ELFa(04;4 ( 00CC`CCT|(T|(T;TkTk`p_D O!!&@00Q_: 0/T;h@/ dd@0 6QQO `00 @ @0 _-@p`P`D  B00 R Р -LDG TklrTlmain() returneder   ),@@(TQ 0/xker -PQL@ T@Z?p㔃  ?!n` p&BNGREP`P`0O?0@@ cAQaQ  p-@L`0T 0TP$ U  $P 8pp Q-@L0@``T0 RP Dp0S2/`k  -L0400T80 -L 8@l02 0C k80 -L 8@l02 0 C k0 8/C0s/ 0-@L0Pt0  0t00k -LPl `p $  $ @$k -@L `pP 0T Pu0ETTu0 T 0T 0T 0T0 T $ k 1-LMpQKP K @0`P 0  @T 0@`\ ڔ 0S 00 S R0 T 0$ 04000CoHkok'0o -LM`@` 0pPP  0Q<0<< @80p ,0 $ $0oo CCfrCoC 0 oo/ p-@L@P 04 00 `Tpk -LM@Ġ`p}^PU  $  w0 T00 0 }^PU  $  k0 oo -L8p`W4@P t0  0@"00C S 0 0 0X 0X 0X 0X 0X 0X 0X 0X 0X 0@ 00@2Ÿ 0i @0TP 00 Tx0 TH4s0 T0 T03 0KSpږ SpGpӌ0Sd p0 Td $ 0Td $0S 0 T$ $ 0 T0 T 0T 0T 0T 0T 0T 0Tn $ p<<s0TCo  -L04Pp08@0`T0 T0  00F  0Td㌋ $(dニ0 T0@@P8P 0T 0T 0T0 T $P 0T0 T -L0`4P 0T 0T 0T 0T 0T 0T0S0'0 Tp w0T}N@T  $  T 0pWd}~@ $ pW 0@W}~ $0P0P@0T𩝨 @hA p00-LMdPd@ 0@P <0S,00(0 00hCooo CA 0- 4p删0 LT 64 Qh  $  0PT  0T  0T  0Tdr@T T! 0  T0Sq S000(040\0h00 0  $ pP6 P%00<< s0 T  $@P90  T  $  P000TP00@0S<< s0 T !0 T  $  0pPT0  T  $P00  $0  `T  $Z0  PT  $0  @TZTU000c 0_ 0 S 0  000T  $p0@  T@0  T0@ 02P $"$Ÿ0 SZ00 SX QT <  :Ple 1 R0  0ml|0@000`\mPQf0000`$Q Y000}SzPw  $0 r0$ 0440 0S0 0 @0 0 00\oAHkk'0At0,00AlAPAAAA4AA̚AfrCo'A -PPL 0R8a8p@堀T Q):W0  t0 0$ T(嬠 ` x p0 0Rp0x  l0 @ 2 0XT<ぞ0400 Tk kA -L M`804@S㈠  $8 , 8  $PP  0r怀,  Py0  , 0  , t0 0t0| R,0H6, l08"20  $R  $p lP 000 }0S^ 0_}0@ 1 R4  $p*  $0U :x t0 0Rt0x T<0pP0UP, 0 0  00TPuZH(K0, l0 20Pw 0  00 Tl000 00Cl0 20^ kLk -L M@lP0p`tpx0p0t0@@0W PPV 0 pP}Kk\-CLB؛A 1-LMPp  0夁,0 A4`pt0 0. P, 0R.(K|0Sʤ0 0 fH0S t00t001 000 H0S H@TP p05/00 T傟 HR #KCPP @D 0@ TTKhE00 TCpkA #-LMp0(@0`Qy04,0 P$0S T @(K0, R@pp  Rp  R*    p0sp pYp# 0S $0R 0Y0! t@H"2d |@|@H|00C|0@P 4WApp0, 00T, 0T0 0Si $0KS00, T0000N 0N 00$0(  0 9S0&6R l0d!20P  0, 00 T@n,0 T ,y0TI4,s0 T,0 T0, 00T 00, T,0 T$0KS0!0, T0, TCA k -L MßBpa0 8P4, l刐 P(K00 P2Wp 2W5 H0CW7 `2W P1CWm ;1CW hhP00 00#30000000 0  00,T0  0 0  00, , TT1WI 0W0  @00,T1W 0W0000   0s0 00000 00s0  @@0@, @@ @ LD ,0@$0P@@W0  0C k]t@yt ktzt lt -L0 A8P4p`t0  0  l0 2 0删t0  t0 0t0 0 00T<C kk (-LM (" P4 80 0qW %8PU@- 5t5% 0 p   8kgPOd5 , R= t0  ,8%@(K$ $  0000 0T 00 T $0  0tt40 0S ,4$@\$4 ťt@P t  t0S  ,3t@́t=3 0 0@@l#K<000008#09000800060300, 0+ :@0 4@` 00C SD-0D-0$-0+0+0+0+0+0+0+0+0+0+0p2 l2  @0T> 0KSږ S㇀Gӌ0Sf 0 Td $ 0Td $0S00 T tt00,,! 8 l81@(P8 0T 0T 0T 0T 0T 0T $ <0 <s0TCk 00̩k+CCC k@B p-L0` 00 R$ژ0SP00S PU@ 0@1 018P <⮘T⬘lpPHkk'0p0a 0U U00s0#!13 300s0#pPp// 0-Ql2x"@P@L p,l”x"p *0:\0///0 =2S 00/0 &//6D0/ p-PL$`@640Fpk -`LQPp 4@T0004 L0 p-@L8`P6S\0&\0`0V`@pk/( D0R <04 S(  6SL0L06/ YSUBAEERF8A -L0H  0S0S R600  0 0hPA -L4 010pA -L@P0h` p-P0 LR0`p0Sp @R600  @h 00@phl -L@pT`= 0S: `PU% 0 0l0tW\0\0\0S `Pd@TQ d@T Q Md@TQ E000x&\01x0 1x0*\0S'똜A -P@L 0p@00C@0 R` 0S R600  0 0k D -@T`Lp\ 0\@0P0 ;0C 80 0 , $(\LpC 0\QP 0h  p-PT`@L\0D0 D0T\0HPD@D0 SH@P000\0ph p-L `0& 0\0 00 8R804PE 4 BtTP80180 X,\ , D<4 0`px(K ` X 0@0<904 D0j ,p gXAAA0.S 0!C60,ʠD0P 4808 Q40040 S0pWp@ 0\* D0S,0 0@D0`p> 0W$0@ HD0DP$ 0,0,  < Q4 0$0HD0 (0 $D::5% 0 (0 ,0  , @x G;D1914 D0䡟d0 H @0Sp<] 2P0C" H0 00C3 R PS0Q<Q&@ R@@L\J 2@ 0S00h01&0\0&\0xS`0`02Pc <0dTHH @0<0@0@00D6@0&Ɖ$@<2S l2x"p ,yw딠AAk4AA -L@Ph -LMP0`="R @;H0N0 4p 0<(K,K? P @P+0,( S 3 @ܠ(90S <2S 00& 6@P@<2S $K@T@W0 ᪌Ɏ kj0AhA -L@3P0h -LMP0`="R @;H0N0 4p 0<(K,K? P@P+0,( S 3 @ܠ(0S <2S 00& 6@P@<2S $K@T@0 ;Z孻 嘼kj0ܡAA -L@P0h 0-@0L P=2S 0H08勻0P0<2S0i0A -L@P0h p-PQL`@p57U 000ESQp  0000ASQ0p l*-L0M0,0  p=2S 8H04 32/.0T10 D@0Dd ,0- $R9Ro 49R Kڣ R 9R 09R00Y@P, 0R9(KP9R R R RTӼF 0A?CR< "9R, RU0008R  -LM=BT (Km. 0 S0 , l2pBxR` \p, @07/x 0l ?0@P Z,@ 0R4(KoK,00(KoRkC`AhA -Lp` 4P=2Sj<0 XQ{0 X00@0!0褑000@T?lm\T@ 0\@00 ;0CPU D<@ 0D@00 ;0C4PU Y@FP  0l @00l0\@PTl00x~ 垸밢AkܝAA$0S0$0eca p-L@(`PUpk0 =2S G l  0-@LP\T0eHD0 D0D0 SHH 0\TW0h -L04`@HpP0 ?04ik -LFT L0S6m>6x0( R h9 2T0 L x000( |@e N@PEERFA`j0YSUB A-LQl0l0m0n0o0`P `0=2㿎<2l˜p0<2x"P`,lBpx"00\dU 3l2x"p ,P <20C<2<20<2l2p ,[2lB˜x",0 0p\l˜x"P0p 0\l2pBxR` \p, @ 08107/l˜x"p@ 0\dT4 l2x"p ,@ l˜x"6p \2<20C<2i8i53`l˜p 0\eaAA 0-@LPP ˎPPn⁈K0 0-L=2PS0X20QX2 @T|2 6S n6SX20CX200 6|X20CX20 -l2Lp$l™p x,l2p ,b0`2 PZl2px", Pr0r0,q0r0<2奯 * 0vP@"0R02 2 !Ql™x",0 0p\e LP  t3j. &00H 70 P @4 6@T h?P ll™p 0\啵 ;2<2@LATL`@D` @@@\fP@` TD 0*p :0P!=C 0D L`\TD ;0CET"P@Ud:@TP!0 5 @P P :0@00 ?0C 000LT\H@D@D 0l™Fx"P00p \ n嫅mNl2pBxR` \p, 08107/l™x"0@ p\dZk Kl2x"p , l™x"6 p\Ktw "P001"PTCA90A/// -ML0Oܳ1y0 )-ML0Oܳ1y0 e-L`P/ p<(00p04p4S80,0d080 000 0, 0@< 07wԐ&88&#Č, O   Č 0iXC$A0AWEVy0 -L Ƞ Ƞ`,DP$ ᢑpP@ 1UI t1U) *@T1U* L1Ue/h@,10S @ 0 ᝕@P ̙@P0U$ ጕ02 0 @  eK0@ be/9/L 0U &$ 40( =@pkrdAhdsd edAk~gdy0 -L M|D0#88#!)P( > (  刐p* (D0P 0(20 0 , y 00P`4Q!<00@aT@!0 '  H h<00d@0P@ {($Kka0 <+0400 @DP@ f$KH gpkXC\Ck 8 8-#TLH%p`P0@ڔ ዕҔ-pk 8 8-#L@(ᤐPPp 0`῔pP 0S  0㏕p᪔0 pPpk -@L0⯕{00L00 -p`0L  JP$  J@P P00 `(Pp 0ղP,\0@P  0@壊 ipkTl\kTA\]pP+@奤 <P*@.P@  hk(oA4oo$A0ADA P 00/Lk x-L$@0P 0@0o0oo0/Pk p-LMPP`V Dph@8@0 ,$0# `p lTAxAH3LBA S-LM@ 00S S h0Pd  0^0?l 0婣000 P  0 P hk̨AԨAAAAĨA0 0 `R/dkPkB -L℠儀p`Wt0@ WVW@@ <T0g0C `pW` /pXkPk\k1 -L `Rڬq B0R !0F]S' VU V2 VL VhdQ-@ @TcP9 qP7 PP@0P0C0APU @0 0 S 000P@V00CR t 0 00 0P0L 000$40 0 `kTkܨAAPkdkXk\k H-L4M<08S , 2PLKHpKPKTK ` 0L @@ 1 L %TQ 0P PL0P P Rd P0Sl0HL, 0R (K0@,$whk`kp AԏkABdrAA@0r  4 40pQ 0/0o\l 7\T 0\< )\$1 R? \0 R \ \0S 0 R 0 0S ,0 |00S  0 pP 700 0R`Lkhkdk`k\k87pHk4k frfrX0 -LP<00S0(@#40àL8kfrk\0 -LPp<0P 40 àL  8kfrk/l0 -LPp 40D#"B ,0S 3/0P 8kkfr(0 -L0Sfr 0-LDP@0S0P0 T00  0frx0 0-L @R0PXPTP00C00S T0000T0000fr 00 , 0^nP`U @^E*"@!BH1f0`  0040, 0 (K@^,*>A0@> 0Z  f0 008 0iS0c80a, PNJFfB{111 p-L M@P`  0  0K`iP0SKp -LMPBpB ( @`0@P/22 V/*@ @T**0S 0 PP: ( P0@P  R0S  P @M*J*P 0-L4MP p3R,0 `-P10Cs0S(K!<0S 40 @^B BO( @ 0cP *E01 1\$ @L 0 SJ*夈  0AP=\ @0SZ SLQL L 1S0D0 i 4 41, 0 S%  3@@6P 3\ @,K0 0>0 1!@D0Z0$1  ''HD 00" D000, 8D! (;40!16P aPKLApkȫAkۣe1 -LsMD, LPK  ! 1 P 儀 `P @0pW `P(d00u(, 0Rg(K0!0 `PL0$ 00 `P P 0 `@K 40`PgP5[S `C[ B&D @P0`PC[Ta !a ^  0Sq0(K. !p0>00b>0q 1 ! tdz q0G 0gP p@ DqpP( K10    h !t.  . a0 S1Q>2=12>303h0 5T( 0! 1 1 hK3HP Z p@Dh0Q q.0C 0b 0pp@Dq  ! !@Rʴ#[Rm0ˠ@1 1 1Q8  @ R ]h l QlKP 0c!d d hK d0KA PH\3:h0\d% * d b0 0b$1#[0d0 Z!0Q$*1"!B001 0j1 000 #[hd ` yI/ 1pAۣe1 -LHM@@aD1Vp$0  8Q$K 0uP P 9'ʄ K0'`0d0  0\0 ` 0T0 X  0P L0 *0D0 H  0@ 4 8 <0 0<dK7 ( , 00 p -L@P@1S<@ -L$M` (1@8 @  0St P 0PSU *0 S   0 S  R:p(K00@ T T@ T T TH@ L@ D@  0T0S* T L  0L0  T LL L @T TT D H 0;00 0 40  8 0 0   B(1@,k(,K.Cp,@(W<@ v(1, 0(100,0, $,0, (00(0, 00CS 0  c00L ?P @(1 0(1$? < {$ 0` Ȍ.@P0qΌ  00 `XKp -LMpP`$K0.> `0.@P0 0 `0 X`P0@ `  0``P0S   . . 0`T -LMP`P@" 0:#:S%0:#:S z'zW P @ @ ȌP qΌ00p aX@P K0@ 0-L@Q P21C 0 P  QP P0\0 ?$00P0 -LP`@! pP2 1C@  U 0 000 P p@P00 R00S尌جA p-L@0PS:T 00? @""!B` 0P ?X$`p厌Z 0ьA A,ALA 1!p-@!10 PL00>0>0 1/*"!B` ` 1 0a0`0PP PPP0P:21C  `0 ! ! ` P PPp10v fr0 fr 0-LHM,0 0@ L0 T0$ ( TK BP T0 P P $, K(@:XAAhA 0-L8MA <0 R0 !R0S $0`(K a1@P *0!00 `;WPX p,0x0PUM +p0@c 00 t0`C0K 8@ 0p lX/@F 8Ke80 PKD KP0 L@ Hp DP& P ȊPU 0- ,04 Kj 4K1@K@``ds0 30K2K0@ =<` `F<K 5(K,壊(友$卋!pA PkApA AA X6-LP9 0x09t0@Tp P290 S$ `D0 ZO0S9@Tpk(%pkA -LM@`p9$0S $PP0 9O$0Sp@000,0h8A p-LM@0Sp Pֈ8 0R: `  40O 0 BQ *ph8A -Lp 00 ;4 00@\ `PPk 0-LM@P,0  80S p0`` N0SL R00 0S00 0hj8(%pk Ak Q-LME hp0OO$ !RBb^V )ڀP@p$821C Pp, (P! PU80S 0xx N0Sd X00&8 PRPppU ,p|A(%pkTAkDA(A p-L0T00U00S p|0Tt0`89TpX0@@9Pp, ( 00C2 9PpcCC@B h0-LM ?Ac 31C0R 00 R $0 00  K KMb?B `0p-LMT`P0LPH0@^ ,0K(P $@ ,` ;KpC0%pC C,%p -LHbH@H0 PS RH D N 2oB00S. U 0, ED00CSD01 RGU0 00,00@,00@0UD0P0!0P00S000iZp,0 7D0,0CSD0000 R/0 0@0 @0 BL!0H唆D00CSD0ȳU L0S 0@00$0 D$( Hw0 0@0@40 0@408@ fr+l,%poX%p0%p p-L,0 p, ` 00CS0pL`0Sp@@ 404 PApP%p0%pk+l+l 0-L,0 0, h 00S00T0 R0H@ <0< 80P, A0P%p0%pkT%p,%p+l+l p-L@M KM  0PQ@c=YB@DB ]BT00U00S Kpt0Tl0`7TP0@A7P$  0A02 7cCC@B p-`tQLP ,0"  0@0SA 0S0S,1 R @00CS@0 OUPp0@P `]60S ph;60PPRmV@00CS@0ʀYOUPp000 0@@0dB0S0S ,0PPDV fr0%pH%pC6 6 - L|呪x0P l l0@@@@\0\QT00S#7<< 0S@hM$嵄2H%p+l+l0%p,%pC CT%p\A-A" J1S 1 0<S RZ020CQ^1S100S^0Q:/0P/(0/ 202/ (("@/00/ 0-@L,P0 !$U$P1s 0!10 ! 0U 00C0001!0 !00C0 0.댯A 0-L 0@S0SP P Q000  &#( $00C0gy0&p&pA 0p-LM`Pw@P P \-P Kp 0 0 00$( $ 1K0 , $01KP K(00(00 00KP 00CS 0 00KP01K(00 (0 -LM`Pp Q)0AW 0 Q D0 00CS 0 K0S@$@PK 40K,@ (P 4@ 0P KgTȯA -Lp`20Cs0S2 P@U R 00 0 PU@Z000S!0202S''P s P o8P  @P 0hx'00202S\%p 0-@LyTP @00m P h,\X0@0H 2000C400  @2$@0\%pAk -LM,0,0 <_yH PQ6P 8 P 4,0 2Q 0SP@ `PH0 0 0qa 0 0 @,6 (6 $6  6,F g 0@S`\ 0 0 `S@ R 0s0 \9 0`S@40s 040< 8 @ @cTڃ ?@cTT' s02`Q q 'f0'a _  \%pA -L Mp, 1R-P!`24 , ' C@A 5 d@ 5,0 d0SR020V400(K040 042!Pb, a' P'Q 0 @@B@BA 0h500 df@@ B@@A Y5 dX00202S''0'0 -`LpOPP ` 0 S  S0S<0 ``0BS 0-`$@  ] `& -LpMPp@P ` 0吀K0 0  00CS 0` V  KTVp P@`  ` -@PLp,`  0s0C  00Z 00 00A0   Q%  0R0Z0S 0Z `40V    12 1 1s 0V0 `00 121 `0-@ MLPPPT 0Puy804 P@ly0@K0&p(kAA\%p&p -L@,Pp`1 ,0Q5hP  00R  0s 0` 0 0  00 0101 1s 0U0 P00 1213 R @0R  fr -L M, p0`$ X 0RS1!Z 1!00  \4 B:0BE c!03P> 2@`v_  V1@J0 SSBB c!03P; 2@pH,!$0 `0\ 1!Z 1!X0R  U0 Z(K@020Tp 10 p@T @Tp 10 p@T ڸ`2 ^   1@2 1 1s 121 0$ ^0 000R$40 0$C -L@MX pPg`PJ  0 S"M1`N1xN1N1N1DO1O1O1@M1P1M1@ T 0S$0HK P0 Pq3[S* #[RH RO R 0AS 0X (KX@0 0@`0 \@ 0T5 Z*,@O X, KP  0CQ  ZX0 000 ,@40  000000 0 s00C0r 00  40@K00 s0  r0000  X0P= 0S3 XX00 K000c0 0S P0`0P z 0   X0 m0S) hPT Nc` S`v$0< [0t@000  X0P L3800 0  X0 @$0HK L0 P3[S #[r0SS S R*@L H0KPHK } 0  DTP H0KCVl @P@ PH0K@@ 0 `@a@F@P @0 0` AP @g (K @P@->0X0X,K@0 0` AP 4,)0, [@k -LMp@P 8K4 8 ` 0P*48@0 10A0!0Q,0 P@8 ,K ,_P8 0,0 B0R,0 P8   @'00KP (K4K  P`@Z`J,K ,7P0 ,0@T0P,0 J `'00KP  P "-L M0p(0, `(PP 0@Tw T P8vj(K0 0 ,PPL0$0!@0;00 0 PP1 I 0 0 PP j 0@@ P ,Km@P:, 0h0b 0 R@/PP 3/P41<  U U (1#20@ 0S00S 0S U P P P 0S * @ 0P p8\iwU@$1 !S@#@3R0! $0S TbDpkk -LMX 0\" T2 0 0L2 gpP (KT,` : X"Jc0? 0 @ lp hp p d H ʟ8" 0K 02 ," ">K K Kq 4r q q (r $2 0#6`000t,!h0. "&d 1>0#6l0(!x $1|0("R KoP00H"cD2L@KH @0 K P2 $P = `P5 H&rQ ,hP  \hL" 0@5P'I$<?  ;` p?Ppp  B000 ssT&FO l@ %,a&T0S0# X00 !TC(5 00@A4@1T1 ` T",00 Q0Q ` 0  FP` 0 00 0  T,0b 0 @ $0@0@0@P'#\g 0L"@wT2(  ,0S K3/Pp  \2 K ( PdT,0  #<?? 01S! L R  S 2/ 1 3  1S30D 0R K 2/ 101`B  8p B T"PFCT0000000000000\6r 0Qa0Q^` ]` T2, T"7E`0L@J0  0 000 `0 00, 040 {P4  `V, 1 4K< K{V@@P6<0S7f)8KP408 0 P8 <00<040@4 0040408 $ 4(00(04  00CS 04 <U4 8,= wLq<G4 tpkHkptkAkAĮkA0S/\0  Q0 (0 R 0 0 0 $ 0R 00 0$0  0$/p 0-L,0P@G  R 0 0 0 ,   R 0 0 0 0 0P1 }`10CS`1LP * Pf0SH0Slf`f\ 00C04Df@ 00C00 $$$ $0mq3p@/p0pkt1pk AаAA -L,0P@`DPLL0[/0$S$0#L0tPi pP ,DY(Qi6 -LMp0S00  b  $@T 40Q 0 r @Tj P,q! (0S00S1`Va ,0; S V6   ,400Qi (K1 0 =0,  (00S000S 1X,0,c400\  0[/(K0  400 ,0   ,F400Q- [/(K0 400 ^' 00! 6Pz 400Q [?(K  P Q PH P @ A 0-@L8i!4P,0S80 80<0@dP@@P 0S 0P0 00|P  A A}P VA8A82ppqDA3p  -L -LM@Q K00  BP   @-88 L210!0 c +lQD(p - L@R 0 S. PY PP0 R  00S 0S  R 40SD(p82ph0 -L RP 0@@<7@P 0@P)p+l -L@p d P `00(0 0$pp@`Q~t w!~d p!0F 000000=h =R\ =,L00,0 0S `,`0p@/p}2$9191 0 , fr -L0@,   h -L8M @ D0 ` = S  = S  x8xxP @U@0AS00S LL9P# <m#(KQ@0Q08 8 0AS00S1 9P!0#0C0ǟ7'@h0*L@ 00P0 2@P 0 0C0dam 8'00C0Qǟ00 T  0p0QP #0 B0C0 c0@ Q10[?p [?C(,00 ,`10`1 @E8 E  @\@ <H P a < @@:L0 L0 ]$@Q&01H0S 3/ \5^08 D0L  4 H  d0l 000,0  4Qzş R0 0404P  p1S80!80<00 0@q40 0\10<00S0 0@0$ 0R00 0,0  $ $@ 04 QD  4^ LL @L0 L400 L400P 40(K=9 =0  P@Q  00 Y *%@\( 4@#<80^00000P000Qp< RH0S ,0 \  @40"^  0  "02,000  0p0 R 40,040:    d0l 0001$ @ @@\E8 EU\ ;,0 H ,0  , * &M6  !000,,,  d0l 000v D@ 010P00}93C? / Ck+lkACk+lkkTqXAt1pd2D=)p42p02p,2pq@B`Ak -ML 0  K -LM@0H0 (  0@@K41 p-L MP`0L S@Kp0 $K0 $0 0 f@P 0$0.@ `h@1 X0p- P`L @Tp04PS0P@Tp)pkh0 p-L@`TP 6/p  P $ `P@0pj)pkhA @P-L8P P0F4 i frA 0-0-M@L0KPd-.@ @@P,F 0  yiU00K0#p 0S-L `0`S   000@0@0h~44Q 00j S 0j U 0j AAرAAlA -LP P 0-LP0@S 0h 7 0j AAA-X0SLL L0S900S0C1S0! S0%5䤢kkkk 0-L3/輲A -L`M@0 K  !6P( K @$(@0@t lp\0CAD0@P@$U< 0ÃɃQN ` PP0*0 Rr 3#!8 8 \9Q B0 .,0 !!,0 q "4 !40Si ,@K W  00KWP00<PŸ0U0qj@2 Rb?  WŸ!>0 C6 H @@0 6RL0  0P @@@PD 4 !DP Y0!0cC61 `@ŲL 0@i@i _W0000S00#0D! Tn,@K j,8B!0 Ah" <0D6 4h0x 0ci ip0, 080000hL  iXi*pk*pkkAkزA3$kk|*p*pAAAA AAPAAA Q-LHMh l0 0S$ S S- (KP PL"0SP <Ÿhl 0 "@T) hl 2 0P l Q0d@KP 1@<  0 Ã/ 0Rl PR 0/0S00 /00/0/0S/ 0-PL @0h -L0SlgA -L0  0_g$A -L0 , 00QNgKg frLA8A p-L0P` @ P V@ 0D Ppph-@0D \0 -L  R h0S 0CS0 R/ 0Sg fr ApAA -L2M! p0 0  `< @0<0 TPP0S (K,X* $fX!X0<  0 0S2@.8K 0P, 'p38K,-  # 0 0Spf8K,  p38K-8K,P ffA frAAAȸAT0 -L   R@ 000qP00 fr 0-L@P  0h P0 0-L@P 0h DP080 -L @  Ph9 fr -L@ h- P<0S8<0/ -LM8CP`<0 (38 P (K)0  @x\2"00D004P,P`0Sw4P 4 1p0S 00<000 00*  4, 0 00S8<0<0<1/P@ @  p` &t1 0-@LlP `` 0Q0C0000S0 0 0hUk k`5pA p-LP@` ^  00@00hphQX0 R 00aS0 @ 0@0`5pk kA0@-@PU P S! ,0  0Q Q U U00 R0^0D > R00 0 P ,0  f$ $10$1$/ 0 /-$8!0Q0A""0! !!Q0 1$k -@1L0`p P@T T8<@1 T8!<@@ !1 01@k10/,0  SE !1R/4Qj6 , 0 R[?ZPa Q @, ,  !03PPR  O, ,[?P Z P @Qi,  [?P  @0Pz@_$ 5 0O,k+,e$kkAA -L@QQ 0,  10 AP,0  11s < ,!X1Q1Q 0,  10 P,0 -L MAQP, Ry0Yqw Y ( ?1 $@a,0 $ 1c10,0 1,   0S00ʅ 0 RM 0,0 A 4 000 $00Y00S @T T  @T,P  10S` S S@? T (Ko,0K X 40S0PX0S ,0 (K X00( 0PA(Kod Rx1P Rr ,0 1 Pj,0 ,  @M,p34P00SG0P00S@9 @AE[?᳀NH:&, 4 j A30000 g A*,'`40S 10SpA ,@ N0  ,12S201Ņ#gA,@,P ,0S@ X0S@ 010POA$kkoA - LN0 -L@T@T ,0 ,0$ 1  @T42p -LM @,0P $`0A s hd\`Q Ki!00000 10! !1 1 0U1 0!10101 K$k Pp-L`Pp@TpU  ,0 S@Tp P-L@ZP h S-`0Lp* P1@T$ @T 40,S, T00Q0S 0^P W g@TXR PPU PU @h 40S,0 R  01P W 100Cs0S542p -LPp`PPU 0 R Q 00S U U U hlP@T0P \ 00S U U U @TU @T -@P0 UL p𩝈R&0R = B @f`P  0S  [`P ,0 0P Udr R0i 0i b0i @B$$10CS$1/0$0Bd5p 0-LP C$J/@0$10d5p 0-L$0P$!R0@$@0 -`L$P\ p q0@@ 1A T1010\1M 1P 0R 10P0$k H-L M< 4@0 ,J 0@hEK6p2(kAd5p p-L`P @Tp @Tp@T  Q00000  @Tp0S/SQ 0S/\0000 000~ -pL@` PPW` P 00  00S00@ P0-LPP@@@T:}P0T 01 R0D00wLA 0-LMP0S6 Q1@ R 0A@S0@& R 0S S0 0 B00 0@ 0@ 0K `P0 6L4L AA -p0LSPa0SV WZ\U0 0CW .\, @ R W`1`!P$1 70S( ^ 0 f0 00@ pf fW P0S    ! 0 R KK fr8A(A -LM2 K -LDM0 @P, H0 D@ PP #0S CPU0L0 ` P`P v`P`U`L` xP Nd#P HP3P <3 P(3 @P1`k3  eP`Vj p=KB 2R20L g"*J@42 PPTp,  000@8 @0$0(@H,0 P0408@X \0< @0` d0D H0h l0L P0G`V @ LT @HK 8P A @0 B!CD EFG@@IW00`C,00, P0R=(KU 0`V Pp P P@,000Tp 800 @@$( H0,00@P48 X0\ <0@ `0d D0H h0l L0P `V@(pkp]p|]pkk]pLBtAHAA-P  0S 34\^ 2Q/0S :P/0 (00 fr QQ-L MpP1Q1 $0KPP) @^$ `$(0$ $0 $0 ,@00(@,P$40$84$<8$@@<P K(K^PP l-(0 @((T (0 lh0lwP -@LPp`T  0R 𨝈UT h MP-L0 0S R K P  P-LM0  0S RP Kq Q-LM@NQO `PM Z: @0C 100Cs0SA,0L> 0  0R>,0S2P U;P00 U"@#0 @@0p ( KP0E0"@E0`0@P ᣵ?