@*85L#΁t kd*,8:\((P +$h*(?`>dL9MP(`& k:'$`&$jl&`(Dʄȸ#,߄2(+H ]*lj480-w4==.FtZ)O̩7t[dI8k̗q|U' hp:L941/XjЅp(ׅ'pЗq|j/ &$x;(% =>+*8>(9dK`-d1)l/yĥ/T9E9,>>?*l!Ά| ߆Dj 0j؛j  6/!'x2p99=O.@N /[/ h (vb;d;X}<,;D`r8ɇjׇ$|;|7T4j&j7,D2PC>Mj\%,vo$00\o?xx540̈W"܈9<5x-/B,(/'=1h#:<Ln7dN̉*<Z6l%PA4X)@"j, |ˉ/ىts6[9pIo45` <99x% !3$(CTjL|(TZ$hl0lx-4% /<ԗqd$3t/4*dʊD,0pBy= (; $,,BE+(T;h,-Lqj+%58+`X#:͋8&(ދ,'hjp P,,|'8)*.#dDl: R6\\jj'xk*HE%*l76`ˌxo،lo&@2a1|@4H&45R*@a: M8_2^l,rB$~9>j(`*Ǎ ͍4,`oe8T8  * (4#)Hy57#D5Sp)f/sUo|5`A>0($`k$+ˎ*LՎ'd|-P"8 pq'o8\'F &Q9\jf8H9lx*@:L9H'( :Џ؝0 ۏ;%PZ<\f',(%t0!@E(8[-f(Tn%,@$)4TЛjǐ-*Ԑd7x:#$/ l<,4&A>0lj5%J)Ss)`4j jjy%0|980H\j<[*ȑPA*ӑDoޑ !\hL2T$-n& 6`!5 *XU'3($;8PPE;]74eljx;|T1n;:d$,Ԓ!,7=.X$:$. B(!A>+~64po?B Ji6<\$*f6v@$L9T8q%lD(D0 DГ ;,ܓX3<Ɩ8`#ؖ@(01)l/x48jE\'$M\*|Y̷%|fd#q  "h,/42lo8z$ǘĺ+՘*6(jH|(E:D6 t5/%?8>G:0VL:Hg1:`~7`6ktj>™,9ϙjx%pA>P k)`!:$q />CxjRIoY+eI;,phj+B<*oA5њ48ߚ1j$8% *x Uoxf%)_9t4 7`@0v8tN2kVov@55`%.L/jśp168Л%ܛ(%9<809( " > $4740 D,r#L X#`i-(@rx> #:4t5(5h5("Ŝ qٜ<5< *'tB'4,,x99A(HD80V7a5i$Yo{ l,jj (!:ѝ98Tq-4\o (#hN,)!6?r1LS:&e r.{:- {76hd*,Þ̢  x*4p)%L&,.8;ؗqO( ]6lh81,u+\& 7`0$#;&\ɟ *xٟ܇+#D"K98p!4 +# 50?<J1<[*d t /8` ?(,_8La*8P!Ġ\8pՠĶ-dw-x%DĶj@+,8f*$#30D )p7'|G<`\kq'8(x&%@>$\1̡:pۡ&oЃ"Hn,Xs(0 +4}%DA4hSR3f2h5$|ph+Pj'd<d:Hģ-)(ͣ#ܣ ",,`P~+4*l x}#0,j3|2B"T8T\8Dg\1s (|7\9(2T`Wo(54Ĥk Ѥ80Xo&E$ h6q# k-tk;4=@2,St/c!pwk`2ԣ%j(jΥHj@٥'\@j4do` $H$j$*35/T/ <l4G,5]h(j$zd#$J.jD-(>36DjLe%\6$jL#1 k $oL;Lª-Ъz<};0DO- *@ ̅*T*ĥ"<ئqD4jLkU8bX& lhR4H1pjE#$ P4*D«,"֫\18-x73PA:H"%'08q?=>Sj_l)ThN2w.`'48k9dM"f7H¬+ά+7٬L +8~-|% :,5`"P8d/^*<6Nq W'p4Ht,H*~<\4 =h'#$8968J:pS14d*Tpox/h'| 7@L5T5'(ԯԵ%߯(!H,p4o18/3h<|-Tph8 kr 5j#ljljͰ'8%@,8<A78|j!/.o7jPB88(Q$_*H nP*|رjT'%=x;HʱjڱX*pЮ%pC1tj kX(%T+ B <k K1t]%n6Tjdohr8j ;8Ӳk)޲'%HP:7D6@4[/x&( 4Ho='I .4c#|̔$07`8@Ȼ1*|7dz78ճԥ/oD68 :X`~7L(2d.+X:L?8THH2$V8)iX2x,p+\$$o K;h-Ӵ,*ܻj$.)Xj0 T3:T@jLT3Lahjll&u4c5$'r$0dB(ƺQ2\պln$%!00 &($\ >$* #(=(Q(H`6pT$Xo` 8"d s|+X5 x&x8) 9 d!B:һ6&Hxo(Xi:/ "8)@-C$$8\\5TF|u;]k;4i%@z,E"L<064p68 ,ƼP&+ּ~%Dj2)6\%<#P+1qC<,S 30i${&xL$l:,96 'ν&0׽1lT:x: L-+|4*(%;h64(8KjS7L\H(f3Do-Mo X="9 {7ž(-: /" XS:-&A>0o>0#M(:8\'`f'!vt,$'$7h 5<0Hʿp,4Hj; > <4685L$@!$74&$( j(j3-($@l_'`N#^x73hn`&d~$>h? l/jy$`9( <#( xi*4*#<6DMn1\^&h#8P" h0Ĝ? m)t-Pd&t))D : 8H &7)_79I*D, M\BZ,8iT00w3y(X(t$\E#860)lBj'  :`9p#h8.:78 q)BX5O,0\x~!tr`98t5)j 9(24p< (D/j D3 P5p*2: kAo"T?$cLo%n);' ;$I2\;kswap_onwi_set_nwkeyucom_unlockpfslowtimonanouptimebuf_rb_bufs_RB_REMOVErandomreadehci_device_ctrl_closeem_set_mac_typeaxe_tickre_disable_hw_imuaddr_bestfit_functionslongjmpwi_usb_rx_list_initsr_crypto_discipline_initkdb_trapvfs_allocate_syncvnodetc_setclockuhci_pci_attacharpresolvechrtoblktblsw_reg_strategysys_minheritieee80211_tree_RB_NFINDputcharural_update_promiscuvmfault_unlockmapschild_returnsmsc_cartlabel_unrefHMAC_SHA1_Updatesmsc_startuvm_map_inituvscom_attachipsec_soft_first_usenkmempagesuhci_device_isoc_donecopyinstraue_miibus_readregieee80211_send_group_msg1sys_getgidieee80211_tkip_micdofilewritevwi_inquire_usbuftdi_matchdumpmagieee80211_derive_ptkttyflushsys_setsockoptcomdefaultrateclock_gettimeieee80211_watchdogwihap_sta_disassocdefrouter_lookupinetswbwi_rate2modtypewi_get_fid_usbwdog_periodcdce_rxeofip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksem_k1_gig_workaround_hvip6_get_prevhdrscheduler_startdb_logpciide_triones_productspmap_alias_bitsuvm_maxkaddrehci_pci_cansphy_cdumass_io_putral_pci_detachicsphy_resetieee80211_getmgmtrlphyattachipmforwardingmainbusprintohci_waitintrumsm_attachsys_closeusbd_do_request_flagsbwi_mac_attachrt2560_set_rxantennartflushclone1in6_purgemkludgeffs_inode_allocdes_encrypt2sys_setsidbwi_rf_calc_nrssi_slope_11gieee80211_encapusbd_intr_transfer__ashldi3artisea_chip_mapvn_statunp_detachsiop_scriptnd6_nud_hintether_ip6multicast_minumodem_breakusbd_submatchtcp_secretrti_find__mainbwi_rf_lo_writeaue_stopufs_quota_deletehardclocksd_vpd_thinenc_xform_aes_ctrieee80211_eapol_timeoutsr_rebuild_threadrt2560_wakeup_expirewi_read_data_iowdc_reset_channelrt2661_get_rssiumodem_set_comm_featurein6_domifdetachieee80211_get_authvtagssiop_pci_attachmtx_enter_trysmsc_sethwcsumwskbd_cndetachdb_get_variablecd9660_vgethotplug_get_eventpcaled_caieee80211_inputcrypto_dispatchsr_discipline_shutdowngeneric_armv4_bs_wm_2if_group_routechangesys_fstatatohci_device_intr_closebrgphy_disable_early_dacurl_csr_read_2dest6_inputgsignalacphy_cart2560_suspendehci_pci_matchipport_firstautoehci_strbwi_mac_set_tpctl_11bgmii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifem_encapunp_internalizetk_rawcc__wdstartscsi_xs_sync_donefc_lfcemptyvfs_export_lookuprt2860_set_ledsif_cloners_countifnetyieldohci_endpdm_freemwsmuxattachuhid_seltrue_filtopsuaddr_free_rbtree_RB_NEXTfilt_seltruesc_print_addrlogcomspeedsmsc_tick_taskvn_writechkin_ifscrubral_pci_caarmv4_tlb_flushIuvm_pmr_freepageqpdevnames_sizemichael_updateumsm_umass_changemodescsi_mode_select_bigroute_dstsingle_thread_clearinit_execuvm_pmr_size_RB_NEXTuvm_addr_alignieee80211_send_4way_msg4wskbd_cdnamecache_rb_cache_RB_FINDsys_getdirentriesbcmpgeneric_bs_r_1ieee80211_node_detachdb_set_breakpointsnd6_dad_startexec_maxhdrszuhci_device_ctrl_doneblf_zerokeydb_force_whitespaceSHA512Initieee80211_ifattachmmmmapieee80211_clean_nodesbwi_memobj_write_2setjmpsd_read_cap_16prefetch_abort_handler_addresswdc_disable_intraes_ctr_reinitbio_inforicohrtc_clock_readrt2560_get_rfpdc203xx_dma_finishpci_subclass_communicationsurlphy_funcsuvm_deviceopsuvm_addr_align_backlogread_filtopsre_ifmedia_stsvndxfer_pooltcp6_mtudisc_callbackcopyoutstratu_capte_l2_s_prot_uieee80211_countrycode2regdomainusb_transfer_completelxtphy_servicepciide_unmapregs_compatuaddr_stack_brk_selectswcr_newsessiontcp_attachla_hold_totalwskbd_cngetcbuf_dirtysoo_writesystempageieee80211_align_mbufm_zeropdc20262_dma_startural_alloc_tx_listnd6_llinfo_timervn_fsizechkunp_gcingreaddoslabelbwi_rf_init_hw_nrssi_tablebdevswumodem_matchbaddynamicportsworkq_initohci_root_ctrl_closeX_db_line_at_pcural_ack_rateuvm_mk_pclusterbswap16domainnameehci_endpduvm_pmr_addr_RB_REMOVElockinitwsmouse_detachttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfiltersorwakeupre_ifmedia_updinflateCopyttyunblocksr_meta_opt_loadbioclosehidms_disableremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetachsys___thrwakeup__divdi3pciaddr_resource_reserve_disabledi80321_io_bs_allocallowpowerdownsys_clock_settimesiop_led_offural_txeofwdc_floating_busuvisor_calocnameshidkbd_bell_fndisk_busydb_breakpoint_allochidkbd_belltcp_pulloutofbandevcount_sysctlsqphy_statussddetacharprequesttfork_child_returnsiginituipaq_cdpci_mapreg_mapsr_wu_enqueue_ccbuhci_device_isoc_abortpool_set_constraintsusb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigusbd_clear_endpoint_stalldb_vnode_print_cmdums_casetdisklabelbio_registerdeflateknote_removesii3112_drv_probepmap_bootstrap_pv_page_allocbufq_nscan_createsr_hotspare_rebuilduvm_mapent_addr_insertroutedomainhid_locateicmp6_errorVOP_MKDIRpool_large_freeip_protoxsys_settimeofdayi80321_sdram_boundssdstrategyaddlogehci_sync_hcuvm_page_physgetrt2560_bbp_readmsdosfs_synccheckdisklabelscsi_mode_senseip_savecontrolstackgap_randomvm_map_unlock_lnffs_clrblockusbd_set_hub_featurepdc202xx_chip_mapuvm_addr_linsearchbpf_filterchgproccntip_drainieee80211_tree_RB_PREVdb_map_print_cmdumass_init_shuttlesoqremquepci_class__adddi3uvm_map_inheritsys_getthridcd9660_syncem_enable_hw_vlansin6_ifawithscopebuf_page_offsetumodem_set_line_stateuvm_pmemrange_addr_cmpkm_freeusbd_is_dyingsync_printvnopsem_lv_phy_workarounds_ich8lanieee80211_rssadapt_inputsys_lchownmsdosfs_removecd9660_readdb_read_tokenem_attach_miibusieee80211_regdomain_compare_rnfilt_timerdetachwi_get_idzeroin_addrbmtphy_cdehci_device_bulk_closewdc_set_driveuvm_map_protectusbd_get_xfer_statusuvm_map_setup_mdre_encapprintfehci_alloc_sqtd_chaincdce_devsrandomwriteuhci_device_intr_methodsprelist_updatehmac_ipad_buffercrypto_drivers_numsmsc_miibus_readregip6_protoxsys_recvfromswcr_freesessionttrstrtwskbd_mux_openrandombwi_txeof_statussysctl_doprockcopysiop_modechangeext2fs_initrtfreesingle_thread_checkre_pci_detachrt2661_node_freecuio_getptrcd9660_linkhostnamelenupl_cdusb_needs_reattachdeflateTuneuaddr_hint_selectsched_cost_runnableem_flowstatusxscale_cache_purgeID_rngttyopenuplcom_rtsraw_ctlinputwi_usb_ctl_unlockbwi_rxeof32nd6_ioctlsched_chooseprocphyslockspec_setattraxe_miibus_statchgpte_l1_s_protousbd_get_stringfill_prlistipsec_exp_allocationsHMAC_SHA256_Finalbpfcloseusbd_probe_and_attachsys_writevsys_setpriorityumodem_set_line_codingm_tag_prependE_abs_script_sched_slot0_Usedaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlwi_usb_attachurl_rx_list_initusb_schedsoftintrarpintrkqueue_registerpciaddr_resource_managecred0in_delmultirt3090_rf_setupuvm_forkdisk_lookupuhci_device_intr_abortuid_findumass_activatend6_rtrequestuplcom_cduvm_km_suballocusb_delay_msucomparamif_getgroupattribsbpfdetachsys_closefromumodem_closeehci_devdttydefcharssigexitscsi_link_openhidirtypagesrt2560_reset_tx_ringin6mask128rt3090_rf_wakeupbus_space_read_raw_multi_4uvm_amap_poolin_pcballocVOP_LOOKUPsr_meta_readbrgphy_loopdb_shift_exprphysical_startbs_notimpl_bs_c_8ifa_delpcred_poolenqueue_randomnessexphyattachusbd_set_idleserverworks_pci_intrieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputdes3_zerokeyre_miibus_statchgobio_matchacphy_cdcrypto_getfeatsched_cost_loadbwi_memobj_write_4bwi_phy_config_agcwsmux_attach_scusbd_pipe2device_handlecpu_do_powersavebwi_free_rx_ring32aue_rx_list_initi80321_bs_vaddruvm_km_pagesufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesr_validate_ioaes_xts_decryptsocket_poolpgrphashsys_setpgidpciide_jmb_caprofhzAES_GMAC_Updatesr_meta_init_completentp_update_secondcache_enterdb_watch_tablei80321intc_attachedsysctl_file2exec_elf32_makecmdsusb_rem_wait_taskext2fs_bufatoffsys_setlogininitarmamap_listdb_trapip6_maxifprefixesieee80211_node_cache_timeoutthecustcp_do_rfc3390ieee80211_req2nodesys_setresuidsvwsata_dmactl_readcrypto_kinvokern_deletesd_get_parmsiskmemdevstat_rush_requestsrt3090_filter_calibwi_watchdogatu_start_scanipsec_def_compfc_lmdistancench_poolphtree_RB_REMOVEsomaxconnural_readscsi_xs_get_doneatu_external_firmwareipsec_exp_timeoutip_directedbcastbwi_free_rx_ring64i80321_pci_decompose_tag_bus_dmamap_loaduvm_pmr_pg_to_memtypeuihashtblieee80211_node_getrssiumct_activateticks_per_secondsd_buf_doneieee80211_get_rtsamap_initffs_flushfilesubsa_baudrateiq80321_pci_intr_establishicmp_sysctlsys_lseekdes3_decryptllinfo_arpmsdosfs_pollpci_lookup_quirkdatamsdosfs_accessaddupc_intrdvd_read_bcaamphy_servicevm_map_lock_read_lnwsevent_finiip6stathotplugread_filtopsuplcom_set_line_statehidms_enableuvm_pageboot_allocconfig_pendingmii_phy_updatesys___thrsleepi80321_i2c_matchbwi_mac_dummy_xmitether_crc32_lepiix3_4_setup_channeluvscom_set_crtsctsaue_csr_write_1rn_searchugenread_isoc_filtopsipipstatsecureleveluftdi_cadb_consoleurl_matcharpt_keepsavectxdb_printsymums_disablepte_l2_l_cache_mode_ptbinuptimesys_seteuidhidms_attachwskbdpolluvm_map_checkprotmax_protohdratu_tx_list_initcdce_activatedes_is_weak_keyohci_pci_matchural_rf_writedb_access_irq_spieee80211_add_qos_capabilityieee80211_cipher_keylenumass_scsi_attachsr_raid1_discipline_initrandomkqfilterbufpagesuipaq_attachusbrev_strpciaddr_resource_allocateiic_execsleep_setup_signalrlphy_cdprocess_newsys_keventcopyargsarc4_reinitsr_chunk_in_useuhci_device_bulk_methodsrt2560_attachwd_standbymi_switchcd9660_statfssysctl_sensorstsleepkern_sysctlbwi_dma_mbuf_creatend6_delayin_pcbinitsys_fchmodatsqphymatchbs_notimpl_bs_rm_4nmbclust_updatehw_prodfdremoveigmp_fasttimobufq_disksort_queueatomic_setbits_intehci_device_ctrl_startuserconf_cmdbufwi_get_pmumass_bbb_statedb_print_loc_and_instohci_device_ctrl_abortsvwsata_dmacmd_readrt2560_updateslotpiix_setup_idetim_timingsrt_mpath_matchgateubsa_stopbitscdce_startrt2661_reset_rx_ringusbd_port_disown_to_1_1uvm_map_entry_poolcrgetuhci_activateunp_bindtcp_delackuhci_device_isoc_closecsignalreaddisklabelvm_map_unbusy_lndb_print_cmdusbd_clear_endpoint_stall_asyncvirtual_availbs_notimpl_bs_rr_2tcpstatuvscom_readstatdma_constraintdb_break_tableuvm_anon_pooli80321_softcicmp6_mtudisc_timeoutfillmapentrytcp_timer_persistsata_chip_mapcpufunc_ifarudav_newbufsys_umaskuhci_pci_attach_deferredpci_subclass_i2o_tr_flush_blockpow2dividesyn_cache_reaperfilt_fileattachsysentieee80211_find_rxnodecpuset_addpmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistrt2860_drain_stats_fifoufs_ihashlookupubsa_intrscsi_inquire_vpdsii3114_mapchanmemmoveicmp_rediracceptugen_set_interfaceusbd_get_hub_statusworkq_create_threaddb_boot_halt_cmdural_attachip_outputbwi_init_rx_ring64bwi_bbp_attachbpf_mtapnkmempages_maxfindblknamekue_rx_list_initpool_inituvn_referencebwi_pci_detachuvm_pmr_addr_RB_PREVbpfreadbio_errorpool_putm_copym2buf_alloc_pagessysctl_structbufqs_stopohci_hash_rem_tduhci_poll_hubaxe_ifmedia_stssysctl_rdstringuvn_attachlasttimesr_wu_putehci_freexcryptoclosesysctl_disklockcnkqfilterrt2860_alloc_tx_pooldesiredvnodesbs_notimpl_bs_r_2ufs_pollusbd_remove_devicepmap_map_sectionmsdosfs_readlinksr_concat_alloc_resourcespmap_devmap_bootstrapdes1_encryptieee80211_decryptusbd_get_device_statusbwi_rf_init_sw_nrssi_tablenchinitexec_mapdb_qualifysnprintfcomcngetciicbus_printext2fs_readlinkether_ioctlumass_bbb_transfertqphy_servicebwi_free_txstats32ip6_forwardingsr_shutdownural_cdkue_resetarp_allocated_bus_dmamap_load_mbufbwi_plcp_headerwdc_print_capswi_watchdog_usbifindex2ifnetcd9660_ioctlem_initrt_mpath_conflictusbd_get_config_desc_fullin6_savemkludgein_pcbnotifyalluvm_pglistallocsyn_cache_addpool_large_free_niohci_device_ctrl_transferbuf_kva_endsr_raid1_intruvm_map_splitentryvm_map_lock_lnincoreurlphy_cdhzdcphy_mii_phy_autodefrouter_resetcd9660_ihashinsbwi_dma_allocrt2860_newassocrt2560_bbp_initsiop_script_writesched_exitcheckaliascue_activatettyretypestartuphook_listrt2860_detachre_tx_list_initpte_l1_s_cache_modeuvm_pmr_remove_addruaddr_pivot_poolkue_detachrt_timer_queue_changelf_initwi_ioctl_usbcpu_attachrn_mpath_countbwi_set_addr_filterwdc_preata_drivemii_phy_matchrt2560_eeprom_readural_amrr_timeoutzlibVersionsr_raidp_assemblesdclosevop_generic_kqfilterpffasttimoinitsiginfosys_getuiddb_set_cmdcomconsunitcpuidsexec_setup_stackobio_bs_vaddruao_createdb_free_watchpointssensor_detachbwi_led_blink_endifaddr_items_RB_INSERT_COLORbuf_mapbrgphy_adc_bugaue_lock_miiidentify_arm_cpuffs_realloccguplcom_set_crtsctsrt2860_initwskbd_load_keymapxscale_cache_cleanD_rngm_clpoolcd9660_bufatoffugenintrgroupmemberuvmspace_initrt2661_ioctlscsi_plug_detachether_sprintfatu_calculate_paddingfintek_refreshmsdosfs_unlockselwaitpmap_init_l1icmp6_mtudisc_callbacksnd6_slowtimosys_forkbufq_implsip_setmoptionsuvscom_reset__qdivrempmap_deadproc_cache_stateifaddr_items_RB_PREVpiix_setup_sidetim_timingsumct_matchspec_openi80321_io_bs_vaddrpmap_vac_me_kpmapswcr_sessionsfilt_bpfreaddb_watchpoint_freesr_disk_attachehci_alloc_sqhuvm_fault_wireusbd_abort_pipekernelstackcrypto_initem_k1_workaround_lvpci_resumevm_nphyssegifaddr_items_RB_NFINDip6_randomiduvm_pseg_initproc_filtopself32_os_pt_notewdc_print_current_modesSHA512Transformfiledescopensys_vforkehci_freempmap_vac_me_usercomcnspeeduvm_pager_initcpufuncswinChkNamebwi_regwin_is_enableddvd_read_copyrightieee80211_recv_4way_msg1bio_delegate_ioctlrt3090_set_rx_antennauvm_pmr_addr_RB_MINMAXdb_history_prevem_read_pcie_cap_regbwi_rf_clear_stateem_setup_receive_structuressys_mkdiruao_reference_lockedcom_resumepmap_devmap_tableufs_fhtovpcrypto_donewskbd_translatedumppcbbwi_rf_set_nrssi_ofs_11grttrashohci_root_ctrl_abortmblowatgetnewvnodert2661_amrr_node_free_allufs_inactivepciide_natsemi_productskue_load_fwnd6_mmaxtriessiop_intrsys_socketuhci_detachuhci_abort_xferbwi_mac_fw_loadugenopenohci_shutdowni80321intc_imaskffs_cgreadwi_init_usbugenioctlvm_map_lock_try_lnspec_close_clonevop_generic_bwritenanotimere_cdufsspec_writelxtphy_casd_read_cap_10iso_disklabelspooffdfreeuvn_detachieee80211_ccmp_set_keyfintek_capci_set_powerstateuvm_km_valloc_trytty_counthidkbd_detachbwi_phy_init_11gdeflate_globaluftdi_detachraw_disconnectipsec_ipcomp_default_levelsensor_task_registersis_south_matchusb_end_tasksip6_neighborgcthreshbufkvmKERNEL_BASE_virtremove_coproc_handleratomic_clearbits_intumass_polled_transferucom_to_tiocmdeflateSetHeaderuvm_pmr_extract_rangebrelvpsensor_attachre_intrmsdosfs_mountfsvfs_relookupem_oem_bits_config_pchlanpcibr_flagsuvm_map_addr_augment_getem_82547_update_fifo_headncpusfoundehci_root_intr_startwi_stopip6_sprintfsync_fsyncumsm_activatesetstatclockratecd9660_strategyohci_allocmem_iffuserconf_parseural_tx_bcntiocm_to_ucomip6_keepfaithext2fs_allocpmap_cachevivtusercryptowskbd_deliver_eventdb_eregscom_fifo_probeieee80211_delba_requestbread_cluster_callbackfdcopy_bwi_txeofbuf_acquire_nomapatu_send_mibemul_findAES_GMAC_Finalb_to_quvm_pmr_size_RB_INSERTin_len2maskbus_space_read_raw_multi_2uhci_pci_matchcmd0643_9_chip_mapobio_bs_allocusb_blk_freelistudp_sendspaceuvm_objtree_RB_PREVifg_headvfs_rootmountallocSHA1Updateehci_device_isoc_transfercue_tx_list_initbs_notimpl_bs_sr_2netintrcd9660_openrw_initi80321_bs_mmapAES_GMAC_Reinitixp_setup_channelsr_uuid_generateohci_root_ctrl_startvm_map_busy_lnbuf_rb_bufs_RB_FINDcmaskbrgphy_cd_bss_end__ext2fs_blkprefdb_pool_print_cmdbwi_encapwi_alloc_nicmem_ioicsphyattachdb_delete_linescsi_activateuhidkqfilterVOP_ISLOCKEDsys_kqueueAES_GMAC_Initieee80211_tree_RB_REMOVE_COLORuao_referenceusbd_kill_pipeuhci_freemin6_addrscopebuf_getsys___threxitdb_searchieee80211_ifdetachuvisor_attachbs_notimpl_bs_wm_4vfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockieee80211_free_nodeieee80211_node_leave_11graw_usrreqnblkdevuhci_find_prev_qhpciide_detachinitiduhidev_detachbs_notimpl_bs_wm_2sr_crypto_hotplugttyinputscanc__stack_smash_handlerbwi_pci_conf_writeumsm_matchukbd_consopsbiodoneural_activatedb_set_breakpointicmp6_rip6_inputehci_free_sqtdwi_usb_txfrmsmsc_encapmaxslpext2fs_makeinodeehci_device_intr_methodscue_startaue_csr_read_2ufsread_filtopsufs_symlinkm_dup_pkthdrbwi_bitswap4sr_crypto_assembleufs_mkdirvfs_getcwd_getcachepci_subclass_satcomusbd_get_no_altsural_newassoc_length_codenamecache_rb_cache_RB_PREVin_iawithaddrbwi_mac_fw_free__anddi3phtree_RB_REMOVE_COLORrt_missmsgVOP_BMAPre_txeofignore_addrsip_dooptionsvn_locksvwsata_lba48_write_regcue_tick_tasktimeout_add_tsbwi_phy_attachrip6_ctlinputubsa_activatescsi_link_shutdowncdce_caSHA384Initumass_cbi_adscsbdropsr_meta_native_attachmsgbufphysuaddr_free_rbtree_RB_INSERT_COLORtcp_debugusbd_transferinpcb_poolohci_pollohci_hubdnextralocsmsc_miibus_writereguvm_addr_fitspaceblf_keysys_setegidbus_space_write_raw_multi_4wdc_wait_for_statusucom_status_changern_matchcd9660_symlinkautoconf_verbosebwi_memobj_read_4in6_setpeeraddrunp_externalizesys_munlockalluvm_faultuhci_waitintrrandomioctlsoftraid_disk_attachsoreceivesiop_iwrpool_getuextralocscsibus_printlinkdb_show_radix_nodeudav_csr_read1ieee80211_eapol_key_inputohci_root_intr_startffs_dirprefucom_shutdownrip6_outputinflatert2661_setup_tx_descscsibus_cdin6_get_rand_ifidndflushcompose_tab_cmpieee80211_parse_wmm_paramsrn_insertspec_pollbpf_wakeupfilt_kqdetachdb_flush_lineaue_unlock_miiwsmux_getmuxipsec_exp_bytesbufqueuesconfig_defersys_faccessatgf_mulbwi_mac_setup_tpctlem_check_for_link_bus_dmamem_allocm_tag_initbsearchif_attachsr_crypto_free_resourcespciaddr_ioaddrsys_setrtablem_reclaimsr_raid_read_capuvm_map_addr_RB_REMOVE_COLORnameibwi_disable_intrsem_read_pci_cfgbs_notimpl_bs_sr_4uvm_map_setup_entriesext2fs_readdirip6_ctloutputdead_polltqphy_funcswihap_initversionbwi_mac_opmode_init_bus_dmamap_syncuvm_pmr_remove_sizelzs_dummybuf_needvakqueue_initieee80211_wep_delete_keyrt2661_read_eepromuplcom_set_line_codingaxe_rx_list_initata_dmaerrieee80211_bip_set_keybwi_mac_set_retry_limuvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getciic_probe_sensorre_pci_cabs_notimpl_bs_rr_8mountlistuserconf_histbufcomsoftwihap_mgmt_inputpdc203xx_read_regudav_initVOP_REVOKEconfig_deactivatebwi_txeof_status64SHA256Finalclallocipsec_esp_trans_default_levelbiowaitbwi_led_blink_nextpdc268_config_readpci_subclass_inputprobe_addrs_sensorfilt_ufsreadrt2560_rx_intrunixswuvm_objtree_RB_INSERT_COLORdb_stop_at_pcsccstqphy_caehci_check_intrral_pci_activateccpupmap_updateehci_device_setintrobio_cdem_setup_linkpci_vpd_readgeneric_bs_sr_1re_pci_activateacard_chip_maphidkbd_inputsr_raidp_recreate_wunexttickeventfdinitboothowtoarc4randomnsphy_funcstcp_delack_ticksbwi_get_rf_loupl_stoprt2860_intr_coherentttopenata_get_paramsukbd_apple_iso_mungeip6_randomid_initieee80211_tx_ba_timeoutether_ipmulticast_minconfig_rootsearchrt2860_bbp_initrip6_sendspaceieee80211_countrycode2nameuao_dropswapin_addprefixenxiosys___getcwdcd9660_specvopsusb_cdrnd_event_headin6_maxmtupmap_enterrt2560_iter_funcamphy_funcsundefined_handler_addressRMD160Transformsys_setreuidSHA1Initusbd_ratecheckbwi_phy_init_11b_rev6wi_usb_open_pipesudav_tick_taskuvm_map_findspacepdc203xx_pci_intrwsevent_initcryptoopencomcnattachuserasymcryptodb_var_rw_intrt2560_set_bssidusbd_devinfo_freesdsizesys_pwritevudav_lock_miikqueue_scanieee80211_pmksa_findbwi_rf_off_11g_rev5uplcom_breakusbd_iface_claimedtcp_closeicmpsrcohci_free_stdsd_patternsX_db_search_symbolscsi_initmsdosfs_advlockswcr_idwdog_registerkue_attachif_indexlimpdcsata_chip_mapusbd_free_xferdb_varssys_utimensatfalloclxtphy_cdatu_joindeadproc_mutexdb_breakpoint_freeumsm_methodspfctlinputcomcnprobephys_mapumass_bbb_methodssoft_intrqdeflateSetDictionaryufs_lockcomintrboot_eaddr_validsys_accessem_read_mac_addrnsphy_statusuvm_swap_iouserconf_initbwi_phy_init_11art2560_ioctlkillpg1url_tx_list_inituhci_strwsmouse_mux_openi80321intc_attachvputonfreelistuhci_device_ctrl_transferwdioctlext2fs_mountrootobio_printpciide_mapregs_compatumodem_methodsieee80211_findrateregyearem_update_stats_countersurl_ioctlpage0setrunnablepool_do_putuvm_pmr_getpageswi_set_ssidcue_ioctlnd6_prefix_onlinkugen_seltrue_filtopsffs_specvopsumct_intrcue_attachelf32_read_fromosversionticks_per_intrem_free_receive_structuresatu_get_mibhid_is_collectionwi_usb_tx_list_initfind_pfxlist_reachable_routerip6_pcboptstvtohzieee80211_get_eapol_keyphtree_RB_NFINDratecheckin_rtchangevfs_syncwaitrt2860_tbtt_intrudav_ifmedia_statusaue_crcffs1_reallocblksieee80211_node_lateattachcansignalhotplugpollem_link_stall_workaround_hvrt2860_suspendmsdosfs_check_exportbwi_fwimage_is_validieee80211_up_to_aclf_setlocknbigpipecue_devsin_controlieee80211_get_addba_respbwi_regwin_inforlphy_funcswsmux_srcopslmaxuvm_pagecopyphtree_RB_NEXTsysctl_quadsys_readexec_process_vmcmdskue_tx_list_initrt2560_update_promisccmd_chip_mapieee80211_tree_RB_FINDohci_freemi80321_bs_tag_templateucomioctlm_cldropmbstatuhci_remove_ls_ctrldcphy_statusuhidev_intrttyinfodb_flush_lexttyinohci_root_ctrl_donegetnulldevdb_dmesg_cmdpciide_dma_initsr_meta_save_callbackextent_destroydb_lpenc_xform_rijndael128if_group_egress_buildloop_clonerttsetwatergetcieee80211_addba_requestrt2860_gp_intrsr_raid6_intrifaddr_items_RB_INSERTdb_last_addrural_update_slotuvm_pseg_lcksr_ioctl_volem_clear_hw_cntrscom_obio_matchpmap_enter_pvmsgbufenableduvm_mapent_mkfreeunp_disconnectsys_listensys_mounthotplug_put_eventehci_root_ctrl_donepgsignalehci_waitintrbpf_mtap_etherfirstcdb_read_bytesuhub_detachrt2560_media_changeieee80211_ccmp_delete_keysr_failioffs_fsyncwsmux_mux_openfintek_attachinetdomainehci_abort_xfermemcpywdc_enable_intrkthread_exitaxe_activatescsi_req_detachbwi_nrssi_writecue_newbufdisk_constructvfs_unbusyip_nhopsrip_usrrequhci_setup_isocvm_map_upgrade_lnspec_writesiop_wdtr_msgpciide_unmapregs_nativecom_obio_cdipsec_esp_network_default_levelkq_timeoutmaxin_broadcastfd_getfilesr_sensors_deletehidkbd_set_ledsmsgbufaddrucomclosesdioctlutsnameip6_setmoptionsexit2aue_resetkue_open_pipesacer_setup_channelip6_mloopbackext2fs_cgupdateuhci_add_hs_ctrlrt2860_ampdu_rx_startsiop_scsifreeieee80211_send_4way_msg2tcp_update_rcvspacerddumpem_enable_intrcpu_setperfuaddr_rnd_poolufs_lookupsiop_pci_resetugen_attachufs_bmapdoasyncfreeudav_miibus_readregcpufunc_dfarip6_randomflowlabelttpolldegetlogpollkthread_createbwi_mac_set_promiscugen_set_configdb_elf_sym_initwdc_default_read_raw_multi_2current_ipl_levellogclosesd_vpd_block_limitsieee80211_kdfgeneric_bs_wr_4install_coproc_handlernd6_dad_findohci_rhscudav_detachufs_strategysr_crypto_create_key_disksr_put_blockohci_device_requestkue_watchdogphysical_freeendcopy_statfs_infobounds_check_with_labelarc4_timeoutsr_raid1_assembleumct_opensd_ioctl_cachepci_subclass_networkext2fs_checkpathns_scx200_chip_mapsocantrcvmorepci_vpd_writeuipaq_rtsprocess_poolrt2560_update_ledip6_setpktoptfile_filtopssr_raid6_rwbuf_unmapmsdosfs_renamesysctl_proc_argssiop_adapterdes1_zerokeypipe_wfiltops__lshldi3purge_detachedpfxrtr_addcd_load_unloadipq_pooluaddr_kbootstrap_destroypmap_activatebuf_dealloc_membmtphy_resetconfig_make_softcuaddr_stack_brk_functionsunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofrt2661_bbp_readswap_syscall_lockufs_kqfilterieee80211_newstateem_is_valid_ether_addrums_enablescsi_autoconfcheckdirsexecswsr_raid0_creatert2560_set_txantennaumass_atapi_attachin6_are_prefix_equalin6_controluvm_pmr_rootupdateleapyearsleep_finish_timeoutsys_sigsuspendcd9660_unmountpciide_dma_startehci_device_bulk_abortswcr_authcomputenamecache_rb_cache_RB_NFINDtrapsignalrushjobpmap_devmap_registerrn_inithead0db_single_step_cmdwd_flushcachend_defrouterblf_decfdcloseexecuvm_map_sel_limitsevcount_attachlimcopybio_doreadwi_do_hostencryptscsi_req_probeuvm_mapent_forkcopytcp_timer_rexmturl_ifmedia_changei80321_gpio_pin_writeuftdi_attachsiop_pci_cart_timer_initnd6_useloopbacksr_crypto_rwuaddr_rnd_createieee80211_next_modeputsaxe_tx_list_initrip6statip6_id_ctxsr_raid6_free_resourcestcp_debxcnpollcd_casys_truncateesigcodeacphy_servicescsi_xfer_poolsysctl_wdogarmv4_tlb_flushIDudav_csr_readohci_add_donert2661_ack_rateem_read_phy_regieee80211_tree_RB_NEXTsched_choosecpu_forki80321_pci_initohci_add_edwdc_xfer_poolcdce_newbufsoacceptkqueue_pollcdgetdisklabeldb_call_depthuaddr_pivot_randomdb_printfehci_device_isoc_doneuhidreadin6_ifaddloopufs_creatend6_freend6_optionscd9660_seekbwi_free_tx_ring64nd6_llinfo_settimersr_roam_chunksmsdosfs_unmountelf32_load_psectiondb_show_all_bufsuftdi_writern_mpath_nextnamecache_rb_cache_RB_MINMAXuhci_device_bulk_transferarm_pcache_unifieddb_add_symbol_tableuhci_remove_intruplcom_setm_tag_nextohci_intr1msdosfs_writecue_resetbs_notimpl_bs_w_1rt2661_amrr_node_free_unusedexec_script_makecmdsehci_rem_free_itd_chainiic_matchieee80211_reset_erpfilt_pipedetachcd9660_rootentropy_add_ptrdb_unaryrgephy_statusiophyattachdisk_attach_callbackselrecordffs_validatert2860_intrcomstopatu_wait_completionaxe_ax88772_initffs1_compat_readrip_outputext2fs_accessbwi_ofdm_plcp_headerrt2560_read_eeprommld6_fasttimeouaddr_rnd_insertkthread_qimaxwsmouse_matchohci_free_seduserconf_pdevuvm_object_printitsr_detachinflate_fastiq80321_devmapmbpoolclock_secs_to_ymdhmsaes_xts_setkeytcp_canceltimerstqphymatchrip_recvspaceroute_initswap_prioritylink_rtrequesttc_setrealtimeclockffs2_reallocblkswdc_get_xferuvm_vmspace_poolbwi_setup_rx_desc32stackgap_initpipe_createsysctl_vnodepdc202xx_setup_channeliodatand6_sysctlsyn_cache_putdoopenatpciide_amd_productspci_subclass_multimediavn_opensr_raid0_alloc_resourcesuhci_freexif_clone_createbufq_fifo_requeuesr_boot_assemblycdce_tx_list_initSHA384Finaluao_detachcpufunc_controlmallocamap_pp_adjrefauth_hash_hmac_sha2_384_192apollo_chip_mapin_pcbrtentryrt2560_get_macaddrknote_dequeuesr_discipline_inituhci_root_ctrl_startuhci_pci_activatewi_cmd_usb__udivsi3re_ifftcp_outflagskqueue_statcdce_ioctlcd9660_rrip_analyzeohci_hash_find_tdexphymatchbuf_fix_mappingbio_unregisterip6_v6onlysys_preadvdb_tok_stringuserretsys_recvmsgpipe_statHMAC_MD5_Finalvn_writesr_hotplug_unregistermtdphy_servicehidkbd_hookup_bellVOP_LINKubsa_devsicmp_inputumass_cdvcountvm_page_zero_enableieee80211