(K@@,  ` @@P Q-LTM| Q0JS-@P |P 100Cs0S,0  ,0S0JS @ l@ P00P0 *@HK=1`8 P`0 \@  80KhKX TP 4 h0 dP P` L pl5PZ Z Z|0D<x x x@ t0 Htp  1 p 00!\,0 A eZ,Kt Pfp@P00KX 4  80 l80KhKP `@ \P T h0 d L PN0 RA :#:jc0@PT0 d0 08K lhK`@ \P 8p 4` h X` P L0 P2V6 0S@10S @T000Z8, KP ,0 0T ,0 50 0 00 (K Z(K00 t /lP@ 0 0R@ P;  | D0, P ,0x 0\x ,0 tt Zpp U | <0eZZ0|700 -LMp`P0&. Y   0@ 0$@ 04 0@80<@$ @D 0@H0L@P X\ 0@@ (0,@(d,,000h00x0000000 00…04…0HZ0 -01=L % 004 /A#b 40=9 =X2 01A !P Y T00<0@1A80[1! !1$1$0S1(1$0S1,11001 M?3!C/ 0  0aF N\ X0S`00`00S`00`01 0Bs0RS( 0S X01 `01 h01 l01L1@0@1 0!x00| 01 111!2!tQ  $YX0@X1\A0SP0@2DB100Cs0SP0@1A2!/A#b!0O1A/!0O1A/!0O1A/!0O1A/!0O1A/!0O2B/ "0O2B/"x0|1t P= @ @ $0@H2LB \"04 l 0S04 p 0S04 t ,0 Q p00|0S0C0Y|00@P0T@0|001 0Bs0SR 0 08 K0K,40/08?L#bN3c1!(KT0d0X 0X2/C#b \00@d!l01 A _9Mb?BLB R-L$ML0 LH < < Q`V pW&V (K,3 A!0 Hp3Q, D  & ]D 2H @@ 8 4 T2 10S, P R( XVt424242L42t320424232,0 0 0S p0 S,0#<0SWE40040 0P <QW\44 @T8Qf1 8 @0 R @0  Q @ 00S 04 R @,0  @0 S @40 S @D Ry uD,00P Q QDT 000QD@ {P@<  fpG@ < ,0D D@ hP@ <0 0fpG@ <0 H0S @40cL S 3041L000 fr42p82p -LhMP `o/p U| X0@00( 00  00"0  ( 0 , P. 0 0 R& 0@80<@00CSn7292\92D92824920 @ 0$@ 0(0 ,0@004@$ @D P080<@,HL 40P0T@<X\ D0`0d@Lhl U$pX x0@p0t@0 x 0|04 0@0@L  LQ `   0K .Pt0O"0@pK 1D x00  R 0F 40x1000@A40=9 =1娿 R0 !(K$04 t!$0 l! pX$<0@`1dA@0h1$X01 !0@1A 0 ! 0 $L0SR X@1AT01AQ $1S4 S SX 0@X1\AW& 0z000000x0 | 400jD0@(1,A#0!,0410 8!40<18 @!3D1 H! 0L1$ P!(0T1 !qXD0@(1,A3018 4!3D1( H!01aP0S0@1Aꈭk Q-L4ML0 Q `oV RD L  D  0@V< (K8oV01o?# @0 p34 o"TH p TM T8  HX8Y0!0  L0S 3#L<P7@T P8 8  8 @T 0S D R030#Z0S 0H4 9H@ PDPfJD 7@T , 8 ,0P ,0S 10S S <\*0  Q% @T<0s~6@T 0 8 ,0tQ0, R 10S S <\j40 Sg @Tsp\ D R030#Z0S80080 \ DP030#Z0S80080 0<\ DP030#Z0S80080  RP80080 PR0Q (0DP030#Z0S 04H @@ H,P ,D  f, D  JHp\ DP030#Z0S80080 \ DP030#Z0S80080 \ DP030#Z0S80080 0<\ DP030#Z0S80080  RZP80080 PRR0Q (0DP030#Z0S 04H @(@ H0nP 0D  f0 D  J4 0H @ H,@ SPH,D  fJ, D =4 0H @H,@ :P ,D  fJ, D 4 0H @H,@ !P,D  fJ, D 4 0H @H0@ PR0D  fJ0 D G4 0H @H0@ PG0D  fJ0 D < 40H @H0@ P0D  fJ0 D 4 0H @xH0@ P%0D  fJ0 D H fr&p42p P-LdM  0P00 H U00 0(KPP 0dSd00SP0S  K@30S,-P 3P3 Rß 0PŸ 0P2@FP 0PP20S  Px2x"@ 0@cd20S-PP20S-P<20S-P(20S $K3/PP $0PA04P 0P PP1!0  N nPv PPqL10S 41lPf :P_ 0 0b 6PS 0 6PJ 0|PC 0tP; x0:P4, ^P,@7pإkD7p`k87pkkkH8pqL8p<7p\8pX8p]pkkLBkgr Q-LJMt`, Pp @ C 0B>S񟗐Q2XR2XR2XR2XR2XR2XR2XR2XR2XR2XR2XR2XR2XR2XR2XR2XR2XR2XR2XR2XR2XR2XR2Q2XR2XR2XR2XR2Q2XR2XR2XR2XR2Q2XR2Q2XR2XR2XR2Q2XR2XR2XR2XR2XR2Q2Q2Q2Q2Q2Q2XR2Q2Q2XR2Q2XR2Q2XR2XR2XR2XR2Q20BMSV2V2V2V2 38H0MK 4 410*ǟ0 L@P00W00S7  ꘧00  KP W 0S0Ž S40S 7ǟ 0 6] 6 6O 6HƟ 0kxƟ 0bL 0@860S00<1 <1  O?K5\ 5RN 0 S<0V KOK E 0@%P00CUS{\0 Sv @_`pd 0!B$5$%gL 0]^ğ 0U@L 0p@5KL 0$Bğ 0P9d7L 0.0@L 0p@&L 0L 0Ϡ 3 ß 0ß 0ß 0L 0@Hß 0(CNK 08 |P81 CRS0L 0-  2` 2tph 000QD@@T 2@L 0@- 0. 0&{@L 0p@Iq| 0i1^ 0R  0BW 0O 0H 0|>Apk0okkkAlpk C46pP8pt$pMb$ka T8pH7p47p87p$CHA_AACDpfrT^pa04CPk8CpT]p -L0@S`p60S'0S  3/0SP+0U 0S P iPp0Si_00S0h&0\%0S D%p0 $%%بkHA0A|AtADA Q-LM0p0 4 ,0 (  0 Q0 $ ` V P0S 0S 0Cs0S 0 R @0"  Q R P0S`V`0 R , R $0DS0 00=%,K4K^4%T]pبkAA -L Mp00 @Q0S 2 |0S0l0$Wq 0 QP `j ,0 R{ 0Q0SxP0S00a 00 P W[ ` $00S  3/1\ 0S 0S T p0S0S00 S00 0S\ K ,00 R 00CS0i(K`Pr q0R00`\$TTT T0%@@H H0%,,< <0%P]pܨkA\]p@AT]p\k4A AAqAsArA -@PL` pP  0h(V6/0N$k -LM0`, SpP4 ( 0 $ 0S"@00Cs0S0婟P4KM0S,K蔇CtC p-`@L PP  0ph $pLA@-@X\XX@@0Q:XP @ @0R:Q:& XPXX@XP @0@ R* 0R X0S @ Q: X0SXX@ 0R 0R 0RXXX@820P#/! 0Q "/@-(0 S<3(057<@ @00@09780<S"p* ;@ @0@0< 7P`@  0pO 7:$T0P7<P`@ + -LM, 8 R0 D@[ S< 80 U<Y (0<K40 4p 0A 00 ;4 000@(K 4cP,P  P`0 @8$"^- <@T& Y <@K04Q OT&# ,04P ĠP9` p@G0 Q%<K0*0@<8PU<0SS4<0,P,8P0P (4 0 /|]p]pp]p< P/0S/ 0 S/P/k -L`P<0 R 0P 0P Rd|]p -LMa/p, P@\P , 0RZ(KaP=; c080 4K 㥝 00Bs0 S?/(K0 QP2 0A1@T (0 P @  xP- @TZ \ 080 "P0.S a0B8 s0Sa0Bs0SW0Bs0$ZZp|]p|BLBApA -L MPp`$,K (0( "4#220$ 04D P 0 @!(K, 0٤P ,0GP 0t !` ,0 Ӥ,l0< ! 0,Ĥ,] pA fredAAA -LM`0PK0 0 |P 0RK00[S  00Cs0 S00•0SLpQ @@Q $P10pk|A 0p-LM`@K Kd0 ]PP0 K0 @@0@0  K0\SQ 4w!뀘 0RKp\"8kp0AAA -PQL`. 00S`S%p0@T@T 0S %0P0SpP020$ 0440apCWPE@\]p -L@P T#!P0@T @T 0S$!@T!`A\]ptAB -LM`x0P ,0 @T $0s (0r @TU 4@K P RT `XX00P(L(00000S,Z 0#4@P0 (PK0@#88#Da'$B0v ႜ 0KF@P VPPpT00S 0S V 0Si 0SN T ,, 0R(K R 0S(0 @ 㡛&P0&0T0U0Sw긦0s0Sj @pPP0೼0  " 40 $ 020$ 04 <<6  0Ɵ$0a6 0? W 0S% |" 0#(#4(@"!| ,40T,8 8#$"Q r  h0R`5  Lp p745 ,Ƞ Ƞ,$0a0"" p p%4 ,Ƞ Ƞ,$0a0""TȤpKV 0S|  @xPr\GP 0u03V0SVU@E( K0^*SB K0 PP 0S& 3\#   @>֙8t P X,0S] S7 @#0TPPp0㸀K 0N@PP 3Pa_~ 0K+P 0S  P @ lG@T@T $0s (007@T2BVP 0 ,(,("4#220$ 04 P j <0`@P 0P@ P` P pW (0 P @ P @VPPz@ YHD@ 0`@P P@ P`p|]p]pt]pPkp8kAACA0SUQ(00 0 0   /k -LpP^ QP𩝸1@T  P   R @0T0NS222l2-T& 0S# 0 iT  0 i^T T` 00 Pii0 i{kk p-P` L@ἒ< P800000`0  0@pkk 0-LM@PP T 0H5/@T  (5/@TK0$0AATAAAH300 -L@T@TT,lI3 p-L0@`lPP00p P P 0U,  Q000  ]phA -L @! 000 0S0 0  0 00h 00 R 0  0h  0]p -LM`P@pn 0TC:D 0PU>Tg0ppP  P @0T6 TUA B:P3 T U-:TU\00 000W 0 0028 0pd NU*00' 0Tl? 0R 00 pp @(. 0p9$ApAAAAAA p-LSP@3 0  0S0`` 0P  0S VP0A0 00@@pV 0^ 000 000ph0\  0S 0A0 00S00@@Ppph -LM`P@pc RY 0APQ`0Sf 0Qv: U  0P \\  UY: T 0  U: T 0P `  0008!0P = T: 0S6@0pd 0oZW 0pcNKU\00 000` 0U0SPB20d2p0: M#AxAAAAhA A,AApAAPP  0S00P0P0;@ |d50, ThA`@,X4)X0@ L,lP,lT,l\AAA]pA$A4AA$AA -L0MPP@p` Q Q T\:QS  CL L d\d `\P 0H8, 00,^9  Q \ # 2RH &PD  (K0D00jn 0 , P8 P  R#@!@ %: R*0PS@0 0S %0 0j 0 @ z:P  W03#40 5<0 500 54 %< %0 %*o0Sj @ Wh:@* Q>:H^#  @ ,0C c 00 0P cP0  ,^8  0LS@0!*Q: 0 L80R^!c: d R000S0< R0#03\0S@4  0 < 4 00j 0 @R00 q 3S Rb t 0000H"Pc Y@8@ L 0%"*W5 2:H^'  @ ,0 cC00 n0,  0R80PL@ *W %0 *\xP8S\!: f 00 R0S0< R0#03\0S@4  0 < 4 4@<@ D @0@8@@ < 4 0 D#8 0TxPp@ 4`X P84 < 0 {A A,AAAAAhAAA|AA8AhA$A0-p0 R0  0R  Q R0S0S0000 00ST^pa0 P00/L^p0 /L^pX^p 0-L1Ps0< <0<@800 <0$ 00P0T^p kkX^p 0-@LPP D R00 0S00  0kX^p< 00b 0P/,1 Q-L`7 1Q 1Q  1Q 0Q0  0 00  0  p@  0PaU0 PPP4 0 0000 00}f~fvtwt@X^pT^pkx0 -L R`@^0 D@00000 0L^p\^pT^p -Ldp@`A@P H0 S  @kT^p\^p 1- L@P`p\ 0-`P  000^  S 0El@Q@1@!T `P0Q 0Q`#`T^pkX^pA Q0-L@00PA0 R G x0 P0R0 R P P0000 0S0SU RUT^pa0H^pP^p 0/᭾ᆳ @Q@#0-!ALP000S0 @Q@#-!QL`p@ Q   0Q R 00p@-`@\( 0S% ^P) ^ R  R@ 0 0 R0 00 S0  0S\ 0 0p0@ 0 0  R \,  R/ 0^ 00 S 0  0S0S0P@ 0 S@@ 0 @0@ 0 0 0S00S0@ 0^@@ P@0@- R 0S^ 0Sk 0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R00 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R0 R 0S@0T 00 S @0P  0 SP y -LpX5 PU?P0S`X`V  0S@W `RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP& ( 00 S\  R (0c\0 0lS0P 0 \00 0&-P( 00 S00SP (0c\0 0lS00@-P(@ 00 S00S@P (0c\0 0lS00 P 0S/0S/P/0S/0S/0S / P 0S/0S/P/0S/0S/0S /P/Q00S/Q00S/0S000/ Q0-PL <@D40-H Q0ࠃࠑL 00/0x| / -LM, pX $`,@V P, :/P 0U@XPU  0,@02$` 002 TV 0@ 002T , `F:/V 0PU -LT0 T0 l'A -PL8p@T 0 `[k 'A0 P'A p-LM@P`@(KT@ 0@K `  徼KpHA'A -LMh`P,@KPp K$P T0 P$塼@KXAk 'A p-LM<P`@(K@ 0  @K ` 儼KphA'A p-LP@`  T0P᣿pT0Pp -LMRp0  S`, 1 S* S YQP(1@T ,  , P0S , P0S @0T 0S  ,KYQP0y03Q0SPP P P X0 R 𯝉 X块  ᘗkk -L`pV$ `(7/ 02 P@T0 7/0 03P`VAA -LMP0`Sp ppS0pS(`@ $0X@6/T6/,6/L<D H06/6/6/W 0S 6/0S t6/0S X6/P (86/K,6/A@ALAAAAA$A8AdAPA -LM`T(4 0p^X `0 e 02R P T0( @^:0 03PC @S T U 0X( 0  0x K p0S 40S @A, K00KLP ,( X10P 0 / T0( @^ % (0X P@ (K$<@ 0S X 0@  d X (0h@ 40 0Z0 X 40, tAA$k A|AA|A A p-L@PT` `< W@T`@T  L@T`@T  A@T`p -L8M⼢ ( pWaWW "2 2`Vkt0Sd 40s 8Kd"] X X P@_e@ @@@Od$ P@P_e @@@Od P@P_e @@@Od 8 P@P_e @@@Odh 0 P@P_eH  @@@Od,y @aq W `V aWX T0e `V( 0R"$K L 0 E g8K qx< p*pAA$B0Ak$AtATA\AdAlAtAD0< ,0bS`K"*8 00R$0S.D0< ,0bS: @ T7@Tp@T Q00 000( `0 (T@Tp 08 xrp A|A;A p-L<`40@TP  @Tpkk -L @R" R$ 0S T 0S 0 00HQ  &Q0S0SHHH H0 0S00 $ $0 k A|AHAA(AA -L@P9 ƺ`P% 000堺x0S! p+ 3/P 0 RBᦺ00C0Ⴚ`} 㸃y/0 J $k A|AhAA -L`0 t0@ 80 RT A4  @$kxrp -LM@D ,0R!* pKD0D, 0Q0*  PP `VU U  Q0-P,L <@DEB0*D ,0R*0h -LM`P<@D*'PP($K00 0 U00  KPE @P upWT T 0 40R0"40%͹0 0-LPpM 0 H L0R$& `VCD R K@P  CP"x \ X0,\  `H L0RX r0Sr\ ,\ X0  0 0R0  y-ᒹ 0p2 D R @STl2 R 40Sf 00#Q00# 0D0H 0C D0H $Q0Si 0C0 Q000 Q0``$00 0R$ D ,0R:K0p00XXT0S $P.0p00<0Q> Q000 0S00`0`0x @A$ K(0KP $( X100t hX`XX<0( X004X(A$kAAA,XBAA8AhA(Ad囸 -L Mpp@Q ` QT QV PUZP 0St X00HWpʹR0400 `00X00L08,0\$T`DH000P0 R x|0 pS 0CW2:0t0Ph0 ᅹ(` `P<t `0d0Qpl0 ^ 10 R 0 0@(K W*`0<`0 8PBtP0e 0<P@$ 80[ V W`k>0>0S'  !80P11""00``PUP\Vp0p p0p P0 0 @XTLHHH H0kt^pxrp$'AA(kd^pdhp|333 3PAAlA A|AzA- \ 0Q|0@l0sp -L MtptP`@F ` 0V 04=`V pPKX,l0spAT'A 0P \/| 0@l0spT1 -`D1PP81 p U00SL@% 1 Q X00S@Pp PVP$1 VV!W 0X0Q0S Uia U   jPW H 0U0040 R vz0|p|p8kP^pTk R-LlM ! @ | @ , pPT@ T x p X x@%PP00nP x@ h0 P l0 d `0 x0t 0x0 t@ 0DZS;>3>3>3>3>3>3>3>3>3>3>3x;3>3(:3:3>3`;3:3:3:3:3:3:3:3:3:3>3>3>3>3>3>3>3>3>3>393>3>3>3>3>3>3>3>3>3>3t93>3>3>3>3>3p73>3>3<3>3>3>3>3>3>3>3>3>3=3;393>3>3>3;393>3>3;3>3 <393=3>3>3<<393|73>3>3,>3>3h>3xZx  T W00 S| 0 y$ , 0R(K> ll  l l0 l P0 P``  d@Td00P0ls0S,@Kl p@  RE , K2p 51:RH D d`8A P`0p@0  dp@ l d 0R00p p0b a bp d`Pbt@00Dx!0000N Qx t h0 x*P 0@ \t d x0P!0t 00A 0 \?d0 x x l00l0 |x+ ` wP@PCK0@P@ p \P C0KP` `` %xl @ l cx0lPl@l @x0 l@ l Wl  P0P 0O 9P0P0p0 p8Qd0P Sp t  ~P~ p@dPd UdP\ \ žl X ] P ` l 000l   l  ` `0 l g PP0 L H ` 0SQ S[ S`HL0CK&@C0D R Z TW00 S   \ @P&@0xP`l0X 0 l0 @ t ` hxl l lDƟ X l0 P@0 P`x l000x  uP@x 0?@x d0 P@ | Q-L@M  K 0"(< K 0 K(50 -0- L M0CQ0  0( K   K0 K( 0 0-LM@TPB 0P40 R@ 070 0RKpbp8BA --LM@xP p` 0@ @ @00 R0@ @ LKkL^p  D@l 徑 \ p0@Pd0S8Q 0K0 T0R 00S+,0XT cQ b08 0 B8 4 40 80S8Ksh @P,0X S00@㓑FL h0HN@T '@ㄑ-ɚ;Ck|pʚ;QA|p -LM`@Pp ,PK 㤃P KPP $PK 㓃PA p -L M`@Pp ,PK zP KP(0,$K#$ !B !  p -LM@uPPA 0> `f@D 0$ 0$ (0, (0, 0 400 4000 00 -`$@A@0L/gfff0 0/x}p\}pR  Rx0x0'' Q Qx0x088 R/An0 -@L 2?0Qp00  (00H >1>1>1t00  |0S 00 0l0$0(Q\}px}p Q0-LM@P@00CS\3333Ą300 0P@K0-@t0h0\0KH0 20A @嫉p}p`}pT}ph}p\}p p-`PL 8Pt00t0@%pkA >0- L@C㷇0 T;:|@Ph0h0h(h Hh 00 8 ,P0 00P60x}p\}p 3 0-LP 0N6P0.t0R0 -LM@pP`H0St0t0# 0  0S 3/H0St t  0  0S 0t0H( (0PP kk -@LȠ`^VH p00RUV tp t0l0t00ηH0U u@ 1HX  k frCA -L@MP(KT3 P@"A@1@K43E$  1   000c@0S |0S \ \6 Y/ 11 A0@r QRs0  PS000S S S 0A @s0S00r R  R Rt R | |0R:,0 ,0g\1 T@0K0Bs0RS< 0 0$< 8 KTǒ,1K@^4, 0p1njeǨ@p60p , 0p\4 8P1ÌeȌP6̌8P 4 108P4S@ 4a S,a t`$1V`1Ǐ` @D0 >+%@n4DϠo@lF/<B @0  P`@ DL L0Ra:4 40R  RZ  \ P D,0ICrAQɚ;A AAk_k' AAAA -@Lt0 | ㆡh -L.H0@St0h0t0Hѵε -@LXpPt0p@ @` 0t0jt0N<t0k0 -L @R剬t0@0  P HPt0@0t000S3/Pt0@0t0PkA -L  Z^ Z Z Z , Z00"# 0@d 0 d  HSPL# 0?0S 감3Ԏ3̐3Ȏ33Ԏ330tq . a0JS J0 `0JSrT333333333333333333333333333L3D3\3<3 0 .0Pc0>H p P`0O0@`d  d >V J0>y  0@d 0 d  H P 0>cJ` 0s ,!0 Q0As ~|A0J\ZSP pP`\H0@d  d Pk =^p!p(p'p)Z)p2 l 0@d 0 d  MH PI>SC ?`}pAk$(C -LP`@t0 p  U 0  k 0-Lt0P   % "20#0 P0S0 0@@T 0h@T00 P0S P ^T @^? -LMPP  봠(`(pK @P ( @P` @P ( @Pt0:t00>0>k p-`QL@pP\ YPUUp 2-LM@P0 S50 ^ B?@0CS+1 ? R  t0 ! T0N>K2n @ :t0\ ~0S萟t0 :t0>%`,pKⰎ >F PP ,  PP0t 5*0t .xr0c Q.PPQJPUZATAk -LM<" l$`P0p0 8b 4b ,0 H4t 8@0  <"$44 4Q  ##0 R  VRӵ 0H0S8Vd V(ڠ0@ X#?0Dh@VH .H >,` 0> 0O p0@Pd `l d Pʨ0H0XQ VR| 0iH0XEH0pBX6<"ot0h"0t0H\2C4 4"Rq N!P0p`FH0X R`1l#OK በP4 A8Vpp8b ʼnH0CJ, t |0Pq 0n l$0!h1Fe0SD  4!01@P4 ) F  82S Kf, 40R"(K    82 S 0R#  4" 4  #042 T8Kf  042 pk̩k frA`}pkD]pԩkA pf갩k -L@ qP` (Q/Q)t0 >;.t0.Hp0t #40,àt x LHQHPޱ ( Q HPkk Q-L@ t00t0t0 0t0 0) P P 㴛  -Lt@ 0R'0 t0! 0)P P 㐛qQ  p ̌t"$ L32C 00t0yh-\}px}p|A -@0LS00> 0Q>|  00CS0 tet8k0p -`ppLGQ0 Y㨀@  0@D  D 9@P 蜠% ,t 00S r PWP|@$  20P; t zRxW  a @h0(PTgʣ/0S\(0Sڜ0  P Hf Pt0@t0 0S 3/Pt@tt  p [ |t  0S, 0S  0S 0SH 0SW~ X | Λt t 0@$  $ i0 t@0  th0@t t    0R20,50t oy pG0 #Y!   A0GS p0S P 0S 0SL @T T   t@(0 h0S&  .H0S;tq  0S 0SWt W W@ p p(0 S|PPPY T 0S 0S 0S >0s0S>>>t  ^&0SqSo m >u 0bS@1@#Te@DT^0p  y t  (Wt{pq !W|pm 'W`pj JW X60|S W 050<#(0 0S050-| ȚtW tW   ^tt { Ty 0>(FxW 0S  tWW: tl 0WtW  > Rt ~lQf0>t>tW  |@ P0 P p p P P 0 @Pp0 P P W 0@0S tt/ W   ct~\Wty'op0t#40#"B )W}p ^W~p  R @J0S.%| zkh}pp}pT}pAk 0-LMp Rx!@<0S9  ј,$!(1@pP 0\Gx#W  ci 0'B0Sj8P0 ,} 8 ʶ8ጸ8 0R,0 !V8僸0p0 #pp0p frkCgfff̩kܩkD]pԩk3|0 -L @R\帣0  (0 P0Sy0(  PkA -`<Lp# 40#P"B p@ 0 t0191 0S191kk 40 -Là@LԐ`ApP@ .H0SPUWT yPʤ0  P T t0 Pkk -LXMPD|0 U`$ G(;U ;U J0U ;Uo C:U :U :U 0U4 p(K:0S 0 S, |0^ $01F0S; @@*@:@pP ,:U+0CU*0CU:U ,0CUQ 9U} 0U9t  @ 5,0t E9p9U H9U , `pT9UC H9U 0U 49U0 R- 4P|pP{8U 8Ua r:80Sn880Sx $0Sjxd8pZp(0ZpT pRP DX0S Z t0(0(SpD  @0h (D0 @0CpKl0 p H@ @ {DpP5 \i 0\ zg p\h\QW hWt@x pQ0CU 0U Gt0p;t06U 7U60St0t000t0t0D6U 6Ul0p06U 0U0 Q4,01 Pp 0Qp| pL6@p` Tp#*l0Sl 앟V| t l0 20  pP   l0tp  DpPE1! p$Ex0p8x0 @8x0  x07x00@x08x00 x07x0q .pm0 0S |0 0 R,0 l0$ 20pRH0p0N Tp@ A0 @Tn0S QhQ 00CS0 0, p000 00 | 0 ={\Ct0p;t0@  s^P  ᯗ| 㿕ppP  0p(0S0S  3/pPt  0    00CsQ 00000!30 !0l0 10C<0  0@-0S| x 00 QRT0 BR 0P@@ R00c!R!<0.l-L0P R 00c!R!<0.l -@Lp RP`$ 0  BQ0A0 00C 0 0 Q  00b \20 200 00SPP0 0k -PL`V@-Q@)pQ$ 0S`0`Q@@ \\ P 0a0 0S00`dd0Vp@hQ  k -@LP [>yyP 0SB[>my000 p-@`LP >wV`0 0 0P  pUB> |w -pQLP@p4 Q( Q+ `0Q! 0Q a a0RPP [`P  0a 0 0S 00pe 0W R 0 $M  kA -LP a@ Rp7 R0S* 0 0 0P \  0a 0 10  0P000  00 10  , J0kA -LMpḠ0S# 0S 0R Up(KPDKD@K k00  ,0 0 P )c/ fr,0 0 0S  c p-LM`P, @T \Q Q 0 S ,cwKp`bat -pPL` ,0 0 @T  d 0b `c` -pPL` ,0 0 @T  md 0pb `c` p-P L`,0 0 @T  Ld0 a `cp`p80 P/0S/0S/P/}p -L@P P*0Ss0 S4P: P0-LP@0P QT 4Q R0S0T0SR\ 0l0 -LPpU`@T * \4@0 > S9>R0!03Q> / p-PL@`p21C0Nnpp@-PHaH!@0 0cS(010(1 ^1  >!R 30bS01\> ^21C0Pp0S5@ 21C 0Qҁ0S0 S0253>1p8, 0 0cS00HpL%p̱klptp/l"!B >0>/\/P 1 0 SXQ \0\"!B >0C>X//@-@PQࠡ  \00 0 a0l 0^Qʲ1 a00b0` 0RQ!0a 000a0!0a R*bP R0 0 R0 0 R Q- ^0n\  S ^ 0n\S1  `0S /D0  0cc/D 0b/1  `0S / 0  b/ D P0 0c/ 0-@PL45/01!(5/ 5/ 5/D 5/10DP 5/\ T5/X5/HL 5/d `5/0(0 5/"5/"5/> 5/,0 |5/8#p5/@#d5/`?5/10AAApAAAhAAAAAAA$ApAXAAA ALA -L1p` Q PQA @@A00 P1D00  0# A(A1HA -L1  `0S 8 DhVhVPDh{VdA Q-LM`  pR KPP VU 0 @@cV@1`d V0V 0 pP AxAAA D0- 00@ 1L0V0@0 -L`@Q d0d0d `1 P 011 H0S L DP3/1 P 01+\0D@c0GdpA 0-L1@00! B!1P  801NU1:11}pp p-@PLp0`PP@pk p-L@,`P@pk 0-L@P@0SU 00 V 00 0PP 1  `0SL 0 SP00 -@L`pTP+@P t0  101D0 001q 0U0@0kp}p -L@Ppp`Q H1W P5T' 2!1C0fX1PPD) W >0 1D  0 1 LP \`XpHd@`@P @ T0 @0@Z % 0@;kdpA -`LP@1N \pP7 R'0d00 0!00*1! $ DDr1D d` 01 ``1 @ 0 ,@1 0 [17D O4P@m k,A -@L`pTPh8@P \0  1010 q 100kp}p -LM@PP pQ` ` R*`pbV1g3Z P !0j0= DD@LQ00`!1``` 01d`d0 0 p0 P  PP&0!0e00,0 PZ 0j0 qT0 PP&,00 k -LϠ MϜ4 0 Q44  10 K0WpP X0,0 ,@K0sDD@0PQ00`!1```` 0dp1d`00X  n000 SR0p00 XFWB @ P`? Y& 00 0bX1! ' 0S  ;$ 5X1! 0  00b^! 0 4 Pt0X00 X,(K,t kʚ;AATApA -LMS -LQӻRQ`pP PP 0 \@ @ 0S*@cTS5X V ʲ! 0P0 000000f0ePP" 1 `000 0X0j 0    0S 0S00P 0PX  -LM Q-Lp@`8gW 0 0g 0 1000P% 1 A @AQ PPQA@AA00D00 0g0` ` p`A0 0 L%p0pHp -L@P  S -LL@L`\HpP <0Y@DT0h=dp(Clkp -L M0SB@  0@E0p|0 0@뼐张`0@ @P#5 7 0@PPT`VVpLL (Ko4GPkApT'A,CdpAxp/l0C A0p3A P-LMp,  ,  0Q`%,` P`U0@Tpc>P 0@PV Us1V 9R P P@U`0X/@gT@!  *R0X# PU X`p0S P P0gX@cYTPP PpP X XPp , 1 0Y0 &17, 717 -L`RPp*Q+U! 0Q*U 0ScPPVU 0@`T@! 7/P`dVP~{ yPAlA(A 0Pb0c0 UP[R<  W0@ 5(@/0:0 0? ᢑ~ 0 Q P:0O0@/Tʭ t$hD0S, K8  ,@T 젠PW0f0 X00Sh ; 1` 00S ,0S  V@KdD UD  @80P, 000@P`pVY4 R000T3WPD3 <0 S@0  , 0ӌEhD -@L060800Č6h5 2-LM R, 唃,L H32C0bP (K#0a R , ,,P 0 0 BO@00 0<0<00D D03 A Qaq@3, ,@P,00; `Z`  ;  , 0 P@   0,PZ , ,6E0 00 8 幻PkAdpQLp fr 0-L0P@; 00U0 P60h A60h誋 -RLpP` 10^ V@ @@ 0R 0 `0aR \^0P 0 0 5@T`V`0   0 1SS 0001P00S 0 00!RR 0001P000$0S $ A00/ -LM @S 1 !@ ROPK LO 0-P0@L0S0S TợP 0@00cP 0 -L@AP  0S 0&  0 0 S-P;0SpL`p3*V@ ; 1T7p ` xNpP U@0S0#S0`< -LMp`$ K@P$0$P 0S  00CS 0$@9@ K(K DN@P $  00CS 0 W  0@P(0B@$@ -LMp`$ KbPP  K(K NPP $  00CS 0 X $0$@ 0PP(0P$@ 0p-L M`@ K 0 #PP* 0S* $K MPP0$ 0K>PP Q $ R 0S R $ 1NPP   00CS 0 P {Kp$P P@$K NP -LMp@ KPP%0 SP 0S` 0S`V  wMPP!0 0  0$P  00CS 0  @7P; 1V 7P  00CS 0 p-LM`@ KPP p0$  00CS 0P?p -L@M\ `, K4 0 nPp0@  P0 L@ \0\X T D @ <0 H  0SH0 ~Q{H00SH0 v\  ,0R@$ @4K00KX KHPP@pPH0t 0c0Qp 0Pp8  08 R !SMpPJ80X0 8K IMpP@Q& X" 4PU  0X!05  0305 1MP0U @@X00 P0SpU0 cW, ,00@,00@ ,0DO DH p,  00CS 0 0P >4P :(K\,%?H0S wW #W -L(M`0pS @K \LP02(K `D < D K8 (@ $P 4 ,`  K@0 -L`MDKPp 8L@P8 P(@P`K0P,0  0,K0 PP$0,L K$(0<`PP<  < R uU #U U   Ir$0 b 40 P0@408@ $0LO LP , -L`MDKPp eK@P8 P(@P`KP0 , <` Q@Y Y(K!<CK@P X널K`8P p-L(M ` 0@< 8 K< K4 0 $@ P ` ,@ Kp -L Mp`,@[,K0 KvDPt[U $K,0 (K ,0 ,0  PP,0( $ ,(00(0,  00CS 0 000r[0\=,>G[,=ꔩk -LM@`4K pPP (K8K PP 4P , 00 0 0000008 $ <048@0 PP$0S DK JPP, (00(0, 00CS 0& 0 (00(00 00CS 0 Z84PP @<0=080 D<,{=040 0<,<ꔩk 0-LMp@$ K(0 PP$ $`0A?AS  00CS 0$<%P K (K0PP 000$  00CS 0 (P uP(PP0A?AS$  00CS 0 ($P$<$<`@06F@ 0\nPP U0S3kA -LMp0`S@   0KIPP,K PP (K,,08 $@ .  9 3S PG0,3Z 4 K CP,ZU<< 3S9T,Z4<,<,Y0P18 00CS 0)<3SP 0 0F6l!PP 55 #0P36㯅  PC  fE,0 ,0 ,0<, $PP  R 00<VPP ,Y4;,U<,Y< #P5P, (00(0, 00CS 0 @ 400,; kAkA p-LM`@ KPPP p0$  00CS 0P;p p-LM`@ K2PP Kp K0:PP   00CS 0;0  $P  -@PLQ 1S 0 Sh0 R0S0 0C#qW P`Z0 ` 08/WP@TP/ ,O4P/( /0S00(0   (/pP/ 0  0C0 00C0; p -L R r R0@0T  (0 (@T@T (e (00C0( 0(0RI @T@T1 &U R`3 P  Q 0Q(0  00 0P pLW@P@T J P0S$P J@TZ@WP/;@TPZ&V00$Q d0 R0 D*@ R 0R@p&pp&p@kN4P 0S  08 8갬k -L MP4 `0S t2R P(K \ 00^<2< L 42,B/@!bQP0p1`k oT @q; 1^ ` q*V  @n@ T 0X0 P 0 0@Cp0PK 0sD 0sA 0SSB v8, pX 0@D0 0,000  0  c8049 \,K, ` PW,pK‡@ O8, `FV 00C 0,00C0  B sPqU7Pl` PPg`P$C pgfff Q-LM<  4 0" 0C#q 0A#Wk1 80 S40 00  ,0 0S Wj4@PW P@0S$00Sx S  APp W ,lWWO40P@`  0`W1@M <P @VJ0 1P5;9@TZY(PM ,#W,CWU @, 0@0, .W,W00S FU(K4 , , %WW0(P00 (P0 ,W8 ,0p8 P 04 0<  0X W  B 00C0 ,VP :P fr p00S S/ P/P/+ -L @T0 00S S S!0 0h0S00 S  R  R 0S00  000  A 0-L@P0S000J0hT -@0 LR ) 0S S S 4ڼ }00w0A -LLMpP0S/@ (K iQ0@0jQ@h 6P 0D H0 D 0 BpKp@ h0 l @P @P\`00S&@ /'@00 >@PxX 0R)@ 0 2 0=@P  t P  0V00 0 0$0 040( 0t  0 Z@ʚ; -L @R 0x00d( 0S 6/P) 00 40 R ShhS p -LM0S@80Cq hR3PU/`,7hP`* Cj0 p 0\o 0lK00@0 l0CdP h0 l DP < `PX@T TDK&?TP u&(0`$K`'@K| 00 0T XKˠD Kˠ =`PX0px00P P0 00$04@P(@$? -L0@S 0S0S S S p呻l0l P< }QP7@4⭃$0$ P @AkĬkȬk̬k Q-LM@p`6 PXP Q00S0v03Q0SQ=`4x`4``4_4H`4_40`4`4(a4`a4a4@`4`4_4_4`4_4La4@`4_4 0S -X Z  s- 0Sd f| D V8[HP7 P5 00 R2  8 40$ 04 00, (0  50S4 S S ԺU( RY R) R' @ú R 00H0 P 0 0 a000,0 0l ,g壺Pb00,0 0" PJ UpJRO   00 0c c 0PXP, 00 b0b0 , 0Y04 1W 0S80 P @Q 0!P7W PXP0Y0 P90 P,  dApTA\ALAk -L` M:/Hp`@000p:/p@0h\0P:/@0@0P:/ @0($0P:/$K,ppAAAAA,1 -L R v 0S, 00 80`pP`C6OPU` pP``pd  Q$0$0$00 $0 $ p08@0A/@TP@PH 0S 0S ,帹$0\Pk A,pp(A,p p-L00@!`00 P0l @00  00  00<00p00 p4Pp 0ŹktA A0 #6pǏ?Q$! t0S3 ?QMB"0z,"pg yP`00@;00唐P2"\@|B0OVXU LB0 ?QP<2<"0\ ,2 \ By "0z,p* C$th",X!po1 Q0l DP`0OQʃPQmP U @TU!@T P `'P`0OVʈm`0p RDhH0p RO,0p  TokЇpk!CeЬk,ppp8CpAppp frHṗppAppA -L@ 0P  -LMp` 00 , 0 0PP KTp P ` LPP 00 00 8000 yt0@T P(KP @00@@0D@0 0 a k A,p -LMp00  Z00Sx0LP Z p0 0@p0t@$K0 0@0@0 \) 0 (08P0`@ (0,@8< 6 000,p fr -LMP @Pp, Z `@#`P P U (Ko,1 -LM@h -L0Z (K  004KP L0 T0PK,@K@5PI,04 @r,@ T> d P< ;HPH <PP3J`H1pPUpG*JPK0OT U00P< @T H1P @00;00<THIP0H0< H@0TD0 R01@P BH 8 P`(080@ (0,@8< DP/00x@090\@ XP 00D0 Pot40K   \K0P`8  8 8<<0R0@@H0 t0xP|`DPP0 S !100s]@@0LSDT 0S)D0DP0 40K)D 0@0 H0L0(P`80P `0@D80<@(P,`5P 000  0弱,p A0-LMX4t0S6H0S80 RKm0  RڼP 05(6@0@0 @8tx`|pQ\\\ \0屰HHP P0嬰44.@0姰 4 40墰Pk<ApĈp,p A@AAAA`A 0-@8LQPH00dLLM8@08lr 0-L00P/H0S1 0 RlPQ0T0T T0 T0P P T p0 0@p0t@H@0H08LXM00 D`088 40G$$ $0BPkLA,pp8lrЇp A@AAA1 p-L PRlH`0VH0 00I8K`MMt0S Vp00H` 00(000 R900 500 RP P0P0T00PTp0 0@p0t@pPQ T0T0T00T0PP T p0 0@p0t@L H00@H0L@00\uPkXA8lrp,pp -L00`2 0 R(lH0S 0H@ pHL P @T 0PP`p0 ^Ppt 00000u00000  0兯PkhA,ppp A@AA2 -L RkH0S PQ1T0T T0 T0P P T p0 0@p0t@H0 0@H0L@dd1 Y&*D@Pp80 pt 80#6 xP`v0@ t墅0P1 8  ]KWL80CX:H꬀pP P@ 0tu0Q x0 Q Dt0Sp0S|<< 80PktA,pppp8lr frHpp0Ȧp A@AA -L00@ @0 R0Nk00000hXK 0ѮPkA A@AA -LM0`0@ Pp 0ʠ @ @yPT0 P`'HH0HP h@lPp@tPKhԁT봽kppp,pĈpp h1@P X 0@!0 R [00 (0 0@(0,@ ) L -0600 9 0>  0@P  .t0 @P p'X9~R40 @P $  frpԬkpppA p-L@`TP@P  R0T 0@ PPP@p0@0@@P1 -pLQ`P0Sȸ帡 0R1P W0pH0@40H0 9,0(`8#|0S: |P 0m(1P剩W, W  @0@00 00S 0Rؼ0Pmw8 RR:0.S 0  $0@= TpT  @000R 90.SԬkpCpȈppAp -L M0 0@0a0 +,0 %?Z 000 P`,0  p <0 00Pp@`Z !0,0 0(K M-LM0L00 , 400S 0P`p <0@P`pG qP Y W 000  ZW,\ (KoW(K, 00q0 (Ko(Ko 0岨A -L\MP T p\ X0  L 0@ 0@0 @0@T \ P` 0P`Ud `0 P0<0h0 P < h LPL04l Zl\@, 1h\ 0OS"U`U P ,KL 0+PPP@0sI ,T\ :P0T0p PPT00@(KT h0O4 0 T@S*!0`4D0 @@ \D 00bUH0 N h D0L@PH@@p PP X. WFʁ qp tq U<9 Xt0   0 0Su0000rtuXYTU0SVt0 TY t6 q: R Q W0 t 0R XY V0 qrruuXuVzrQ A p-L MPK0@0% `K0S 0S  0`%PKp  -LpP01 0101 P`u 0P@`PU`P `400v0@0 @ -@L0B0 0C0hۚ긊p 0-L@PBUT004ޛ0P0T 00   R0踊p`8|n9  00 RHa `?`4000PSF8R괊ppAAAp@-`@\( 0S% ^P) ^ R R@ 0 0 R0 00 S0  0S\ 0 0p0@ 0 0  R \,  R/ 0^ 00 S 0  0S0S0P@ 0 S@@ 0 @0@ 0 0 0S00S0@ 0^@@ P@0@- R 0S^ 0Sk 0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R00 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R0 R 0S@0T 00 S @0P  0 SP y -L`@V3 ^=0S`PVPU p` 0S`` T PR 0T 0RU 00SW `PV p PU` 0S``P p P 0S/0S/P/0S/0S/0S / P 0S/0S/P/0S/0S/0S /P/Q00S/Q00S/0-@0 S0/ UTR p-L@PT `P`@@T@p 0-L@PT P@@T0 p-L@`TP@P  R0T 0 PPP@p0@ 0@@P0 /T- P  P 0S 0R Ppp -LMp 0`00 R 0040@4 Q0$0 $PK @$00$0 0s0P@$00KDkX/lpp0 \LP 0 @0D0<0804000,0(0H0$0000 00/L0S X \\0\0\0X \ QL/0SX0 X0\0\/@0D  D R80SPQT0T0T T0 T P<0 T0P P T0 D 0D0/8pxp -L@p`\L0S XP7/PU L0S \ 0-L M   K0 P Kp4-2L?0Q Q x 0S00SPpx0S /40  0 R  R x 0\0 00R0S R/ 0-P$@ L0R 0100S P 0$0 0$0@-P @Q -0E0@0@P/ -L M@00P`p,0 D,4,l 0 T9/(HLP`p84PP `p9/9/(KXA AATA -L M`0Pp0L ^x@00P1 @5/Dl@8 <0@5/WK5/d@T t5/ @TT5/h@T 85/ @TkAkAAAAA  - Lt,0 S0 h@0`0h p x`<@@PD H00,T0X@d\L`PpZ BZ YNZ  el n -L M @$ `R0( P4"49/ 09/8000 ,@ @@0H`04 0,@00 `p@9/X``@0P00p9/@0 009/x@0hx0P9/@0p\0P9/YϊB?0 89/49/@TP P1ł"!10C cP X0S) RP9/X@T9/(^$K9/@T X0S, 10Cc\tP9/X@TP9/T9/H9/TA(AAA@AhAAAAA$A,AB4ADALAA -Lp@T P` 0 `@S nPQ 00 R 0 QR0kk p-L0`S"0@T  P @T @ PpL@0Q @`0(0Sp3/p 媙kkTAH1 p-L @RP$BW R R000  00@ d` h0S% 0S0 00@`p@0h`00S S 0 p 0?x0 R L0L Cp0Q@0t0 t0t0p t PkA!Ce kVUUU0 0-L @RPhV0S @000CS0x0D0 D d0S0d 00dP@0PkAA -LD R @0 BD R80SPQP0T0T T0 T P80 T0P P T0 xp8pA0 -L @RVP!  R R000  @  h0S 00hp0Q@0t0 t0t0p t 嵙PkA!CeA -L8 R 00S080夙墙AA -pd@L`PPDLVll\ 0 @@/`P PkA -L(` M0 40 , ,0S# 0!Q@h0S 0 40@PGl0S@`h0S]d P R U@%Up008;00;00@Wd RhP! UP @Up 0SP 0SP @(KP 0SUR P0080000 0_@ T~ kAAAp0 -L @RPUTl00Csl0 @ S0@0lh^ϘPkA,A0 p-L @RP`pyUV 00  y R000 , 0 0pl00l0PkA!CeQ@- @P-\ $0 R 0@W87pk41 -L R  1 `V2 p`V 0 00S00p Pp@`5XHYpW Y  KT'X0@Z 80`Vp,M$J fr#pЬk'k5 PADA 0-LP@Q0\0$C I 00Q i6P @0  0S 0@0@  0S 0$3 0S 0 p-LP`@<T ` /00%VPp84  -0L@ 1/ -LMP\@`Tn T]dPZTXPV1 -\ p`X PG0\ S d RD@$T@6 0\ 000   P00V@@T@ 0400P J0400 R R 0S 0S $3/1 0\7@1)/@@\` x @P0d S Ǯ$0 @0400P J 4 $0<$0}p p-L0@P`  p fP$0<$0p7$0<$00 p Q-L Mp@@ @+ R t1\ \ 0R@@@A 0,P K0S S S -P 0 KiMPx 0 Ki9LQ0PU 0S0S PU-P $,$ @0 00$ 0LP}.kk,p P0-LLMR@00  帕0C40 GX0[SK0SN X厕 0RIK0@ XK, 4  @ XK4  @ XK4   @ XK4   XK@ @0 XK@ @0 XK@ @0 XK@ 40  XKp@ X0[S \WKD0SH?@]jptAATAHA|AAAAAAAAAABA -Lq`h@TP# 00  R 00@00+ U0XSh@TPX 0P @h0S 4$  ΕkAAA -@Lp80S`&@P%D00 Q0P@0 PP0PT0 @0SP0 P0P0T00@T 啕吕kxp8p$A40, 04  KD0S/ 0<40 KiZ h 0`ޔܔ ڔpkAAA p-L40@\ 4!0phq[ L0S 000CS,80 S0 p@0pQD0S\0S P QhT0T0T00T0PT P 0SP0 P0P0T00@TpxQ 0S00 S1 x 0S004 # x0Q' P`Q x 0S0 00RV`V 40;404;40,0x0xQOMKAk8pHA4A$A0k fr -L40@  x 0P Q x0  R0 00R8 0r03P0S 40 8 -L80S6 0-L @R  40 <0S 00S 80S 000 000CS 0,0 frk 00-@PLP# 80S" 0CS800<0S P 80S@0 0P000嫓,$妓 塓 frAXAhAAAA -L40@ P`  P<400!1ZP@08#1pQ  R8P  PP 800CS  R80 ꐀD0S PQ T0T0T0 @0P 0T @08PQ(0T  P0T  PAk8pxp -00L0CS1!`2?0P1@p 0 00S 80S1H@T @T x 0S @T $)x Px0Ppx00x Px0Px, T` 4 +4 40;40@ QPY00S  _  ,0 0,0  frPp -L M||p2 @_W, 0 4 c` LrLb@0 @? "0S0 02 R@U"0SJ P`U]PPUZ DP80S\P\T0T0T00T Pa@0P0@0T00S 0SEl@TDx@4@@0@,0040,00.0P80@(KV@ 0S 0S  㹈0 0 `0|0 P d700PH3D|<.8,Dp,p fr@pT/lk8pxppAAAAA$A p-0LM@Pp0 $0KT :pP00 $`0 P$  $``k  * 0-L 0PS@  @*P0@J*DA -L`@TpU@ PPp0 dP  LʐUp@W0X$徐@Tpp frLApAA d0-LP嫐L0Q  P 0h蠐(h蝐 kA|pAA#p P-LM4 8 \ 8 0!4 |1X> 4 0 xP@/ R, ( L0S300X@PY5:`,K, pPT,@  L0S YX@%:P  `pP J(K0P @C0T0 40c8 pd0 R X70P4 0b8  p0),0p 80" - ppkA@p0 -LP@U3 PU0 ` pP &@p P 0$0 p0 00$$0(0$0 /0B0Z 0YZ 0@k t00-L Mh@P`@@X 0PP<<0< P0 P K0hwCDpA(kpxp8ppp0 -@P0L⬠`p@0 p Qt0t0t0@0p t ` EX0@0 0Sp0 p0t0 @tk,kLpkh/l -LyA 0p-L@8Q pL0`XP`p Rt0t0t0 @ p @ t<`pk -PpLWL` `0:P$@@0$0 0 @$0@0$0& k 0-LM0K@ :PP000 < 00P P/0 ?0S0 00H00080 P$ 00?000k\/l`/ld/lk 0-LxPp0@P X \0R H H0 ?R40 0 00dkHpD]p k$k(k1 -L 嘁1嘑` !1 0S0`1  P\ p @T  P1 0 PP @T 0S0C0ʤ 0 S0( Vh0S 0@@00S PLP 8U4A frkHp,kkkh/l$kAD]p kAAA  0-(P(@L0B0 000kLph/l-0<2 -L@ P 0S $00 R 0 0 0  -LMPp`o P' 0$ 0$S00S 400T(0 $@ 00 0@(KP 倕 K00S -L MPp`8 P. 0+ 0$S%00S" 400 T( $ 00 ,@  0 0 00K(0K B K00S -LMPp` P' 0$ 0$S00S 400T(0 $@ 00 0@(KP * K00S -L MPp` P. 0+ 0$S%00S" 400 T( $ 00 ,@  0 0 00K(0K K00S @0p-LM 40 0CX \0 8 0@`K`0 0@ PP Kp0L`K0 PP0 0P U,PP80Sv40  @0p-LLMP `40 `K0CX \0 ` 8 0` P L0L@`Kp -L8MSp@`( K`P( 0 ` 0S$00S ` 00CS 0 $K(g 40K 4@ T0 P <` @` 0 8p D ( TK@0,0K 0L@ HP  ``( L0K0 @ ` V( D0( 0c0 0-LM@ PK PP  K0 -LhM@0 PP @ 0S;$00S7  00S`0 S S 0 @0LS 0(K K09@P p K  0Z S 0@ <0  @<@ @  0 p-LMP8 `KL4 X \ ` `0P @P L@T H8K#HP r@Kp@K 00 0H LKˠ8 Kˠ @PLT -LM  -LM c -LMP@ hKL< ` d h @8P PJTp1!0KQ 00 0P @ 0 娀 PP(@`T 00SC 00SP WPWC U* KV9 T @KPPx巁@KPP~|\P x0威u KT `@KPT0@ KP00SPZP,,p -LM  @wK -LMc  0j K p-LMP K`P p0 $@60  `t  00CS 0p -LhM@( KPP$(` 0W 00#00P$  00SP PP  >( 00CS 0 $K(@K^(0p` lp  0 P 0-LhM@( KpPP $K(0 $`L0$ P  00 )P0 R 0匠K 0 PP  (  00CS 0(5ꌠKP  P 倀 |p 0  0 P0[S괭k -LMPc0lKd h0 l D @ 'PP K0D cdK\P PH K ` 00SP< PP8 0jPP1  00Sb  0<PP%40 H<00<0(K  0,0@0,0(>PP0S (y0P#  00l PPSPPK ㌀ 00@ ( 000 0PPk 5 0PP@;40  00 y@KP@ 0p@ lP PP -LMPp, @P t f000(K` H000 C %@P00H00\ K00 @P 00, @ fr S-LM 0 `  0K0 @Ps0P 0  pk -L -LMp`x@P= Q R1@P000 x$ 0(K#40Q@P  x (0 x@*. à 0L@ @bT x00   @( 40940 00(  (0x `40;40k -LvHA 0-LM0x 0 PQ%4@ Q Xu HL 0à L0\A(kk 0-L M P@x 0PK0 -L (x0 !(!(q"$thA 40  /x 0 p-LP@40  ` x0 x0 0 `p 40  /x 0 -LMP@x00 R  R uu40 H 0 40`8 V& $KP8 (40(sb f (0P40  0f 0 0 0 0 0Ak(k -L`00Sq; h@TP 00  R 00@00& Fh@TP0S0H 4h0S , tkAAA -LM`P x0L R  $010 (4Rp R@% 1 W#*1 R 0s 0 2!1C0QX @PBAD 0*T @D1 W:@0s 0 1P3!2C0$Q1 PKup , KP ,80S$+P3ᘐBC $0S40040(0 @  0* @p@@P Dk87p(kHkk -LDM@X 0`S0S P X 00S S Dt@3 V 4t 0SPX[0P x@3  $ R21C"0 \ `@ K0L 0Cr 40 0āP000Q  010N `!0 00@0@ Ѝ8@CPpųXpE.\pnm\AtATpk_k0@-@PP 0 U0   R 0U 0  P `  0 S.0 0 R@ Q ,0U 0 \000AAE-@Mp 00 Q.\R00S Wࠃࠓ.00ЍQR J \.\ 0 S.SQZ0.SR.0Wࠃࠓ00P^ J0 S .ST \ ^ZX \0d `h`cV 0 S  ^Q 0 0LV \00SQH\)0@ S  ^R 00A\  Q00SPRQ 0S0C0^ Wࠃ\_00W @0!000cR00p0l T # 2RQt  B0 S 0 b0lS 0b 0 S~00N 0 Q0G0 s R .R Ap@-`0 S0C R .RA2 1C00 R 0l @0` 0 @P   PPE#J 0u0  P BJ0r0P J0@P0000@00p  0@00pE- @@  0S ~? 21C0 CPbUP U`p@PEupG8 `0 R0@Sw@pPUpG&J`✠0 R0@SwPU@J 0P0SU@ J 0P0S 0S Ap@-@`? 0r03R0S@ 2 1C00~ P ? 51C0 0C 0S0 00e 0C0p 0S p/SPE 0Su@0S0 00d0C000Bp/S@D V:0St0S0 00b0C0/S 0S0S0  /S 0S 00L 03 s0A0qs/Q P@ R .RQ4 0?Ac/Q/ 0?Ac/ON -PPLp`PPX!0SP, <P@<@81 (!(10Q@! 1>5 Q  0P@   B ਠ0000>~( B3 1CP" Bc 3X `1C 0 000kdp`ptAnm\AQQCA0@- $@ 2 001PQ   R 0\$0^0T00S 00"0lphpQ/ 0R 00/ -LS0@hx0 0-LP R@ 80SA P 0 0=e0 갭k4A -LMp0@L$ P PK,`K30 004 0 0 00  S 0000S K$ Kj PPH$ $P S $0 $0 $0T $ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40$ ``0$ #40S$0 d  S0$ 0d0#4s00S0$ 0d0#8s00S0$ 0g004 $x0s0`0#8s004 $x0scW EPm0z T0XV 0s0^\ S0 0S0e U0Z0 -LM@0 p4SP4` x0s $ h iP(K  vmd0WlW;`0 00 , `pdX01mYdp0$00W 0, r 00KPPX0 G,2#tp 0Q= x0000s7 PdX0A1 A,0K=PPdX0A1'\0080 Y `0X,  c BHd04K ǷPP 46 XPPX `d07 `n40dH80ca 4y4>XA 0-LM PRp@ 80SH0S` 00S`y H0S DKL $00  0H0`갭kA -LMP@404 x0s` S0p`d R#*d0X  B0C2!03r T0Q` 0`P0dP$00i!d 0piA -L MxppPQ P"@ @D0 @P< `<0#0 0AT@T 0S$0W0V00S  PD0`@(KX#00K`P'= \04#`@<00@0 ` `8`0 P0$p@ 0O`P 0V2D 004 0U 00b x0s\ ,K 40KP`,H W,P R,0 S ,0 T ,0 4 %,0 4 %,0 4 %,0 4 %,0 4 %,0 4`, 040 0 0d04 x0s? 4ΰS0' 0 000`Q% 'D @b@0Sw0 40040S x0s``1D @0`0d0!55T000 0 p80K~PP X 802d0,0 $ (` $g`% frlphpkAA40  -;L0P0Clphp -@LplP`0p8< U##00V 0aS0!40Xl@-P`@p h\00|0S 1Ph 0\ RP00  h0Q0h0p0Q0p0x0S0#x0%/ -L MßD D@ 0 `0<` 4Pp `\0 o ^( Kd0000K`",nQ4 |T#000W{x00 00 s@0N8K4 K@0Kr4Q <P ֯40PQP20s H<XZ0@0P40sc,t 40h@Pp0, Qg p@ X,0K@P4 Op W0@0@4 , 4@ BtAȍpApp -LMpP @ 02$p  0 !P  0P:0RT0T$pH 0X!