_get_sa_queryuvm_vsunlock_devicerd_root_sizein6_delmultistathzenc_xform_cast5route_ctloutputwdog_ctl_cbbwi_nrssi_readsched_idlebio_warnuftdi_get_statuswskbd_cnattachwdc_ata_bio_intrvirtual_enduhidev_get_reportsys_getloginifaddr_items_RB_NEXTbuckstring_inituhci_free_std_chainiq80321_pci_init2icmp6_rediracceptbwi_set_gainsdetruncdb_elf_symbol_valuescopyoutpfindbufq_peekcomconsaddrip_ctloutputuhidev_set_report_asyncwsevent_readenc_xform_arc4bwi_stopbrgphy_5704_a0_bugarp_ifinitdb_write_variableufs_dirbadcd9660_readdirvfs_unmountallrgephy_loopsys_renameatohci_allocxcopyrightsdattachsched_peg_curprocwdc_default_lba48_write_regtcp_timer_keepusbd_devinfo_vpsbsynctcp_mss_updateiopiic_cdphison_setup_channelpciide_lookup_productfree_pagesehci_root_ctrl_startdb_proc_print_cmdrt2560_initrw_enter_readdb_show_all_procsvunmapbufehci_device_ctrl_transferuvm_map_pageable_wireroute_outputrti_deletesys_geteuiddb_output_positionem_clear_vfta_i350icmpmaskreplin6_pcblookup_listenmsdosfs_mknodip6_defmcasthlimsys_munmapsii3114_dmactl_writekp_nonefilt_solistenvsnprintfrt2860_node_leavearplookupuvm_map_pageableproftimer_trampolinechainallocuplcom_methodssw_reg_startpmap_copy_page_xscalesr_ioctl_deleteraidifmedia_baudratei80321_calibrate_delayem_82547_tx_fifo_resetusbd_setup_default_xferuvm_pagelookupsoshutdownuserconf_hist_cmduftdi_cduserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tableip_mloopbackbwi_rf_get_tp_ctrl2bpf_iflistKQREFwdc_downgrade_modeieee80211_node_leaveip6intrqaxe_newbuftodr_handlend6_rs_inputscsi_activate_buspciide_mapreg_dmasoabortm_free_unlockedem_82547_move_tail_lockedem_get_bufcast_encryptunp_inobwi_default_led_acthidkbd_attach_wskbdlogkqfilterbpf_mtap_pflogni6_dnsmatchdb_extent_print_cmdip6_init2uprintfdb_clear_single_stepsensordev_installrandomiduvm_page_printitmainbus_cai80321_local_dma_initcoredump_elf32rt2560_intrsoftdep_flushworklistsys_issetugidinitclocksbwi_rf_attachcd9660_mmapif_detachaue_watchdogwsmuxopenwdc_ata_bio_startnd6_cache_lladdrifqmaxlencatqsession_poolunp_connectuvm_pagermapiniic_smbus_read_byteif_detached_startpool_serialuplcom_activatexscale_cache_flushD_SEscsi_probe_lunaue_ioctlirq_entryni6_inputvfs_mountedondb_expressionboard_powerdowncputypert_lookupfc_lookup__bss_start__if_downndqbVOP_GETATTRuhci_root_ctrl_methodsieee80211_fix_ratebwi_get_pwron_delaysiop_add_reselswwihap_deauth_requsbd_fill_di_taskieee80211_node2reqwi_usb_matchelf32_check_headerrt2661_bbp_initdb_historygf_logeephy_cdinphy_cdttytstamprt2860_mcu_bbp_readural_set_txantennaieee80211_node_allocieee80211_crypto_detachpmap_unwireipaddrip6_auto_linklocaluvm_pageunwirerti_fillHMAC_SHA256_Inithw_serialehci_device_intr_abortauth_hash_hmac_md5_96autoconf_attdetufs_chmodbufq_nscan_resortsr_raidp_discipline_initcdattachuserconf_devicesr_raidp_alloc_resourcesbwi_rf_off_11ain_localaddrsys_sigaltstacki80321_i2c_casii3114_dmatbl_writeDES_versionbrgphy_resetsoisdisconnectingauth_hash_key_sha1Blowfish_initstatesched_steal_procwi_media_changenull_decryptsyn_hash2rttimer_queue_headarm_pdcache_sizeexphy_capcidetachucom_dtrrtredirectuvm_map_printitdb_read_variablesoftintr_initieee80211_setkeysdonedb_regsdb_stack_dumpsr_raidp_rwuvm_pmr_pnaddrttymodemdb_lbuf_endehci_free_itdmtx_enteraxe_devskqueue_poolvntblinitbuf_rb_bufs_RB_INSERTcpuset_intersectionallcftablesem_lookup_gcubwi_rf_tssi2dbmuhub_activateAES_GMAC_Setkeysleep_queue_initpmap_preferin6_ifattach_linklocalVOP_REALLOCBLKSuhci_globalresetE_abs_tag0_Usedtcr1_get_timecountugenwritesys_setresgidsr_crypto_encryptuvm_pmr_freepagesieee80211_input_bamsdosfs_sync_vnodesplassert_failarm_picache_waystty_initaxe_ioctluvm_km_freesys_killrn_mpath_repriouserconf_numberperflevelcomconsiohpmap_set_pcb_pagedirem_watchdoguvm_pmr_addr_RB_NFINDrt_setmetricssys_getegiddb_set_single_stepuvm_objtree_RB_FINDsw_reg_iodone_internalhidms_detachem_check_mng_modeserverworks_setup_channelumass_init_insystemfrag6_deletefraghdruaddr_destroyem_validate_eeprom_checksumdirchkifaddr_items_RB_FINDexphy_resetipip_outputpipecloseVOP_REMOVEpci_mapreg_typewi_usb_activateconsinituvm_pmr_isfreeurlphy_statusext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachmtdphyattachifaof_ifpforaddrcryptop_poolsensordev_listsr_checksum_printhidms_ioctlsc_pld_shminidatacleanrt_timer_queue_destroysr_meta_probewi_cdsd_cduvm_pseg_geticmp_mtudiscipport_hifirstautoieee80211_tkip_delete_keysys_fstatem_read_eepromenc_xform_3desrgephyattachuserconf_enableext2fs_vinitdb_endlpuplcom_intrumass_bbb_resetffs_alloccgbuf_object_storecryptodevallowsoftsmsc_wait_for_bitsobio_foundgeneric_bs_w_1sa6_anysys_getpriorityatu_radfirmpci_subclass_cryptosysctl_diskinitsr_concat_discipline_initE_ldsa_abs_reselect_Useduvm_km_vallocieee80211_send_mgmtcue_getmacnatsemi_chip_mapbrgphy_bcm5421_dspcodescsi_xsh_delrt_mpath_nextscsi_plug_probesys_unmountsr_meta_native_probeuvscom_dtruipaq_detachbootdvelf32_probesumct_detachin6ifa_ifpwithaddrvgonelpciide_jmicron_productssofreebwi_amrr_timeoutbwi_rf_lo_findnd6_dad_timerbwi_led_newstateuaddr_rnd_destroyinphyattachcpuset_unionbwi_init_tx_ring32uvscom_shutdowndb_del_symbol_tabledb_add_exprsiop_timeouteephy_matchpmap_removebpf_mtap_afrt2860_set_basicrateshidkbd_parse_descicmp6_fasttimouvm_pmr_addr_RB_INSERText2fs_removemtx_initif_clone_destroyehci_close_pipebwi_regwin_enablewdccommandvmcmd_randomizebpf_setfuserconf_historypciide_pci_cauvm_page_unbusyfilt_hotplugreadbwi_rf_lo_isusedtk_noutusbpalockext2fs_mountpmap_collectBlowfish_expand0stateuhci_check_intrukbd_enableuvm_map_addr_RB_PREVdb_symformat_elfpciide_compat_intrgeneric_bs_rr_4cpu_sysctlcd9660_deftstamphotplugkqfilteri80321intc_smaskzlibCompileFlagsip_randomidbrgphy_eth_wirespeedaue_tx_list_initnettxintrieee80211_recv_disassocnosuidcoredumpukphyattachsr_startwu_callbackcddumpdb_search_cmdastusbd_claim_ifacetcp_disconnectuvmspace_execuhci_timeoutwi_usb_detachwsmux_createsys_mmapehci_bus_methodsbootnd6_is_addr_neighborblf_ecb_encryptunp_rightshostnamedb_print_llinfodisk_closepartcmd680_setup_channelpci_enumerate_busbrgphy_fiber_funcsem_set_eee_i350em_disable_pciex_masterupl_outputi80321_intrext2fs_bmapuvmexpnextstateventenc_xform_blfbufq_doneehci_detachsensordev_getufs_diremptyreinsertfinishduprt2661_newassocsleep_setup_timeoutbrgphy_crc_bugukphy_serviceqsphy_resetsmsc_stopdeflate_decompresspool_destroylogwakeupshutdownhook_listhidkbd_attachip_dosourcerouteieee80211_node_join_rsnsoread_filtopsgcu_miibus_readregieee80211_media2ratedmapoolsbdevsw_lookupdisk_changebwi_mac_resetuplcom_matchamap_lookupsdoreallocblkscache_revlookupamd756_setup_channelbpfread_filtopssoinituvm_mapent_isjoinableem_get_speed_and_duplexVOP_MKNODuvmnd6_ifdetachin6_ifaddrroute_protofilt_ugenread_isocsync_vopshw_uuidext2fs_truncatere_newbufcd_play_tracksscsi_do_mode_senseuvm_pmr_allocpmrvirttimer_trampolineip6_maxfragpacketsdb_errorehci_confdprefetch_abort_handleruvm_km_threadsr_checksumem_rxeofuhci_root_intr_methodsscsi_probe_buslminm_leadingspacesys_fpathconfwsmuxpollarpt_pruneohci_device_bulk_methodsem_copper_link_postconfigkp_zerosoconnect2knote_poolcnopensiop_scsiprobenatsemi_setup_channelscsi_test_unit_readyural_set_bssidricohrtc_reg_writenmbclustural_get_rfsominconndma_freert2661_mcu_wakeupuhci_device_clear_togglesoftraid_cduvm_vnp_syncpool_allocator_large_niieee80211_get_disassociopxs_cdwihap_assoc_reqarpt_downsr_concat_intrrdgetdisklabelarm_pdcache_line_sizebpf_tapnthreadsdb_lookupuvm_pmr_addr_RB_NEXTrt2860_tx_intrnumnegpciactivatemii_phy_autouvm_pmr_addr_RB_FINDuvm_mapent_free_removemax_datalenmsdosfs_initohci_device_ctrl_startwi_write_record_ioext2fs_writelf_clearlockbwi_rf_set_ant_modegeneric_armv4_bs_wr_2uvmpd_scan_inactivedb_lastsymsiop_resetbusurl_memip_srcrouteuhidioctlip6_accept_rtadvieee80211_recv_4way_msg4sr_raid6_alloc_resourcespte_l1_s_cache_masksys_setregidusbd_device2interface_handleurl_csr_read_1cpuset_infosusbd_dopollvinvalbufsys_ftruncateuhci_device_isoc_startbwi_rf_map_txpowerubsa_dtraes_ctr_cryptm_splituhci_remove_hs_ctrlsoftintr_disestablishentropylockumodem_ioctlurl_stoptcp_timer_initdb_tab_stop_widthdb_putncharstuagg_unlockedsii3114_dmactl_readscsi_sem_enternd6_maxnudhinttcp6_inputsosetoptkp_dirtyehci_set_qh_qtdtcp_mssifa_addcache_purgeudav_stop_taskbpf_mcopycomconsrateauth_hash_hmac_sha1_96uaddr_pivot_insertfork1curpcbdb_activevfs_hang_addrlistpci_primary_vgacue_tickdead_writeufs_dirrewriteinsmntquettreadtk_canccdb_write_bytesrt2860_media_changeext2fs_blkfreeudp_outputfind_last_setsoftraid0rt2661_set_chansys_chmoducomreadprelist_removeuvm_objtree_RB_NFINDffs_vgetrt2661_tx_intraxe_encapinitprocsr_bootuuidip6_getpmtu__umoddi3bcstatsbrgphy_fiber_statusarm_dcache_alignvm_map_downgrade_lnugenclosert2661_media_changeip6_log_intervalnull_encryptsched_idle_cpuswihap_auth_reqscsi_activate_lunuvm_page_physdumpuvm_atopgX_db_sym_initmaxprocesssyn_cache_timerieee80211_auth_opensolisten_filtopsatu_internal_firmwareprocess_kernel_argsin6_update_ifa__wdcerrorSHA384Updatecdce_detachrt2560_tx_intrehci_alloc_itdrt_msg2suser_ucredsd_shutdownmem_noext2fs_buf_allocbufbackpagesral_pci_matchatu_xfer_list_freeuhci_free_stdwihap_sta_deletepciaddr_resource_reserveuaddr_kernel_functionspmap_free_l2_bucketRMD160Update_intrevarprequestmsdosfsreadwrite_filtopskernel_mapuhci_device_isoc_enterwi_init_iodumpdevwsmouseioctlcd9660_lockusbd_ref_incrieee80211_mgt_subtype_namegf_powbwi_led_eventugen_do_readdb_not_taken_bkptm_printpciide_unmapreg_dmauvm_pmr_splitvfs_mount_foreach_vnodekqueue_kqfiltertimeout_add_usecwi_mgmt_xmituhid_do_ioctlzeroin6_addrstrncasecmptimer_filtopsatu_tx_startuvm_objwirert2560_encryption_intr__guardohci_device_bulk_starttcp_mss_advSHA512Update_intin_ifaddrnd6_optionwin2unixfnmax_hdrffs_readm_freephtree_RB_FINDbwi_mac_hostflags_initaes_key_wrapurlphy_attachieee80211_get_assoc_reqsr_meta_attachsr_meta_native_bootprobescsi_inqmatchfdesc_poolcmd_pci_intrpool_page_allocsr_switchin_pcblookupm_tag_delete_chainfilt_pipewritecd9660_polliicprobencbadaddr_read_4bzeroumass_scsi_probearmv4_drain_writebufswapdrum_addufs_closedefrouter_delreqfixjobcuvm_pmr_size_RB_REMOVEdb_show_all_cmdsehci_shutdownpci_subclass_daspscsi_devidin6_addmultirn_newpairbios__udivdi3sys_obreakblf_setkeyusbd_set_config_norgephy_cdieee80211_pmksa_addpciide_cdlastddateucom_do_ioctluvmfault_unlockallsr_meta_getdevnamem_inithdrpmap_curmaxkvaddruvm_pmemrange_addr_RB_NFINDin6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotsys___thrsigdivertsys_getdtablecountmbinitsr_errortcp_secret_ctxusbd_get_reportabortwskbd_default_bell_datascsi_readsafe_cmdieee80211_set_link_stateamap_allocVOP_LOCKbuf_rb_bufs_RB_INSERT_COLORMD5Finalwskbd_matchcp_timeaxe_rxeofcd9660_vget_internalrt2560_decryption_intrdb_page_print_cmdwi_intrrw_casvgetrd_attachkd_nowaitugenpollieee80211_create_ibssbrgphy_jumbo_settingswsmouseopenwinChksumbufq_requeueserverworks_chip_mapfreeclusterchainmld6_initswapmapscsi_get_linkdisk_initSHA256Updateohci_bus_methodsohci_hash_rem_itdatu_cdrip6_ctloutputdisk_readlabelpciide_pci_writeaue_sendusbd_getnewaddrnd6_na_outputext2fs_fhtovpsr_validate_stripsizeumass_cbi_transferext2fs_createieee80211_gtk_rekey_timeoutem_local_timerusbd_bulk_transfer_cbexec_aout_prep_oldomagicwi_sync_mediauvm_map_teardownpipe_pollpool_reclaim_allnsphy_cabmtphyattachucomopensysctl_dopooluhub_matchpmtu_expireuvm_mapent_clonetcp_respondsys_readvcrypto_getreqamap_cow_nowroundrobinbadaddr_readuvm_map_createissignalwdprintsr_attachfilt_uhidrdetachin6_selectrouteieee80211_recv_rsn_group_msg1cdevvprt2560_bbp_writeuhci_intrbwi_mac_balance_atten_setsoftintrmsdosfs_kqfilterigmp_joingroupuiomoveohci_device_isoc_donewi_usb_wridrespmsdosfs_startlf_alloccpu_idle_leavedb_loop_countwi_intr_ackpciide_dma_table_setupbpf_reset_dem_hv_phy_workarounds_ich8lannd6_dad_stopdiskmapioctlhid_start_parseuseloopbackinflateSyncPointuvm_waitnexecsbwi_init_rxdesc_ring32mclpoolsi80321_mem_bs_mapieee80211_regdomain2namepmap_referencesys_bindrt2661_watchdogloioctlrw_exit_writebs_notimpl_bs_wr_8ieee80211_eapol_key_micrt2560_free_tx_ringumct_initusb_abort_taskspmap_bootstrapbs_notimpl_bs_wr_2blf_cbc_encryptipsec_auth_default_levelsys_mqueryarm_picache_line_sizekmeminit_nkmempagesbwi_rxeofusbd_new_deviceuvm_pmr_size_RB_REMOVE_COLORmcllivelocksscsi_io_putscsi_iopool_inituvm_pmemrange_findfillinusemaprecvitbmtphy_funcsums_cdfilt_sowriteuvm_kernacccnpollcsys_linkucomsubmatchuvm_addr_initlog_opensr_rebuild_initfilt_randomdetachuvm_pmr_size_cmpuaddr_free_rbtree_RB_MINMAXfragtbl124userconf_totdevi80321_bs_tagrt2661_tx_cmdxscale_cache_flushIDrt_tablesrt_ifmsgrandomread_filtopsieee80211_plcp2rateumsm_setobio_bs_maprealitexpireipstatunix2dostimesr_raid6_recreate_wurt2860_delete_keydounlinkatscsibus_caubsa_attachiic_probe_eepromuvscom_openurl_newbufusbd_delay_msffs_dinode2_poolcrfreecnputcuhid_do_writepte_l2_s_prot_wip6_lasthdrohci_device_isoc_abortuhub_uhub_capci_count_vgaugen_matchtcp_reaperlastnowpool_sethiwatrt2661_tx_datasvwsata_mapreg_dmawi_read_record_usbuftdi_methodswdgetdefaultlabelmicrotimeuvm_pmr_addr_cmprt2560_tx_datapipeunlockuvm_pmemrange_addr_RB_MINMAXuvm_swap_getpciide_serverworks_productsext2fs_reloadrt3090_rf_initurlphy_matchcsefindelf32_copyargsisochariophymatchuvm_km_alloc1siop_cdcdopentcp_usrclosedaue_ifmedia_stsboard_resetphysmemuvn_flushurl_cduvmfault_relockinferiorbwi_rf_calc_rssi_bcm2050ukbd_attachxscale_cache_purgeD_Eclusteralloccryptof_readsr_raid_syncuplcom_capci_dopmrt_if_remove_rtdeletewskbd_attachin_pcbbindumass_cbi_statexscale_cache_flushIlopagesmtdphy_caudp_notifyuhci_timeout_taskuhci_root_ctrl_closeendtsleeprt2661_resumewihap_check_txstrnlensigactsshareuvm_map_freelist_update_refilldb_set_watchpointuvm_map_addr_RB_NEXTbpfattachuftdi_openif_detach_queuesitimerdecrieee80211_get_delbaether_outputpci_cdem_phy_setup_autonegpmap_bootstrap_pv_page_freeuvm_addr_printauth_hash_md5crypto_kdoneinflateGetHeaderbpfilter_lookupm_copym0bwi_led_onoffaxe_miibus_readregvm_physmemiso_shipdirrdwritebwi_txeof_status