^4E  T0 #T1 01$pP0S6:0lP`P00W0S W ፪( K,0K($K ,0 PP$px~H 040 0  $pfP K$` -LM`4pP4K(K 05@P$,K4K(0үP,(0H R:S 0S Q0S1$K-P*,$ -LM@Q`PdX 0`32aD6"\\050@0 0P咯pPX 0\ H `X H0@ a 0P{pP 00 0-LM$4   0-LM`4<0  <0KPD p,K8 K0PP40K8K,0DPP.0, H0P*0@SH0 @0S0S 0 P 0,  @H00Sᑩp፩(KUP0兩<\PP0}<00<0 -LM4p8K,K 0P@P80K8K,0P30P,H0P *@,0PH0 @0S\ 0` \ {P d uP 0:6p2(KT0)AA -LMp( 004P @4K,K0C00X @D4 0`P1(K4K,0哮`P-(\0H0 R (0S  @000 A @D\0 0S (K`P 0\ 00T00S$Kب(ը -L M, ( S0 S0 p_(0S i$K``0\p \K 404`VWx0sA ,K` X0H0bLd0 -pPA,H0 @ 3  P,0x q4P0 40X`0S) U% q@0S (0&,y (0K,p pP(S0 `@0\p,p\ `W,,pl` AAA -L(MP(dp^L 4:dX0  a <à 0, `PX0,d (#d X4K>< K,0K`P,0( SH \00K H 40<K夭`P00(\ H @H TP PS 0 0 T0 0% 5#40% 5#40% 5#40% 5#40% 5#40`  `0#40S dS00d0#4s00S00d0#8s00S00g0040x r0`0#8s0040x r0c00,0SK>D  @  D 0 @ P9 ,0 @D0CS,03(0\ C(0< K`P0 (4K A(X>t`P0K<K40`P00\ (H @d 0(K0p0Ω`PL R S0 `, x0s P0H0  H L0,`@0P,` H 4)-LhM0 ,0  H x @6| T0 0|0d 4 ` S0t , 0tR/(K@ 0APt | Pt @40p@ * 7K0P Pb P t \ X  `\ 00R   S R\ q T `m 0Y 0R S .SY B0pl0 h0 D0 @KdhP K<0KPB`HK@0PKR@P4@PHHPH @0 s 3S00S9 \0S`lp R PP p᧦h00h0 2X \ ᙦV\`lp  V 0fl2l Q 0\0"'t V |  д0t0 N\` 0\\`S  P X0S@H` 0 0   H@7K Pd(pd 0,0`0 x 4r` <0SPZ VPR<` H; v 3`x0s00@`Qw T00P00SS  Q u  0=Pt d`0S  Z R t ` <D0KpPt p0|SD0 0;0x t>20X0 \ d\(p\0A,00.S  R R0.St`R <` T d`0S  Z R= '|0  |  T   u ~ 0Pt |d`0S  Z Rr |m0 @40hQ`K0t0 aH卥t@ ]P t Y` <D0KPhp R T0 x  060D0| T   d00S  0Pt 1\d0@,0l ( p0\;0t #tx 06t 0x 0`60 <D0K@P!pQ T  &D0 |0 m` <D0KPt D0p R |0 x t060x _Pt@ 0t@ 60x TP060 D0t pA/ 00 00$  / 0-L`P @pP 0 40 00 -LM0K@`<P000   "-LM0K@`+P0   -LM``B0$0 ,` (  h0PSp 0S\, KǿU   0W P$ -$K\54A p-L00PS@  0< 0S  `P  01 Pph0S 0S p-``P,0dSd L L0@ 0@T  T0@0 @0@ ,00@$( Z BZ  e|  t Fp -L  pd`P`R 0x`@i0Q %`<;$0 :$0`" -L8MPx0p b@P (KPڈ7 U@ 5 `0 ``t @oT$0040  0@P(KH H@, :H N@P" x0, P  4 0R   >V P <~;{`,; 00k000,H@ 0 `4 < !0 p4 L 8 !L0 \P4 "0 4 "0 4080 0$02 0$02 4$ 2@SQT  0 40 00,0 0 $8  0 PP $TQ80S 0 40S"x 0/"0 0 4(00080 0$ 00020<0St 80L pL Pm:0@j0 Rg 8^d 4@,0@ x|D 0 ,@ q8 <0 P 2@?0!4 H @D000H0`D 80D4\t0 LP 3R#0D  0 D0x02t\8Ll00 0l0$ 0P S@CYP@l0 4p00$0B\0d @`d 0@XR O@@0 T400,0Q,厢0,0 |QIP00B  P< P P@P$00104P00h010 0`b删 x0e"0# $4!X0 @0(.XH0 00@0&0%40| g0  x0y4; , @0Wd0X@P lp@ lP L \8BAQU<&`d0 ` ` P6,@K.QdT0@K @۝P,KP8 K0TPP`0K8K,0PpPUX^OTL0$  P 000FQD -LZMXH 0 l , 0p1 S 4  KKll!0S `T1 V 0@0PlATPd h  T!20 d1 &Ah 0 dp1` 2Rx1 We@ @@tA P L! l!P pt!Kd0b0a1 V Sd00X\ 1 գPa l8<| 2 \ Y1Q0UP!`! \1 0X1 pR/KO?KNOK@P KRK81YP @儁8!@0H| cX!X! 0S 0PSW Q S0x p40 40Ȍ \p@0.1K4 X1P KK p-K0h%0(Kl!0S/:MKl!fP #h!R d10Cd1 S 00 h!  @` \! X! H| 0 ` P @pR0S S@0`1 \A @XA @T`1s\AtKV 1 R0dA0d0l` p0T!00b0p1d P Qڌ0 0C, 0R(Kx0s{ 0@ t! P1 LA 0X!MK'X 0@@@`a \q 0 4(000S<P@X `H0 a@0nx!2O020.1K4 oX1PO-[(@K0 1BP@0@`1 \A @XA k @ԖKV Ζl\{ pt!Kd0b0aV S1 X\ d0pPa `80| 2 PY1Q U P!PyA0 0x@0RU RU*ڔ0KK,-1Ku-1[!(@K00l0SC:MKl!mP % 0h!`@pR d10CSd1 `hA@hA PUjx0s0@041 41 0U.1K U0KK,-1K??@ZKV KKnKX?V@? @"@>t 0OX p"C~BA -LPMd dd P dX  T 0L0 00LS P4H  Sv ()NX L Td0@0 @TReT0Pa 0@0@TZPTX ,0KPSTLdZD 0MJ TpǏ p X4 SHP`dX0@0@0@ a31 Q2D T0C` @ < X8 0n9^ ^SZn<ZRQVp l0 T 0\0 4 ^d0 ` RLDd0S*d0 \ R X0P H` \0b@  0l \5 Qh0 |tTl0pP` P `5>VNP1hV0R3Q ʧ Ld0 0SXU H Pd0pppܙ0 <HU00@p0P`0Sm 0s] THP`\0d iZ!L / d0Rp:LdP OPP00 T H8Q\ ,H0d 0S* 0L\0P00T \c H0XORH 0Kd0P IP\ 0帔T0LQ00埓@U]:0s\0STT\ 10SH `0X c a51 Q0V1 $ ^!\G :0S \Q | 0+t$@L\%:@T- 0  0@   `0 0  @T0$0 pP` #P0S? `Q5 `. 0 0 0 0 kL%pLA Q-Lp`V Q CiQ Q `QE ?*00@ Ti 0iTP0 ;j17`i @ Po`P 0kT& 0Y#Y#  loP ` po Q0 0Q Q000000` 垿 0 0i 0 0- LCM 0 ( P @Rp `52p Pp( 0R)$K,JK K/K 0_pP,h 0Si(p81XP(0@ R0'1K0 ,@pKpk(A00@-0 \ PllP \@0 SP 000 <80P 000nS0 n0Q00 Q 00 84 00 4<00-0 \ PllP \0 S P 00 000 00A S@-2*Qf 1@ 0S':6:6:6:6d:6:6:6:60@S 2S K S 0S0S Q0A0@S. )ڀS S) `S 0S0 S 0S @S00Q00Q`S pS SS SS S0S:00:PSS 10 S R褱k -LDM@dKP@pST@D` @0S񟗾 C6C6B6B6B6B6B6B60?60?60?60?6B60?60?60?60?60?60?60?6B6|B64?60?60?60?60?60?6tB6`B60?60?6,B60?60?60?6 B6B60?60?6A60?60?60?6A6A60?60?6pA60?60?60?6dA6LA60?60?60?60?60?60?68A6$A60?60?6>60?60?60?6A6@60?60?6@60?60?60?6@6@60?60?6<@60?60?60?60@60?60?60?60?60?60?60?6(@60?60?60?6@6?60?60?6?60?60?60?60?60?60?60?6?60?60?60?60?60?60?60?6?60?60?60?60?60?60?60?6?60?60?60?6?6?60?60?6?60?60?6?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?60?6PAQ-0 P P P-@0 ,H0 'D 0 p-L@`T$@T ኸP 0 RpP U 041 S 3/PUpp輱ki$P0 0-L@PT $@T ^P0000輱kD0 0-L@PT@T 0GP0̱k -Lp`#WP,PU) PU7 0SXQ 50@^)*0 0# 0 0#^ ᗷP Q  号P PUP^ 1-LM@P T$ $@T P0SP 00P$ 0R! K@`T SP4pK`\ 0 P@T PEUK뼱kpLA -LMЀ 0R$0 Q   Q$ 0R  K@`T RP4pK` Ჷ P@T PEUp`A -L(MP RP0,0 1Q  R P 0 0S0CPR PQP P, 0R](KP0@l1ZS RLKO0  ҶpW60cPU   3P@$ 0X@p PEW U`0S <K  @X Z UP0 0eP 0@ <K㑶  P PEZ @P p̱klA 0-LMЀ` V$ ! P0@T PPPU4pK@T PU `V  P $ 0R K F؍ppıktA p-L@`TPL@TI ᐶP Q000 00  QQ 0S\000 0 00000CS00$ R( L0(0 (0 ($00 (0$pp輱kL 0L0v - @L,0P@  @h8 0$    0$ (0@ 輱k -L0PpS @T @T P  l`P"  fP0 F@E0/S@09S@P 0@T$@T ҵP000@p 00   00 ` 꼱k D10-L0M8Q@ T $@T 娵PP @T(@K70 (0K'KF@P <P h{@PD@K p! 1@P <P @Sf@P 0RK0 뼱kpAX*AA 00-P@L0P  $P$00 (P(00,P,000  -L@ R! !  110C0C11}^ 10P RZ -LPp`@Q 1@ 0S `TP UV@0@S`@0 0C@0 M^H00H0 -L`w0PUpPU 81W5 @T@T 0 R0S bP@̱k p-L M8@K`P ^(` A PKp踱k P-L`Pp@Q Q P^@P 00 0@w@@\0\ 1`V@ `V; 81, R@T@T 0SPU 0 pR*0 0# 0 0# WY  P P P㜑 ̱k -LL0@S PL $m 0 Lah) ]6CQ -L0pS 00Cs0 SP@ 00 CSr  RQP@T`U 0S U0S; 0`V`V vP zP0gS"\ 00Ls0 S0gP ^0P@@00L\s0 SL0!lr/0A!b0RPXP0S ıkgfff -L@pP`P R-52/0P@ 2/k p-LMK`f@PP cPP pPPVP  -Lx@\Q hh Q 1S H1 RPE Q %0S 0R*0P 0P[0A!R<10 R _m#pW00R:R*  P`PP ! P$00007ȱkܱkkA}pA -L@000  0@Xẖk -L@00S0 0000@hṉk@1 p-L PR 51!S0#R:5 `0 R0 0 00  `  ` p`0p 0 `00 @0tP@%d0@P `0S phb000 0@@0PkAԱkpp -LapV4P @502k -LMp2S 0 e00S P, h0C00 (s0,0  ,0 (@`(000 0 Pe0 U050d00@0a0 p@B  @0PU0dofd6 L-L M<@< 0 P&/  YKh܍pl/lAd6 -LtM`V, P@ ;V ;Vf ;0SpP ;V 7pp, 0Rz(Kh;VP 0VU T;VN Pp %4;V K$;V sP0CV0CV*0CVZ 0V  0CV \ @ 0 p5 0# h`05 xZ@ IpP,pppLp9V N0CVE t0CV 0V} 0CV0p1p @ 9V3 ;0CV 0Vb 0CV~1p0X9V 50CV8 0V 0CVWpPZP~ʕpT8VZ 0V 70CVyCpPF1Se  3/pw8V 8Vd41p0l8V= 0CVY#pP& "pP! U(8V 80SA pP LPK 0KdpP?_Oo8l0p04h0p00h@pP1S  3/h0Tp 4pP5"  'q< 0 \%  #! """!1# A A   -L"@R\0700"R p-L@`PT4 T T/p E Ap0S 0S0S @T 0 ,p3000   00p@Tt l p@0^  0@0X B0000pkkkk -L M@,.PK4pK `P:BT/@T,  ūP 㿫P00CS0"Q4`00 0007P20C2 ᤫP 20C2 `(K k -L M@ᘡp.K4K `:PP .0[ P(K40[ BT@T  aP  [P0007 $@P#  Y U00 p2 S0"04P0/B 2 020P2027Pk -\ \:5S0d0\-P41P0h040\0\ h2i 1i i i 0-Lp2 D0C"2X 00/0020S@ b @42葖@42/l\k 0-L2@41pSl0 P4e 1d hfP2e ƪ020D 0hX6 -PpL`WR81W(0 %i 0*   R P 0S  RP 0 〪PN  z P11<<1100@0@00@0@0@ 04!4s@, 1& 5 L 83TX $ Th $3T00S 0Sn S 1P mSS1 2T) 2Tt2@P p10Sl XB@ D0RZ@  100Sa@`10`@  @ 5"51@P p0SV At1@P p0S7 `A0S L1R0T4Q V`P   gpQH00H0iSL0Sli000 0@@0000 0@@0c\Q000 0@@0kpk5݆pxcrpp -LM`(8ApP[ T (8AV 0 0L.5A0AS2@ W S(KU 4 @:  dZ 4   \Q 3 QZA@@@ R+66466666666666666666666666666666,6( @Ps 804 0CP800-/@4K @.K  @ UpP P @ 'ZI 4K !㲑@!1RAR1 017@w 0.K 4PA@h.K  0."P 1  5  ?@T> @ @08!Pd 4 X A@;@00_! 1Sq@p10q1 0 1  0 0@0@ @H 0-UP@o  0 E@gAkAkʚ;Q0X0/ᨁ0 Q-L`p 0CQ :R  R R /|0Q %0CQ`P5@05@<W(000h02i i kԓ6 -LpP DP 5EUp 4 20S30@ P` 0OP`P` R R 0,Q/Q@ᜡ@ D0RH00H0Q 7TQ@Q40 3A0 @  100S၁@10@ 0 @ `0P@ `0S |0@ P`| 0 OP`P`000 0PP0Y-AxcrkpppA40 -@ LP 蔎p p-L`@/PP p 00,0 h0%0 1!0 Td0f e nD 0\p,@Pu|0A6Ȕ6p -L@hk- 0 `0S S 0R 0 R/21C 0/k p-L `\Pp0#U T @uT 00000   {Tp -L P@  @P 00 ST@P0 #>+8A -P`QppW@L qTo 1R& 1RP  0Sc0PS000000P 0S 0S PP P P>   R0; Pp`PP`p XP1P!  +p @P@U00S 01 @P@U00S $ẵPP00SP P0PP5i 6i( -L@`p  PP 0` pP0  0+|A 0-L @P3P 0  T*0P $P 0 P+AA -pRL`@PPU@ - LjQ0P+ 6pA 0-L`P@XT   @ T0Ph@꜎p 0  0S/-0S  0 00Sp@-0 @PbUe\5* 0`  0`R Q T 0SQ 0S p?^00S eR 0SP 0S p~3pp@-@ `0\!P 0\ 1 !P U 00#  0 0#\pp0 /l -LMp, ` 0  ``0S@ T00  R *0Q 0Q  R 0@0S`0#0S0SATg@1@0T 02 0Z@T`PU"0Z,PU 0 @P  @T 0SY 1 !\PPU,0S@ NP@@@-0\Π@    @ @0 -L`@ P@Qp >* 0 RQ 3  \0R 000Q ^f 2 @@@ 0  PP0S:  0    0@  p pPP00 -`L0pS0S 0@T  0 0S@0SP U 0Pl 8/PU 0 -L@p`0 X@P0Pp@ @ 0 0D0 80\ 00 00 0( (0p 0/l/l,6\6Ԡ666 0-@0LSP0p ㆿ0P000h0 0-L R (0Q0 R0PS0hB) a@P 0 0T0T Q*00Q4P0$M) K)}ppA/l/l/lp4A,A p-L@PT`00 c00 00 P0`0@p P@(ꤎp@A 0-L R38 P -LMⰒ`0PPP@R@T%T〢xx2 D  dQk*0PSh 0RS BQ:`aT"0S`1 pqQMP!``0;Vp9WX00S0 㪾PPp \100ڢ ٢H1, K0I,0Sp: ^!Q Q\ 0h 100 0  ᢢPpe੢ 0 00`0 R 0h1000<2("0N Sꨎp/l/lkppA\A -LM` P @ pP RX@U TU @Tp R P 06 0S PU 0ES 0 Z Rq T 000S` 0 P 0SPP0 PP 0p0 00R '  00CS 00 ^ھ0S  \ R0S P P 0S'  p P@  0Ss @Ty  dɡPe p \0SP 0S:0S   0SPX`   0`V`  | Q R 0S  <'p40S  Q0A 0 =\ P \00S Q  00CS 00R 0hd 'T'pH0   ( 00A0AAAAAp -LM< P`Q@ 4 8` 0` 0<, K,0SB Pp- p@Q V Q y0RPP0pS @@PQ (K T00S p 0S < 0 0V 8 ` 00 , @R= V 0 0rS@40S  T Rp@T |0X0P  ,0SP 0UJ PbPp@T 1P0UP0sp0S3 R 0wS0S R0 040 FP8 p ` 0s000 :QR 0p00S  t 00 0@YU Q 0 S R w0RQL 0 Sl PR 0S 00 0 P@hP PEUp@o@r@Q ^#3p0pS" 0"0 S R ZZ  R@%4%PZ %|AA\A Q0-L@P0h0 P  @ P00T00S00T  Rh/P/ 0R /Q/r r0R/q@Q/P/r0S/Q */ 0S/r0S Q/1 \/ / -L@@PA- 2\ \@Q`Ÿ2 00l0a6# a c$"cb!0b0a!6# a c("cb!0b0`# `^ ap P%"0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b#b`! `^ a%"0a@0b@7#0lc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a^"0a 0` 7#0bc! c a$"0a0b6#bc#! c a("0a0b2#bc! c a%"0a0b'#Q 0 x0 b00b0l6#c! c a&"0a0b"6#bc! c a""0a0b1#bc! c a'"/ly7 p-LH@`P0SzP P 0 hp/l -L pR` <0S 40 P400 R 0S 0 R 0SP@p@`UT0D@`fPUV00S@ PUP80080Hkk -@L `P pP 0 0 R GPPU 0 S 0:: S c5P0 Q 0S R 0 S PUX r0rS i@S@P T 000 RPr r0R Sr -Lpr`@r00S -@P @V PW 0P 0 RΝP @PPPP -qrpLPWr@`P[ 0SM Vo 0@S``@@ 0S Tp  0R0S @T r`Q< XW00S 00P 0PPP R 00S0 0S0Q 0 0P0`SPRV``@00PP 0RWp`P pGW0T@##A 0-@ L0lUQ00 000hҺ0 / p-P@LT`7pP0P oZPpP 04 a!0S00@@p蜴kkp0 /ᬎp/ Q-Lp`@0P* S 0S-` X FU` ܑT0<6`6x6x6x6x666666p666x6(66x6-` PI @` Ϝ @ 0 ` `j`"-` 0S+ uy[`q[`W! @T8`0 0 0 @`ZT\[``P`9` 0S  0`kA -d!-LM0@,0 0T` 00 A p@T3  0 P!0R!R 0SP 0 AP P  9PW  0HP 0 [P Ep@TW 0 [P E(K>P;Ppꬎpʚ;0 R3 0% %'/ᤴkpP (0 P0 Q//ᤴkp-///00p R3/10 P0 /ᤴkpXp 0-L@P0P0 080p PP 2S//ᨴk -LX`pP@P 4 #P P%U0pS*褴k6 -L< @R g00Cs0S 5 40 w40 r040r0400 -L pR`PP%U s@P P L #P0 #P 0`S*踎pk6pP-Q2 S R 2S,00CS,0\0000 000侸䨴k@-Pp 0` V@1@!^ *0 00^:Vn@ pP0-L@0"PP ""0  0 ⅛0 -L0PS& @T<@T :P,00,0@Tp+ 2 S@rpT0W0 ㇶ`P O,0T0r,0  @ 0``@00 ``pꨴkP -p`LZPP 0@T \ l0$Q3`A`PT@T 0 p80S080Z} (>zcpAA -LPM`PKpDd Rd@d0K \  T 0X 4 0 r <`p0 0p@@Td 80SK080d{ -L<0S 4@P # -L40 h0S  -L @R <0S 40  -L @R <0S 40 T0 0-L @RP0eP0P0 Q0PkApP1 -L PR0LU𯝈U?0A ~`P  w@PA ȀP㼠p p  !ᝓ  !ᗓ(%`@P0PD0 00o0U PkApkp -LXMphx P` D @Pt@ 3@& 0 t0 '&30#P00S, 5 00 R' @PP 0t03 R00SI TU000!000pKD+xpK t0l hp d T (K P,,@0T PA@,,P 0S 0S40 PA@0   040, 0 GP, `@<:pKD(0K#x`pK8 <@ l hp d @` @,P$P 4`P0t03PkAĎp̎pȎp -L M@ 0t%Ḓl0l  Q  0S 0rQPKo됏pAXp}ppA 0 000/ p-@PL,`ሒTp(^1 @0 CS  @ Q00T0#Sp p-P`0Lf00 p -L M4 , p4  RKX 0 Z0 PQ 0`@PD 0 10 0BR0U `  P6@ TXU00  S@3 ,0S0 00S 0+0S( 0T P 㫯 حP @0 S,  4  R R000 ձR000 Z0 P P00PUP U 000004 @ (K 0 -LHMlKP DՑ1pWX5R pWR  R@T 0 X P^0S `V 0S?0X0 @T/ X6 0ST 0`0 0 L P>0S` P 0S 0 50$00l P 000@TT@ L@ `@ pW(K 5d 0810l0 0 ҠP0 00̱k -L(MP@P`0AS`(KHK `C 0`T<0 H D 4 @ ] p%P 1H0vP0CL S666P66D@PHLh1``LL10P 㥮<0@ X < = 400hS `301  $0`L@`U @%T  0P U`P  `h0 pBK  ,0KK21C0b ?A1c0ukĎph6 frgfff -LpMⰁ`0Q@(0 2 PKD㫐< 00 D\0   @0|0 x 50p0 7S0 `/0Sp PU 0S( 0R1$K 40JpK"s"0J0KP  HKdp 4 L r0(0 080<0< 0帠 0ßP00000NpA 0@-L M0 S66p66@XP,P 7:P00S?X/ , @@  $,Pp @Z `Q 0 70 0BR0` 0=PP+p W@00P0, 0 0(KP,P 9@P00S ; :1@9P@,P P@,P 9 0-L40@0PP X 0`OP t9808 a0h400400hCĴkCgfff R-L@`pP TU f9@@TS S *@:0@ 08 T@S# S U *@A9n:0 00 U 0S @0`v TP@ @8`U 0S @000 -LM`@pTPR T= T  0)p (K <pQp@ 0S p@ pP;0 Q080@ Q0001 0  N0@004 0 a `R \0p40 pU P Plh00C0 00C 0t ,00C0000k fr6HpĴk --LM0,0 pR Wd2@TS P@T. 0 !0R1S R SP  収P P  凎P0`Q , 0BSX666666U 0 `0aR  R  40040"8(K 0 NP B8 02 8p.40`U  0 ;P0  0 `0aR  R0 0 MP 40040\07Pz8 r 0Rt0PoABPjꬎpʚ;t0 -L PRp`P@0U Pᢎ$p  0h5HpԴkĴkk -L@PMt x P` P(Kt Rppp ZlKDt ZR00S pTp  X0  lKX0 ` L ~Pp > 5Z0$00  l0 08! t R00 S V&  p00tlK` d0 hp ZPp  5004 00r x0  0 l0 08! Wp0 , 0p 0 0ZHpԴkĴkk0 p-L PRp)`Pp@5d 0850`,P  0phHpԴkĴkk -| LP \@P@0Z0 `p04 0帥T 0 @0 0mfHpԴkĴkk --LM0P@ 0U, X0 T@ @  0S;PP 1 0S p6, 0R(K `V0S+pWV V(p 㻨P7p  06@ ᠠ \X0 X040 Ve\W|0(1 RP \  P pI PpN0S `pZ W p0@000S p8 V 0@@L8 R%@TZ  02:P\0ScV4 &U '7Tx7pv-pZq m}Hp 0@T @* ?TKDk 0 K0  0Rl0 0#S0S 0#SP'  `P  0 S*`7p0S@@0 @8@5PipP `r!P 00 0@S7477777770 P `/pU  (`Pf 0 `pI KT0KIpPT`80080 00 0 00 D 7SD 00 <Q 0 @0 50|0 @0 |  0 Kv0P  㖧@P ˋ [@  K0@]4 0 (0,@r L(  A0 0N@K"㩋"0N0KP  LK7p@ 0S K T0KpP]T RZ L ($T `800C80T0DT r00 0T <050T 400P80080Qo 0 0s03R0#SQu QKWpPQ 0P FQ   0PEpPf @P@ c 0S0 _ Pf V@T @P P 0S  K3/@e@@ 00 00 <0t$20S 4 00 040L $(t<050r   400@0S 0S K3/0SD0p@T $0T 00T0r0 $ 0T0 @ P o@P P R 4 0~@P@T` r00T 80p080 P Q  `V4pQ 0SS0Sp frԴkHpĴkkAA P/0 A p-`PL @HTP4@T(ph Pph0B8BA4B(B -@PL@u4q(m$0 he8BDBPB\B -L Mp`XL@0\48 0`PMK GC0<><Q 0l8@d5@X1DdH D+HK,$BBBBBBBBBBB -L@0T   (B 7@B -LM0,0 3P2 p0@ 00@׉:K ։=2K00<0<Po:004K Pʼn  Ὁ0 < K;0K1< K<1 0, 0R(KpkA -LM@ , D 3P5 p 81@(0@刉:K ㇉0P2K`<0: 4K P`x  t@ pD l0 < K;0K1< K<1 0, 0R(K WpkA ?-@< L0 <0 $7 -LRHM `p00 p@PP 408 0B S800 RH TKQ `@KD 0\0 0 X 0T r `L/l  p-PL0`Ppl0@T@T 81S 00 ҈Ppp̱k 0-LHM@T# 80S0Q 0S XPKDň 0T0  L <0r S80K0   40040}TB %-L@Mp0` ,0 04"4s0 CR\0 G2ş, 0R(K0DK X0 T 剈T@K ㅈX5\ D 0 R .`P; 0T 0  0; 00@0 0@P0C@ 0P00Pg 0 @  @,K0K0@ +PKP;% 00 0 Kppp -L q0S1 P@ T0 hP0@U ` R BQ0 00S VP0`PT hP0@U 0`0 R  x00UU` gpkp00CS/04S/0 0S/5/0 R/ M@ P/  P 0S 008//l 0-@hPLP 0S00S0 P8 1P00@0 0/l --LM`D 0  ,0 @04!4s0PdU)ڲ1 0S*1`P000 0p0d 0ႄPQ 0d0 00S_ SL S ((K000, 0000+ 0S04S @@2m1 @U +U((0 0 R 0YuhQ  Q 0S 0000S6 :S00(0 0 R 0YrhQ  0S 0R QW zWw 000 R02& 00~+0 Rpgfffpp 0-LP@Q 0 R0S Q8 qP  0  0 0 00S 0/l -PL`0 4S p 0 0S 5@ 0 0p  @(@22m0 @kp0S S / P// 00 BQ0S 0`00//0 RP/0S1 Q/ -L$MЀ@0p$0 00CS0` $ 0R Kf Q000  PBU 00 30K(D K6㍞ pk2i  A "-L$Mp0,0 P衟P0P 0Sh@T @T 0S000A 6 ㈜`PP 0 0 @Q:0Q7 0Sh 0P0 0h 00h`0 \< K;K80  L K D1 <4!4"<00 0 1@T+@T( l0 3S3S08 0R(0SmX0S  Q000 0S00@@L0 R(K,0   #C pkB -LM@Pr`p5 < 4&$'$qr,  4%<00 0 0 001@T+@T( l0 (0U3S3S80S4 4Z0S  Q000 0S00@@D0 R(K,<4!4(<0,  ꐵk4B 3-L R 0 0 0 0 4,4 s  1S0 0 0 ! 0 0 0 4!4s0 0Q1 0 00l  A C0(  $,$<$4,4r ? 40 ^E 0PS5岐0S P 0 i Y0801 0 4)4 S*㦚Pn1S@40 [P @0 00 080ᾓ\(K04  00#0l0E  uP=XBXϠ, a`PUPE+10Cs0S1t, Sq: 0A P044$ 80P P0S P10  `1`!尀 , ,XI,@^6PUPE10s0X1*, R': 0AP044$ 80Pw@ 0RPY @0!QT 0k긁za긁(Ko808 尀 , @Xs np pkk|kk -L MP@` 0 \G l0 J 0S&0S/"\! `1Q 0S<00 s 0%,80S/  p80@0@P0 K180S Q0 1P 0800(0`cT7L0S0h @@0 KH@_pP 80S 0 P1 p frxB <3-LM R執C^  KP7 2 @ 02,  0Z3  $#$r 1S0!0 0  00@D!D t@0 0(P1 cp $<&$ 4!4%Pkt Akp frkB  0-@LP0vP 0 nP0 10BB -@`LPP妶0SpW@PV l0 (0W @VU@0S 0@S 3/PkT A -LMPq`0r00 SS S (K0S p4@K04"4s00g00S03,0 #10s 0,s0#0 @4KK.K-K@L!P c7, 0 @>!P( K20P ,@ 0 @u!04"40]B p-LHMPP` 400S Kp\@KDzs 0 X0  P 00T0 4 0, r 9B -L\M`P0p(0 3 400S T00X0( 0R*$K|@KDLs 8Kx  Pp 00t0 4 L r 0PP 21C0@ 10\  00>00>0 x ;!G/-ptBB -LM@P  $Ph 0-PL@,P004$4s X04"4s Q\00AQ\ <0h0 0QST JQ :<0h QX0Q:SX0h[0T0TԷk A --LM` 0@(0 04"4s0PdUt%000$K 0$U$Q  0pKqP %000`P$0000(SDФ1 0  @AQ8y7x7x7Lw7Lw7Lx7Lw7Lw7v7xx7x7Lw7Lw7Lw7Xw7T@tʲ1#U0 0UR 0Sc 0)S   21C0#10\ 0( * P6 @,@ A@ P`PE`A P0 0 `0 p,   _p@00 _4 ,00 04"4 0s0 $#$ (K 0 0  0  @,@ pp -LM< Pp001 cX80 M ( (K 804"4, s0P@4 0 R0 408`04"4:1s 0 :004  $#$r Q0Ա40:0ı0c4z0 $#$ 0  P 00< 0R $!