32ieee80211_node_join_htrnd_timeoutieee80211_parse_edca_paramspipe_ioctlfilt_timerexpireural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootbpf_allocbufsbwi_init_txstats32set_stackptrrt_gettablemsgbufmappedohci_device_setintrrt3090_set_chancomprobe1cdsizedb_symbol_valuesuhci_device_ctrl_startumass_lookupdb_evarsupl_activatesmsc_attachiic_smbus_write_bytebwi_rf_get_latest_tssiwsmouse_mux_closewakeupgetnanotimeatu_devspciide_matchrt2860_rf_writei80321_mem_bs_mmaptcprexmtthreshkprintf_mutexrt_getifadb_malloc_print_cmdwi_get_fid_ioenosyslockmgrbwi_bus_attachrtlabel_name2idbwi_node_allochidkbd_is_consoleuvm_vnodeopsdb_bcstats_print_cmdvfsconfrt2860_free_tx_ringVOP_OPENcompwroffbuckstringuhci_device_bulk_startrt2860_enable_tsf_syncsiop_scsicmd_endusbd_fill_deviceinfoscsi_interpret_sensesqphy_cdugen_do_ioctlext2fs_flushfilesdes_ecb3_encryptieee80211_send_eapol_keycomconsattachedbrgphy_probelxtphyattachwi_usb_txeof_frmufs_readlinkrdopenin6_ifadddoscheckpathpcbmapatu_newstate_tr_stored_blocknd6_option_initbufq_quiescebrgphy_servicepiix_setup_channelext2fs_setsizeffs2_balloc__guard_localin6_init_prefix_ltimesnchstatscd9660_fhtovpmsgbufpE_ldsa_abs_selected_Usediq80321_pci_intr_stringsys_setgidrt2860_set_keyuserconf_common_attrfilt_ufswritert6_flushehci_timeout_taskgeneric_bs_r_4E_ldsa_abs_slot_Usedmmrwffs_bufatoffieee80211_add_ds_paramsem_init_hwiq80321_pci_intr_disestablishwi_usb_rridrespdohooksgf_invem_pci_set_mwiieee80211_rssadapt_choosenprocessesehci_free_sqtd_chainem_disable_intrukbd_activatesiop_sdpaue_setmultiif_detached_ioctllocnamppsegswi_usb_casch_chip_mapuserconf_showbwi_next_scanip_mtudisc_timeout_qsr_scsi_cmdaddress_exception_entryffs_fhtovpgetvnodefilt_ufsvnodecrypto_get_driveridbwi_mac_updateslotpool_setlowatkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmpsysctl_emulseltrue_filtopssys_sigprocmaskdb_commandrt2661_select_bandin6_if_upfilt_pipereadenc_xform_aes_gmacsoreservepidtakendb_formatrt2560_reset_rx_ringuvm_mmapusb_activatescsi_report_lunsufs_quotactldosymlinkatuvm_map_uaddraroundin6_pcbnotifyifaddr_items_RB_REMOVEbrgphy_5708s_funcsusbd_clear_endpoint_toggleexplore_pendingstrrchrgetdevvpm_clgetpci_mem_finddefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangecuio_copybackisodirinodb_strlcpycfrootswsmousepollchrtoblkscsiprintsiop_get_lunswuserconf_pdevnamminphysukbd_matchurl_ticksys_fchownatrtalloc_noclonetimeout_mutexether_addmultiieee80211_recv_actionpci_powerdowncdce_cdffs_vptofhvfs_isbusyifunitirqstackbawritetputcharsvwsata_dmatbl_writewskbd_detachpmap_postinitcsedeletepool_print_pagelistffs_fragacctrt2661_rx_tuneffs1_ballocsys_fchowndcphy_attachuvisor_methodsums_activateinflateInit_SHA384Update_intdb_breakpoint_cmdvwaitforiomii_phy_tickcd_read_subchannelextendfilelortrequesticmp6_inputbuf_valistuserconf_addohci_device_intr_methodswi_func_iocreatedefilt_randomreaduvscom_closebwi_regwin_nameieee80211_michael_mic_failuresbreleasedb_history_sizein6_selectifmsdosfs_islockedhipagesmax_linkhdrem_dma_freeumass_attachcryptof_statudav_resetget_stackptrsysctl_rtablemsdosfs_reclaimbwi_set_chanbwi_rf_calc_rssi_bcm2060wdc_free_queuesqphy_serviceuserconf_hist_eocsys_readlinkati80321_intr_disestablishuvm_objtree_RB_REMOVEext2fs_getattrrtlabel_id2namesbdroprecorduvisor_activateuvm_coredumpem_write_phy_regi80321_handlerwdsizenamecache_rb_cache_RB_REMOVEacphy_statusip6_sysctlsuserdiskconfural_tx_dataatu_get_card_configvn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1tk_ninsysfilt_opspciide_mapchanclusterfreefilt_randomwritesr_warnrt2560_beacon_expireieee80211_alloc_node_helperrootdevehci_device_isoc_startm_tag_firstem_82547_move_tailcdmatchpmap_map_entryusbd_get_config_descriptorpfxrtr_delpciide_machdep_compat_intr_establishdumpsysicmptstampreplif_detached_watchdogusbd_ar_pipecy693_setup_channelrip6_sysctlext2fs_fsyncdoforceuhci_root_intr_startsys_fsyncwi_usb_stopuserconf_add_readsr_crypto_writere_pci_probeusbd_reset_portrt2661_set_macaddrifconfsiop_led_onpciide_pci_intramap_wipeoutuser_configcast_setkeytcp_outputnsphyattach_bus_dmamem_mmapi80321_attachupdate_ledsext2fs_updatetcp_timer_2mslaue_openpipesi80321_gpio_initffs_reload_vnodebuf_putmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointsr_ioctl_installbootif_addgroupciphy_cdieee80211_setmodeuhid_matchieee80211_add_ibss_paramspool_allocator_freefilt_proceopnotsuppumodem_parambwi_pci_resumeem_rxfillffs_reallocblksphtree_RB_INSERT_COLORrandomcloserootvpaxe_miibus_writereguvm_pmemrange_addr_RB_NEXTugen_do_writeieee80211_eapol_key_decryptsr_raid1_free_resourcesuserconf_maxlocnamespool_reclaiminitdisklabelpci_subclass_serialbususb_quirksbpf_sysctlvflushehci_openieee80211_bip_encapcddetachpmap_clear_modifytcpctl_varsarptimerbufq_dequeuetcp_reass_limitruaddsys___set_tcbrdstrategym_copymsystemsbcopy_pageip6_freepcboptsdb_free_breakpointsif_upcoredump_notes_elf32piixsata_chip_mapumsm_catimeout_add_nsecehci_intr1rt2860_enable_mrruvmfault_lookupm_extfreergephy_resetupl_intrucomprintural_matchdeflateBoundVOP_BWRITEbufq_fifo_peekrt_timer_queue_createm_cluncountwddonemsdosfs_ioctlpciide_dmatbl_writeupl_matchrt2560_stopno_constraintsys_opensr_crypto_change_maskkeywdc_alloc_queuergephy_funcsscsi_sem_leaveinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangeether_crc32_be_updatepgdeletert2560_next_scanuvm_pageidlezerobwi_enable_intrswskbd_do_ioctl_scdead_vopsdb_symtabsi80321_irq_handlerieee80211_media_changeucom_detachuaddr_hint_createraw_attachural_set_rxantennahidkbd_cngetcscsi_ioc_cmddb_boot_sync_cmdastpendingifnewlladdruhci_noopphison_chip_mapether_ip6multicast_maxpipe_pooluao_initudav_iffifa_ifwithroutem_clinitifpspec_kqfiltertcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolieee80211_set_keyieee80211_bip_delete_keyem_smartspeeddb_print_positionrtflushclonedb_radixgetblksr_raid_turem_tbi_adjust_statsxscale_cache_flushD_rngmaxsmapwdc_ata_bioip6_mcast_pmtusoconnectrt2860_txural_initvtypesuvm_map_fix_spacenobuffers__lshrdi3data_abort_handler_addressrtrequest1usbd_errstrSHA256Update_intsr_scsi_ioctltcp_identtcp_rst_ppslimuhci_openbwi_pci_activateem_realignifinitsd_cmd_rw10cd_load_tocunpst_recvspaceuvm_map_mqueryget_ifidscsi_io_getsr_infokue_initxscale_cache_purgeIDuvm_map_kmem_growraw_inputcd9660_reclaimrt2860_stopkue_ioctlfilt_logrdetachtimeout_add_btnd6_ifattachunpdg_recvspacedofaccessatpipe_closeeephy_activatecd9660_inactivesoftdep_mountmsdosfs_rmdirdb_is_activemsdosfs_fsyncre_setup_sim_imcfdatadeflateInit_ffswi_usb_tx_lockusbd_do_request_async_cbufs_checkpathem_init_eeprom_paramspmap_pte_init_xscalepfxlist_onlink_checkdiskmapreaddb_elf_lookupm_tag_findinittodradler32blf_encvputpte_l1_s_cache_mode_ptvector_page_setprottcbhashsizeworkq_syswqcd9660_setattrfilt_hotplugrdetachbwi_rf_set_nrssi_thr_11busbd_get_configieee80211_node_leave_rsnuaddr_kbootstrapufs_quota_initkqread_filtopscoredump_writebrgphy_bcm54k2_dspcodeusbd_setup_pipexscale_setttbem_read_part_numaue_csr_read_1xscale_cache_cleanIDbuf_acquireieee80211_beacon_allocatu_attachubsa_get_statusdolinkatbioopscpu_classesieee80211_add_htopbpf_setdlttcp_flush_queuepool_setiplmsdosfs_statfslboltpipe_inituvm_wait_plarn_mpath_priousbd_open_pipe_intraes_gcm_reinitsyncerprocrt2560_set_macaddrifa_print_rbufs_ihashinszcfreein_setpeeraddrinphymatchatu_taskwindow_inflatedb_readlinert2661_enable_tsf_syncether_ifdetachsr_meta_native_readieee80211_recv_probe_requhidev_get_report_descuserconf_histcurrndstatscy82c693_writemsdosfs_inactivepciaddr_do_resource_reserve_disabledcurrent_intr_depthpanicstrbwi_set_clock_delaypdc20265_pci_intrupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeif_startunpdg_sendspacesession0bwi_power_offviscpywsmouse_do_ioctlE_abs_lunsw_return_Usedehci_abort_isoc_xferhw_ver__umodsi3copyincomparamsiop_common_resetural_stopudav_sendcd9660_defattrohci_device_bulk_closeehci_reverse_bitsrtalloc1bs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetdes_set_odd_parityuaddr_pivot_selectsigacts0uaddr_free_rbtree_RB_REMOVE_COLORfindblkmajormsdosfsvnode_filtopsntohlsorflushugen_caiophy_funcsuvm_mapent_tryjoinbwi_phy_config_11gttioctlarpintrqvprintfslpqueohci_root_ctrl_methodsttycharssyncdelayuvm_vslock_devicewi_usb_infofrmugenreaduvm_pagealloc_multihidkbd_enableffs_mountral_pci_resumewsmux_mux_closeicmp6errppslimbadaddr_read_2msdosfs_vopsusb_desc_iter_inituhci_add_intrconfig_process_deferred_childrenbufq_waitohci_ifcdieee80211_add_htcapsluphymatchxscale_cache_purgeID_Ebs_notimpl_bs_sm_2in6_setmaxmtuem_camsdosfs_roottqphyattachusbd_finishbpf_getdltlistrt2860_startm_tag_getuvm_map_freelist_updateuaddr_bestfit_insertsb_lockem_enable_tx_pkt_filteringohci_root_intr_abortuhci_polluaddr_bestfit_removert_labelscrypto_unregisterHMAC_SHA1_Finalupl_watchdogsuid_clearttwritedma_alloc_initatu_initem_activatebuf_rb_bufs_RB_NFINDbuflowpagesehci_activatert2661_set_basicratesswapdev_vpre_miibus_writereguipaq_methodsaes_xts_cryptieee80211_deliver_datadead_readufs_pathconffile_pooldb_boot_reboot_cmdohci_timeoutbwi_setup_tx_desc32unputcbwi_rf_lo_measure_11gendluphyattachVOP_CREATEcpuset_firstSHA512Updatecdce_stopifai_cmpbwi_rf_set_nrssi_thr_11guvscom_get_statusnd6_recalc_reachtm_intervalpagetables_startin_ifinitohci_device_ctrl_closepciide_mapregs_nativein_pcbhashlookupsys_mknodatem_setup_transmit_structureskp_dmare_eeprom_putbyteural_writeucom_cleanupVOP_ABORTOPehci_pcdcoredump_tradsr_raidp_free_resourcesbwi_power_onem_identify_hardwaredofchownatsr_wu_done_callbackuhci_idoneuvscom_set_line_codingdefault_chip_mapsys_acceptuvm_map_entry_kmem_pooluvm_pagerealloc_multiieee80211_wep_decryptbwi_rf_calibvalwi_inquireehci_pci_takecontrolleradm1032cloneprobeuaddr_bestfit_pooltcp_rst_ppslim_countieee80211_recv_assoc_respieee80211_parse_rsn_bodyukbd_detachaes_key_wrap_set_keyif_clone_listtc_windupsys_futimesrt2661_update_promiscsdgetdisklabelsysctl_proc_cwdbwi_intrwi_do_hostdecryptsiop_table_syncinternal_commandpci_subclass_wirelessuvm_map_boundarymalloc_errintvlbwi_phy_init_11b_rev5ciphyattachin_losingsis_chip_mapVOP_SYMLINKgeteblkrt2661_suspendrt2661_detachusbd_set_interfaceem_force_mac_fcscsibusmatchinflateBackInit_crypto_kregistervn_ioctluhci_remove_bulkwi_usb_ctl_lockufsspec_readdb_show_calloutrt2661_set_txpreambleaxe_cdpipespacefiqvectorget_last_resort_ifidohci_alloc_stdcmd646_9_irqackip6_sendredirectsbwi_initcast_decryptddb_sysctlsr_get_blockbwi_startukphy_caitimerfixip_stripoptionsieee80211_node_join_11gbwi_init_statechgsyn_cache_countuaddr_stack_brk_createieee80211_add_xratesnd6_timer_chuvm_pseg_releasecpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1ohci_detachbwi_mac_adjust_tpctlwsmouse_add_muxbdevvpifa_ifwithdstaddrehci_cdi80321_bs_mapuaddr_bestfit_selectuvmspace_duseddb_watchpoint_allocudav_ifmedia_changeselectroutein6_nigroupscsi_mode_sense_big_pageauth_hash_sha1sys_mkfifoatuihashrijndaelEncryptscsi_ioh_deltcp_keepintvlsr_raidp_createuvisor_detachcdwriteufswrite_filtopsttybgconfig_searchphtree_RB_PREVwihap_sta_findusbd_printuvm_km_valloc_prefer_waitsyn_cache_poolpci_subclass_mass_storageffs_allocaue_tick_taskdb_preveephy_funcsinphy_funcsucom_hwiflowrgephymatchbswap32ipsec_exp_first_userlphy_serviceplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingrn_walktreepool_prime_pagepciide_ite_productssys_chownuvm_pagewirebwi_calibrateem_stoppci_vga_pciin6_joingroupsys_munlockhotplugattachinflateBackuvm_anfreeuhci_bus_methodsdofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfilerw_exit_readieee80211_iterate_nodeswi_intr_enabletablefullumct_set_line_stateuhub_exploreupl_txeoftcp_maxidlevfs_getcwd_commonset_cpufuncscttyioctlsys_lstatieee80211_recv_wpa_group_msg1ieee80211_recv_addba_respohci_timeout_taskohci_hash_add_tdieee80211_tkip_set_keyiso_uiodircttykqfilterurl_activatecttyopenpmap_link_l2ptinet6ctlerrmapbwi_bbp_power_onicmp6_redirect_diagdisknamessched_queued_cpusumass_quirksdumploRMD160Updatemsdosfs_mountacphy_funcsffs_clusterallocbwi_calc_rssiuvscom_activatenullcnpollcuvm_km_inituvm_objinitbwi_hostflags_readpciide_acard_productsbzero_pageffs_sbupdateudp_sysctlsys_openatm_clcountbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlendb_list_breakpointsusbd_set_protocolrt2860_alloc_tx_ringrt2860_updateedcankmempages_minukbd_accessopsusbclosesis96x_setup_channeludav_matchvector_pagekq_ntimeoutssys_sched_yieldvmspace0bwi_phy_clear_statescsi_decode_sensettywaitwsmousedevprintuvm_map_setuptcp_syn_cache_sizewdc_default_vtblieee80211_add_tieem_defer_attachetextifa_ifwithnetmemchrohci_device_ctrl_doneqsphy_statussqphyattachpte_l2_s_cache_maskcomp_algo_lzsieee80211_recv_barsysctl_cptime2scsi_mode_sense_pageboot_argspipelocksr_raidp_addioumass_scsi_setupproc_pooluplcom_dtraue_intrudp6_inputsys_writert2661_next_scandb_get_valueural_set_txpreamblegeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immedemul_flags_translatesr_uuid_print__bss_end__ip6_insertfraghdrcnstopextent_print_allihashtblieee80211_set_shortslottimesys_dup2em_phy_resetdb_inst_countdb_read_linesiop_productswd_get_paramsbread_clustersys_readlinkbwi_rf_writert2560_setup_tx_descext2fs_size__ashrdi3bs_notimpl_bs_mmapzErrorohci_intrxscale_cache_flushI_SEcrc32ip6_auto_flowlabelsvwsata_mapchanuipaq_cafintek_worklistdevid_copylf_splitifafreeVOP_STRATEGYtimeout_add_sectzucom_rtsxscale_cache_syncIrip_sendspacecoredump_writenote_elf32uhidev_writeusb_generic_tasksxscale_cache_cleanID_rngamap_addtcp_freeqif_setgroupattribsuhci_device_requestcom_attach_subrsii3114_dmacmd_readdvd_authrt2560_node_allocexphy_servicesiop_maumass_scsi_cmdcdreadbufq_disksort_requeuesr_check_io_collisionrt2661_get_rfrt2560_enable_tsf_syncspec_inactiveehci_device_intr_starthidms_setupwi_func_usbwsmux_do_ioctlsys_sendtoicmperrppslimgeneric_filtopsknote_dropuftdi_setcue_watchdogin6_selectsrcrd_casoftclock_siem_82547_fifo_workaroundwi_usb_threadsr_ccb_putin6_pcbsetportalldevsbwi_vendor_led_actrt2661_iter_funcwddumpicmp_do_errorvmcmd_map_readvnsmsc_initrandom_startcomconsfrequsbd_get_interface_altindexamap_extendsigpropvmapbufumass_scsi_switchi80321intc_intr_initdehashtblsocketopssiop_pci_matchscsibus_bioctlX_db_sym_numargsnd6_maxndoptuvm_map_clip_startffs_fragextendtcp_always_keepaliverawcbtablespec_readumodem_cdunp_markacphyattachdes_key_schedicmp_mtudisc_timeoutnwsmuxpmap_zero_page_xscalettyread_filtopsuvm_mapiic_printusbd_bulk_transfergetinoquotabrgphy_5708s_statusscsi_do_ioctlrtable_existsdisk_lock_nointrehci_free_sqhcd_resetX_db_foralluhci_pci_cascsi_ioh_addbwi_mac_reset_hwkeysscsi_detach_busudpstatroute_inputsetrootcd_read_tocural_amrr_updatecdioctlieee80211_defrag_timeoutbufq_switchcue_stopuvscom_detachifmedia_addatu_usb_requestfrag6_queuelxtphy_funcssr_matchusbd_set_config_indexlogopenluphy_serviceieee80211_add_rsn_bodyrt2560_txtimert2661_rxratecd_buf_donescsi_devid_pg80breadntcp_hdrszscsi_devid_pg83tcbtableieee80211_recv_4way_msg2i80321_mem_bs_init__xordi3frag6_drainuvm_objtree_RB_REMOVE_COLORdosdiremptyigmp_slowtimoifpromiscre_disable_sim_imip6_setpktoptsfork_returnsys_getsocknamecd9660_lookupricohrtc_cawi_usb_intrusbd_alloc_bufferinflatePrimemask_rnheadsw_reg_iodonepte_l2_s_protoufs_roottcp_sysctlVOP_SETATTRsmsc_chip_initpmap_kremovesigactsinitohci_pci_caffs2_blkprefdomknodatusbd_set_reportcpu_kcore_hdrexec_elf32_fixuprt_newaddrmsgvop_generic_lockcomconsiotuvmfault_anongetconsttysr_concat_free_resourcesbwi_detachural_bbp_readsr_ioctl_diskusermountext2fs_dirrewrite__ucmpdi2vn_closefilepci_findvendorumass_discoip_mtudiscvfs_free_netcredem_power_up_serdes_link_82575mld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_matchusbd_get_protocol_nrssi_thresholdpmap_l2dtable_ctoruvm_mapent_forksharedm_pullupenterpgrpxscale_tlb_flushID_SEnull_zerokeycrypto_freesessioncnbellm_copydatabufq_nscan_requeuegetdirentries_internalatu_stopcd_setchanieee80211_get_probe_reqmtx_leavefilt_signalsigactsfreert2560_free_rx_ringwdc_default_write_raw_multi_4ttymallocupl_attachums_intricmp6_notify_errorieee80211_recv_probe_respbs_notimpl_bs_sm_4pcisubmatchkue_setmultimmioctluaddr_free_rbtree_RB_NFINDuvm_coredump_walkmapdb_nextumass_matchsched_choosesendsigohci_device_ctrl_methodsbpf_ifnameehci_allocmohci_cdural_ioctlsmsc_iffvfs_busytimecounterfilt_ufsdetachbufq_initlf_getlocksr_raid6_xorpsolistenpdc205xx_drv_probewskbd_compose_valuespec_getattrpciide_dmactl_readobio_bs_unmapiic_scanip_ecn_ingressmsdosfs_bmaprip_ctloutputffs_vtblif_getgroupieee80211_parse_rsnpool_debuguserconf_morekqueue_ioctlmax_processesem_free_pci_resourcessys_wait4rip6_recvspaceamap_share_protectieee80211_bar_tidfs_sysctlukbd_cnattachieee80211_ibss_mergeboot_filefilt_sordetachpsignalieee80211_regdomain_compare_cnconfig_pending_incrusb_task_threadbwi_mac_unlockamap_pp_establishauth_hash_gmac_aes_192ieee80211_setkeysuvm_pmr_nextszatu_activateuvm_anon_initffs_reclaimbmtphy_causb_free_deviceusb_exploreifaddr_items_RB_REMOVE_COLORbufq_nscan_queuexscale_cpufuncsif_link_state_changepmap_virtual_spaceieee80211_add_wpaieee80211_eapol_key_check_micusb_disconnect_portpage0_endieee80211_add_capinfobpfpolluvm_pmr_nfindszupdatepriohci_activateciphy_fixupbwi_mac_lockbmtphy_servicesched_kthreads_createuhci_device_bulk_closeuhid_cdwskbd_cnbellbintimesr_crypto_intrbwi_set_clock_modere_woluhci_intr1jmicron_chip_mappciide_print_channelswi_seekfilt_soreadpmap_remove_allrtable_addrt2860_mcu_bbp_writezeropageipsec_def_encbrgphy_bcm5401_dspcodeffs_nodealloccgbwi_mac_calibrate_txpowersoftintr_establishuvm_pmr_removeip4_input6pdevinit__iordi3uvm_pmr_findnextsegmentinetctlerrmapresetpriorityrt2560_set_slottimeenoioctlrt2860_watchdogwi_usb_start_threadbwi_dma_txstats_allocsigacts_poolpcaled_matchexecsigsconfig_initip_weadvertiseskip_fcicmp6_redirect_inputbuf_rb_bufs_RB_REMOVE_COLORrw_enteraue_read_macpciaddr_print_deviduvm_addr_destroyuvm_pmr_size_RB_MINMAXdb_access_abt_spnd6_ra_inputffs1_blkprefin6addr_loopbackuvm_objtree_RB_MINMAXttypenduvm_swap_freepagesqsphymatchnd6_dad_starttimerin_revarpinputstrlcpyuaddr_bestfit_destroyX_db_symbol_valuesiopiic_attachehci_device_isoc_methodsumodem_setusbd_reload_device_descsmsc_read_regext2fs_advlockknote_fdcloseusbd_get_devcntehci_device_intr_doneem_get_pcs_speed_and_duplex_82575if_clone_detachpipe_rfiltopssiop_dmamem_allocubsa_openin6_cksumcomcninitpciide_print_modesstrncmpcsrc_ptedes1_decryptvfs_shutdowngetsockieee80211_get_deauthbwi_newassocbs_notimpl_bs_c_4upl_startsyn_cache_respondif_creategroupllinfo_nd6sbcheckreservepreemptuvm_iobioattachieee80211_begin_scanunixdomaindb_next_free_breakpointbwi_led_attachbwi_tbl_write_2smdscsibusattachumct_rtssyn_hash1ulminwihap_data_inputi80321intc_do_pendingdb_last_symtabproc0paddrrn_addmaskifaddr_itemspciaddr_do_resource_reserveusb_attachbpf_bufsizeselscanpciide_promise_productssoo_pollumodem_activateuvm_map_uaddr_ertafidx_maxsig_filtopsknote_processexitohci_device_bulk_transferukbd_cdricohrtc_getcalwskbdopenrt2860_reset_rx_ringrt2661_eeprom_readem_startttclosurl_rxeofipsec_soft_allocationssleep_setup_bus_dmamem_mapip6_fragmentnet_sysctlcom_cdbwi_mac_init_tpctl_11bgtimeout_adjust_tickswskbd_do_ioctlxscale_cache_cleanD_Euvm_pmr_size_RB_FINDudv_listdead_ioctlaue_initusb_matchbwi_txeof__wdccommand_startsysctl_iflistvwakeupcmd680_channel_mappci_subclass_bridgeif_clonersrt2860_set_txpreamblewdcbit_bucketvgonewdc_probe_capspmap_initializedtcp6_ctlinputsched_init_runqueuesdb_stack_trace_cmdusb_allocmemsd_sizeufsspec_closend6_prefix_offlinkuvm_anon_dropswapwi_detachucom_lockigmp_inputkmemusageswcr_sesnumlf_getblockpciide_irqackautoconf_attdet_mtxumodem_attachtcp_rttdfltcleanerprocpdc202xx_pci_intrieee80211_parse_edca_params_bodysbappendstreamm_tag_copy_chainrt2661_bbp_writeohci_handoverusbd_intr_transfer_cbsowrite_filtopssr_chunks_unwindstrncpycseadddb_disasmsdreadupdatefatscue_memata_perrorvfs_getvfsaue_txeofffs_sync_vnodedeflateInit2_sr_raid6_discipline_initproc_stopvfs_vnode_printdb_history_lastrrticks_initbio_status_initusbd_set_port_featureusb_run_tasksbpfilter_createsysctl_locklockfpoolwihap_disassoc_reqieee80211_find_nodecpu_switchtoucom_cahtonlsched_all_cpususb_find_descin6_mask2lentcp_dooptionsdos2unixtimesys_sigactionsr_scsi_donedeupdatehci_ifcdSHA256Transformrndlock__negdi2in6_purgeaddrcpu_modeluhci_softintrsii3114_read_regarm_dcache_align_maskcttyreadcd9660_unlockpciide_dmactl_writeuserconf_cmdsural_taskbwi_set_bssidiophy_statusschedclockbpfioctlconfig_attachsr_sensors_createohci_alloc_sitdcue_rx_list_initbwi_hostflags_writert2661_attachhookbmtphy_statusdisk_unbusysysctl_fileusb_syncmemugen_detachi80321_io_bs_freesoisconnectedurlphydebugamap_clean_worksuhci_alloc_std_chainusb_block_freememVOP_PATHCONFumass_fixup_sonydk_mountrootassertwaitokdb_run_modescsi_minphysauth_hash_key_md5siop_script_syncxscale_cpwaitvattr_nullsys_getsockoptrt2661_tx_mgtre_rxeofumct_paramuhidev_attachfrag6_nfragpacketsdb_linesr_raid0_assemblebwi_cdpool_allocator_largein6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlite_chip_mapcpu_get_controlVOP_READLINKbuf_mem_initumass_cbi_methodsdb_ed_stylemii_submatchuvmexp_printohci_root_intr_transfermsdosfs_pathconftimeout_wheelbwi_pci_conf_readbpf_m_xhalfumass_io_getaverunnablecd9660_getattrttyfreettysleepehci_root_intr_donert2860_rx_intratu_get_opmodeunp_disposescsi_inquireufs_getattrBlowfish_encipherieee80211_mhz2ieeevfs_exportuplcom_closesr_hotspareuvm_km_pgremoveex_region_plfscalesmsc_matchffs_alloccgblkip_optcopyvfs_registerieee80211_proto_attachm_livelocksys_dupmcllowatmii_printieee80211_setup_ratesbpfilterattachproc_stop_topci_find_devicetimeout_todoswcr_initdb_lcbwi_updateslotumsm_truinstall_changemodecpu_read_cache_configumsm_detachwdc_sii3114_vtblsr_ioctl_createraidpanicget_pc_str_offsetciphy_resetural_rxeofcue_rxeofL_cksumdatamsdosfs_lockseltruepci_subclass_systembpf_m_xwordscsi_xs_syncieee80211_recv_group_msg2softdep_initializestackgap_allocunp_shutdownieee80211_tkip_encryptwi_resetdovutimensdummy_get_timecountext2fs_sysctlgeneric_bs_wm_4kthread_run_deferred_queuearc4_initsr_raid1_recreate_wuwdreadlastdaycheck_execdb_max_linewi_usb_cdtcp_initpte_l2_s_cache_mode_ptdeferred_config_queueciphy_funcsucomreadcbbuf_rb_bufs_RB_MINMAXnetisr_initipport_lastautouhci_endpdsis_setup_channelwsmux_detach_sccom_raisedtrdb_last_commandicsphy_statusip6_pcboptwinSlotCntvn_kqfilterext2fs_syncsched_stoleni80321_io_bs_unmappte_l2_s_prot_maskpciide_intr_flagudav_ioctlcrypto_registercache_purgevfspostsigsys_pathconfcue_open_pipesin_addmultigetmicrotimebs_notimpl_bs_rm_8maxumass_clear_endpoint_stallohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_initi80321_i2c_attachtcp_templatemsdosfs_readdb_object_print_cmdieee80211_notify_dtimrt2860_select_chan_groupfintek_write_regsr_crypto_finish_ioohci_initcomopensata_setup_channelusbd_setup_xferauth_hash_hmac_sha2_512_256ieee80211_tree_RB_MINMAXmtagpoolpiix_chip_mapbcopyiic_attachwsmouseclosewdog_autourl_tick_taskcue_detachusbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_optuaddr_rnd_removetcp_reasssys_getfhext2fs_vgetrt_timer_timerrtbl_id_maxcomcnputcKERNEL_BASE_physSHA1Update_intehci_alloc_sqtdcuio_applygeneric_bs_rr_1ni6_addrsaxe_resetdefrouter_addreqin6_clearscopebwi_pci_cand6_dad_ns_inputuvmpd_tuneusbd_set_addressudav_openpipesffs_setblockipsec_expire_acquirepci_suspendkue_stopicmp6_mtudisc_cloneatu_send_commandinflateResetmemcmpwskbd_init_keymapobio_bs_subregionnamecache_rb_cache_RB_REMOVE_COLORumct_dtrip6_dad_pendingieee80211_rate2plcpmsdosfs_createcd9660_startdb_output_linebwi_get_card_flagsbwi_rf_get_gainscomstartaes_xts_reinitdb_examinecfroots_sizedb_end_linebwi_mac_gpio_finitickadjpool_alloc_item_headeriq80321_irq_mapip6_splithdruvm_map_addr_augmentsiop_clearfifotcp_secret_initieee80211_recv_sa_query_reqsbreserveundefined_initvrecycleem_phy_hw_resetubsa_matchextent_printieee80211_alloc_nodeblf_ecb_decryptcrcopydb_symformatural_newstatewdcloseundefined_handlerssys_revokeural_free_rx_listsysctl_stringsys_rebootuvm_unmap_kill_entryext2fs_specvopsbufpoolproc_finish_waitwdccommandext_dist_code_bus_dmamap_load_buffercpu_forksigonstackuaddr_kbootstrap_selectwi_write_data_iodb_print_ifattylistwdopenuvm_vslockre_initdeflateResetuvmfault_update_statscast5_setkeypci_ndomainsttyoutputkue_caexplicit_bzerocd9660_tstamp_conv17wskbd_calxtphy_statusuftdi_8u232am_getratetqphy_cdcopyaddroutcryptodev_cbumodem_detachcpuset_add_alluhci_root_intr_abortrn_mkfreelistVOP_READbwi_phy_calibrateufs_ioctlffs_freefilein6ifa_ifpforlinklocallastdtimegetdisksys_setuidiq80321_pci_init_wdc_ata_bio_startstart_updatesiop_common_attachudav_cdusbd_clear_port_featureusb_abort_task_threadufs_quota_free_blocks2re_stopsenditsr_crypto_decryptudp_detachbufq_fifo_destroyacer_dma_initcluster_writernd_event_tailhidkbd_decodeuvm_setpagesizeehci_root_intr_closetcp_xmit_timersr_raid1_rwucomwritein6_recoverscopensphy_serviceaue_ticki80321intc_cdsr_raidp_set_vol_statetimeout_add_tvticksvwsata_write_regmclpool_warnmsgi80321intc_cadb_termscsi_preventmmcloseieee80211_get_assoc_respcd9660_accesssr_wu_getffs_statfsuhci_shutdowncpuset_complementrijndael_set_keywdcprobeiophy_cdudp_recvspacekm_allocfill_file2fdropi80321_mainbus_matchgf_initsyn_cache_unreachuserconf_histszsys_getrlimitrt2860_attachhooki80321_mainbus_foundicmp6_errcountbpf_attachdfintek_cdicmp6_ctloutputieee80211_ba_move_windowcpuset_issetsvwsata_dmactl_writeufs_dirremoveumct_setrgephy_serviceieee80211_add_timif_attachsetuppipe_writem_clsetwmssr_set_chunk_stateuvm_map_addr_RB_FINDcryptof_pollin_pcblookup_listensbappendm_copybackscsi_remove_linknd6_rtmsguvm_swap_puticmpbmcastechoHMAC_SHA1_Initextent_print1db_continue_cmdrt2661_mcu_beacon_expireehci_timeoutbufheadconfig_scanwi_get_nwkeykp_pageablesr_raid6_addiopmap_copy_page_funcripsrciso_nchstatsem_update_eeprom_checksumkue_txeofugenkqfilterural_amrr_startnlineswdb_restart_at_pcdb_sstep_printohci_rem_edether_ifattachusbd_devinfo_allocinflateSyncsr_raidp_xor__wdccommand_doneumass_adjust_transfersignal_initfill_drlistffs_updatedb_print_formatrt2560_tx_bcnwsmuxcloseunix2dosfnspec_advlockmtdphy_cdfragtblraw_sendspaceubsa_cauvscom_breaknullopre_attachuftdi_2232h_getrateAES_CMAC_SetKeycomdiagextralocunsleepvop_generic_bmapwdprobescsi_xs_getX_db_lookupmtdphy_funcsuipaq_seti80321intc_matchblf_encryptsched_proc_to_cpu_costohci_alloc_std_chainipintrgetnanouptimeohci_pci_detachuhci_pci_detachudav_activatei80321_pci_attach_hookdes3_encryptmaxdmaprt2661_tx_dma_intrural_alloc_rx_listusb_block_allocmemext2fs_symlinkdb_skip_to_eolip6_savecontroldevice_registerpciide_chan_candisablesr_raid6_set_chunk_statend6_dad_stoptimerq_to_bmountrootsyn_cache_resetdb_inputcharuhci_device_intr_doneuhidev_opendb_boot_cmdsundefined_entryip_initreaddeprocess_read_fpregsohci_freexural_txtimecd9660_rrip_getnameufs_check_exportdes_encryptsysctl_rdintpdc20268_setup_channelcd_interpret_sensein_mask2lenbwi_ack_rateural_eeprom_readscsi_iopool_destroylodirtypagessr_ioctl_disciplineem_probeumct_get_statusfindwin95VOP_WRITEsys_nanosleepre_rx_list_initstart_init_execifa_update_broadaddratu_detachnd6_addr_addifa_ifwithaddrsr_dumpclock_ymdhms_to_secssiop_add_devuhci_root_intr_transferbwi_dma_freebwi_phy_init_11b_rev2db_write_cmdrootduidif_clone_attachuplcom_get_statussys_getfsstatohci_abort_xferbpfopencdstrategynetisr_intrem_config_collision_distnatsemi_irqackdeflatePrimerandomwrite_filtopsnd6_slowtimo_chuvm_km_valloc_alignenc_xform_nulldb_max_widthip6_pullexthdrmalloc_printitcpu_idle_enterbwi_regwin_disable_bitscomwriteuvscom_intrbuf_kva_starttuagg_subVOP_RENAMEauth_hash_gmac_aes_128cdclosecast5_zerokeysys_fchdirsr_crypto_readsysctl_ifqprocess0ieee80211_send_eapol_key_reqm_cltick_tmorandompidwd_cdurl_initfilt_ttyrdetachrt2560_update_plcparp_inuseuhidwrite_bus_dmamap_destroyvn_polluhci_device_isoc_methodsinet6swrouteswdosdirtemplatemainbus_cddb_uvmexp_print_cmdre_ioctlsys_mincorepdc203xx_setup_channelieee80211_tree_RB_REMOVElastsecondswdog_timeoutpci_probe_devicewsmousedoopenwi_get_txpowerural_plcp_signaludav_stopusbd_error_strsusbd_sync_transferlun_switchamphymatchtcp_maxpersistidleudav_tx_list_initspec_ioctlufs_initproc_reparentrt2661_select_antennauvm_exitfc_bmapcallspr_rmpageffs_initcluster_wbuildsr_crypto_createsvwsata_dmacmd_writescsi_ioh_setbootsyncuvm_initaue_attachieee80211_crypto_attachsys_ioctluvm_map_addr_RB_NFINDif_free_sadldb_dotbwi_mac_gpio_initucomstopieee80211_node_joinfilt_bpfrdetachcompress2umodem_openicmp6_initbwi_mac_shutdownbs_notimpl_bs_rm_1disassembleuvm_mapent_free_insertfilt_ttywritepool_update_curpagesiop_script_readhid_end_parsein_setsockaddrpool_set_ctordtorcy82c693_readbpf_moveiniq80321_hdlg_irq_mapostypevndbuf_poollastpiduplcom_resetuvm_page_physloadaxe_iffucomstartreset_entryuvm_pmr_remove_1strangere_setup_hw_imwdcresetwdc_exec_xferip6_insert_jumbooptipintrqtuaggohci_noopusb_frag_freelistip_slowtimordsizerijndaelKeySetupEncrt2860_load_microcodeubsa_rtsip6_nexthdrrtdeletemsg__bss_startumsm_openrt_tab2domdcphy_cdbwi_rf_readpciide_via_productskue_rxeofsiop_attachrijndael128_encryptVOP_KQFILTERukphy_funcssys_msyncdeflate_compresswskbdreadsbappendrecordevcount_detachsd_cabwi_free_txstats64ixp_chip_mapsoftdep_fsync_mountdevinitmsgbufehci_device_bulk_startwsmouse_attachpciide_intel_productsuipaq_dtrmemsetcuio_copydatapipe_free_kmemufs_getlbnsieee80211_get_actionieee80211_sa_query_requestphysiosr_ccb_doneohci_strin6_selecthlimdb_show_all_vnodesupl_sendwdattachdb_symbol_is_ambiguousmii_phy_delete_mediausbd_set_report_asyncin6_unlink_ifacrypto_kdispatchicmp_mtudisc_clonert2661_rf_writeuvm_pmr_insert_sizesodisconnect_spllowerumct_closesys_setgroupsmainaue_csr_write_2lxtphy971_funcsucomttyohci_device_bulk_doneether_crc32_le_updateusbd_initmtdphymatchtimespecfixbwi_read_spromsr_raid1_set_chunk_stateuplcom_opensiop_lookup_productuaddr_bestfit_createural_set_basicratesip_flushieee80211_delete_keykue_startre_watchdogsiop_scsicmduvm_unmap_removepmap_alloc_l1svwsata_chip_mapi80321_mem_bs_unmapicmp_errordb_hangmanwsmuxdevsbs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbaddes_set_keykqueueopsrt2860_iter_funcsmsc_miibus_statchgvholdbufq_fifo_dequeuepciide_map_compat_intrubsa_parityidgen32db_help_cmdrt_if_removesr_minphysscsi_default_getghash_gfmulusbd_no_quirkrt2560_ack_ratere_read_eepromsis_hostbr_matchuipaq_matchm_adjsr_wu_donemld6_stop_listeninghotplugioctlsvwsata_read_regpmap_map_chunkppsratecheckkmemlimitbuf_rb_bufs_RB_PREVrt2560_rf_writebwi_ioctlbwi_init_rx_ring32amap_copybufq_drainphysical_endbwi_phy812_valuebwi_rf_calc_nrssi_slope_11bbio_statusuhci_allocmuhidpollsched_wasidleieee80211_ieee2mhzieee80211_dup_bssi80321_io_bs_mapuaddr_hint_destroylf_findoverlapsr_raid_start_stopfilt_msdosfsvnodebwi_txtimelf_wakelockkv_anydb_sym_numargskue_attachhookdumpconfAES_CMAC_Initwi_rxeofehci_pci_detachbrgphy_cahpt_pci_intruaddr_lin_selectdead_badopbwi_dma_mbuf_destroypciide_dma_finishpool_large_alloc_niblf_cbc_decryptcalcrusys_unlinkdb_cmd_listmainbusmatchrt_setgatetcp_ack_on_pushpmap_growkernelext2fs_rmdirufs_chowndofchmodatsysctl_intupl_tx_list_inituvm_shutdownkqueue_closepte_l2_s_cache_modeuvn_initstrlcatifnet_addrssysctl_int_arrbs_notimpl_bs_wm_8uvm_map_set_uaddrcdce_matchsoftintr_dispatchdisk_unlockpciide_cypress_productsufs_ihashremieee80211_recv_4way_msg2or4cttywrite_bus_dmamap_createSHA256Inittcp_update_sndspacesr_crypto_doneurl_stop_taskpciaddr_device_is_agpsdmatchusb_freememudav_txeofpool_chk_pageproc0cdce_initufs_renameaxe_caext2gennumbersr_bio_ioctlbwi_rf_calc_txpowerudav_attachuvm_map_entrybyaddrsr_already_assembledusbd_get_hid_descriptorrt_ifannouncemsgsoo_readbwi_rf_lo_update_11guvm_km_doputpagepciide_vendorspci_get_powerstateufs_opencopyout_statfspmap_modify_pvi80321_intr_establishm_catbwi_free_tx_ring32splxbwi_regwin_switchohci_pci_attachrtinittqphy_statuscluster_collectbufskp_dma_contigsiop_handle_qtag_rejectwi_write_data_usbumass_scsi_minphysuvm_swap_inittcp_nowaue_miibus_statchgdb_trace_until_matching_cmdproc_printitural_bbp_initdes1_setkeyunp_gcsys_clock_gettimeip6_hdrnestlimitcsefreepool_catchupcpuset_clearxscale_cache_syncI_rngfrag6_initsiop_sdtr_negbuf_replacevnodeuvm_pmr_size_RB_NFINDiq80321_pci_intr_mapre_miibus_readreguvm_mapent_addr_removetimeout_setrdread__subdi3ntohsmsgbuf_putcharbwi_media_change_bus_dmamem_freeinet_ntoadb_boot_poweroff_cmdsd_flushcd_setvolext2fs_mkdirohci_openext2fs_direntersys_symlinkatmii_pollstatrlphy_cawdgetdisklabelrw_exitpciide_machdep_compat_intr_disestablishkv_pagedupfdopeni80321intc_calc_maskidgen32_initbwi_dma_ring_allocrt2661_amrr_node_freeifmedia_list_addpidhashrt2661_updatestatsrtprefxscale_context_switchuvm_totalencdebugicmp6_ratelimitdb_unread_charsr_raid1_createsys_mkdiratiic_searchdofstatatstart_inituhub_attachieee80211_recv_assoc_reqether_fakeaddrsysctl_tc_hardwarert2661_prepare_beaconsmsc_rxeofscsi_ioc_ata_cmdtcp_mssdfltrt2661_alloc_rx_ringrt2860_updatesloti80321_bs_unmapuvm_swap_freeatu_newbufdata_abort_handlerbwi_tbl_write_4bs_notimpl_bs_r_1umsm_closeaxe_initdb_look_charuhidev_set_reportin_pcbdetachmsdosfs_vfsopsaue_ifmedia_updttycheckoutqrt2560_watchdogpiix_timing_debugicmp6_mtudisc_callback_registerdb_set_variableuvscom_set_linevm_map_unlock_read_lnaue_causb_explore_tasksrnd_event_spacesr_concat_rwpmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachdb_search_symbolcn_tabswaplist_insertsmsc_lock_miiip_forwardextent_createrdclosebpf_freeddisklistin6_lifaddr_ioctlsys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectem_mta_setip6_mforwardingnd6_setdefaultifaceffs_isfreeblocki80321_mem_bs_freeseltrue_kqfilteruvm_map_lookup_entryhztoicsphymatchBlowfish_expandstatebs_notimpl_bs_w_4ieee80211_get_probe_respdead_strategypciide_dmacmd_readswi_handlergcu_miibus_writeregni6_store_addrsspec_fsync__wdcwait_resetuvm_map_deallocateicmp_reflectieee80211_parse_wpamii_phy_activatescsi_xsh_iohext2fs_reclaimpciide_acer_productsffs_ballocsys_getgroupsieee80211_node_attachsys_linkatuhub_cdwi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textumodem_get_capsufs_startsigstkinitbufq_disksort_dequeuebrgphy_mii_phy_autoohci_devd__end__kinfo_vdebugbwi_start_tx32rt2860_ampdu_rx_stopnsphy_reseturl_sendcdce_encapufs_bmaparrayfragtbl8i80321_mainbus_attachuvn_sync_lockaes_ctr_setkeyumct_attachurl_resetusb_needs_exploreswaplist_findufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachre_startwsmouse_cdricohrtc_settimeVOP_FSYNCbwi_mac_get_propertyffs_sysctlipport_hilastautoarpinit_doneusb_wait_taskuvm_anon_pageinspec_closecd9660_closeuvm_map_mkentryem_initialize_receive_unituvm_map_addr_RB_REMOVEsys_shutdowncngetcehci_rem_qhsii_fixup_cachelinetc_adjfreqrnd_statesuaddr_pivot_createm_gethdrem_dma_mallocugen_activateconfig_rootfoundcue_cdputcsiop_resetsii3114_mapreg_dmaieee80211_phymode_namebufbackoffricohrtc_attachsysctl_rdstruct__divsi3uhidev_cdwsmousereadxscale_minidata_clean_sizeschedcpui80321_gpio_pin_readbwi_mac_bss_param_initrt2661_attachurlphy_servicesbappendcontrolukbd_set_ledswihap_sta_timeoutsiop_update_scntl3pciide_nvidia_productsugenread_intr_filtopssoftdep_flushfilesdb_access_und_spipv4_inputm_getclrpool_headwsmuxioctlsr_crypto_read_key_diskusbd_interface2device_handlepcaled_cdipforwardingdb_lexohci_device_isoc_transferieee80211_get_cts_to_selfusbd_open_pipe_ivalicmp6_redirect_timeoutsyn_cache_lookuparc4random_statebwi_setup_tx_desc64prtactiveksym_upcaseufs_makeinodescsi_xs_ioip6_process_hopoptsusbd_find_edescfilt_ttyreadsys_getpgiduhci_runcom_common_putcswaplist_trimcache_lookuprdioctluhci_allocxobsd_pci_mem_findrijndaelKeySetupDecdb_boot_crash_cmdbwi_rf_on_11auvm_objtree_RB_INSERTsysctl_tcurl_detachbs_notimpl_bs_rr_1umass_scsi_sense_cbrijndael_encryptricohrtc_clock_writeieee80211_recv_mgmtbwi_newstate_beginumsm_get_statusaxe_detachdumpsizesowwakeuppci_matchbyidukbd_keydesctabsr_raid_inquirysmsc_setmacaddressextent_freeuvm_aiodone_daemoni80321_gpio_pin_ctladdupc_tasksched_syncusbd_clear_hub_featureext2fs_vopsieee80211_send_4way_msg3db_mount_print_cmdcomcloseiopxs_mainbus_caeephy_attachsetsigvecsiop_dmamem_freeurl_iffsys_sendmsgi80321_bs_barrieruhidopenvn_marktextiic_cdbrgphy_bcm5411_dspcodestrcmpsys_quotactluhidev_matchsr_raid_startwuieee80211_get_hdrlenuaddr_pivot_destroytcp_mtudisc_increaseulmaxatu_txeofin6_pcbconnectdehashluphy_cakue_cduvm_pmemrange_addr_RB_INSERThook_disestablishexphy_funcsbpf_catchpacketffs_isblocksr_concat_createucomwritecbdb_stack_trace_printusbd_find_quirkuvm_swap_allocpagesuvm_aobj_poolhotplugclosedb_show_frame_cmdsys_adjfreqpci_cadb_examine_cmdqsphy_funcsuvscom_seticmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_initscsi_ioh_runqueueuaddr_lin_functionsuvm_addr_entrybyspaceata_set_modemii_phy_auto_timeoutsyn_cache_getnetisrdb_clear_breakpointsttyrubieee80211_get_ratevop_generic_islockedrt2860_reset_tx_ringuaddr_hint_poolm_pulldownbufcachepercentbwi_mac_detachacer_pci_intrpmap_initufs_rmdircryptodevkey_cbrlphymatchieee80211_next_scanpmap_zero_page_funcarmv4_tlb_flushD_SEminsr_meta_native_writeuhci_device_ctrl_abortip6_initconfig_detach_childrenrawcbpdc203xx_write_regsmsc_detachukbd_cngetcz_errmsgtcpcb_poolsr_shutdownhookrt2860_updateproti80321_pci_make_taguvm_map_addr_RB_INSERTBlowfish_stream2worduhidclosetimeout_add_msecipip_allowsys_polluvm_map_clip_endufs_makedirentryusbd_set_configuvm_mapent_mergeieee80211_recv_addba_reqm_defragem_write_pci_cfgrtable_l2setvnode_hold_listlastdosdateudav_unlock_miibuf_rb_bufs_RB_NEXTuhci_add_bulkral_cdufs_linksched_choosecpusys_mkfiforicohrtc_matchuaddr_free_rbtree_RB_REMOVEzcallocdb_cmd_searchifa_ifwithafural_read_eepromin6_ifinitin6_leavegrouprtlabel_id2sasqphy_caem_reset_hwsddumpiminsys_chflagsobio_bs_tagget_hw_ifidKQRELEdelaypci_reserve_resourcessdstartdb_machine_command_tableip6_hopopts_inputddb_regsselfalseieee80211_media_initricohrtc_gettimescsi_default_putcom_enable_debugportpage0_datavn_isunderusbd_get_port_statusuvm_pageoutpffindtypepdevnamespci_subclass_dockuipaq_breakqsyncwi_setmultiuvn_clusterifaddr_items_RB_MINMAXre_gmii_writeregcd9660_vptofhwi_attachusb_camii_phy_downuvmspace_forkraw_initknote_enqueueums_accessopsudpcksumtcp_sendspaceurl_csr_write_4db_maxoffuvm_pmemrange_addr_RB_REMOVE_COLORffs_oldfscompatieee80211_add_rsnrijndael_decryptwdcdetachmaxlocksperuidfilt_ugenrdetachin6_matchlensys_madviseupl_openpipesehci_device_ctrl_methodsrt2560_plcp_signalscsibusdetachdisk_attachwskbd_displayioctllm75probeip6_clearpktoptsncpusdb_cmd_loop_donearptfreeubsa_detachfilt_ugenread_intrdb_show_arptabbufadjustcom_detachieee80211_ccmp_encryptaxe_stopural_set_macaddrbs_notimpl_bs_w_2dead_printeephy_serviceinphy_servicemii_media_tablesr_discipline_freebwi_rf_lo_devi_measurewdstrategyrt2860_set_macaddrttyprintfi80321_pci_bus_maxdevsreaperprocsigcodedb_elf_search_symbolhpt_chip_mapipip_inputdeflateCopyieee80211_send_group_msg2db_delete_watchpointcomttybuf_undirtysysctl_tstringsr_meta_cleardb_watchpoints_insertedusbd_start_nextxscale_cache_cleanDfilt_ttywdetachamap_swap_offpool_allocator_nointrbwi_pci_attachsys_sysarchrt2560_disable_rf_tuneBlowfish_decipherbio_validateigmp_initmii_phy_add_mediafilt_msdosfsreadwritecpu_reset_needs_v4_MMU_disablecache_zapMD5Initem_txeofpcaled_gpio_pin_writecryptodesc_poolbus_space_write_raw_multi_2ffs_vfsopssysctl_mallocwihap_ioctlcpu_info_storeieee80211_outputfrag6_slowtimouvm_pmr_insert_addruvm_map_hintwant_reschedrt2661_amrr_node_allocpmap_bootstrap_pv_allocatormsdosfs_mkdirkthread_create_deferreduhci_free_sqhieee80211_ioctluhidevsubmatchbufq_disksort_destroycrc32_combinebufq_simple_nscandevid_freeboot_eaddrre_rx_list_fillieee80211_sa_query_timeoutscsibusactivatend6_timercomcnpollcatu_matchbioopenbwi_phy_set_bbp_attenqsphy_servicein6_ifloop_requestcd_patterns__cmpdi2crypto_workqsr_crypto_create_keyssd_ioctl_inquiryscsi_xsh_adduvm_pmemrange_addr_RB_FINDraw_detachscsi_xsh_runqueuepmap_get_pdeural_read_multibs_notimpl_bs_wr_1domainnamelenehci_pollpciattachigmpctl_varsusbd_get_report_descriptorsd_thin_paramsip_rtaddrfiledesc_initrt2661_enable_mrrload_dsatag_switchurl_ifmedia_statuspciide_pci_readatu_get_cmd_statuscue_csr_read_1vrelewi_set_pmwsmux_do_displayioctlohci_alloc_sedem_set_media_typeem_update_link_statusscsi_xs_errorprtrealloccheck_consoleamap_freeem_detachin6_domifattachugen_get_alt_indexusb_blk_nfreend6_prefix_lookuptc_getfrequencyrt2661_mcu_cmd_intruhci_device_ctrl_methodsbwi_rf_lo_adjustsync_inactivespec_printext2fs_lookupmsdosfs_openehci_hubdext2fs_linkvop_generic_revokeohci_hash_add_itdusbd_get_bufferieee80211_add_erpieee80211_decapfilt_sigdetachfilt_seltruedetachext2fs_renameipsec_def_authuhci_add_loopusbd_setup_isoc_xferttywflushcd9660_rrip_offseturl_startwskbd_default_keyrepeat_datacomcnmodeclosefcomioctlumass_cbi_resetscsi_ioh_deqsoftdep_sync_metadataif_clone_lookupgetmicrouptimerandom_initdisk_openpartmii_tickip6_dad_countem_pci_clear_mwiatu_complete_attachumct_breakuvm_pager_dropclusterfilt_generic_detachuvscom_rtsip6_getmoptionssensor_task_unregisterehci_intrlist_timeoutbwi_rf_calc_rssi_bcm2053pool_print1wdc_ioc_ata_cmddb_breakpoint_listcd_get_parmspmap_extractrt2860_set_channd6_ifptomacwsmousedoioctlamap_unaddural_watchdoguvm_pmr_insertcd9660_printsr_meta_saveohci_rhsc_enableif_congestionnfilescd9660_islockedin6if_do_daduhci_root_ctrl_transferrt2560_amrr_timeoutcue_txeofrt2661_amrr_node_findatu_rxeofaue_detachcryptodev_keyieee80211_iserp_stapipe_kqfilterem_configure_k1_ich8lannforce_pci_intrext2fs_openpmap_devmap_find_papmap_kenter_cacheusb_insert_transferaxe_matchukbd_keymapdatasr_meta_validatestopprofclockbufq_nscan_destroydb_hangbwi_rf_on_11bgnullioctlcertance_irq_mapuaddr_pivot_printcryptof_closepte_l2_l_cache_modeisohashrt2860_rssi2dbmmclsizesparsediskre_eeprom_getwordrt2860_calibwi_set_debugbcstats_printbwi_regwin_selectbreadem_intrieee80211_node_copyamap_lookupipctl_varsbwi_init_tx_ring64apollo_setup_channelpmap_page_removert_timer_remove_allwskbddevprintuhid_intrpcaled_gpio_pin_readrt2860_free_tx_poolwdc_output_bytesatu_ioctlieee80211_classifyproc_stop_sweepieee80211_media_statusiophy_capmap_set_pt_cache_modescsi_xs_exectcp_usrreqmichael_keydb_playsieee80211_setbasicratessd_interpret_senseuvm_map_pageable_pgonuvm_addr_invokeudp_usrreqifmedia_initrtable_l2ext2fs_vfsopsuvm_mapent_freeext2fs_inactivedead_bmapdb_guessesif_getgroupmembersdb_show_all_poolssoo_kqfiltercpu_startupamap_refehci_device_bulk_transferuhci_device_isoc_transferdb_command_loopwdc_ioctlamphyattachrt2661_updateslotfdexpandsrandomcoredump_countsegs_elf32sr_wu_inittickswdc_ata_presentpdc20262_dma_finishmsdosfs_closerd_detachpool_do_gethotplugreadext2fs_setattrsysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intruftdi_activateusbd_get_device_descbwi_phy_writesyncer_maskwdc_default_write_raw_multi_2uvm_pagedeactivatecy82c693_initufs_unlocktcp_ctloutputrt2860_mcu_cmdrt2661_plcp_signalukphy_statusieee80211_derive_pmkidMD5Updateblktochrifmedia_setem_setup_interfacebio_lookuppmap_createuvm_map_extractsr_crypto_meta_opt_handlernd6_prelist_addufs_removepciide_activatesysctl_tc_choiceptsignalboottimecd9660_readlinkxscale_cpu_sleepVOP_ADVLOCKdb_watchpoint_cmdaxe_watchdogwskbd_mux_closefrag6_inputuhci_device_intr_closecompressBoundpmap_alias_distunpst_sendspaceffs_indirtruncsmsc_cdieee80211_add_ratestcp_rscalettwakeupuvmspace_freeext2fs_inode_poolffs_ino_poolpci_detach_devicespmap_pageidlezerouaddr_rnd_printmii_phy_statusmsgpdc203xx_irqackcpufunc_domainsswapdrum_getsdpVOP_PRINTfdsharepci_subclass_memoryuipc_setaddricmpv6ctl_varsbwi_rf_lo_measure_11bfintek_matchcdstartgf_premulfilt_generic_readwriteuserconf_disableumct_methodsvrefin_scrubprefixusb_detachipforward_rtuhci_device_intr_startbwi_rf_lo_update_11bem_access_phy_reg_hvdb_elf_forallohci_device_isoc_closeuplcom_attachurl_int_miibus_writereguhidev_activateAES_CMAC_Finalsr_uuid_formatnd6_dad_na_inputuvisor_cdsd_cmd_rw16ghash_updatedb_set_temp_breakpointsiop_cmd_putdb_buf_print_cmdbwi_rf_set_chaninpcb_pool_initializedsys_nosysbwi_regwin_disableat_pollallproccdevswsr_rebuildxscale_cache_flushDumodem_get_statussys_mlockalluaddr_free_rbtree_RB_FINDwskbdcloseuvm_sysctlmalloc_lasterrgetsndiskmapopen_bus_dmamem_unmaprthreads_enableddisksortsys_fchflagsnamei_poolrt_timer_countvfs_buf_printuhci_device_intr_transfercryptodev_opworkq_destroysmsc_ifmedia_stsukphymatchuvm_pager_putdiskmapcloseohci_device_bulk_abortbwi_newstateem_access_phy_debug_regs_hvudav_cabwi_get_clock_freqin_canforwardsmsc_unlock_miiifa_item_removeohci_device_intr_abortieee80211_tree_RB_INSERTpmap_destroyscsi_mode_selectkernel_pt_listuvm_map_freelist_update_clearetherbroadcastaddrieee80211_rssadapt_updatestatssii3114_chip_mapvfs_getnewfsidaue_rxeofem_cducom_attachSHA512Finaludp6_ctlinputitimerroundarm32_vector_inituvm_pmr_size_RB_PREVwdog_shutdownscsi_print_sensewskbd_update_layoutmmopenffs_inode_freeohci_device_intr_transferwdc_cdpci_findproductamphy_statusukbd_intrifa_item_insertrtioctlkue_ctlscsi_xs_putifaddr_item_pluaddr_hint_functionsieee80211_tree_RB_INSERT_COLORprofprocswdc_free_xferip6_inputbuf_free_pagessleep_finish_signalicsphy_cdwi_usb_cmdrespsr_crypto_alloc_resourcesgeneric_armv4_bs_rm_2route_srcbootduidehci_pci_activatespeedup_synceraes_xts_zerokeyigmp_sendpktsched_cost_residentloop_clone_destroywdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcbwi_rf_clear_tssim_getptrukbd_cauhid_activateufsvnode_filtops_bwi_adjust_devideuvm_fault_unwireuserconf_common_attr_valsched_noidleuhci_add_ls_ctrlobsd_pci_io_findsys_getitimerhid_get_datadonicewdcstartcpu_configuresr_rwohci_pci_attach_deferredip6_freemoptionssr_raid1_alloc_resourcessqphy_funcshidkbd_delayed_decodeieee80211_amrr_chooseusb_create_task_threadsieee80211_end_scancdce_txeofbufhighpagespmap_fault_fixupdcphy_serviceuaddr_poolrn_refinesgeneric_bs_rm_4hmac_opad_buffersockargshpt_setup_channelhidkbd_ioctlvop_generic_abortopsr_raid6_set_vol_statesetregsupl_rxeofni6_nametodnssobindvmcmd_map_zerodb_read_charvfsinituvisor_closeupl_caubsa_paramcnclosedb_tok_numbertcp_do_rfc1323ip_fragswdc_dmawaitmii_phy_setmediain6_ifpprefixkd_trylocklo0ifphostidpool_chkwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutrt_if_linkstate_changesr_raid0_rwipqmaxlenif_downalluaddr_pivot_newpivotext2fs_vptofhnam2blksr_raid6_assemblecoredump_writeseghdrs_elf32rt6_deleterouteip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cain_socktrimieee80211_recv_delbaext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectuhci_alloc_sqhieee80211_std_rateset_11gdequeue_randomnessuvm_km_kmemalloc_plart2560_alloc_tx_ringcue_casyncer_maxdelaydeadprocstart_reaperehci_root_ctrl_methodssys_fcntlnforce_setup_channelvfs_free_addrlistsys_setrlimitsys_sigpendingbwi_led_blink_startrt3090_efuse_read_2loop_clone_creatediskmapwriteem_hash_mc_addri80321_timer_initeduvm_map_cleanuvm_pmr_get1pageicmp_redirtimeoutworkq_add_taskttyclosewdrestartugen_isoc_rintricmp6_nodeinfocomp_algo_deflatemaxvfsconftimeout_addcpu_cdip6_forwarddb_fncallnumcacheobio_bs_freesr_bootkeycmd0643_9_setup_channelural_write_multiuvm_pagecountcpu_initclocksbwi_mac_fw_alloccue_sendwskbdioctlmii_downrn_mpath_hashbrelseext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miicpuset_delttyoutdevice_lookupehci_device_requestDebuggerwi_usb_txeofcdminphysschedhzurlphy_caem_allocate_pci_resourcesi80321intc_write_steerrip6_inputtcp_totbackoffvdropuserconf_basepci_subclass_displaylooutputrt3090_rf_readcue_setmultirijndael128_zerokeysoisdisconnectedcpu_coredumpxscale_cache_clean_addrrevbitssvwsata_drv_probedvd_read_disckeypmap_clean_pageuvm_aio_aiodonesr_ccb_rwpmap_clearbitieee80211_mgmt_outputcrypto_freereqbwi_rxeof64syn_cache_rmclrbitsdb_boot_dump_cmduvn_putscsi_add_linkpci_vga_tagxscale_cache_clean_minidataieee80211_proto_detachmii_phy_statusuvscom_matchcommajorcrypto_newsessiongeneric_armv4_bs_r_2bufq_disksort_peekenc_xform_aes_xtssoclosesr_ccb_freescsi_detach_targetinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemonskpcluphy_funcsdb_leieee80211_bip_decapbufq_fifo_createohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8board_startupsys_socketpaircnreadpcimatchcertancepci_addr_fixupdounmountuvm_swap_allockthread_create_nowhidkbd_bell_fn_argtcp_ackdrop_ppslim_countdb_elf_line_at_pcarm_picache_sizesr_map_rootttspeedtabns_scx200_setup_channelkqueue_readieee80211_add_edca_paramscd9660_mountuserconf_maxdevre_pci_attachcue_inituvm_pmemrange_addr_RB_INSERT_COLORfork_tfmrateacard_setup_channellxtphymatchi80321_bs_initsr_hotplug_registerpv_sizeuvn_sync_qin_proto_cksum_outwskbd_activatewi_media_statusurl_miibus_statchgnd6_purgedb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdwi_scan_timeoutuvm_wakeup_plaiszerodevuhci_devdciphy_caauth_hash_hmac_ripemd_160_96ieee80211_recv_pspollumass_caem_hardware_initgeneric_bs_sr_4lf_freesys_fhstatnullmodemohci_hash_find_itdwihap_sta_deauthbwi_ds_plcp_headerprobe_addrs_eepromif_attachdomain1sys___get_tcbraw_recvspacesr_raidp_set_chunk_statebwi_mac_set_ackratesieee80211_amrr_node_initdiskerrwi_startcd_cddb_machine_commands_installieee80211_state_namesys_preadem_media_statusscsi_moveehci_root_intr_abortkernel_pt_lookupkmem_mapcd9660_check_exportukbd_translateconfig_pending_decrqsphyattachaxe_startieee80211_input_print_tasksoqinsquediskstatsums_detachcdce_attachdes_ecb_encryptudp_inputnchrtoblktblehci_sb700_matchihashrn_search_mresettodrusbd_ref_decrpcaled_attachufs_readdirsys_flockiq80321_startpvwi_usb_do_transmit_syncspec_badopbwi_memobj_read_2msdosfs_linkbufq_nscan_dequeuepciide_unmap_chanbs_notimpl_bs_c_1ohci_root_intr_methodsicmpctl_varsigmpstatmichael_finalvn_initialize_syncerdpipeselwakeuprt2860_get_rfxscale_controlcd9660_quotactlicmp_sendadjtimedeltauhci_root_ctrl_donesiop_morecbdcy693_chip_mapcdce_watchdogsmsc_newbufdb_mbuf_print_cmdsiop_ppr_negwdc_ata_errieee80211_choose_rsnparamstime_uptimeuvm_pagealloc_pgcdce_intrsmsc_rx_list_initfilt_uhidreaduvn_wlistuvm_pmemrange_addr_RB_REMOVEsowakeupinsidetcp_autorcvbuf_incbufq_queuesr_raid0_free_resourcesbs_notimpl_bs_r_4db_putstringprefetch_abort_entrysigactsunsharetimeout_hardclock_updaterdattach_edatagcu_miibus_statchgupl_detachrijndael128_decryptbwi_setup_rx_desc64ttkqfilteri80321_pci_conf_writem_tag_deletecd9660_ihashrembwi_phy_readsensor_findip_fragmentfilt_timerusbd_endpoint_countsys_statfsSHA1Finalsched_nomigrationsinittimecountersensordev_deinstallrawin6pcbtablepmap_protectkprintfdevice_unrefrc4_keysetupdcphy_matchscsi_startuvm_pmr_addr_RB_REMOVE_COLORin_cksumvnode_poolrt2661_rx_intrvnode_free_listtcp_savetiuvm_pagereallocbwi_setup_desc32iicprobeinitsensordev_countrt2661_stopiic_ignore_addruvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadpool_printitubsa_flow_endpciide_attachdes_check_keyrt_senddesyncsogetopthid_report_sizeuvm_unmaprd_matchricohrtc_cddb_deletewatch_cmdusbd_ref_waitsr_crypto_calculate_check_hmac_sha1pollscandomaininitsii3112_setup_channelvflushbuftime_secondbwi_pci_matchacer_chip_mapip6_forward_rtusbd_get_interfacewskbd_get_mapentryuvm_pmr_initsr_hotspare_rebuild_callbackusbd_read_report_descsbcreatecontrolsys_mlockhotplug_device_detachrt2560_resumeieee80211_setup_nodebioioctldvd_read_structvdevgoneumsm_intrhtonsehci_pci_attachubsa_setdb_show_callout_bucketbucketkqueue_writesys_syncieee80211_reset_scancominitrt2560_newassocieee80211_add_pmkid_kdeenodevobio_bs_barriersr_raid0_discipline_initffs_mountfsin_delayed_cksumm_clticksfintek_fullspeedi80321_mem_bs_allocicmperrppslim_lastrtstatttvtimeoutatu_startkd_waitokabtstacktimingsafe_bcmpspeclisthbdwritecpu_idle_cycleversion_to_spcVOP_INACTIVEwsmux_do_closepte_l1_c_protouvm_mapent_biastcp_syn_cachehaltpciide_sis_productseephy_cainphy_cawihap_sta_is_assocsr_raidp_intrieee80211_std_rateset_11akputcharums_ioctlbootargssys_getsiddb_trace_until_call_cmdRMD160Initdisk_gonewi_write_record_usbdb_show_all_mountscue_csr_read_2uhci_device_setintrm_trailingspacefileheadrc4_cryptusbd_alloc_xfernextvnodeidcttypollsr_meta_initural_startkp_dma_zerosensor_task_ticksys_swapctliic_dumpcpufunc_dfsrbd_reqbs_notimpl_bs_rm_2copypktoptsin_selectsrcmsgscpu_exitip6_initpktoptsworkq_threadbwi_get_eaddruvn_getwsmux_add_muxbpfilter_destroyunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamesr_raid6_xorqpci_vga_procusbd_nbusesfrag6_nfragsip6_log_timeem_deviceseephy_statusinphy_statusrtalloc_mpathsii3114_chansetupxscale_cache_purgeDusb_begin_tasksscsi_activate_targetdisasmufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnbwi_iter_funcsbflushehci_device_intr_transferscsi_link_closeipsec_require_pfsswapdevwd_cakue_sendsysctl_intrcntaxe_tick_taskvn_readnclrunegheadbwriteleavepgrprt2860_set_gp_timerqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closestatminsr_copy_internal_dataehci_root_ctrl_closewihap_sta_allocem_fill_descriptorscast5_decryptbrgphy_copper_funcsxscale_setuprt2661_set_bssidnamecache_rb_cache_RB_INSERTpcaled_gpio_pin_ctltcp_timer_funcsipqent_poolif_attachdomainubsa_requesticmp_ratelimitieee80211_rssadapt_raise_ratesr_crypto_decrypt_keyuhci_rem_loopuvm_km_page_initrttimer_pooladler32_combineieee80211_regdomain2flagadd_entropy_wordsrt2560_rxratergephy_load_dspcodeusbd_get_config_descsosenddosetrlimituvm_pmemrange_addr_RB_PREVrn_initieee80211_set_timuvm_objtree_RB_NEXTsr_scsi_probecmd_channel_maploopattachusb_match_devicesiop_update_residural_rxrateieee80211_save_iewdc_input_bytesusb_abort_task_thread_procRMD160Finaldb_listwatch_cmdrt2661_set_slottimepci_get_ht_capabilityusbd_do_request_flags_pipescsi_cmd_rw_decodechainlengthprocess_read_regsbwi_mac_startwdc_pdc203xx_vtblsys_unlinkatural_disable_rf_tunettwakeupwrrn_lookupsr_wu_release_ccbspciide_ati_productssmsc_write_reguserconf_show_attrsys_execveamd756_chip_mapite_setup_channelfdallocprfindrt2860_updatestatsrt2661_alloc_tx_ringscsi_doneexec_aout_prep_oldzmagicrt2860_set_bssidchkvnlockhw_sysctltc_ticktockbwi_start_tx64rt2560_newstatephtree_RB_MINMAXdb_siftinguhci_device_bulk_abortdb_look_tokenpmap_alloc_l2_buckettcp_syn_cache_limitnumvnodescryptof_ioctlcomreaduvm_pagefreeehci_device_isoc_abortext2fs_inode_allocswcr_encdecbufq_fifo_queuedb_examine_formatin6_pcbbindpool_large_allocicmp_do_exthdrieee80211_inact_timeoutreaperbwi_bus_initieee80211_add_gtk_kdecoredumpfilt_kqueueugen_cdmalloc_rounduppipe_readuhci_root_intr_closeuvm_map_addr_RB_INSERT_COLORifioctlsys_utimesdb_symformatsusbd_do_requestnd6_storelladdrrip_initsocreateobio_searchusbd_find_idescpmap_cache_stateureadcatu_get_dfu_stateaue_startufs_setattrrijndael128_setkeyieee80211com_headlogpriworkq_queue_taskmemhookdoclusterreadcast5_encryptsys_exitpciide_chanfreesbtryusb_desc_iter_nextuvisor_matchieee80211_send_4way_msg1m_applyswcr_processcryptof_writeudav_startaxe_lock_miiuaddr_pivot_functionsdomkfifoatrt2560_detachwdc_exec_commandudv_lockbufqsdb_watchpoint_listwdcintrcd_playHMAC_MD5_Updatesys_clock_getresaxe_attachsyn_cache_insertrc4_getbytesswcr_authencttystats_initpciprintpci_mapreg_probeem_allocate_receive_structuresbrgphy_ber_bugucom_matchnd6_umaxtriesohci_device_intr_donedcphy_reseti80321intc_read_intsrcnd6_setmtu0nd6_debugip6_maxdynroutesuvm_map_pieumodem_cawindow_deflatedb_delete_temp_breakpointehci_root_ctrl_transfercpu_cpuspeedpciide_cmd_productscpufunc_iddefrtrlist_updatert3090_rf_writeurl_csr_write_1_tr_initSHA1Transformesymieee80211_defragcrypto_invokeosreleaseubsa_breaki80321_io_bs_initVOP_RECLAIMscsi_probe_targetsr_raid1_set_vol_stateip6_getpcboptbuf_releasert2860_newstateucom_cdsiop_update_xfer_modeHMAC_MD5_Init__modsi3smsc_txeoftcpqe_poolpgrp0mainbussearchurl_watchdoguvisor_initwihap_timeoutuserconf_changedb_panicuserconf_helpsr_ioctl_setstateufs_advlockicmp_initsr_raidp_openingssii3112_chip_mapcdst_pteuvm_growcsecreatevfinddevieee80211_node_cleanupE_ldsa_abs_reselected_Usedral_pci_attachpciide_unmap_compat_intrrt_msg1ehci_device_bulk_methodsether_delmultibrgphy_5709s_statussave_rtedb_history_currsr_crypto_get_kdfmainbusattachrn_mpath_initheadbwi_watchdoguvscom_paramexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutwdccommandshortieee80211_rate2mediavcleanuhci_device_bulk_doneiophy_servicecd_getvolsplassert_ctlsys_getresuidsys_fhopensr_crypto_ioctldos2unixfnpciaddr_do_resource_allocatescsibussubmatchrtentry_poolbufq_restartuvm_km_pgremove_intrsafeext2fs_sbupdatein6_init_address_ltimesdefrtrlist_delsys_fchmodatu_watchdoguvm_unmap_detachieee80211_recv_authehci_add_qhupl_initusb_dev_quirkswskbd_srcopsuserconf_common_devvfs_mount_printstartieee80211_needs_authwdog_cookieusbd_devinfosiop_wdtr_negvn_isdisksys_selectbwi_attachdeflateParamsbwi_mac_initbadaddr_read_1vop_generic_lookupcryptoattachzombprocdb_branch_takenin6addr_intfacelocal_allnodeslogreadumsm_cdrn_mpath_capabledead_lockworkq_next_taskieee80211_name2regdomainbwi_nrssi_11gtcp_issphysical_freestartfc_largedistancesys_setitimerisofntransurl_attachnd_prefixsmsc_tx_list_initvfs_unregistermii_phy_flowstatussmsc_ifmedia_upddisk_mapselwakeupumct_set_baudrateffs_reloaddefault_chip_unmapdb_set_watchpointsem_initialize_transmit_unitfill_kproccnwritert2661_reset_tx_ringumass_bbb_get_max_lunin_ouraddrpolloutdb_show_panic_cmdehci_device_bulk_doneuipc_usrreqnd6_na_inputdb_next_free_watchpointvflush_vnodewsmouse_activate_bwi_rf_lo_update_11gaes_key_unwrapem_media_changerip6_usrreqin6mask96colddb_clear_watchpointsunp_scansbappendaddrbufqs_mtxbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountffs_vopsdofutimenssys_pwriteisohashtblwihap_shutdownuvmspace_allocrevarpinputbufq_nscan_peekcd_pausecompresshashinitttstartumass_setup_transferciphy_statuswdwriteipsec_keep_invalidpciide_channel_dma_setupuao_detach_lockedpci_devinfoumct_set_lcrieee80211_parse_rsn_akmrt2661_newstatesdopentcp_tracemii_phy_resetip_getmoptionsuhci_hubd_piixin6mask32__moddi3disk_countohci_confdpmap_page_protectdead_openscsi_detach_lunsr_ioctl_inqkue_setwordpci_vga_countdb_list_watchpointsuserconf_attrwdc_kill_pendingbmtphymatchicmp6_redirect_outputroute_cbsys_futimensexphy_cdreadepcpuset_init_cpuscsi_init_inquirylxtphy_resetuaddr_pivot_removetcp_slowtimoieee80211_std_rateset_11bre_setup_intramphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbsbchecklowmemswapmountffs_mapsearchsys_fhstatfssmsc_activateelf32_load_filesys_getpeernamert2860_alloc_rx_ringrt2560_prio_intri80321_bs_subregionehci_device_intr_closeehci_intrieee80211_get_txkeydb_taken_bkptdb_eqnamescsi_strvistcp_set_iss_tsmbpfwritedoingcachesys_getrusagepdc205xx_do_resetauth_hash_hmac_sha2_256_128aue_reset_pegasus_IIuvm_map_addr_RB_MINMAXcryptoioctlbufq_destroynd6_prunert2560_set_chancomconscflagm_getbwi_bbp_power_offffs_truncateuhidevprintmii_attachuvscom_cabwi_rf_workaroundttylclosecmd680_chip_mapwdc_svwsata_vtblpool_allocator_allocsiop_cmd_getwdc_default_read_reghidms_inputin6_ifremloopchar_typeohci_free_sitdusbctlprintvn_closeworkq_createuftdi_readudav_csr_writeuhid_do_readin6_createmkludgedoclusterwriteusbd_close_pipeusbd_deactivateffs_writeieee80211_wep_set_keybremfreefilt_sowdetachnd6_initip6_maxfragslimfreedoutimensatdb_show_regsuhci_reset__wdccommand_intrrt2661_startaes_ctr_zerokeyuvm_km_free_wakeuprootvnodeehci_initifmedia_ioctlpmap_pmap_ctoricmperrpps_countuserconf_modifywi_usb_rxeof__one_cmpldi2cpufunc_nullopcd9660_ihashgetumct_camii_phy_detachatu_media_changeumsm_huawei_changemodewskbd_add_mux__muldi3umct_cddb_qualify_ambiguous_namesuhidev_caurl_lock_miiip_mtudisc_timeoutrandomopenin6addr_linklocal_allnodesamphy_cabufinitubsa_closebootconfigscsi_quirk_patternsuserconf_lineslimit0rt_if_trackciphymatchuvm_md_constraintsif_attach_commonE_abs_targ0_Useduniqdosnamedb_recoverinflateSetDictionarypfxrtr_lookupext2fs_mknodvttoif_tabdb_delete_cmdbgetvppgrp_poolsr_concat_assemblesmsc_ioctlsd_cmd_rw12ucomstartreaduvm_pmr_addr_RB_INSERT_COLORucred_poolxscale_cache_purgeD_rngcpufunc_ifsrip_insertoptionsdes3_setkeyarp_maxtriespmap_uareacd9660_bmapaue_eeprom_getwordukbd_cnbellphtree_RB_INSERTrt2661_initdcphy_funcscom_obio_attachufs_dirbadentrybwi_rf_init_bcm2050bwi_get_firmwarelogioctlicsphy_funcsubsa_databits_bus_dmamap_load_uiogeneric_bs_wr_1strlenrt2661_intrusb_run_abort_tasksdb_machine_initsensor_task_workuhci_cdconfig_suspendieee80211_parse_rsn_cipherkue_activatepool_page_freewsmouse_inputwdactivatecopystrsched_nmigrationswdc_do_resetiftxlistwdog_ctl_cb_argsys_pipert2661_free_tx_ringural_setup_tx_descusb_detach_waitarm_pdcache_waysarp_rtrequesthw_vendorbwi_mac_testieee80211_encryptxscale_setup_minidataext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initieee80211_recv_4way_msg3i80321_pci_conf_sizeproc_trampolinesys_rmdirem_attachcd9660_vfsopscpuset_copyem_get_bus_infobrgphy_5709s_funcsspec_accesssocantsendmoreproc_zapusb_rem_taskpte_l2_l_cache_masksiop_sdtr_msgcdactivateuvm_vsunlockether_inputlockstatus_splraisequotaoffbwi_phy_init_11b_rev4coredump_note_elf32fs_posix_sysctlif_slowtimouhci_root_ctrl_abortrt2860_setup_beaconsmsc_tickudbtablewi_setdefwdcattachufs_printem_rar_setuaddr_lin_createfatentrywi_update_statsAES_CMAC_Updatesiop_startbwi_pci_devicesusbd_printBCDsys_statrt2661_txtimeukbd_apple_mungein_baddynamicieee80211_keyrunhotplugopenlineswmsdosfs_symlinksys_symlinkicmp6_sysctlclfreeconfig_found_smem_check_phy_reset_blockuhidread_filtopsusbd_interface2endpoint_descriptorfdreleasedb_line_at_pcehci_disownuvm_swapout_threadsural_bbp_writeknote_attachmax_keylenrt2860_ioctlieee80211_tkip_decrypt__assertif_congestion_cleardb_put_valuend6_dad_ns_outputin6_prefixlen2maskuvm_pmemrange_use_insertudp6_outputieee80211_prfcn_devvpcom_activatewi_get_debugmaxfilesupl_devsuvm_pagecmpuvm_pageactivatein6_addr2scopeidgf_mapdma_alloc_bus_dmamap_load_rawffs_mountrootrd_cduplcom_paramuvm_map_pageable_allsleep_finishehci_device_isoc_closeipqmsdosfs_strategycd9660_vopstimeout_delem_ioctlural_media_changem_cltickuhci_alloc_stdrt2661_load_microcodeieee80211_chan2modeif_delgroupspec_strategybwi_rf_initiic_cauvm_pglistfreebwi_tmplt_write_4usbopenums_attachext2fs_readsoo_statwskbd_cnpollckue_newbufuvm_map_isavailrusage_pooldisk_detachstrchrubsa_methodshid_clear_localbufq_disksort_createehci_check_itd_intrscsi_sizescsi_plug_poolrgephy_capci_mapreg_infouvm_pmemrange_use_cmpaes_xts_encryptrt2661_free_rx_ringuvscom_cduvm_pmr_size_RB_INSERT_COLORdb_deleteauth_hash_gmac_aes_256crypto_driversiftovt_tabsysctl_int_lowertcp_backoffworkq_task_poolsys_chrootehci_odevdubsa_cdieee80211_rssadapt_lower_rateumodem_dtrsr_crypto_wu_getehci_device_clear_toggleuhci_portresetrt2860_attachicmp6_redirtimeoutenc_xform_dessoisconnectingarc4random_bufpci_subclass_processorsr_wu_freeehci_check_qh_intraobj_pageruvn_iogeneric_armv4_bs_w_2MD5Transformmld6_inputgeneric_armv4_bs_sr_2em_set_eee_pchlanrgephy_mii_phy_autouvm_objunwireieee80211_rx_ba_timeoutbpf_d_listsr_wu_allocuhci_root_intr_donesyn_cache_cleanupip_pcboptsfc_purge__data_startieee80211_eapol_key_encryptifmedia_delete_instancefilt_timerattachE_ldsa_abs_data_Usedurl_caenc_xform_aes_gcmbwi_mac_stoprt2860_txrx_enableucom_breakpdc205xx_pci_intruvm_mapent_allocudav_miibus_writeregacphymatchicmp6statdb_single_stepgeneric_bs_w_4inflateEndexec_aout_prep_oldnmagicsr_set_vol_statewsevent_pollieee80211_pwrsavesys_profilvmcmd_map_pagedvnciphy_servicein6_pcbhashlookupbpf_detachdVOP_UNLOCKpmap_uncache_pagesingle_thread_setehci_root_ctrl_abortsyn_cache_initcd9660_wchar2charieee80211_find_txnodeip_ecn_egressether_ipmulticast_maxsr_raid6_createohci_checkrevbwi_dma_txstats_freeuvm_init_limitsukphy_cdentropy_input_rotatesii3114_dmacmd_writein_pcbconnectem_free_transmit_structurespciide_dmacmd_writeieee80211_add_igtk_kdeVOP_POLLVOP_IOCTLrt2860_node_allocstatvarsafepriluphy_cduhidev_ioctlwdc_default_read_raw_multi_4ip6_copyexthdruao_swap_offmachinebwi_newbufwi_cmd_ioVOP_CLOSEbwi_reset_rx_ring32uvm_anallocin_pcbdisconnectuvm_vnp_terminatewi_usb_rxfrmbwi_init_txstats64sys_getpidnd6_defifindexuaddr_rnd_functionsipmultipathunp_dropuvm_map_advicetcp_mtudisctimeout_startupcue_matchrt2860_eeprom_read_2fintek_read_regrn_addroutesdactivatefilt_msdosfsdetachdb_print_sadb_elf_sym_numargsural_detachdb_trapperukbd_cnpollcdoreadlinkatdvd_read_manufactundstackconfig_activate_childrenip6_check_rh0hdrieee80211_input_printdomkdiratem_allocate_transmit_structuresnforce_chip_mapem_mc_addr_list_updateremrunqueueatu_initial_configsoo_closesiop_handle_resetumodem_rtstcp_recvspaceuvm_meterumodem_intruhidev_maxrepidpmap_needs_pte_synctcp_ackdrop_ppslimuhci_ifcdsii3114_write_regehci_device_ctrl_donemaxthreadnd6_lookupieee80211_cache_sizeurl_openpipesukbd_countrylayoutbwi_led_durationsys_getppidsr_raid_request_sensescsi_ioh_pendingmii_anaruaddr_rnd_selectVOP_READDIRdomainsrc4_skipsys___sysctlsd_cmd_rw6arm32_dma_range_intersectin4_cksumextent_alloc_subregiondb_putcharrt2661_node_allocieee80211_recv_sa_query_respneedbufferusbd_do_request_asyncin6_ifattachieee80211_get_addba_reqtcp_rst_ppslim_lasticsphy_cabs_notimpl_bs_rr_4wsmouse_srcopsohci_root_intr_doneiq80321_thecus_irq_mapip6_multipathusbd_get_device_descriptorcd9660_initumass_fixup_yedataiicprobeipsec_soft_bytesmichael_initnselcollemul_elf32usbd_open_pipeohci_softintrmsdosfs_lookupspec_pathconfmountroothook_listhook_establishem_copper_link_autonegbrgphy_copper_statustcptv_keep_initsys_chdirdb_unread_tokenext2fs_diremptyuserconf_cntdcphy_casr_crypto_wu_putE_abs_msgin_Useduvscom_methodsext2fs_inode_freedb_find_variablescsi_io_get_donexscale_cache_clean_sizebuf_objectucom_activateip6_rr_prunejmicron_setup_channelsbcompresssr_crypto_rw2iic_smbus_receive_bytepmap_free_l1nd6_outputSHA512Lastcdevsw_lookuplogsoftcsys_adjtimerijndael_set_key_enc_onlyohci_device_clear_togglesr_ccb_allocwdstartwsmuxreadamap_splitrefspec_open_clonewskbd_do_opensd_thin_pagescryptof_kqfilternclruheadscsi_move_doneural_next_scani80321intc_inituvm_aio_biodonern_initheadusbd_get_descuvm_pmr_printvop_generic_unlockuvmspace_shareieee80211_node_leave_htrt_timer_addentropy_poolpci_get_capabilityieee80211_print_essidroute_usrreqdeextendspec_vopsem_gate_hw_phy_config_ich8lanieee80211_wep_encryptsr_raid6_openingsem_receive_checksumieee80211_recv_deauthsched_init_cpure_config_imtypetcp_dropicmpstatcom_irq_overrideudpctl_varsuvmpd_scansys_getrtablem_prependsoftraid_casmsc_resetinflateInit2_cd9660_pathconfin_pcbrehashpool_walksyncer_delaynore_resetre_tickin_arpinputpmodehci_root_intr_transferufs_accessin6_embedscopeif_alloc_sadlphpoolunix2winfnmsleeppiix_setup_idetim_drvsreassignbufuhci_confdsiop_minphysip_freemoptionssr_meta_rwums_matchsohasoutofbandddb_initieee80211_release_nodesch_setup_channelbs_notimpl_bs_c_2nd6_dad_duplicated_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovpbs_notimpl_bs_wr_4maxvnodesether_crc32_besiop_setuptablesinflateBackEndieee80211_add_ssidcpu_reset_addresspgfindatu_rx_list_initobio_attachsoftint_pendingtcp_ackdrop_ppslim_lastloadfirmwareswcr_compdecbwi_mac_lateattachral_pci_devicesip4_inputtcp_inputsysctl_dumpentrydkcksumuaddr_free_rbtree_RB_INSERTnd6_gctimerieee80211_ccmp_decrypturl_csr_write_2iptimerip_inputwi_set_txpowernd6_setmtuaxe_ifmedia_updwdc_ata_ctrl_intrdb_last_non_spacemii_detachusbd_get_endpoint_descriptor_tr_tallyudp_ctlinputudav_rx_list_initpool_sethardlimitpci_subclass_prehistoricip_freefvfs_lookupdb_show_cmdswdc_default_write_regrlphy_statusudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnd6_ns_inputdeflateEnddevice_refehci_device_ctrl_abortffs_syncrd_root_imageuvm_map_submapsr_hotplug_callbackscnioctlrt2560_startufs_vinitsys___tforksr_ccb_getehci_noopbwi_mac_fw_load_ivpool_primedevid_allocpgrphashtblrt2860_read_eepromifmedia_matchget_crc_tablestatclocksiop_ppr_msgaue_activatert2560_tx_mgtwi_read_data_usbdvd_read_physicalrw_enter_writeuserconf_argbufatu_media_statusMD5Update_intm_tag_copyehci_idoneinflate_tablesiop_pci_attach_commonpci_io_finddb_value_of_namert2860_free_rx_ringpmap_l2ptp_ctordata_abort_entryhid_get_itemrt_xaddrsmsdosfs_getattrdb_find_breakpointip6_maxifdefroutersm_devgetwritedisklabelsr_raid0_intrmsdosfs_printkernel_pmap_storeem_write_eepromin6_ifattach_loopbackstartprofclockohci_device_isoc_enternsphymatchupl_ioctlundefinedinstruction_bouncesys_getresgidprocinituaddr_free_rbtree_RB_PREVeephy_initatu_switch_radiomsdosfs_readdirdead_ebadfbrgphy_attachusbd_interface_countobio_cawddetachsoo_ioctlswap_officmp_redirect_timeoutforkstatwi_card_identaue_miibus_writeregi80321_pci_conf_readieee80211_recv_eapol_key_reqicsphy_servicenull_setkeyrt2860_resumewi_send_packetigmp_sysctlin6mask64db_lbuf_startohci_rhsc_ableuipaq_activatesoftclockre_gmii_readregieee80211_node_freetc_initupdate_modifierreaddir_with_callbackffs1_compat_writeieee80211_amsdu_decapdb_breakpoints_insertedpdc203xx_dma_startblf_decryptswdevtdisk_lockuhci_initbwi_rf_gain_max_reachedarc4random_uniformsbwaithotplug_device_attachufs_reclaimkv_intrsafeem_access_phy_wakeup_reg_bmscsi_xsh_set_tr_alignsr_meta_opt_handlerrt2560_alloc_rx_ringsdwriteohci_device_intr_startxscale_minidata_clean_addrwsmouse_cafilt_logreadsysctl_rdquadbwi_mac_fw_inituvm_vnp_setsizevmcmdset_extendsr_sensors_refreshural_cadefault_product_descaes_key_wrap_set_key_wrap_onlyip6_use_deprecatedehci_softintruftdi_paramuserconf_hist_intextent_alloc_regionsys_mknodbwi_mac_config_pspmap_proc_iflushext2fs_mountfskill_vmcmdsuhci_device_ctrl_closeuhid_attachbwi_rf_off_11bgufs_mknodpciide_phison_productssbinsertoobin_lifaddr_ioctlknotelf_advlockpffinddomaineephy_resetwsmux_do_openfreepci_device_foreachricohrtc_setcaldorenameatwi_ioctlrt3090_freqsugen_get_cdescffs_hashallocswstrategyuserconf_pnumehci_allocxbwi_plcp2ratescsibusprintnamecache_rb_cache_RB_NEXTehci_root_intr_methodssched_cost_prioritysys_getpgrpuplcom_detachuftdi_breakukbd_ioctliicprobewsonewconndb_fetch_regufs_direnterrt2560_set_basicratesudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotocom_obio_caudav_watchdoguvm_pagealloctcp_saveti6wdctimeoutHMAC_SHA256_Updatenchrdevfrag6_freefundefinedinstructionuvm_pmr_use_incaue_cdrt2860_switch_chanre_pci_devicesaf2rtafidxnamecache_rb_cache_RB_INSERT_COLORcoredump_unmapnatsemi_pci_intruvm_map_vmspace_updatepciide_chansetupqsphy_ca