$  <0 H0S9 0`!4H00H04 04"4s0S/@3 `PI 1`80 @@S00!1(,01(  0 @100 0202x  x , c,p0 $#$<0 S  <0 HP 88`Il <00<0 00pW7:0<00<0202x  x ,ppp -4*-L ?@4 0 8 G7^400q x0  0 Y Y \0P0x 0 0@ () *04 0 80 +,", nr 04"4 0!YY }< 0S;0H Pppk TkXk -@Q`RLMQp % 02K R RP VPU00U0SRF R R @00`eV00S RU 0BP U 00 \W < 4!4"<0 PW <4!4"<0 / 6S,t0TP!>X{ Xqkqk -L|`娒P@P |! @D`t`x2 20S? S A !0S01S 1 gXP W 5?R2 RT  R; 0j Cx@ |1Sh06 0jC0@P10%Tt h1l1 S 1% A5g 1 R0! S 1 !g0 RV (GP h00j C PN.j2 2:|20Sh hS:0S0 Q0|20Sh  h S:0S S:00j Cꬹk2k9Xk -L|0W`@p@P@T:Dp0 Q! P𨝘@}80 Q!h PP𨝘ꬬk -LMT` 0, K@$pP 0 0R ' (K 0aS0BD 0a0bSP 0@l l0<0 l0w0w0000S S,0S H000 0PP 0 0 QP Pp 0D@D0t t 0S "2S1 `0t0 R!:t0=t0Px T0X1P lbT!0dR0 0010L2 84!0("?0˨000g:So: S 7 100! 00&?0ନD R1 0cS!`S? 0@L1PA#AXP & 0(@0 @ Z V 0@P_ |!080P00@ HAl0 PK 7 kCqkk -L6| PS@p@T  0S  S/0 + !V(  @0S"1 0`V 0000 0U00 |P l0  HP t04t0t04t0萵q -LM`0 P P  00lSڽ 00lSpWP, $ 0! lPU0U40 P` 0O0@0@6 P0A00e0     0/8 4 0 W ! 1QV P \00H000  zU p0 0lQ0P,@ P尀T㲁 ,00S,   0R (KQ0` 0R(Ko0 Y  0R; 0!0000 0a1 0P,@ P尀T㲁,  0@_8@ 4P @P@P0,0 p 0@_8@ 4P @P@Pp  Q00000  0Q ꐵqq --LxGMtx  0 x , p0 K 1 0#2S S4 Uϟ, 0R(KZ 0R p ':Wi 0@`jTh` V TPP P ) " _@0S S ( h0@T000Q'Z   t0KaP< t 0R:0p  R 0S0s 0S0S 0s R  0S0S0S 0S `` 0S ( P  000 "101 0h#21S  S R0 000i@`dTh` P $Q P\ l8 H0 @ ,<$4P` @%$&4`,,.̃$Q@&.P @ @ P P > 0`0"!V00. V 101;  啠Pb `_ h`h``h` 0   (0 ( !0 00!   e_h`0`e 00 h` 0S T10cS`!0bSڈ   `1R 0R 0R6 S&02 ' =06 00 00@T |0@  |1Se S h@~9@s` 0R0%p :W N ^  `$a 2 0S $ - `9R $ ' $ #0  @ <4!4"<0  <4!4"<|0 P$Q 0 0PU+ R 0S:D@T/ Q $!  P1 0#0  @`` 0Q^ ȟ6 S4!ʼ^ 0K0( 0 6PqP |Q XX!0 b0b S0| |0 VU` 01 la0fR ?S0 0,1(10U 00 U U~ Q $!T!R 00bS)0c\2`V   Q$$L0A" 1ǁ h0\  Po Q a P` P`0` 0 `` 0h `lh` 1\0lࠣ ̣ 1DZǡ0h` 6h`VS00c 0a0PU0U00/0  0 00S  0R   c PU t00t0$P  00cSY10cSU$ U = @P 0(PHKMdKM\ \ 1@01/p  h0]N@v$80 ?0$a70S` $Q, \101 00cS10cS$0SQ T1 0bS00fS ڜP^8lK 1990l0 u @  t0KPx t 0R0%p R*gt0  th Po Q ` P` P` P`` t0A0` @KGKH`K埅0d`K`\K 4Kc`K啅K0 P  P ( SL OL 0B $ RH0a2`Ve#> P 1PU 0R #3RʼP`HKKdK 0 P`puhHKdK 0PP  p 0DP @0H0KGK D d0KcKK0`0 &KPh`u 0`B DPU qpkqk L!ATBȤqPPkdqkqkqk|qk`qhqlBH?kCkLqP T!00bS! `R00\0S  Q0 S  (PQ2 U 00lS⟢00[X6 S`7a` 1t0Ut 0 0bS000  &`!80!?0t0`0`SS1R!P1Q!F81S ac' 10 1   h0Q0B0 P R1  P 6 Sʰt"00S !h` V 0? Q< Q0AS6 8 8| 8 8 8@ 8 8UX 0bS R 0bSQ0PUh0S 0R H0\0t0 HŃ tt3P3C0 |1SC S  hr 4t 40S% O" t4P3C `fPV 0 ( 0 4 nP; jh 000@ 00cS h`h`b& Rd0`S0S/  Fh0K t0tUD xJh tJ`0#6S % S#0lSڨ%6S$! 1S !10cS000ũP`l ? 0! 1  F_K`RP` |0SK8\  <10cSTl 1R2 40+ Q$1UBP1&#Q  !T |P l0  HP  ](0 ZP0bP? 0t 0p!0bSth1Zh0 0bS6 0CS񟗘(88 8H88HKdK 0n~t0t000)P a00 f chR0TT10\116 #J @N000& d(0(8?0Ѡt0`0`S? 00C0/`0hs 8ZPce I  P`00`0h` $a P &\Y\!h00bSThP` ? 0  0 0  PK`P`!h`V'  0R< H1 0c0cS0004 P 0@q0S SP IP101 Q f ` 0SP `10cS0\1Հ T!hP , 00cSF0lS' 1SY:6S=0 0R0 |0S8!R <1 0cSd;bc0 Pc ? 0 0 K T |P l0  HP  't 0p!0bSth1 UhQg 1R 40`,0?0՟ ? 0 t0ătt0tP0St0 00cSP 00C0b0SH00@00L10L1h`v0PE0 A 0h`:` t0PjaS1R!P1Q!s010 Rt= R  YH 1E 0SB 5? th0``h0Po Q a P`| Q a K T P| |P l0  HP  m&0 * t0ăt+t0tt 00t0?t'`t0Ńt0`V000  ( 0R\ / 0l aS0 R0000 ``h0PoP ` P| ` TP`| |P l0  HP  %t3 R $a Yf 1c 0S` 5] t0 P&0S |0S ,!S0b0#S:(1h 0(1 <  t0ătt 20St  ,Q(Q0S PH*10x00 ( 6`"0s06s0S 4ڰ' 10 1$"cM 2t_0 WP!KP  P$11'8a0 !0\<` \` <$!0, 0cS 圀şt0 ăttt!0?0!G`cc 0P3CU  0P3C U 0  0 DP0 ?0  긹kCqkkLqTq -L --L0@00qQ/s0A1h1 !S0 Q xQx<0 / ಝ&r0 S0Һ6 LBعkCB -LdMp|0t @0|0 t t_t] -400aS7!0! 1%| 0 0d0 Ot0t !0rRP1P!-nPx |0 x^jjZ|@W| 0x0U1!Z``` |`` @0 \b0c3QZ\ , Z dP \:|0 |1S Si S .t t(K1Sd t0r0SH1Z:S0!0bS\ R Q<!0\` aV0b0bSTt 00aS  0Q ^ 040@ t UG|@x`xVP"P3 ! 13^jjZvUs⿜40 @ Vv |g<l  tp  t  p $ 0S\ p(P>pl JP  aZ0`0 00Ƀ S~ZK r0 S Z Rl0!0bSG0* 0O$jHD 0@ D H0L@d`P ɟ00S; 1 I0 P00Z|0 0xW 0 0 0|0x@ 0S|0 (l   t00t0)`P ȟ00Sȟ0 P0000xQ p 0`R Ex0 P  @B t0 1R B Z40! <4!4"<0 p Q<4!4"<0= |\0#P7P\ 1Q!0X  a7\2 S 0S0X0 S"r 04"40 00cS0ՠ0 H' S 1r 0 4"41 |1S S S2p0 2 r0 $#$r0Sl1eh@TlA@0X0@0t 00 0t\  10cS0`!t`P. 0 S   5TX0l H ,0 $<,Q$$p@T0K.UT`K4,, 0 @p@ ,{d00d0dh00h0t0d t     U t0 t1 0cS 81!S3 <8!0000@N 0RJ #0?040? ܚF;(0H( H(0@(0CPs00#$ 0h 0|||0H 0PPt Gp TKCp 0 #10 " 0 0t0✚M| x0 <P?C7 t 1o ≚| /@0S0KT@K;T0K(K p04 40l bC@@t ' T#R1!@ <414" ~|< y|1S' |8 q|( lK 0:0X!0\Kph.XPT Q00|, I| D{qpqHqܤqX!A p-LD@P`;P00T00Sp40ph, -LD@Pp!TPg 40 T0 00h 0W0P7S p-L0M`@08PK0 B0K@8KL H07KL< @@ 0RKpp+8X*Adqh!A -L,M0p\@, ` , 0R(K0S PܒPQ 0@SŸ5P: PŸ0 P- U V)  0 !@ @L pg Pm @0@S D^ <  ,$!$0,0cS10cS 0v1 RV  0 !@ @2PH DY <,$!$0$L0cS10cS`Fl 04"4s0SD0 ~* 6h1DQ2*t05t0 p10dSnpA0^/t1000 00cV0 R] 3PAP @PW<@KDA P > 0(L 0 M >LL @ r 0HQ4"4 0!?L0s 04"4$!00!00, S0X@|@R' H 0@(Ko0H @ 0`S00D0 ( d>( L ` < [>< L XVTTPR벁@, R r 04"40\()pppTkXk!A!A!A -@xLP|`pQ |P4 P @, Zw Vwp0P:0`00#$##    P0(@Q 0#0 s c 0P `1 00 00@ =+0 0 8 (  r0q00W 4P745]P4 1 -4 P4 P/ P)P$ )P  P iP40 0 0r 44 0r0P R 0S0S0S 0S R 0S0s Q oPP PU  jP:P 0S  ºPQ WPP _P 17PkkqCkB Q0-L M@P K00S S *0 `@P|^D 40PK0hz$ 0PK0hzꄺkq p p-L`$P@ᘿpk --LM@0,0 Pl0  pY*Z{ (08 S0 8` >X :(K(`1 4 `Pf 7`P7`N P n6w q0 4!408 (00310#1@1!0S1 202 q p0|0$!$ 8,8r r"QA"A"y 0xq4"40,00,0 ( @0H 00:` P`A`Z 0 8 Y4<0(0S9` 4 4 ~ ܻkxkq(B Q-Lp@` 0v03Q0S5Q񟗀^8$^84_8^8_8^8_8|_8_8^8 ^8_8^8_8^8_8`^8^8^8^8^8^8l0   0 o 0 oö`Y xZ t`l0L s`-`l0   0o/2`VR2Ÿ @`Pu`P l0L| _`L2l0 Pi  `2<`-`Al0 E 0S 0S$0S(0S( 8`l0  0S  0S$0S(0S9` d1l0<,\80@},10`00mQ@$`V_\(0SP@Ⴟ` l`)`Aٽ`< 0oXl0 ,0,0  w x )k|kkqDB)AkTk Q-LM 0S K0S0S P0@ SAP T \ 0 ! HPd0P @0S   0ktT7qf8 -LlM$@Q p,  PU , 0R(K`VP0@Sp iPe P 2 R X 0 S| 0x0 t z H0KHK0 u4GPKH`K@PKP |! HK00 Pp Zh |0xP 0R:l@KT4d`K0 |xc@\PKI40 c0KdKum| 0L |PWI [tP&[pHK0DpP (p HPKHKP @PKP  @KHK0YP| t p @KHK0IP bHK@ Kp  pp tPpHK `0TpP ׾J[@K&[0(冸P6ptT7kf8q!AX*A -@@0L@@h --LptMp0d*00`0 ,0 l h 0@#2S S4 ahP ], 0R(K0G0K 0S (:XW 0S000 V04"4s0sP 0 dR' U00U0S 0000G0K 0S ` * p0KhP) p 0R0% *3b#KY00 0S 0S0s 0S R  0Y0 0 000" "(00(0G0[S0 j SH@K+30P HPKG0K0d@K4K/30 dPKc0K06K#Y 0S V 0S ( ¶PY d0執PUx 0Yh0 l 470S@0   h KEV l 60S@0   hK 0Y l0  h0Sh@K @0S@ )0V l0  h0Sh@K @0S! 0r@HK h0BP# 00 00SS 0sP   (0 0(0 Y S00d00dSP/U,tPU l0  ^@([T P,Up @0 Yl0 #0RY ,0S00S40S80S0S 0S$0S(0S0S? x$0@P8 Y P4l 0S@0   h KV 0l 40S@0   hK 0 HKh0@ PhP 00 00h0 @0 P P R` Y 0l D30S@0   h KHV 0l 30S@0    hK0 HKh0@ hP% 0@ʋ@HK1H@KGK dK$K 0D0 10d@Kc0KK0`0 V"  030So 000, 1P'F000 1P#0RCY  0 @> $0Y0"!$007 <pzPUv000! 000Y+ 0 (@ 0@PU8 R 0R( R 0R0@^8( TAPK00  0  |ꀶqpTBqʚ;!A -LN0ʼꜺkqQ-@P P*R 000P'u 0uжqk -LMP)0Kp @)0[ !#R)K R  (0/0(0 (K%aVT l5,  , {001S %1S ,5,  , k0701S1S1S ,1S Q ( dPh$700001S41S81S 0SK S} 0SA S00S S000(1S 1S  2P @00@0s  #04!40庐(1 0 ! 0 4 40)[Z Z \#/(00(0n00S 00S0 0 0``000Ÿ(0CIs0 # 0p @@cB 0^)@[T T` x"/(00(05 00S S{) +0K@0+ K*K*0K嗺*[ 048( <"4!<0#,##8 0000 1S S0 R0 0(0C@0@0@0 R00C@  00C@0@0@ 1 00K(00,<4) #:+0K 0(0C@   00K00,<4) #:+0K 嶐0+ K*K*0K&*0[0 +0K0  0049C40жqTk -LM|4 8 +0K `u+ ["2S S (00(0(K( 0P "2S S  0P`P + ["2S04 * K0S000 0 48<,<4#:4*0K0SY )Y( 0S:Y )Y p 0S 553 R1 (3PU0 )PU& 810 R@T@T W 0S 0R Z 0S .P$00$0w040`O0@Y0@ )YuPB8 R DP  0mr@ D0R@  10t0Sa@`10`@  @ AK@2@P `e0Sw e 1 q*K 04 8<< 4) K#:)0KP> 0 p$(,:0 ###̠ ) [*!4"<0##$#8 0Hp*K 0)0K P  )0[R 0 0Q0`P&000 00 0y/P|@dH00H0 0 0 0000 @@Kq}жqPBḵkxcrkpppd0 -LQ1  0 ($ 00 0 ꠺kжq -`0-LM R1   00  0 _ K 00 0{꠺kжq0@-@$ 0@0 0 0 /vT2#Egܺ @ -Lp@MhK- `h(0 @ 00#  d,0(00#`a0"00#\@dȟ0! 00#X@Dlŀ0 0 0#T@$(0, 00#  P@b* 0.0 0#L@0"00# H@ǟ`0! 00#D@̀0 0 0#@0n)+C0,0O B0#  <@`' 0.0 0#8@a0"00# 4@ ǟ 0! 00#0lʀ0 0 0#,@&0, 00#  d@b%0" 00#P@0!00# <@ |Ɵ0 00#h@lɀ\0,00#T@n<& 0. 0 0#  @@-0" 00#,@0!00# X@` ş0 00#D@lƀ0,00#% 0.0 0#  \@+0" 00#Ha`E0!@00# @@4dF@0$00#` ş0 00#L ˀ0,00#n P.0 0#$T0a P! H@ b.0!0# ğ<0 0"0#|lȀ0  0#d@`0,0#H$X0a 0.0# L@ (*0!0# ğ@0` 0"0#4@Ā0  0#h0n0,0#\@# 0. 0#  P0b(0!0# D@ß0" 0#hl΀0  0#P,00,0#`@0#a 0. 0#  h@$000# L@Ÿ` 0 00#lˀ000#T@00 0#" 00 0#  \@|b-000# @@\Ÿ` 0 00#d@<Ȁ000#H@00 0#,@!a 0 00#  PAb+0@00# @@4QH0P00#PPXU000#<|` 0 00#` \lˀ000#D@?0@0c80 X1" 0@ D <0 08T#8^H L0 !\0!pT..l<, 8 D[#4@ <8 -K2KL[T30K801PK CP4K .KP /K0pKP4K  {U'DP  0#<0 "( 0#40  Q X)*, 0R(K唄pk!A -L` 0   RpP @0 Prp00@b Up000@-pS`P@0 0s0s0 r   00 p0000  " @Tp@-`RPp@0 0s0s0 r   00 p0000  @Tp0@-PQ0@ PUr r0 0s00 0@ 0 00p@-r `Pr .`@ 0" 0 @ . .0 0  .p"A -L0 10@  h 0?,0k -LM Y ,0S 0 01,  s@#X`p  0$0#s@ `V  %ppP ,0 $p k 0-L@)8h -LM,  9/0P`,0S,@p,Q@T@a0 9/p0 P`(K0S,ppa@,0S@S0 9/@p0P` G-MP$`Q0l0h 0Q0 1>0   @$T  p00 Rpp 1Tx?>   c0 i  0S0W d@JT 00` 1^Q?>   c0p@ C  0`0CW^ Bb 0  R 01Q0110`1X100a1 $Œ\ !  0S 02S\0 P3Ѝ1>0   q  R 0101 -L$MH L  p ?ac`0OO^P`1>PL 00B"aeQH LL08`0?pH>   c 0㠢2!s0K)PL0` l2RH LL8`0? !> c 00POP>p@` Q 804 \0 0S. 04  0 S ^,@ 0O QD  RH  0屬|坭 ?(KLH,0p S0QK 0H 0 嗬僭U k#A4#ABBtBB -LXMpH@ 5 RD @ 4 `0040 0@@DP(0PpǏtP DPt8@ ?@d_jbD< 8 <@`8P a4!, QU1U.Q4P1D 80@Q< 8 @ D0DP @ ?  <@. _@P @ P.b8 Q @< ( D@<8`04 cQ PQC` 0a@0 d3R D2@, 0PŜ00 P0 0^= 0aD 0O L0 H@ 0aDPL K @_`p 0P* ᖄ@_ p@ lP eaDL K `F,PaDppP l0 .?MaP00C0@2 RT@T0,0!00C0D@00@P <K 0(KD ɯ 0t &a@ `P D0O  d  %h D0h@| x d < /X T  ?@0XK0@x `0 \@  x |K 0O R" /d@ hP9,`pK@popD @0@P%0 X 00 , 0 P CQ/d0 hP9,XpK@<PU T -LM0 @00_Bd @P R b04Q RPQB K I@P  <H 0S 3SK U -L M, 4 0 0S}Po0@0<44SP`  t填 0d宪`嚫84S 4K?\`, PP, 4K?`00H SP`$ T0YP3p0Z/`0 1>0@ 0R!pP`\WWPwP3H(K \0`R a`05!p, QV1V.Q PpP3PD B BBU B -LM@ `0 ,0Re] 7P, ? |1HP / c]T1 R?\00A0pS:* 1R?\00*0 000 W 0p5 ;pL#0@4D0 :   S  ,(K 0l=S Xڪ  B ?>L0S@3C " B " 0ǪkU | B BH B -L\M` p0S]`/0@0T8Z0LOPo P` 0OVʶ <4 S?]_0 @ `40 P8 48HP 0S>6p\<@<`0?0 0P@`WPo<4$  $ 4 DL0@4 D d6 HP/<`0 800c@ QD0P 0b<@ 6`  QX"<<@_ `00P"008(KoUF`  0کv `@ 0tlş0p `垩(K< <@$80`$8D TLÙ@TP D T  n < 0S141@\?\0 0 010  @ 0L00 $0 ^0C0 ,04 a]1>8 0p0@ 00?0L #00 0040 0屦坧kU B B B B -L$M@ D A`PP0S(K@D P, H < $Řh0 R 0S0S\0CQ B0S P3,C02SQ0ɯ 08 4 \D ɯ P 408D pQ7'<0 ɯO/`8 K 8\`0< c Sl`0QQQ /<O^ P `1p> P0 AO>@ pL H LPK` P`PU`0% 0S 00  \0 @p 0pWH1P<0/ P`i<1 R <`0?`P3 PPD 0`@0g YDP% dVp 0@_@, 0*T d墦 Q800cOYqU80pV, 卦勦kU T B B( B -L0ML @H T P0 L3P0 R00S  L zPD H\U 3/ 00S T08UZO 04 R40 p F0SFpW\ T K D@ < 8 Z?O[ `p0 , 0 K 1> 0`# 8p^ 2Rψ0K0O` 0@1 >00S 0@ <0 TZ p T K pQ8 4 }Z8PK` 1ψR` 1> 0 #0P @` ^$ Po j$ 4 DHL0S@4 D  j 40Z0C40  j! 4004008@K0L DB@@ 0A R!4 @ < S@ < @K(K80, bYmP \^ 1/U`0 0O0@1>0 R!00 \ c! 400C40 i! 40040T0@Tà Y3P 1>0 10  $0@0C$0 $0L80  $ 00C \ 0P  0 R 0O0` @1 >00400 c! 400C400 a! 400C40kU S-L,M@L0 00T00S`H D  VLpW@ H  R\ \PLVPG 0: S t0D 0 ?Sʰ LQ ?HKY@0,PV ?p YUL20 Rࠡ02 0 P^W L#0Sࠣ0 PW(KL @10P80 0: SvD0S0X0S<0 @p0O0 , 0, |Tp P p0''<@P O ȟ P T0K/<Y8 4 l` @ ,0O0 |"X^8W[80< 0@ 0 0w t0D 0 ? SʐHR0T R80H RK< @ 0,,@0 0 w@ 0@p 0 0 l 10P0 U3< 0 .,0 0 VX  0岣 At B3 B -LM ,  @_ 0"X 08 X4  ?n40 0X, `p U84@8 0 @ ,P\ 0T AB4CQLUPB!A0 00, S000 ĘT@!V4 < 尤x<0PQ`004sUP`1`#Z ,kUV`!@V`YL#20T 0U00 RH3 VHY@0SJL#20T 0U 00 RH3 Vt\AZ@0YLØ2 08@ T@!@`02 08 \YYPL20 80S@@2 08` BVPZ,(K004`T~t,@T, TPL#2, P\08`V04`V PT PL#^08@T04`V P P  -LMP0p40 00 `@$4 ynP @ 0壡p(K ZO ,0P>* 00 ,0 T Z= H#0S0C0h0 K P 4 L0 pP+0匀0Q5h@T'dp@l0S 0l0@l0Sl@l00S0l0 00 ,0 H#0S00~  _0 DP0hp0 0$ Ρ<0n#A B B B8 B B B -LM 00 $5Sm  @ @ 0T`À  !0@d0 l4@ P\S,SQ00P ` VP 0K0  S; 偡@0Dd^㈀80 0 / S@ O0  pc8@ `S_YQY 0'V V0  @4\\VX1 (K0S K 0^ 0P @`R0S0S Q @_@0 PS _ hY4KKx0KPK0@0@8KPo 0KP4 R @K00(00 0Kg80S`2 "K00S*40S2(K 0` `0CR 0K00 n @P  Q@0(0 Ss ,p0S崠 Sß ?J   ^V1ЀK 0^@ d0 @`>@ PPS SQ00P @0d ` b0 R!,#Q 4 d030, @80Tv`<`,P00<00,  H,00P4K50S|80^X<,P00<00, H `,00\0R 04\0H<0SDO@$ .0 S 4S P004SP|IPG84S^Z#T@0bRD4K_ Wz8@0` "T4SY:V@<` B B$BD0n#AB BB8\BB B BB@BB M-LM0@0 0R`]`/0@0X0s @Tg 0S < D?`@tÙ n^c&8Q0` ^d tN0 \Q@d 0PR@TPU\ 0 4pǏ,0  0P `P<4@S+&  O @H =Q@P<ڜ0,h h 0(K 0吜|84 S  ?;R#3 iP 0@ x01h`TP  0 H넲8B BL0n#AB BB4B -LM P@8%0  X= R00  P 4R00 0a QUUQY00 @0@@ P  b PR0b1rl1eQWWY;0YSڜpK4K 0P 4Q A0! 4 X`V 0  LK0  ` 00,KPP ,0@H 4 !T@_N R  LET2S85@%0L00@T  T R ( 0@<0K @000@ 0 @_0PKP P0@ c# 0S4!#Q P030 蛞@!<0  \(000  X,pp @0a0C @6/  V0 X 10( R" 0P 0 @ 00@ @ bb R3a@`QVRpl ^A 00 P O nK00P @ @ bb R3a `Q\RH:D 0`( 0<0K 0 @@@_0PiP % P @00 @@ 00V<`d 80< b201 R2Q0<0d 20!<0 (0000S*@5L 0` U 85@@0L 0P@T \ 00 P  0<@,L@KTQs 0 00T@# *00P@/*00\@^00 T 0  {@0 @L<0K0 0 0O0 @ 0@P <@K0KL@ 00d, d0 c# 0S4!#Q d030, H<,0@,P H K !X X@@0 00vP VS( 00@ @P 0@<0K0 @_0PP / 2 0<H @0@@$D/00h00dh0@   m  2Vb2(KP,K00tEPZ, l0H !: ,zK P  000K @P9 00000 0 d0 c# 0S4!#Q d030 L@K0` 0`HK ,, 00H<00@0@ ޙ ۙ frTBpBB-  M-LdMh p l h0P  ` H `0@t 0H@ Hp0SH \H@  ?wNP L `ph0@0 pKDD@ Od 00}$$000(80d 0 @(, 80<@0 <80)Q0 d0 {d@Pd H|8 `0 0`/`pd@\ 0 HPt0Q 8100`0t RL0$ @d< \p8p p0K`0 @tX0 T@ H0`@XpK/OpWXp T LR  @ 0Q  ã?  8 AT\ Ry 0p@<@(KP Q81H0@ ?@@ 4 00 Q0 p ?Wx t0 `@tpxd0,K cS S8RCQQpA0hXK P@<,0@ P< `@xKh00@pDp@p XK4pK`F0OLX T TJʓP Sq < \ Ild@<@ e P L dp Pd@00;00`0_Hpd  l\ \4^ ?XQLM, KH0 PXKh@<,0@ P< Wv fr,pB R-LgM ! `P+00AQS+!@0T" Q+L0( ?Sq ` (0@0 @    0P(K1UP Qh0S PPiK 0@DP<0@@,00@408@!Rl h rn iKʚ85 0|1 0iK 0iKP P 0O`0@0@3r b RTQT2 1 g/K  0! 1 0KT1 H D t T@_P`POp@P <` PU`Ġx 8P 4` 1!H@KX0 ORp0t@AqN 0@`^ p1TQ(0a OQ0(01S45AS,:' iK0p``@,0K0 p` 0PPJ0iK  ; Ve ,00 0105QS*P1iK0pp@,0K P@00 0PP 0d0 " A `iPP@ 0 A#O 1#  )1 ?p 0 P% JA`-8pP P P 00 /1>0 A! `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p/1>0 AR! "@e00 @0A#O 1#"1?0 @0 P`% !-L M`<00` ,p `$00KPp0OV V 00P  (0KP 0( P `V$K<0S  R$ 4O0@, T|{@0 0<`@Pd@P00K< @P-,0 SQЬkpBBB -LM 80 4 P0 l1\ \RXlX^QVp00 < #4 0 004,K 000aPP8 ,0R<4,,85H 0 80 (K, 00 @@<,^3 . R Q485@ 0L 0 U///// -L⨒B\%P0R /0 R40Rh0 S8P0!R/TckC-0 LS03Q% 5p00P5,5MS ڬ4S9Ӭ4հ4S@0Ӱ4Ѝ0t0O/Rs QE.1EPo,`SH@P ``P`P`,L` `0` `@0/@P@ PP`O@D%0U4e85X< 8P 0` 4 @( X0<0 8P 0` 4 < K<@$0#= ,K ',0P@S  0o 0P@Et@ =S 7P@(K ǎ峏 9 BB p-L00@SP 0h0S  `P p0  8 Pp -LM, `20\%R64d 00  8@c_Úd t(`p`p<@D_@,(D`Vp ` p, , 0C@$0(@[`4P8`,P0`qFTB -L$0P p`  ]@P`@0 S` V@ J@P  R0 0 @ -LM`b$0p RPUMT500#0mPP00U00S@ $KPH& @x0 @ 0@@Q 0 QP\L&&&$0`B:$0 R-L@M\ x0X \ 0L0 0<   < P (K\PL7 X\ @\0< @@ \ ZX $0 0@0 \0cP(K6 H80 ,` 0s@TPS8@t8 J Y` 00:00,D, T`:/P ,6 HP\%R  VWP x0@@,P \ g@ \0R< #\ P0S~ %P%X`Bu P -5@0R5 @0SX$0 L5@s00!@T   O P  Y# P h#P04\%R0P 0P,0h Hh0 S, 00;00,P,@  04 P4 =S540@@4@"@ D 4$5S,01@#D4 QH L480 ,0H,4,@ D80 Q&D04 \ i400p Po40HL$d0P` l, @\5.`$QH 0H0 @P 4L?%;4 $Q,0HSP 4$H04 ,0SXP`L  40S 0S0X 0 X0@040$ X(*($ PL4 t0$040Pd ( 480@,0@x0X  @0S4HCL 40X@!00K0uaQ4P0S^`\Q`a004 S:O4/ 0@ P  TQe 4 +4 0040 X$00445PmPM05S404%@P 4 ,"4 HX<0@P4 40L$4H$p%ATBBDB -L,M@$0H ,@ L (K`2 L0H  @@#L  X`2, K 0D0 D:o //K@P$Pf,@H`PiD0DP#L3P#L3h DDh0 S, 00;00,SD(5`(0D/ (D,L  D 40@>D0LP@ 380Pp ,0 Hx,.D@80pQ"P@0D\D4 0g0`H4LDd/ ` 0P1,,K#Q0 P ,iD 5D0$%R,0DSPD0$% D,0SL0H80 D0 0< K4 <0 0 C H0<B9 -L$Mp8@T$K DP@ 0 TPX, @ @>0O 4 0 4 4 $"0@<0 8@ @_@P< K @@P=x=``( Kd00 l  \,1. Q@P (~'0,x=(0, H  >,0  (gxB -LM`X SKl , pP/$T5%0S& R `P T! 0Ss0P1 # @5$ KT$0iPQ $0rLP KZ 0@P< (,  0R(K 0$0 0@ $00$0%C  g$03P $0@$0$LKZ 0 @P=S3$0KKZ 0\gp @0,00C 00K(@ 00@Pp00S@4 4 @P  @P {5)P=S$0 `щ5 0T 0@P{ , P! Hjx  0 #40S@ )P $0 LM 0  @T$0q 0S x x 0S@TBO@ZZ KYO3ZKZ ,SKl  0,X\! $  Pp0 S9 \YP$ 550055 DR/K@P <g^KKZ b; Ta 0T /  @T TT *@P@ZB_<PZ XZ4YOZ KZ,KZ  ;@P 5H00#0!p@BBDkX%ADB P1-LMDAD!00pPP$1$aPP ݈P  KPP.  PP 0 0 R  0 0 `"0@Y ^  , 0E 0   B  V!Pk!p fr8kp0BXB\Bpp p-L@P5`PQ ~~`pqq -L@Sh -LMp00S| 0hS0h ,0 `RK 00600 Rh@T AhP`U@7 0 1P0S00O X 0S0S 0S 00 10S  3/P00700o00600,0S0SOP Xh 0S- 0 UAP0h R` ,0S0C,0 ވx00S~ $0{  w00S T  0S00 kpBhBB -LHM` `` X \  D 0Sd lX\ P \0P P P 嗈T05S*P(KDT X@0d0U 0T0  45 S: \XD 00KPPdD X0 8 H \4 @ < LP D d\0L  0j7Z ZSXj\XRQ(VsT0,0X @H @aP T @<PP]80SWTP0 0SN4 Rw d,$ y0t03U0Sd000X\ XT p850 0c Y !YP0 HHT0`d PH H 00H0,K0 0PPdX 0  R:0S*,,-,0P H  Ud T0@P 00@pb b R3a`QVRuUsT85@0L 0m,X @0)D  d0X 00 @d 1d 0S-X0@0X 4 Q`  0S 0S d0 0;0X Q U D0/X00X00\ L R X0@0S PX4 Q8 R d0 X0P 0S P`d@K @80@X40l@Q  X75BkBB -L$M@ H 0 SD H00Q 0ASDP@` P x 0F S,0 x tp x0@0 *PZ @pt(0 cS S9RCQQ @P0(KX凄 0 ((0@0/S8P0@R pP0 ,0 0Q00QRW H ,0 0QP @p0p@$ 0 Sʐ U- P ``p pW V   Rڜ@! (0,(0P  | 0 S\ 0d1!0 ,倀K((0Sက | w|@ `PpQm @ h ,p fr|BB -L M P0  000S Pt K`0` -00P P 0 S0StqpqQ/ 0R 00/ -PhpL `@0 0Q   R 0S0S P0Ptqpq0 -L||`@p0 0PP 0S0SP PP frtqpq(0 - L06 0Ctqpql0 0-L PR 80S @| 0P W0 u갭kB d1-LM PRp@ 80S$ R 0S` P 0S0S`0  0 0P 0LS L tPUc 0 00h X0 `  $P X';;8PL M P PPH PL 0RT0Rn 4t<& 08!P00R00S'P0S `TP 0 0 0`!T 0D! H 0 HQX \ @ 0 .R <E@LT 0RX^ L5 R@000L LL0000@P L  B 00C0   TP0S L1 0 ~P 0: Sr \\@T1H 0#6 PL@P\^) @PLL1  B P00C0  B L000P 0@P8 P @P@P x8 q8 00 0 0. OK @P Q<^ PTpUc \!R} QW U <8P0SpB@g 0Q2P {8s&aMOK T 0@Pl XQN L!00C0 L B LL 00009 <T @p0QR P1 p0Q@'A 0P00C0aX1S 1T@!0@ I0 T T000<@\P rrrL P HP@ 'TX1 S0H#6@  DP pB%A8BBk`BBHB q-LM`P@p  0p@pvt`SS P0p 4 4h \t0ɯ00 , ? 00S,, P (K,0  ,  t`0p@P-  0t04 p P,0 J 0@ h04@ ɯ , TtQ0 QP,  0P, P ,  0P004 SR000Q 0S 0;0P 0S 0;0q|B -p@P0L`p P .PP 00S  O0tP   0:0000   40 0L au -L MP` 0pS0s0s0s $0sH0sL0s@0s @(KD0s8 L0$  p0R @P Rd0 2 R@L0$ ? @dD 8#8R 88d0$d00d00\"00D0 R@08"d R q~ L0$  0@Ppl 0 0R00 ,@ @ R R  0@P 0,@SO:J (0sS L0$ 0p Q ]@P \0x  0@Pq00s000(0s L0$  0 0 00(0 0@PVq@ L0$ r 0@G DD0d0w00 S*q0s}00s87p -LMP`( 0 R0d 0St0p 0K02& L0$  KP80d 0S 0t0p +P  ,0S !5%P/ 0P-L0 0a00P0/0a00P0a0/ -LMPPp`  H0@ @6/00S  3/K3/BB// -LM @`Tp1 pP Q*Z  6/$0( ,@ TP ,Zp Ph6/($0,  P6/( $0 , ,6/  6/$K BBB4Bp@-`@\( 0S% ^P) ^  R  R@ 00 R000 S0  0S\ 00p0@00  R \,  R/ 0^00 S 0  0S0S0P@ 0 S@@ 0 @0@000S00S0@ 0^@@ P@0@- R 0S^ 0Sk 00R 0SI0SD \   R00 \0S0  0S  R( ^ 0Sm R 0S 0R00S00 S0 0S    R000000 \0S0  0SR 0S@0T00 S @0  0 S 0R00S00 S0 0S    R0 R 0S@0T00 S @0P  0 SP y -LpX5 PU?P0S`X`V 0S@W `RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP( ,\ R ,0S  R0P 0  \8 0R:\00$-P,P ,0 S 0SP 0 S00:S P 0S/0S/P/0S/0S/0S / P 0S/0S/P/0S/0S/0S /P/Q00S/Q00S/ -L`p@PP7/U@V 0S0 `P$0(,  0a7/@PPU@ Q 0( S$0 AP:,00P* <P7/U@w`P7/XBBBB 0-@PLc @ P0dql&A 0-@PLc0 0 0000q<&A 0-@PL c 00000 00q%A 0-@PLnc @ P0dq%A -L@@@DT@d@ p-LP`0Pc(0 @`0 pxqT&A 0-LP@WP .P0 0Q0 0P0lB&A -L@<PlB&A 0-LM@P{P0  0lB&A 0-LM@PhP(0$ ΄, P0 R 0S B^R* 0S P P0$$- 0l 0il A|BB0B&A$0 P-L 0lq A|BzB p-LHP` 0@S b$ @` p 0l묺q &A A|BB R-L@@ b/00 bR*:^*0N3:#:S4 ^! 3 P`0 R R0f0g S:^0g0f  S* `S:\ 𭝘 0 HH D0:l44 005l  00l  0+l A|B B<BXB -L,M< `pU@0 v*:Vp:1eP@H6fF @TP] p0K$ 0 X !V01,K qP@ , 008 40 pP@p@PTW5 48 \0   Z:@J   0k48  by80@ p<0 pT <  0<  00<h00(K< 000< e,\k 0k A|BBB7tB -L(M8 `P (K4p@@4 >P* 2P@T% 0S" 0S0$ ,(00 S ! 140,K0K P ,  @0 0C"0" 8 4 0$  04S0!0K,K P0  @0"0C0 -L$M`  PZ4 80  t@P,K0pK $ 0@PP @P (K40@$0(0,0l, 00f0eaQ80  _xq_q_ꬺq_0q_dq -LMPp !P  t$0(,@ \`,K 0` `4P !P  (K@r -LMPQp`, 0^ 0^$:0^!* 00000 0000@P0S @ 0 !P  K @ @0 @j 0`j,B A|BB -R  SL M R40 Pp`z  Xy:#:ST:#:SP:#:SL :#:SG$ :#:SB 0Vd*UAXPPx a@P; $ (0 V6:,00W0K0 @T+ ( $0 V&:,00W"R 1 S0!,K  $tP XM @ 0iU#RP (K@, U:00U40PX40  LLT T0i88H H0i$$< <0iU*QP A|BqBmBnBrdB -LHMpH L0 :D 500K,P(@4 0dP40K40Kࠁ@K`00@KS0%5R 0 0T@%5UP @ P0e S* `0KV (K@j  DH L0P@ P -L4MPpU@80 { 0$%Q01Sr: bU0a,0 50 R 10 >0   80 0P, ```P(Kf4   40 ,80 PP   0 ,80`P P  4800P, zP -L$M`p @ PZg ^ 3: @f p@ P`WK 0-@ MLP  0P` 0P` 0P`xx 0P`` 0TP@`DD0*0<0 K0dq(kxBBqBqBxqB0qq$&AP/,,0 S 0 S/P/ 0 S00:S -L$Mp@4 80  00 `0bS1:\W YM0I  :#:S R 10`h Y !3\ 1!0a 0PPPP\: @P `0S:`0V @T (K@ R 0S@(0$ ,00U: R `0V@@0ST  1gq! Y `P$( ,0  0 R 1S0!,K0K?P, 40U@:00U8P80 448 80g  (0g  0g A|B BBB<BXB -L.^0 !P A1S  0AS 10 ! 10A0 0ng$g"g A@Br\BBB: #:S-L0 !P0B.0Og g A@B\BB p-L`!Q@&0 ,P&^  QP# P 0  `p Q0S 0000 00`p$$$ $0g fff A@BL\BB BB -$ 0@` cL  P/"6<@SpQP !R00R0S0!P PQ<@T𭝨Q0P P z@TP  0f A@B8B 0-L!QP@ 0 D.  R 0!0h 0fWf A@B5\BpB -L`@VP`PVp$ 0SPP 00 0A S 10  ! 1 A 00CS0 UX01SZP `FU b-@L P0 0 0R000 0: #:Sp-L@`"V  00b0eS 0S 000  p/0fee A@B\BBB -LM@p, ,P0, a@T; 0S"4PU(0 ( 0M,,P ,P(K {<0A0C0 ( Q{ <,00,0 PP  0>PiwK, veBBB: #:S-L@P7j&jV8R[Pp) $F%6p@00 @` `` b10Qe>P@  00!d R$0$ (0(@@ <0te,, ,0oe~ZpqԼq A@B(BHB -L0@S0S0b 0@sb,h[Z$$ 0De 0?eq A@BlBB 0-L0@S700$ R(0(0(0  $R( 0 P 0S P 0PS0!P 0S 0CS00PS0000hd 0dB A@BB , -LXMTK`P pK, 1@TO 0K( 0@ , (0$Q\ $ \0K((0$0^X0 $p ^0 !0SU000 0R0) P ^0Q $0S Q\ ,0(0,0@\, Q0 X0(00P0X X0S\ X (K\J 0dԼq A@BB ,0-L4P M@,, 0P\K0hTqlB(k -L$MpQ@H L  `D@ Չ1P< P 0SC@WeQ0 0a00P 00< @00WTa 0S0C0@0 DP @0 DP T\LPpWAD!1P 08 0P 4 ,0 @W1 0SPQC0WdP00 `00R04P4 0080P0  'JD 0S U0000PRH @FW(K@Q Q0,,00000DP 0@0 c~cBtB -pLAQ@`P Q RU 0S W 0Bs𨝈U  0h<0 00RUh[ 0h+ -P0000L00 0@Sp` 0Cs𨝈  0h 0h  0S 0 -L M $0@pb< :#:S Z%ZU! ,& X0XX (K 00Cs 0@A 0"0Cs@aQeb PT  b Qb @P b0 00X{0 00 0!0c0,0 ! P4 !,0   P!4  40 4T P !  @Z1bP10  1` 0bD0Esb>u 0As Z`\100 !1 cttt t0b``h h0b j 08  j01   0b뫪 A@B"B#Bs B -L@\`po 0S $ 0Pcz'zWZX@P%ioŸ0 p p b10QeP 00@P0S X0<00!  R 000 00 000X 0  c!A00CS0K 00Cs>D00 D0< @@ R$0(0$ @(S; $ 0n#6S"(,0X0UD*^* && <0#8(U$ R;$ R*M&$  n< &P@D00D0 0$  c<"&0n000$ D  D 00C0o]@oV@@@ @0a,,/00a$ $0aqԼq A@BJB8 B/d B -@LPX00 p-`L PP P P@W(P" ) 9p-a B -L@T 40S 0S (0(400C40 0-L@PT 40S0S# 4 R B004 2 0S#0S%0hNV@P0S p0S0Cp0ʀ |0+a(0 ( 0h 9<< <0a(( ,0ay 0aؼqq A B B B!B B -L'WP 0 ؼq 0-@HP ML@@ 0PY,0 QAK0h?Qؼq(k!Bq 0s0 0/ Ap-L00@_1 ` P 0S P 0S 0SpPRp 8V0S00`@ Pp 0Sp落q 0-L M`PUL@LLT 0 @@X4 0(0@PXK0\0n(k !Bq,!BHq -L@ f4 T0SLH1 P `T    @P*@ P #c0P4 T000 3G R 0 $0P$!p x 0SlP00 cPL_HRVPp`,_(_$_|k`0nHklkxk!BHq4!B!B`!B p-L0P@ R/`p0@S0a!p R 'P$ 0U10`P V000V000C0S\00 0004T(^$_U  0_됽q!B!B A4"BNP"B -L@P 9V M-L M0 0, `p0? 0P`6ɯ & ZY@P ,6z@P`P (0 0 0CS999999,  0SF40S/ Z= (K46_( !0%@TP, 0@P6 @_Z4@ 0P 0@P`ڼ&^,06ɯ0Q6Y4@YY40S0Q ,!h$7"B"B\"B -L 0`s0CS 0  Q$0$0$0 $ @T( (00) h!0g%@T( @R'R00R @P hU !p00Cp0 0RcdiS ! 60XpQU @T 10@P 7UH Tp00Cp0@0STPpWlk"BqHqq{ -LM@< k \d` P@ 4 0Z  4 <0Z :@P`0s  4pP (0(@@ p<0Z4@ \ @ @(K0 0%@S@0P  07pP (@A dP010 0@0<\`p<Z :@`p@T0Z  &*G60 ,0 T |4PP( (0 0p!`$@T h4PP(0 P6PP C@(w@P(q@T0 00@S8 #08 Qu4@(kjP Z@P (0 K# 8 S(T5N  P 8 010"B"B -LM`@$K/p 0K @ $p @ @@PP P  lS I(  5K -Lph1PUU `tCV 7@P'P@@P0W  X R`P0@P= @`T. P`P^ 1@P  W00X0S \P^@DZ( ` U `lkxk 00 0/M0Ѝ/ -LM<0 D00 @8  @0@(K80< 0R40 #404p# "B 0 8 0`P`"2P0#`0 e p,0 @ :@P`,0@X Y@| 04 0Y(1T(K  00!c 0 000? 0 Y# ,00O001T  , 0vT000  0  0Yq frP$B\$Bh$B AD#Bt$B -LM!  \  @0xϟ 0 : P L H0 PK@Pr D0 <HQ jT0Q  S DR00 0 001  0P    @  QnX21C RL $0 b0`"vWp!#6 0CPWPS@ Y  <@K a 0<@ X0S00S< Y WP`P @T (040S0Q `VPPV < 40 Va  0O0@@ Y4-4.88!81U0 00HP,(0~C PK 03PK0`PPPY00SV|4(0,4(o@-0 00q&A%B$B4%B%B fr&B&B$Br%B$B%BD]p%BX%B%BXt$B%B AD#B d%B4(0!(C4,PK !00x00I;@  0PK@;@>,('4 0{U 0vU 0qU ! 1lU},(0v  !(0k\U```!`1RU4{<0L< bPm Um  PK03g Q-L`pP#*@JV  0rP T    @-6@004@ 5@80<@ 3@ 0$@ 1@( (0,@06@P0T@/q -LM| KP l0 #Q*XXw/T0T0Q*b"!B10b 0T8lr Cr A&BA8&B0 -L@TP" Pp` :S0| Q*Q@T ,0" 10Sx0SP@pTVP0 RZ 0 0m 0`U042p̽kq 0-@L 0P PL*:LQ0贽k R-LP@   0m-0 0.  . Q/! -L΂n^P`Up(S N@ Pe,g(0 h  h8lrk.  . Q :/ -L(M@ .  ^P U< #: (K  P e8 !fV @,pK , 0S0R*@V^ 0 }P  K @TM X18LpP  814@K0@ 4 0@ `.P04Q@ @\J00000  000 84Q8 `V< 0e<@ }P (8`D88 O 00 0SPkk8lr A&B<&B  R-@`PN`@L@Hf pp .0 h @X 贽k&B 0-LM R' 0+K KK0yvL4NX0@$ H u80@$ H lKRqCrkkL&B -L M@ < pW` 0G#X*qYp1Gp`00W80 M J$J>00>0S`1h# X00 V0nS`7  Vj3W@2 8 ,0K <` P0d,S1! @ lP 4@K , 04 0@  @ XpiW@(K괽kh&B -L M0`SpP7 0SB0SS4KP40 0 %*@,Kh 3P T,.&R*<PR0R*0a"!Bb 0 00  000 JU D ,0 0S(K0@b 0`S00:  ,$0 0S 8lr Cr&Bq>00   -L΀(M\p@ @4 K00 DL0T40 @ 0 S00R<0 T  R 0S 0<S:R 0  48 0Sa 0S^ "0_00`,K 80, 0 P4@,`T<08 DE,:,0 @T @0S8< ,:,0 @T%@0 R\ 0S  YfA0S 1@ 0S  0S`4K+4K+(K0C ! S0,  1!0Q @ T00 a 0 @S@0 ` R V0 f4K` +PF xxx x0fQddl l0aQPP` `0\Q<</P0WQ((D D0RQ$'B8lrqqtKB fr A&B]&B&B&B&B'B -LPp<눀@`0^& 0R 10 P )* )贽kq -LPM r 0RZf 1    Pq 0R1   hK@h`Kt!p@P *T00 p`P1XP1 Q 0 hK!PR UMZ EU1h K@U@PQ x0*1(K0@p  P0 00 @` P@hVqk# q0'B  0Rl :@r8'B -LġM ) Q 1 R R AR   Q;* 0 1 S0P1* p X00W0S1 0h !Wp$K` 0@P0!&00 `DP?pX(10 0 Q *0h6 0(0  X00W0S X H 10  0 R0 0, S,0 ť$Kqkk# : -LMP`Pp>0$ N@ lT(Kp,K, hh0  P,44/00O0 - 8lrTq' A&BD'Bh'B 0 p-LMx`\h. h0K@P̌.!' 0` PKp 0O8lrTq A&BMD'B 6 0 -LM\00 V> 0(K\~ !p@HPh0 0 zP4$1W, 0( 0cP`(8 0:P@zG`W h 0 (@P0 D0S 4Wj00S,(K, `Q,,  a$$$ $0&O8lrTq'k frt'B A&BD'B -L℀Mp@t `6.h (PK  @0(@ $P @Dw/ K&B -L M8 \ 0 S >8 @0n(K 0`̌@P0!Y# 0&0 PnZp14K ,0 !0aphp 0R40 0 d0  40S_,(K0b&S@@ 0@ (P3,P0U88 0,0Z0S :@p4@Q00000  000  0%(Z8 ,8 TTY/P0UN@@D D0PN,,8 80KN, ,0FN8lrkq A&BD'Bg'Bd%B'B 1-LP5P`pW𭝘  $@P (0 (0 |0@P`:P@`XW% =%% 6P, p00Cp0 0MHk'Bq A&B'B >-LM0`~0^@Pp0 0` `P @P 000T 0 00 0P  K0 T@PjMhMfM''((B'BT(B 1p-LMP0 @||` 0h `0R0  bL@P 0K0 P 0`Kp4MTq0n8lr'k(B Pp-LMPp)@`Kp P \0 #Q*HM0Q*b"!B10b E%JUp8lr Cr(BP/ 0 S(0$ ,00\/1P/0S,  `0R 1P `0R 1/ -@PL`0P`@T0@-D0DQ 0$ 0PT0ST0SH H0RL L0RP P0RX X0R 0 00R 040c@P4@PP80S@Q 0S@ R00S0 0-L@PP D0 0U:$0U#300 0 0 P00P0/ Q-&:0@2 8P 0Q:0Q4(0Q*00Q:40Q:<P 0 R 0Q:0Q4^,0Q*LP0Q:0Q4 0 Q:@r$0(0@-P Q0#03 P 0S @@1 Q#3PQ8Q 0T # 3P R0T # 3S RLQ T0#03P0S T0#03R0S<Q 0T # 3P R0T # 3S R\004T # 3P R0T#3S(P T # 3 Q ,RT0#03\0S 0@r-$0(,( Q:,0P3400Q:40P34000/ -LpPU/ 0S,`@T1 T R& @TP @0 0 R0 0` 0S0@  0S@@@`P ~PU 0 00p 0 0  R P< X? P@0T 0` @]0S0P  0SPPP`OP K0SP0D0S0p  0SppP@6P 20Pp0p 0 0 y0S@0"0S0p  0TppPP @p -Lp` R 0SPU 0SZ `0 0R 0S0S @TP R0 0@ T`@0S0P  0SPP`PP @@P Rk Q 0S R 0S 0R 00  S`00S0@  0S@@@`:R 0S0Q 0@ 0S0P  0SPPP@P ~@ 0R 00  S`0p0S0@  0S@@@`bP ^ R0 00 0@ T`@O0S0P  0SPP`PAP =@v R 0S|0P 0@ P*0S0P  0SPPP@P @ \ -LpPW8 @TD@0Sp`W`V p 0Spp U`P@ 0U@@ 0R@@V @@TX  p`W `Vp 0Spp` 0-PLP@! #3Q0 R  0 S R0P 0 Q@@00 0@0P/  S/P 0S0#03 P/ P 0S/0S/P/0S/0S/0S / 0- LP@P'$ Q00R03SQ #PD0$ T(0, 00\ H00SP 0T00 P 0S/0S/P/0S/0S/0S /P/Q00S/Q00S/ p-@ P$` UZ3L<Lp000/0/_ -L0@Vhe0/ -@0LAp3P0000/N0/Q 0-L0@P!}P 0! 000 00000 (A -pL@P 0h!S9@ `T/ STD@T/  HIT>@T` $ 0S X:W  WP 80P L0P V@#P0$ (0,00 S%*LP$$/ 0TH 0OH@r A(B(B6 )B M-LM04 40`"P @Yxh 10 Sp!z3S0CD  , K00K0 P, fPFY`+,PU (0$ 0TI*,Q $ (0g (0R,T:00R4T*P* 0@P@T :,QP,  ` (K0g00T0@ , K00K0 PP hp 40`@y z&, ,P `$0T* , (BXkr p-L0@@, x0|S ! 1QpS1P`#`3P Q#3Q030 "S0aP^ Q0#02SQ#3R0#0 2S%p /0|G A(BX)B -L$M@0 0 S80 < Q<@ 0Q:$0R , ,(K#|  0PZD0 D0$Z(0, 00Q 0ZU Z , D0@@4@ 4 00 0 R 80S 2 R} $0Q@!@1Z `1`!T<D A lDPP3 pW0 @ 00CS1:1:2:2:1:1:4 0S40S0Q(0d0S !1FF00S  DaK00CS0JV $0 Z `1`!00S @@ L0 D04Pl X0l 0l0`@P`0 @@0@`,P, P Z u< A$0Z `1`!< , 5<d , .0U 9+8(L L0F, 4 40|F(Bk A`)B)B! x)Bd)B 40-Lh t@RA>00 p-@`LP 06/ q6 6/Up6/;PP(  6/@@PP 6/0/B000cSp6/@PPLH0/B000cSp06/p(6/Up*B4*B@*BX*BVUUUT*BB$*B -p ML`2/8@0P(,0!08/ @04 0lP8/d8/`@8/V (0 _3P% 48/ K" Q Q9 8/(0+ 0B@@8/0S0S W8/8/@T 8/PiP Wl8/d8/ T@P8/H8/h*B(At*B*B*B+B+B+Bdq ,B$,B+B\+Bt+B@,BTq+B@+B -L M⨒p`$0 , 6/(, |6/04 p6/0 \6/P$6/0@"Z380 0@P4K0"CP< 0U@ 0L, 0Rg(KP6/`d 6/pt 6/x| 6/Z PP 0 $04@ <@@@6/H0D0L  P0FT0T  XF T F0T06/(0$ D , FT @PF T 6/`6/D0FT 6/T  l06/8PPxLpl,B,B,B,B,B.B.B.B -B@-B\-Bx-B-B-B .B@.BX.Bt.B'A  0-0L M\0\0\ 0d R@P 0xP0 dPtu00Le5T$0 -@@0L\1PU PqDa\@TP# 4 P1\ 0P10\0T10000 P$ 0 Rs8@P \P 0 @Pd0. d0d0S0,0S00S40S  0?2B A(BeX)B -@ L@Pp*0 0JS`!`1 PNP ,0T$0( $ R 11S63bS$i[ 0>@r A(B2B -LM$0  p-L@!Q`>:!#:SS  R9Q)0P0$  8 < @ D H L  , ( 4 0 `@0H00A9P0pphP0P8.>444 40q> ( (0l>3Bq3B A(B 3B@3B -L`p PP 0@ -@QLP`p y@0S@0A0 z0P0g@ -LMp ,@PO4 00` KAr -L MpPU0@`0 U (0$ ,0 0S PP / $(000 ,,  V  0\0 0@0 U o ?0 , 0 0 (K $ X00R0S@ -LM<0 $`8 ( 4 ,0\p 00 ^ <0@ 0,0 0P408@ DPTP#PH  0,0 00 e`0\=0`KLO0@D@,KX `0 @PH c 0@8K 0D,K@ X`0 @PH Jx V! 3D @ @0F !Q0@ V < 0`K, K0P%8Q `D, K@0 X@PH  0@d8K 0D8@, K X0`@PH M4 0<0  @+8K s c8K 0`` 8 K:T@ .`h@ hdP 8 S  0M3xd  0s'`00 bp\PD00D0`p|d 0.3hP/t0)3T<h h0$3@(\ \03,P P03Pk(AXkr(B@r Ap7BkP7B<B'7Br7BD8BP/ S/P 0S0#03P/ -0 L@1P  1S/000P ,0 10S#02 000P0,0 0l   `  l0000  c 0(0 $ 0| R01020142pq̽k p-L0>005d8BOqmZ -LM !Q 0R aR >0. R 0\  0 P  0-LMPP *"*R 0^* b^ >0^ 0\.0 H R @ 4d 6R0  0P 00`0S*#0q - L | -LQ 0  0` mP00 P00S#-@ !Q 0R aR >0. R 0\ ^H:H:H:`:h:(:0:  0c  0\  0U-0 " 0S  ʠS,ʠ\ 0R lR >0. R 0Q  0 0,-@ !Q 0R aR >0. R 0\  0] -LM0^    ʠ,ʠ\ 0R lR >0. R 0Q  0 -LM@ !Q 0R @aR >0. R 0T`V0TK p Z 0Pdh E$PK0@ $@ P @_/3d8B -LM @ 0S0 , pP 0 h d`Vd0`0S0 ] > SZ UX )YQ>0^PUN  i:#:SG0QD0SA3Q>,  F r9@p@  0 0 h0 6@Q 0S; @@ p0@ `,K0@!@P,000P  0JZ  0U@(K 0@pW P ḩP @ @0 S  @@T @$ 00SS@@ SP1S``/ 0@ 50 @ @S Sx0 kP: 00 v q  S0`  XʽW@ jK00 @P 0L 0S  @ jj 0CZ p@ 僩똠 p  R -L,MH T H0 P H :#:SD >0 Z< *2 P08 40 m8 wP L 4 d TD8 0P4 Y PP , KPD ,P <0S{D0ZL%2:<0,$ QS. 0R+:D0<Y!0 0 4 0 0 0sr 00 R* Y0 Y0,P, K <0SGD0UZ*xp p1l-P\I/WH T8  040 L4(K@0 Y@0  Y@0Q0 ,0<  aP 0S000 R 0S,0 @4` @dP P00PdI/H T8 LD8 x4 (  $0-  0-d8B A8B8B8B -LM@`0S0 pP (K 00Q, K⑝PP00@0S 0 0K PP000, R 00CS 0,`0,0 00@SP \0 0 00/ M-LM0, Z (KYzpP`, 0P (0 :p@ Q P`ZY, 0P  0,  0, A8BA9B M-LlM0 | 0S@ #fjDvx  KWlKt p 0f0@ ,0 ~0  0 0 0, K0 0tK (0 @ ( c, @RRP@Z  000000  ,PQ@, 0O`Vp0 6tKO Wt p 0ʘVHH[ D0+44\ 40+p@t0 K@&x(K A8B 9B09Bp@-`@\( 0S% ^P) ^  R  R@ 00 R000 S0  0S \ 00p0@00 R \, R/  0^00 S 0  0S   0S0P@ 0 S@ @ 0 @0@000S 00S0@ 0^@ @ P@0@- R 0S ^ 0Sk 00R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R000000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R0 R 0S @0T00 S @0P  0 S  P y -LpX5 PU?P0S `X`V 0S @W `RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S/0S/P/0S/0S/ 0S / P 0S/ 0S/P/ 0S/0S/0S /P/Q0 0S/Q0 0S/0- @0 S0/ UTR p-L@PT `P`@ @T@p 0-L@PT P@ @T0 p-L@`TP@P  R0T 0@ PP P@p0@0@ @P// -LTM@ < `K Kh0p@-P 0U"F#``@ 0P !T01Rb`0^pнk Cr 0-@PL(00Dkr -@L(0Pkr 0-L00@S(0P PQ00 0  0(00Ͽ00C0(0 00 0000000Q 000 (  㳿00C0Q$0 0  qTq -L(0@ ,Q: 000 (  ㊿ 00C000S(0  Q00000  00  0@@QH0 0(P$ $00000qTq -L000CS00@0<@0(0 000, 00C 0Tqq 0-L@\ $0(P 0hQ(PA (0P(P A000$$ 0h( 0c(A AT9Bp9B9B 0-L(0@ Q10 0  0(00 00C0(000Q$&0   @@(P¾p0   (00D000h,0  @ @ 0(Tqq AT9B9B -L(0@|4P|`[ Un{ (`jᘾU00C0, p , (0Q QQǠ10 0 0   000(0 6Q@ 000 Ȍ  00C000$S 0  00C 0 R0ƌ00Sh $0S0 (U(` 0S" (?0``Qt0 (0(0L0  DDD D0'00 40~'( (0y'qTqy`Խk AT9B!9B9BO9B -QLP`  pW&  (0K`VP @0Ds(0 (0 (`VP !o(ؽ P-L M4 SP80 2@0S@ lll"l2'T`2`Ÿ``V R<0 @_@TP ?ST[ 2@ ?S>;  40S 0s ,0S+(0S1!D0Q `P0@K  0 @0 ,@ PP0@T 0S) 8!81&41 Q @(KRD0Q Po0RO 0@V8UR8 04 (0 V (2($$P P0&D D0& AT9B$:Bȇp,pq frTq<:BHpq:B9B -Lr\R2$ RP@L0R P U3 @0Q  Q*60 0 0R0 4 R0B60  B0CR0 \4 `LV`@DPV 0 SP@!@P@ 0R:P U%\ `LV`@DPVʹ|%60 0 R \ `LU`@DPVнkTq Crh:B:B -LdP *P0  0 P0@ 0P y%q:B0 -L M4 0C 8 <  0@ D0 H < <0 B0 H 00#, 0  R P \2\\b>ȟX 0R #v @_<0@TPOTK (00\䁟Q D0R A0R ,0S S D0R 0R  (0 0R8|A:#:S l$h10 ZP*VR4<0A #F@MD80H @0"&@!(KoT 0@ ?SʯR@0D0@T P0U ?@P 0QʛP(KS``` `0%LL2.P0%88D D0$ȇp,pqq frTqHph;Bx;B AT9B!0;B ;B:B S-LMP0K4 0P , E  .0 P0@T. 6P` P ` 44000Hp(O(0 P000,0  000D 04 0@T(K:.0$ N$ AT9B9B;B -LM0.`p,@K 0@(@  , ,@ T" PP000(H(0  R000(0 0   0,@T$K- 0K$Pk AT9B9B 0-LM # 0Sڀ0,0 @ `Pp0 T0 `p"0 0,  S, "(Ko"нk;B8Cr0n`0gV@P0U,>0 N@ U $`KP% $J gU_"hh@c0>0>0 0 U ""ؽkoo@r8lr=B=B>B -L−M™0 @0 ,  0 @@F^ p80 0b\0 "6!v21C!@cw `0SG 0PcW@"#<:2TF1C! cU`` ƠTʌ0P08@0D0H0L0 R 0S0!% 0%0" 0%^  n2`1Cc R0S 0pePcUgE" 0, >0>00 00 >0020h 0P00C $ (0 0, `\0T(XL(K,"Tqнk8Cr5 CrqP>BoqoԽk$>B -@LPP`p (00 (00C0, 0 0, U,0( 0 `$p,0P qP (㻸 00044 00"  0"  0" AT9Bp9B9B9Bl0 0-L PRLwH0H@0D0 0d $ d0HPdP0hPk(A:Tqq -L`\p@P(0 ! R (cy!P\@P P W (0 U (0 R(]0P@Z\HQ(=(0  0p  !   -LM`00 pP@, 0 \  0   , 0 B>B8Crk>B>B &0- $PL@0h8lr -LHM80CvW,2 R000;P00W70#`T@hKH0@THP@pP *(0  Rl 0p0 p S(0&Z00SJVD (0@I Z00S &(@(PU@ U l0S0p S  0i40S00W70#`H}hKV 00 P  h^(K(0@( յ((4 40=( (08Pk(A Ax>B?BЇp,?B>B -L0@S0S 80$$ 0 0봽k Ax>BX?Bl?B -LMp aP U 0\ 0S U@ \4# @TPU@$  0`P0S U@`0` D0@Q@\40(40 88CrDCr|?B frTq -fLMV@:P& V& R, (0P0p @  jV  R (0P J8 0pP  hI`帻 ] D屻 888 80}$$, ,0x 0s8lr Ax>B ?B ?B?B T0-L7D@P@0@` d `0@0S 3/ T0DCr8CrܽkTqh0@-d ,\@\ 0C2nS03S<0<<!R?CQ@00@0,0nH00qVUUU -LM 4  X \00S( RO 6&즟0Po PU`V0P@Pe `R00Q0SF. 10 1D p(0&\ 01001(10(1(@ p00p01Y01 0Sg 00 R  X 4 Q0S0K,0 0 |0@4`pP, K00K @P4 @T# X; T (09(P9(0 % Y @@ @18pzW (0 p[8!00 0X8!0 (0ppKTpo T hp>Y R40S 0C40((001001z$1 0$1(@`0@ 0Smh0p RIl pSSQL Sj (`ῳ000Y P R@q ( KY1000w @ XI04 S0K,0 0 Ll  {G,10,1ㇳk00 (KR (u0004AP`tK@, , K00K4A0 P``4@"~ 0P/@(`Ld0F0T0 XXX!X1 4K4 [P0 0 @>w 0$#0 y@ } 00(@ 0$#巼_00Z 0$#嫼(@lls/l0pXXu/\0kDDP P0f00D D0a8 80\ȇp,pq(@B A?B`@B?B?Bd%B)@B -LM88c8ß1@_@TP0U10@@ 0dS R101^1 d0SP12d RP@D0 U`t",0 lh0Q| T2PU 0O Q ,R0jaZ``X@@00S T  0PD1V#W Z``X@@P4 ( p 0SM Q40SM 0C40(Y(  Wk]<1W0J<1 0$ #啻P !(HH 0(0=( HgPwtcPskp0Q  ^ R ezx@Te888 80~$$, ,0yȇp,pqdqTq\q A?B\@B?B 0-LMp耟蠟 L X``V  0``V 0C0`00d0(0008 B6C0 P@U`D-,0<@Y8ѿ(D frTqqkqqAqlqqq $3-LM D 3 P1 0KZiWm @ ,0R0SW 0T00000 0Q0dŸ000<00   r<4P0"@8pWn 0 00, 0  AQ4 {0!@Po?CSD00D0W0 #0/Q R 0O0S@V0l0a0KhW4, 0ȟ 0X@T@0@PoPU`Q{- 0D0Q Po0RO 0@Vi@iUe@eU\0l0a@`0 p18p0W1<00 ,@ PJ frTqqklqVUUU,pȇpp@Bk h00-LM\ @D0QP D5@00/0Pb0$ 0 Q frTqlqqq|@BC( /0@-P@\' 0S$ ^) ^  R  RA 00 R000 S0  0S \ 0000@00 R \- R /  0^00 S 0  0S   0S0P@ 0 S@ @0 @0@000S 00S0@ 0^@ @  @0@- R 0S ^ 0Sk 00R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R000000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R0 R 0S @0T00 S @0P  0 S  P y -LpX5 PU?P0S `X`V 0S @W `RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S/0S/P/0S/0S/ 0S / P 0S/ 0S/P/ 0S/0S/0S /P/Q0 0S/Q0 0S/p@-`@\( 0S% ^P) ^  R  R@ 00 R000 S0  0S \ 00p0@00 R \, R/  0^00 S 0  0S   0S0P@ 0 S@ @ 0 @0@000S 00S0@ 0^@ @ P@0@- R 0S ^ 0Sk 00R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R000000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R0 R 0S @0T00 S @0P  0 S  P y -LpX5 PU?P0S `X`V 0S @W `RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S/0S/P/0S/0S/ 0S / P 0S/ 0S/P/ 0S/0S/0S /P/Q0 0S/Q0 0S/0@-P@<\' @0S$<4 ^) ^ @ R 4 RA 80@04 R0<@0<08 S<0 < 40S48<<4\ 0@000@@0@0@ 8 R @\- 8 R / 80^@0<<0 S@ 4<0 < 40S48<880S<<40P<@ <40 S4@8@0< 8 @0@@0@0@40S<80<0S<0@ <40^4@8@< 4 @40@-4 R @0S8^ @0Sk< 0@0R @0SI0SD 4\  @ R0@08@ \<<04S<0 < 40S484<88 @ R( 4^ @0Sm8 R @0S @0R@040@@S<80<0 S<0 <40S4 8 < 4 R00@000@04@ \<<08S<0 < 40S488<4R @0S4@0T<@0<0 S@ 8@<0 < 40 S484<44 @0R@080@@S<40<0 S<0 <40S4 8 < 8 R08 R @0S8@0T<@0<0 S@ 4@<0P < 40 S488KpG0C0C+㱏@P+0DD0GKL4  0C@PD p$ t4 xt Hd c@P0d0CS0:;:;9;9;9;9;9;@To00S@x0! \ `娚PPW  P@ 0C@@P\ D刚\ Pペ00@00S0x0 0000S2  0\ m$0+P@P f00Sr\#\ @P\@8L0 mpk Drq@ Pt  @0` l00l0| R0 p 0 ` Pt@`*t`(VZJn(0Kp# Vt p  >FI00;@@|0S00 =^t W)| `Yj" Q *570S` hp\ P ih) R tlKm0S PkkЇp frTq#p!Ce!p@ |: -L|@M t00t0 q pKL 9pP00P00Sp00p0 0q AIBEpJB00 z -L M 0R d @\0!@@@h0P  0x@h d0@KhD0ApP 02,0!pq DrJB$DrJBhCrJB(DrPkJBJB0@- x0S0l061cQ0(0!a"@_400 #U" 0 l0T0 -LMP ` p @P: @1R ᙸ@P2 0nt`Q70 a@P$ R, d060>0. V @P b 0 K0 P  ah K fd 00f#&Bd 0S* 0d 0c#&d  KB P-0L R.  . hBDKB 00 0/ -L,MP ` Zj @<0"00S_ R@@ P  Z00ST K0R00}  0 0TS0 C@ @ء00 KP  @H` Dp < ,@ L 8 @@ 4 W 0S/0PK 0f0@`/ V @ T00T00S`' T ~0 0C0 S/ V(K" R@f0PK 0G0@` pX00\0S T0 `Iz0Sx A `P WT {dKB fr -LM< -L M@H \?pP` 0 \p:@P`0s UP,  (0  X 0  0p\00 0\P P(K(V,000P0\`p \:@`pPUY   U   R(,  (0 !0!,PU (,PP 0 P@ R, "PPU ,K 0PPP ,@(,,000, (0 , (,=|KBpKB -L0S0S\xpH0 `0@,PXW𩝘KB M-LM p0   0 0U@` | x t 0) 0 R_ |t\  l hU`0X 0@P` K@V 0P |` x t ڀ0 |@ 0|tPxPK`,0  0 0  8P ? ( ?   D0(@D( S @2 0QD :P@|0`S8 PU `0S @␀0#0000S0 =0(K(  0S@   (0 h#X3@P`@T   N  0S pK, xK 退K , K00K 0 Pp  ֔P 0^ ,0Y (04(@”㰔( @ 0Q 0  ^ f,0Y0S@0Y01 YJ᪦0ᤦ0ᓦ}(@㊔2U x@R x Qx0KP` >P (j:@ Q P`|@T0\0 tzpx@ X(  s30<X /I((( (0LBKB0LBlLBKB AKBKB -LM0`p @0U `p KT0 R 0-LM@01 00H00 0 P=0S P0000 0S 0Sj00   P$0$0$0 $ 00 K0K0hLBLB 0-LM@ 0C^ >40 0P40:  0   0 S 0 ' P0"  0 b0S     Q$0$0$0 $  R0 K0hhK00 K0hhe 0LB AKB#B p-LMPH*D1Da @ T`@L0S @T U0 0S6 0 0 R(0( 0@ @T@T"m(@T 01 Pp 0S0  Q$0$0$ 0 <0$N(@TKph蹕zb 0DrDrDr -P0LpW `0V0eb8@ 00 0 & ? fr -LpM 00 @"00\{  0SR 0 0 0  0S 0  0$00$<0 P70\0= 1 K0  }P"xpK x ?000p Pp0 <0S 0  0$00$<0 a  |0 0P0(K p a 0x  0 #40   L0 K0 P,0p(P0` @u(x 8 0#40"!B 0SPvLBDr frk(khd0  ̓DrDrLBQ00R 0S-LP P00S00S000P2LBQ00R 0S-LP00P00S00 MB p-P@L` P:u00Pc` <p p-P@L` P!u0,0Pc` #p -L0MßPU, `X 0SR P HK0EUS  T DNvp`2@0ZL P0 0 l0P ) T R ,0S00S40Sn 000Y00S @0S p0:0 SR  tP@0S V% 3S" @Z, L0Rc(K @T0S- spL@ ddUpXX @K`@0S<0S80S4 ,@K ytPWLX\L P40S;80S89 0 Py 0@S.0S/+p 0P" R㲀 0S0s 0S! R 0SI  0 P 0 1(K 0 000  0, X,  (Ko04(4 S:0 0A-P @0 ,00 ,⾃,0S0S NP ,crDr -L4M⤢ 0 S( L @H "0S/0Ss 0S 0S0sj ,0,PSh DKD`K`0T 8Kk5$@K Ġ#ČK<9KK4`P  K0 `KPK P 0S0 0\K0 KhkğxKPK`KdK_kxğEdPKc`K$8!dKKL $@P   -kP 80S0C80@KD>kß8Q dK( K 0 P tP x  KZP 0S0 00|3 ld0KP kPßEP$8!0dKd0KcKKLP @P   jPa 80S0C80Ť@KDjdK8a K Ÿ(P 0P `P #P ' K  PG 0S0 00Y2 R e1 R 00 VO P0 |1 R 0 A80S0C80kh80S0C80Ŵ1 R 00$ #  KP 0S0 0000YV 0 RH  D`0 RG x00 =%04"43KWPkp*AkkcrtOB)AOB*A)A47pH7p)ANB@PBOB0OB -L|M(pS0,0 @ | 8#QP/ 7Q .70S&7T/0CT*7T 0T)-`7Q 7Q 0Q PE`, 0R\(KU`D7Q0CQ(7T 7T7 1CT6 1CT1 7TA0CTG*U1CTD 6T@ ,0T= 6T 6TH0CTV:Y 6T 6T t6T 1S  3/`-`U  0`|`6T0CT*"0CTQ 0S0S 00S0 @5T )$0CT45T :,50SM1CT 05T <5T`c,5T 0TYl ! 5R/`VU`R4T 0TUS YY p 4  R:p 4  R:q0h$0000q0H$``0000,4T . 0CTH 0T[ r 10aR001#050%p< 10bP001#`3`#050%3Tb 0T_ 0CT![1`d3T 0T,@h|2. `$3T 0T5`,`0`0 d$㓡`(d0lYB P`VkP K`PPhp FpP4Ki K茐K⠀ 嘐 |K d@K 堐0P 0ࠐ 0 Q @0[dt0!s @0K p0 K@ KT0 P UP , 0S00 \00\0W$-_@Wh|2 冡`TP %04"4s0P R 5R00K KYP0S`4$0%04"40pMi Ji(>iildiH|PBNi0WiHKieiHi"i ix i %i i )AIi i i Qi kRi Si !i kPB -LMMğR  ST1  0P R,0 X 4Q 1CQ 1CQ -p, 0R(K0  0Sp0Sm1SSi1SSe Rb4Xa 1CX^ 1CX0I TP P@QM@`0SH0SEpKxg  gK g@T00   1FS0K0K$p XP T1W p\`K g\P<0X@P80T@40P00  \P X@ T P agP ~<@Kgg0)\2X  \K \gTpWJpWG 0SY L`K HgLP<0H@P80D@40@00 \K LP H@ D @ #gP1X5 S_Kx(g  'g(OK( #gT5 NK`` g|| g XP T11!KgT00   _NKf( (fT!5 `F` f00`FfpKx`f  fK f,piixii )APB -LM@@0T0 @T 0 R0 KM@T -LM`p,V 83PU,P  0 , PUE 81SA@=T@T@T 0S,0S 0iSl PJk `2 R ,  P00^00Sd V0 0,@ ,0S3 ,  0S9  0@hl*P hl* Z 0@hl+P hl+, 0 0@+P +,(K 0@*P *1@P ) 0@)P ) PZ,0,` ^RlʗRV ^0 0bSPRXWVU P y̱kkWr QB -LhM4p0$0 DP T @0SST@`KDeU8K@D%D8!0@0K?KCKmPP <`V $ 0R K@KDe40T0 0 0|  x 8r zp)A*A -LMqQ@R  R$ ` $ 0R` K\a0S^ .S\ T 0  QO .QM Q0  0 n?R0ns 0tPK0Kf0[ K T At [R A0Bs0S 00 R@KX eW7 K9 [4PK9:e00 < 0 B 04!40 e0 n0p*A -LlMp@K0`X 0 d7h0d 0PK99 d0 000#0 QK ξp47pH7p*A -LM0夀K0 x,0 d e@TKpPK@pK` p  K`K\K[`KxKw`K4 0 @p PL, 0R (K<0 R  0  ) 兾pH*A)AkDQB*A -@LQQ 0S\  R dPpGP P %P P P UP#P P GPUU` 7dP  1dP U U00 0  0 0 0  0000#0  d  dP,k$k -LM@pPPa0S4$KT P X1@T T tP08@TP;`0S 0 ~`0S 000 s0 m0S 0 @ P `p tP@ P`pX8`0S 0004 L0$ḵkRBQBQBxRBQBPRB "-LM`0AK0 @x,0 ! c Td%500KX2">K 4 KK 0 a ,pK 0 0K KB㔠 吠 Pi  YW \@Pc P 5d0S0 000K `>c` dKK@K `P4K0 P0U0`@0[ 0P s  T @ K{PP ,  0R&(K KP 0 R ! S/YD0 R 0!0 $ p(*AkkRBRB*ASB p-LM4ad @0RP0 *h0 S*1 R 0 l 0R&Kp0BSh0 S:d0S 5 0 R 0 Q|0 R PL埼H,KVPP pk@SBxSB k+A)A -@LN0000#0 -LMp\Pq@T:0Kib<,`$!$(,)@K0 0@⸠S0 S: 0 0000!0 00Q  Q 1#[2[[[00!0 000!000WU ` 0U* 0S PUp00W00S 0 0eS1!@Q00Sa PQ"J 000 0 000!0 0000! 0000 PU` @Z J0 000\`@Z 0p X W00Sy P q< @H @ @y`X 1 1Q00Sb v0&P @ @0dA PQ"J 000 0 000!0 0000! 0000 PU` @Z J0 000\`@Z 0 v0&hVlF`FJ0Q`ZZ v0&8SS@ALaPLq u0RS00Ls0 S0SA Na0Nr s0RS00Ns0 ST`, ALaPLu00 LqQSr P`0 R-\QPNN0`@TY0.S 40S X*,` 000 04 0RfQ 0000 S 0C`00c 0Z eV -L@M4`0P(,0 6 R UVpp V I, 0R (K40 <Y H@KT T V0 @KG0KHK寏 / 0 t3P T0S  @PhPP ; P @@Pe0 0000 P #P\ : XP 0P 40 0S X P0@: 00L0 L`00a0C 0@@@* B1VL (p+VLv0@(0@@@@40 X R L00 VTL@ VX 0(PP e0L\ 0@ l ^:4 30 S L\ P0aR :0`@0DS:/.00Sn@U L P00l0 000PP 0S 0S} 0Ss 0Si P L@:(@( p04 4Ps00#40@@L0Č0 4,4s0/ 0p P@@@&P |" 00@0@|"P`00@0@|"00@0@F `d$a8`tP V TL X X0 cUL0X@ ^UJ00S0C00 00S0C 0 000S0C00z 00S0C 0 0p`AS 00SX 00S3P1 0S. 1 0( 0*e "UP"p`VrkFr4+A Q-LM@PpU UTP0 SRL00SSHDXE,p LYA@> ;` ?T4?R2T0HP4 R0I\/ T& R$ T"0X0Y`P TP,0pcXj Y X`Y@   TP X0j S -L M0` (  @$ (,< 4!4"|WP( 0Ri$K1凸V+ 10SPDKwT0 C0KD K<`K0S7 ([P 4080S0C80?1@T @T00ST0X0W*< |20Sh  h S*S0@P Xp00S0 $!$#KS0S S:0m ptklkkpkVrL+A -LM@P6`30@p/0 pKpoTB &-LM P8 P0  0 0  < R2Q0,0  $1 bP0,0 p<,$!$ ,, ,  ,K M  M00S <040C<0 4 P00  0   808 04<0#404(K100S  0 4 00 0Pm4 ḵk -L M4  000 0SJ\H 0 ,1`VC @T= p,p @T 0 RZ0P +P& P' P  0   @pT,0S`V p(K000P BoLP0,0 P    pp40`̱k -L,M\ş 0 S0, L0 @P` G:X+ @T@ HK@@KOL0 TG0KHKJLHK(ۗP  $0f4"4pAs0sZ <<<< R* Rp @l, 0R(K RWp`ZO Z* Z ypk47pH7p+ATB -L M@ ,  `0Rpf |" 0@,W4-P`>0@ 8$H0S |2  , (K 0 S4`  K:XY @,: 0<@ JPP. ̟! !=0@@8DH@T JTe T2 TL,P |2@0  <@T^ 0@*084HTR T,P |2@0( (, <@TW :T,,,0SK |"  00@0@,,, @0 (PT),00S |2@0  W}T a:0DSiv,00S |" @00@@0D@<0S{dT:WT ,0S |2@0x x| ,(0U@P 7 F,00S |2@0H HL <@TK,'0:P  ?*,0S |2@00 04 ,<70S W4 W5,'0P P 0@8x<, ,,p 8 8@ 0 Y8 00KP, 0 0R0% *Q, /<, , <<, ,<, , Z1<, [,<8 , TQ~00bFrkTBXBʚ;k0XB47pH7p -Lܣ M`0p@PA 0pPd 0'Su1   U WU %(K0S 0SX 0S (0K  #* P,0:Sb @` PQ0MSp 0 P4 r 0/Sj40 u q0Sk S 0Sn S  ( <4"4)<(#,##(Pp 040  P`0@P`4(P`V 0S0S0S (P0 0@0@ 0R0% 4:PP 0R  s03 0 0@0 @jMc0P4 0 R_  sZ 00S0 0 000S000 00KP 0 0R0% *l00S St 00S Sh> 0@ 8$H#FrkhXBsTB 0-L|P@ R 0S00S0 R  DbP @0 S00 0?kXB -L8$00 0ktkk|k Q-LM# @P`p, ( c@P 5", K  Xpf`0, K $K -`L1@410!0c4810!0c4<10P 0c4D10 0c4C@@D0 00Q@0 00Q D1P@10 R h 00 S,H0 0L00 0C#0 }PpP}P@ꫪk -L, 0PR"* L0Sj1,  0S*4@pD`@` }@X4<0,0 H8@K00 sK1,  0S:j,k -Lk(Q/0( ,S  3S001 001 R0P// Q0-L M090L+S+!< < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < <1\0 0uK0- 0K0h؀t 0K0hX 0K0hT,,0 PK0h2kXB$+AFrWrx -L8MlrP@P$ ` 1$ 0R KQ<R#00@@0 G^ hg0S 40I4'> 0@'pP0L <Q񟗀Ttl0F\77P Pl0l03Tl0P0 0l0+l0P 00l0%P\,Pp$+A+A  R-L@p`PP T V @  /P; 177 (R-LPp( B(0P @@0S1` P  0 0 7P 000 0 0 0 -LM`PUP1 @0 0P <4!4$K"<=  0 / 000P @ ZgpP ; 177 0 @ 0 0 000  R/0@Pp r -LM@4 8 4@a@DX(@(<4"4 0  00 p4 S@l4p(@PPd P  @P_1(@ ``Fh @ 4 ,0K/@PM4,q0 n00 4!4Rs00#$ ,000  g$, "$ N r 04"4 s00#400P!  R4 000,0)) , )<p00,08 Q @PP7@(Kpp -LMdϟ<@KP@ 0 , 0p  <K⨐K 0 g .WD 0Q#  K !`P ><:P7|0K0 3^ R , 0R5(K4Q  K !g`P8Q  K !]`P`Q  K !S`P0Q S @ 0@0@ S 00 S 0@@TP00(@CT0*t 04"4s00#40 R U0 00  0 <000S U 0 0 00000S U 0< 0 00000S( U 0+ 0 0  P P0S|K`P Z@  g " B-  L,0S) 0S&0S#0S  -`P|0K0 0@  +|P1 80S0C80,*U  u`P 0SP ˟X0 0@^|KX0\@   W 80S<  ! d^ 04*8  R    R  *8#4"<0##$#8 00s 0X@KPX-0 PKW0Kf0X0K K0K ( 0`PP9 L0 0@L0P@ 0S |" P00@P0T@ R 0S W 0S  1<10 SK<0K@K@ `P0 S @  W h0S Q  5  R R Q Q R\ Ry QP Qn R 1K@0100 0K ! BrP`PI1  @01bW l0 0S#|20Sh  h S:0Sb R`S:  0 P`|PꨀP `P``e  b`PPMAV 00@0@0S9 |"P X00@X0\@0@00 @ 0S\" 0@@ 00S Sl 04#pqPp  _0|@K-`P@ P@0S1<<1P |" 00@0@5S,0 0 @P0@P3` |P3` X0 0 @X0\@400  @P|@K$+@ @ j|ı0SQA Pe: 0$a @4P0 0S  ,00 0( `P0S |" `00@`0d@P00sU `px00@Px0|@ |2p pt  0  `XPu 0V0 IP(`00S000 00S0 0 00S |2 P(`h00@h0l@00S S 00S SP 0S 0SB P0S 50S600S2P 00SR 01  00SL 00S S@W h0S0  -VP0!(p0 P0@p0t@@T@T  +P^ 0S  (V  `00@`0d@-0S* |" h00@h0l@0S0S,00 pWr ,AYBk -LM@` 0pR :P" 0S*  @000g@P @P 0KP  0R0% *TpD0@P4  0 01 WrTB -LM8 P`ቸPz 0ypPr gP 81@(0@ (0 0@0 BY0`00 0* BcVx  c`0@ 080P0PPPPPPP oc0S8 ( 0:4K P`p  )*80 0 Kd14 00@X0@ |2  80S S) S Y00 I(K 00S P PX |2 !X |2  X |2B  !` c  cyFro)A -Lp0Sܠ0 `@ T' `@V P`P( R  BR0( 0 UT` `@VTV0$0VPokcr 0-@| xPL04!40 04!40$ R0 ^)P0 00S0 0hkk 0-LM@ `R0%P .:U:  0S  00S0S6 S1@0S 00S P 0S 0S P 00S0C 0 0 (0KP ( 0R0%P *2@P $(50S 0S0S0S0S P 0S 0S P0S 00S%04"4s0 0#4 0 Ă0 4,4s0! C\5 $#$ `V.0S$0S!Z? (0S S {81 ( `V p  (P 00S0S 0S  (P0SCd`V_`V  v(P0$0(00S.O 0$0(%04"4s0 0#4 020TBFrMbko -LPp0@ 0 4,40`A(P 00S 2 D 0$0(00$0(0kko T00-LL@MKP0`0 00P( 00@0oxood0GS S S S/S 5S S /S p-`@L(P'0V00@ 0`p <1-LMp0 W``, 00PU* PV(`U(" W(0 Z:(@'0 0 ( 0V0110 0 %"P(`UW@ 00S @3@#,0(Kk$dr -LM< @ D < R<0 4 @0000 x2pW,p  , < R 0<0P80 %*T R<   0Rs21C< ,0Z0,0 pW<Pr D, @0Q @3@# 4!(K <J' @  NPML00X 80$0< ( 0538 r0,0 H10aR001#,05,0%\040P !0 T`V& 8`V xP0"0!Bs 0P:80@0  0 `0Vs21C< ( ㍬@<@,k0kZB S-`Lp@`PQPR00S`RU  BP ` V V*` X OD `P00X00S U  6` |2D -L0St0  00 PH0@ <<0@{$h~hXko$drDdr<$ZB -Lⴀ p{~0`V |2P@T 0>CS0`VD0$E D 0, #5#3 0k  < HVZ> "0 000% 1SS Ss 01P 0 S `VN @( `P 80< 0CR80= A@X `!P|2 = 0`@ 㱧0 P   `PṱPdP 40 `40@00|"0 0 @Ba 0`[!`0( 墈Pd40 `d01` T0 0 1p0C0, 40 1ek\BCMbkk -LP@' 4 00 SHP00S0S1ST0 00S0 S!< T0| 0hQ  =P4 00 SkC -L\M┑ P0p,0 <@KtH`^0`< 2 P= \ 1S  W R  !0\20 az `<W 01s3 @KD`"!< 0r |0 t 80\, 0R(K1S <2 ,0 G{pkkkCk0,A p-P\aLP $0@S 0SD TP $0@S 0S6 T0P S) T0 R0 R'@0SpSp0QpS P 0 R 0S 5RD0Qpp0\0)' @0Sp$dr0kkkk -@d0LSh00 l0Q QX0 R(h"00 <!,0 R(h 0R 0k@\Bv|2 |0- LP8*<0@ 0P0 0@   ,Š?0 % :,#3 000uMb -LM@p 0S z PU <`V} |2H pQ Q|Ww 10S4001 1 BaH0 0 P 00014!(10 ,1 Q `V p p<00 0B P pb0S 0S W00p0 d0 Ba  08}4{,x $ukkCMbkk\B\B\B\B -P!L@lp dP P :T 00S a.3000  00  00@T ␭0 4F0  \\B]B -LMpP@ Q 0S0S  `PL 4 ;00 20 SHX 0PU 0S `(K0S 0S`0Z0S0 ,0 80 4 <@Y00S&,0!H (2("0 F @T P P 0 `d 0T]   `P 4 0 Z 0100CS(к<ܺ<ĺ< 00S Sv e0R{ 000 Rt e@0 @@0 P0 1 0 e @t@04$ă[X0 ㇠ 4t) $;㹟奠pppFrk_BL,A0_Bp_B -LMXş PK$0 , 0Sl e0$e 00@@  R9P^ 00S008!U( 0S @00 0 pp    0: d`K0`00 HK0 UG0KH Kc0Kd K \@K S0S+\ R 0 (SP &Pz @@K S3 RP 80S0C80pß, 0R(K@@KC(` rS x0(0     0 fS0S S Qh +@"40 0( :@@᣷ K0R0 Kp @@VZ |"P`00@0@|"00@0@,2@EP PPT$ 80S0C80Ś6K 0K ( 0K妺P{ @@K1 <10 K0K嘠 *; 1r P e@0 @@0 P0 1 0 e @t@04$$x 00So0 0 0k% \@K0P 4"4,%K5K 4XP T0 P K 00S SUᩧH0 !4|s ,;W$CpppkFr@`B\,A_B`B  -LM0 005 @ 0000 0 -PL,Up] b`P` 0F 0S9 0RX0 0S0R0S`!000S]Q10 0  000|6R\!00C0038 P00(1㦞0 R 0 噞0 P000㎞凞倞p 0 |0 t0Ba0 @0@ <0ckkoFr`BAHaB aB`B`BCMbpaB -LŸ`PQ 2 0 @  00q0S 0S[ 5P8| S4PD ||0x0 0 0R0(P 0V0 0  3 @T1,m,0⇦ P000m00 @t0@ 00k P00p0mݝl 0@ |0 @0Bam\kokFrkCaBA4bBbBaBMb -LMƟ@<K 0P ,0 =Q LK9Qt& 0Q 0%` ":V0 p\K\K 'QPU0 $f0S0St 6@P  , 0R(K  0KP  0R0%` *嚝5@P $(<0S80S40S00S $[<5R e0S  LO <KPT \0[S S @KH P R 010 0SC 0S@0S=0 s 3X R6 Td0S XLK⛥H 4 R \K⑥$ y⊥@⇥0 00Sj <K{ `c0S\ L [ \K Pp`P`7 lK@,X e0 00S c0S9 \KMe0A <K P Q <0S 80S40S00S !@KK( 00KK}@P 40  00 Rv 5}a0S 僜[0[0S%04"45K7p1 R pH0SD0S@0[S <0R  S P#80S 40S00S`@"@ PP^0 <K\ K Ġ.ČKpo@ 0<K @5 0. `@P000 <K\ KpTs<K⠤ l zPP 0p|` `,pkkVrTBFrbBO0 \[48\l- \^ &300  L0[S^ @KH PhL0[SZ PP@ 0PAᢥ0Pb 09( y ᅿ[0[0S0\%04"45K5 R  `  `0KP ` 0R0%P *||5@P $(t"[0[0S S5 R^  5ZP4 RS *O4 R "o<KSP4 R< 8U e0 00S P4 R, ባDd e0! P z HQ v 0Xs !30R0 :0e @R@U@Te 0e 6P  0@S! q0S1 400P40 @PTB P 0 ~ 0T7὾  P2U^ 0SR  U  1S 012"0 10,U&P  @*h 0`0zU 0e 0 e P5  0 S !D!0,R00S4000e P a @ @<P{P% 0U00S 1!0 40  X0|"0 0 R0 <0< |0| 02X0X 0 'pkVr(dBeB`dBTBFrdBdBdB|,AQ 0S \; 0 A9 e0 00T4 3 R6 <K̘e0D @, 0K⑺P  0R0%P M*X\@T3 R  0$2 R  @ 0<K@ @0S{ Su 0 S pK`^ 0 K0KKC0x [0 L2 #@x K0r  #30 x K0l0K0  $(,< 4!4"<0  0 |@ $(,< 4!4"<0 tPE Z? 048< ,$!$#\ U *(1 RS 0 H0㦏K Rh0 h0R@1*T:0PU= ;@00S0 R  ㅏp0 R%  @0w@Tm 40 R  `0ipkkVrjBjBk6Mb4kkB,AFrlBTB\kBjBlBkBXlBkB -LHM`P|@p0<K ,0 BT2 RH2 RE(, 0R(KX 2 R 2@P .ᢗ@⟗0 0<0S80S* 0R0% =:P1 h@KJ ^KP d\? 0 A= e0 00T8 1 R <Kne0D 40S00S 0 R ӎ0@P $( @0KP @ 0R0% *X @ 0@ <K@s( cpkkkVrlBHmBmBFrTB,AQ- P-R 8PM\dr )Rp-LP@` :R P!P @p@phS S @phP  㺳0 0 @0P @@ph7P 0S 0S [@m @P d@" - -LMXp0,0 0Y0 0 0 P`0U @K3 0 P @ < 0 :R) ( /pP: @ A @0K  ᢧP4 00  Y @K Dȟ, 0R(K 0S0  0(0 pPWpP700 0 :R0K@ ,0H00 PX  GAH R 40<00 p0 0r#$#̠`#8 0v00 0 :R0 q 0\:( 0KP P@0( b l0( 20 K` 0 :R ,6@P0 04 f0S100 _a0S |"A0 0@0@\ 񟗥=0===\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\=\==P====p=8====0S |" 00@0@ R 0S |" 00@0@0 # 00@0@0S |" 00@0@0S |" 00@0@0S |" 00@0@0S |" 00@0@0S |" 00@0@0S |" B?0@1 A0S |" <0@1A0S |" 00@0@0S |" 00@0@t0Sq |" 00@0@f0Sc |" 00@0@X0SU |" 00@0@J0SG |" 00@0@<p\dr-AFr -LMP `@R $K0SP0@S'P% P 0 R Tp  0R0V0Sp  t0嫊P vP ZU0p@, 0PߐkX*AdrtT7㟑dr -L0Mğ嬔0@,0 `0Pp`0L0 `0P ST  0S 0S0S HK8dX 0 H0KG KHKX ȤPU TS PUC @0 l0  v0S,0S00SU , P0S 0S$0S X }P0s] 0 0@T 0 @P0r 00b"PJ 00@0@Zo l 20S5P0#@HK L0PLP (0 0@(0,@40S80S @], $0R(K 0sl0s` L KZ' !0۱@P l 10S\P ڬ@HK L0PJᾮLP (0 0@(0,@0L0 J(0So h0P`0@0@!  00@ 0$@T;\" PS0S |2( (, 0 0c 9l0@PP PT @߸p L K^p\drdrʚ;Wr-A Q-L0Mℤ, L @P`0 s0^\t$=x#=4$=@#=#=@#=#=#=@#=#=t#=l$=$=@#=@#=%=%=@#=-0L0 X 2L, 0R(KBV P "00X 0@S 0L0 r90L0 %TT 0SHK @G0[ST /0L0 0@S2 R 0St 10L0  V 0L0  T+0L0 r2Ÿ kPL xPL p Ɏ0 љT80L0 ~HK 0@K G0KHK 0WL o000c1 R 0SL0K,p 0pH0墤PA EF,]0S 0S 0s S0S,10 GOPo 0l P0 v@0gP  00 PTcL0S10L0 <\t 0L0 p̱kmBkkkdr)A -AmBmB -LMßS3P@p0, @0 0 `K3 0P `   X K$, 0R(K T 0S 00 0S/00 0S 0S 0S$0S(@Ty 800 0S 0S_ #,0 0 0 گpP700  0Zz 6(`0241"4101 #0 !0p0@ 0r  # `#$#8 0HQ 40<ء < < 0( apP`U 40SH XEF0S U0 0. =>=>=>=>=>=>=>=>=>=>=>=>=>=>=>=剃  $(,04@DHmB( $0-L0 h o0G=pkp0 -L0S P q00P0S p3 p3 fr8lr -L@`PPT T pT8@P0TP0@p00(iSPPpmB <0-0LM0CP@ S A=@=@=@=@=@=A=A=A=@=@=41? ?30 000 >0  0   00#2+! RA=A=B=A=  K000"000A10 00  Kr0 0A100 0L0 mBUU33 4-SLM`p3P:W) @P0@0PU (P 忁(KQ @ < @ x, K00K P , P UJ U @v0C@$;0 3$ 466cR 80 2 8"<08\!0l\<0  0 R00L @U^ U> d" 8T2< R42@:0#::cQ80 0@0 2 @0 !0S 1p!0P1\ 1R 04 K04 1hx!p,0d1 R P!pD1,P01P\ 01R' ,4 K,4 h00@  0 R p00P0P\ 0R 04 K04 hpl p`0,PL0\ P0R ,4 K(w,4 0h00CCmB8lrmBer0lrdkr}= p-Lp P 0 R L x4tP h@0`00&!00C0L 4tonBdrklk 0-PSL@02~s 0H00H00 R-L@)/ R-L@/ R-L@/ -L M@4  ,  R uRu B,  tR RQT10Pe 400Cs40 @`0 ' U% @  T:/ @ :/00 Ep6S :/Q q U6*P400Cs40 (Ku, RPE @`0 4@D 00`:/tU:x:/PP `:/oP L1H,P:/8:/0:/drnBnBBoBBHA,oBnBnBoBnB Q-LM@|hph`P$@H4,D hHoBloBdBoBoBoBoB$pB/ Q-L l@A p-LMPK0@ ` % Pp  0$ZpK= $0-L@PJ 0hYꈎB@K= Q-L ;@A t0p-LM@ P(`K$0 P0( 0 0  P  0YKpkkK= $0-L@P 0hYꈎBL= -L7 , ,0PPS PAA/ 0a0 +-L208<Tdrd 0-L@!!@ 0`|82@\@0  "!dr frD0 - "L 80!1,<\drD0 - "L 80!1-<\dr 0 -L|AP fr(0 -L8@,dr, 0-L 8@\drl0 -{@P`80L <$U08< 6600s0s0Tdr0 p-L`4^%@P00 R  0 QPR0S P Q 4@^P40|phD2] 4dr fr/ -L@0 }0o@pB -1LPPp`540U208 R  @P, p P40p!! 00! 0Y000@00 @  cfz 0!! ~ ~dr\kPpBpB 000 -L1@ n;h frvr 0-LP`0Pp' 40@0 C@D@2A@ 00PU PP 0@  PUi iz}drpB 0-L|A fr 2-LM@ :P 00K,00 P ,0K00*@P,00 @0<8P,0 僒 p4p>}W?00âZ`BB@,A-0\` -,0\ VWBnK ,0T+@,0TTW00CbV @"B" @!+,0\T1 W0 0  00\00 @ 0 @m9, 0\0 0\ 0!!(K0},}dr qBQ=xP=$R=|P=pN=S=Q=\M=pBpB -L4P0@ , `, p,V0@@P`0/(0 -L04,tk 81p-LM` @P/P**1%! 0c2VU!004 ,`d00  R00C0  R004 ,fU*pd !YUd00  R00C0  R00C0  R`kYQ'C0 -L @lp P`a/! ?0d0s2 R0 0c0`kkX0 p-L `M00@P @P8<@@PD@HP\p`kD0 @0\/00  0,!{`kHktkMb qB 0-LM@ ` 0000 R /p.0Lp @0`P 0@P8<@@PD@HP\0 08\`kC0%p,%pHkTqBZ= <2-L M4 p0`S  \0$$ L000# $00LrB`5AqBqBqB -L,M`$ʟQP 0S @0S @Q%9 (K @2S( %.9!  p@A0Ds0S, +4 3D 4 P0 H9L @)49 < $9$)TH 8 0 @ x #0DWS񟗥g=c=c=c=c=c=c=c=c=c=c=c=c=c=c=b=c=c=c=c=c=c=c=c=c=c=c=c=c=c=c=g=c=g=c=%80!0 H)%t#%\,O8pOS"B %$40S 3  Z p%p1?3?3t3t#0JS$Jt %L30St 2t  W <%60S %08| thKA; @@ l DW!p `@,   da]LHXfT\THx<%(`s5e'`-A4ArBrB4A@5AP5A05AX5ArBBBrB rBrBLB(rB4rB,B@ArB*BrBrBrB`rBLrB8nBrBDrBHrBPrBTrB3C\rBXrB@26"0 P 0@E@ 0P@`0pO0@0l 0@1@P0@0ererererererkerererererer erer 1-L`P0@&&P U  0Z?Q ^p0 `0qx0WP@!^ 0Z?Q@TPpererererer erer0L0 0-L <0r8P8@@T,0(tAT0er9er fr 1 -LF0 \\0 0\ 0\ `0\  L'0@@0 |0x  `̠d0l`T0T 1H0@<spAPAerAkererer erer====erluB00P?  "2/ -LM@ @`@`@`65@`5@`@`@`@`6@`P Q#A0L ;5 Q@``er  Q#A0L : Q@`L Q#A0L ;5> Q@` Q#A0L ;5> Q@` Q#A0L ;56 Q@`@`@` -d L_ 0-LL1P@T 4 8040< 8 H0<0 @ 00S 0 0!s r AuBuBuB Q-LPM@8 P `KP2X00S KLT0 0PL0 0HD00@<008 40$00(,0,0(0$040 80<0D0H0X\08<1 -LMp ! P1 L!<1$@L G08 0B`BK 01 ! q 00  00  00  00 $00 ( ,00 0 400 8 <00 D H00 1 0 1"BK P k p10! 8`H@1<0(K8PG0! 4!81 ` !0K frggL10 0" ! -L(M`0001 0 !L1`4 0R  R  R 0R21C 0#QZ!*U9PpK A :% j!8P( 020 i!(K 21C 0#QZ!: 000 , 0 K pH00CH0 P 00 ,20 p 0qq fr A vB0vB$ 0S00/er( 00@S 00erDo= ` -LMT@PP T @QQ S  0C" fr#p -LMP0 0 !H 1AH!Z7!`000F40 1 0 0SpL1 pP@T@T  0P @T @ H  0J"T m <#pl  0;" m fr#pqerDvB-^00 000 Pp-L`P Q   @PIp N 0#q O 0q AhvBvBvB^l=Ĭ== ===? p-Lx`xP0e0@ Q<00  \8P@@(0t@p pp=T=erer -L0ter Q-LMP P- Kp0 R ` /P00 S000 0 0K%  6/87phkfr l1-LM`!`\1L|DAs'<1<  | ]o1(@K0pKP!* o0 $5PPD"` K9PPP@8"0徶0!*nL! PL1>@0L!0*4 T 40L0C0(Kfrfr#perfr4rr8lrHAkkvBHkpkLkqvBx -L@Q00  h+4hn0  "!n lkwBvB@-@Q >0^ 00\R 00$0(000/ -LPpᡀX`@  (0@X -LPp!X`@  ,@X -LPpᡀX`@ 0@  XX -LPp!X`@1@  \X -LMp `( (@K0 PP$@ IP4( :8 ^ * 8\030#\03S@ %^ 8 R030#R03S: S@*21C "!B 0:0^ 0 K mnDwB|wB -LM`@Tp*  R $ PR @0PS L   0 rP  @R(K @ ` M-LpR0`7 0@06:#:S30!Q0 0SK! ^ PU` 0@0 :#:S :#:S0S R^R1n/n -nwBwBwB -L$nxB -LM@ \ 0P 0 0c80 0圢Xp{ `Z}0 K40K  0 0S 40 Rs @2.! ,  080@ \ @, T>0R:00P^ (K\ 00a, : #::cS1!^, ,8000`\! R P 0pWB21C0,0,0 X 0 `021C@0  R< ^ 8,0 0S< 0 0p  , K_ t0,(!(, "*46*80,  ~p 8lrLkrhr4lr -L$M$( 4 R80 `Y7 080 0 VR"PpPP$8V@1,K040K `V 00pR00SP 00  $00( 0(Km@xB -LM`p$(!3  0R,0W80,  PP p 3U00S 0S  @,K(K QR , 0 00$( p0$KllxB -LM@\P$(`3*KpȌ$  K$K pP$0 0 $P(0`p: #:S-L 0. . hl봽kxB >0-^0PL@=`P 0Y`p@00T*U 0U  0 J0SjZE Z p Zl봽k8lrxB 0-LM(KpR(0 $ '`00^*P0.Ơ\|@ : 0c \A 5110a00:00$00$  $ 0S`V F K Cr -Lʠ,ʠ! Q`PNS$ S S010!p $pU4W@ QH `@H `@P h`bb@ PH `Z( ` Pj 8@L d-0lererer AxBxB00$0(000w -L@p@  `,PP  `00  000$0(0 0P0@-@P# T!00Q:P  RR*> 00 0 bR !. .0 00 >00 >a 0Q00> 000 -LM< @  @0$ RY 0R:@0@0S 0 Q @ Q=D==(=!k1jk@P, 00 p0 X :00j 000 0 X*@TpPd@T0 <0`0V,0  V Q:>0 >0 S00`@ `h V `! 0eV`! Yy P@0,`pPXp e `"*<0@T Tf Q:>0 >0 S00`@@h T @!0T YI @ @,0p80 8 X :8j 8 8 X* Qp@a Q< 8`0VP4  V: U:>0 >0 S00P`@0 `h V `! 0dV`! Y @_j0p(K Vj 01, 0 +o4  0$ ,,@j(>j ;jhyByByByBeryBp5AyB4yB -LM@hPQ $3\ b  S] 2"S0"hp"iit1Eit1@8 it1 8i2XRR0S  Z$ t"10@T \\"$KmhP2 RJ D2DD ?8R0 A0B%@h Z$Kht1  hh  0!h!phPPhLhZ2 : Zt18lht1 0\hT$KmhH1P 1R? 0\1LŠ0aB%@0P @`ht1hch`}h]zhvh $KmphA5A{BgrLWB0zBzBzBBerer8A<{BAerererer8AzBzBzBzB zBTzBpzByBererzB4zBDzBzBdzBh{B{B @00-L8@Pd 0l1ph!0her fr-0 .!  !!-0 .!  !! fr frerpker@@-``6(`t`6 !!@@- 1 pppp`L! 0 p?`L0 !@Ј!  :P"  Q -<p!W R !P Z8 xW(0  !@Й! p? pG!@- ?}$ !iDЍohReset vector called, LR = 0x%08x-DMO- i@0lP @!1 ! ,OaiDЍN  0O   ! -- -i(#80"*^000 -LMP`0 Z*&:0:6h S1SZ F:#U@pT $!000SW-jZ1P@p 0P*0hp0P0@\ R , Kl}, hpH0j8Zx 000bQ00(K8lr0lrer}= -`LM0:#5 pP6U0000 000 0 0000SY @8@pP\ 0R , KX , hpY <@P*h8lrirHkrdkrhr0lrer}= Q-LM5 1@@0S 0܁``T* pPV @T 0S 0P` RC WtP, KpP ,*h@pTW!$!$A80!0! 0!000S@8P0 KP(K0*0hp@\pP\ X0R , K$, hp fr8lrerir@krdkrHkr0lrir}=/00 -L R0 @ frer 0-LerP000/0 0 /hrhr0 0 00<10/p@-PQ@` %ʠ  00S0C 0 ~ ,210P  21C0P: #50 p p !-LMHP Q:0Q*b"!B10b0 @ R  R 0S0U 0`0 0 pK $0K00P`$`  0 R@8Kd@pP\ H0R  $  hp Cr8lrir0lrer}= p-@LP`OTpphT0 R 0S0S R/: #:/k 0-LM@\* \0 0 >0 0000@S0 lPpP\ P0R  K@b hp00irhr0lrer}=8lrhr 0p-LM! P @+  0;00 0+ R 00Ppp`pP\ T0R  KD hp 00Pp\kr0lrker}=8lr0/hrX0@-@P R 0S \ RhrX0@-@P R 0S \ Rhr1- P1!Q1 0 0+ 0 00 .0U 0 00 0A 0 0 0 0 408 ,0er}=hrhrTkr,lrHkririr8krhrLkrhrhr0>0S00 n  ) ,#0< >0D 00@@02 RxDJD ZQ D@46ZS#PP @): R-P 8#8ZS#;)6?>41@D0 pPU@" W,U>000 R bpP\ 1R , K, hPpU@D J(ZD 0(K)6;#;x!1@p1p18  0D00001 RD JD QpP\ 0R , Kg, hpoPpP\ 0R , KP, hpl0l 0 <0 `04 080 1 Lc_ D`_@^_irhr8krhr0lrer}=8lrirdkrhrhrTkrHkrBBB p-LMX`PP @ 0000@PKphr -SLP`p@ <P 0*"5060@0_8lrHB !:-LMP@0S 3PY :h!#Šd1@ R`L 0D!0000S)(q81! 0S7 000 00S ppP\ 0R  K  hppP\ p0R  K`  hp8 ^ir8kr0lrerhrir}=8lrpB -LU (hUpkrhr -LU 0 ir|jr,0 R 0 Q 505055/O|jrkk 0-LM0S | 0@T00 KKhOL0.0*@ @@@0@|jrkkk 00-@L  PRt P `00  0@@080)  0P^|jr8lrhrerB 3-LԃM`0 0 0, 0` V5 0Sp,PP F201@T 0 A@ p`P 0 "!B 000 \ P `\ VYZ @: JT * P J\T:|b|rT\$,XRXB00HH"u 0B0,"l 0"d }!0\!0W1@ CD?FD@b0$J!@$B!PE L!l0!:p1  P0\\ 0TT PU 0<@N<< 04 PU( 0  PU 0 N 0 PU 0MD\(KY 2 1C! c@@0 !]]o8lrBLBhrerhrxjrlkrhkr@krhrir`krfrhrhrhrhrB(kjr=kBirBhr=Bpkr=PoBB -L Z - LP -~LMpP: h#eP@X*`010!0S 0000 1 R8+  0Sp P\ 0R , Kz , hpp P\ P0<@R , K$c ,+hp8lrerir8kr0lr}= -LM@00bs^P `p  0" 0RP Q&20100CS00Qx0 R hpP\ L0R ( K( hp8lrpkrhr0lrer}= -LM0 @`VX 10Sܑ 0 ZB @kQT`< @P{:#5p  U6 X1U3 40C4 @!40C4000S ApP\ 1R , K, hpZ 0(00Z@@ 0(K 00S Z `@P, KP ,*h0@ fr8lrir0lrer}= -!zL'2M1@T$ P `i , 0S 0i0(KQ  0 0X00S 0  A,00 p LQP@0S0  P0pkr8lrhr -LMP/00,KQ00 0 0 0  ,0 ( @z:` #! P:0l PA 5110a0000(0T0(0J(  * 5,0 ) "$K Crhr8lrk -L0@0CS0hZPjr  -L,M@ D "A< @ PPp 4`K8P @ @  0 @4 0` `@d5P$X4`" 8F<:# p@0 0 S  0 R8ZX`8<f@ D00<00(KpP\T0\, K8 p, hp괽kBBir8kr8lrer0lr}= -L$P 00$@zjr -LM@\pP8 \`0`$: R2P0 $6; #;1@00  000 00S PpP\ p0R  K`  hp<0`0.Z(+Z8krirdkrhr0lrer}=8lrHkr̈BB p-LM`P@0J$E00 P   000 00S@8pl@pP\ P0R  K$ hper8lr05PQ pP\h5\, KH@e N, hp@T0D6Q0D\4@$؄@:#:S14$$`Q,K"-P p 0S,P 80,0 Ld4 \4 ,Š,0  P 0S8* `*:"*#:S+*3#$PQ  0,P 8000 |w3 3 ,Š00  P L#0S8*S#P0`@>$<  PI2#$ Q4 \  0+P 80,0 ",@<@;"<00 4,Š000@0X2 R]<8*<,"B0S p<P\ 2R <, Ku<,*hp00"080!Bh0<  !001 0+; !0,KQ,Pp0KK,PippP\ 1`R 0 K90 hp0pP\ 0R 0 K#0 |0hpppP\ X0R , K4 , 0hp4hrker8lrhr\kr0lr}=hrTqHkrirdkrhr8krir0 )Р)0 ) )0 0-Lp0 40"!B P0P0بP0 R00 0l1R0C00p1@C\PU0T 6 @^@D H0L@0 > >>>>>>>>>>>>>>>>>0S @0SJ0!(!(q"$POOOOOxOw3d %pTpr~p@g00^0PL U@`H@ $@K, 0z)$ 00ZUj KAPLk8lr|B -`1LM0800 0(0K 4pP (KK#pP@0(4 P 4 Kp0p , 0 pP0@ @_0  Kp0 pP0 00GH 0-LM  $  (0 L!P + 0.LB 0L!.@ L1:40 0L4PL L@E@L1+$ R(0800` E`0(0004 K00 fr(=pk0 / 0-Lper/ -LO넊B -LO먊B Q0-L@P0`0 0h8lrk Q-LM`R>00~D1N@pdPP B  0d0T09*JWZ3 Z,K00K 00P`0`  0 R pP\x0 \X , hJpWZ (K 괽k8lrir0lrer}=!1!01!!!!00 / -@LP 0SL `10`1000S 0 frk -L0S @ `10C`1 R0 N frk=AЊB -@LP 0S 8 `10`1 0 N frkB$=A@@@0@0@0@ 200 R@ 200 R@ 200 R@ 200 R@ 200 R@ 200 R@ 200 R@ 200 R@ 200 R 200 R@ 200 R@ 200 R@ 2 R@ 2 R@ 2 R@  2P00 R@@A0P0A R@A- QQQQQQQQ RA- 0@P`pQQQQ R@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  Rp@-@P`R p0-@P0/R0-@P \< 0L l4 @P0/R0-@P \ 4< 0L lRQ@P0/QP:/// Qp-LM@P` S 0Vp pppS`@rP`&0-@P0/R0-@P \< 0L l4 @P0/R0-@P \4< 0L l51@P0/ Qp-L M@P`S K 0V Kp  Kp K@rPp`(Ƞ"(,Ƞ 8! p@-@PpS`b `c0#3 Q a l.^#(8.(030# 80 (3#0"P@p.8BA Q ! C2 Q-L@P-S'pU#`S PW0#03d g0U f  e00#2 S06"l P@X t@P` r0(@pP` a@-@ \B/@-@/0@-@QP a0 ^1200 0100 -L\M@P`p H5x^`0p(KSP 0R p#83Kst00 X$rP 8"(KK<K3KsK#KKKSKx p :@K>[X: K0x p0 8@K6[X.[ *2[H%2[ \   p@ xp@ hR6@K80Kx0 p 3[pS20K0KnL0 |  0KL L LJ 0| S  j0R A EJ FK  0SbZ X#P l %*P0 l l0 Sl :\ p L4p Bl /@P@ x0pL0t0 \ ` T h ` h0|P0X0 Ud , HPPt d8RIPP:p^x\p@T0T \  a n @"((b.` P0n`s #Ȱ  pP0x\ pT0^ P000A#Ƞ`0 |0`I00XhFK 0h 峐`0T0Z`0 T ^" lP p ZL0l C0n0l A3><Z0@L0["[[2[x h[[$[3[xh$kp@-c@bP`T !L2pQ:P:/// -LM -L MKyK K0-@"P#0/40 $ R/ 8 8#$R/Lk40 $ R/ 8 8#$R/Lk 0/Lk/  S-L 0P  mHhuB0  /uGp(B 0-LM0S00 0Q 0CQhPh0h@ \0\1w P0 0H0QDP @0QX->->->X->X->X->X->X->X->X->X->X->X->X->X->X->X->->\F 0@0Q0p @ + pprrk|klB|BB -p LM@PP]xx9 R@ l)lɟd h9 000 ;T FPi0 D Fi0PF0 0R0m 0"$#4+;"+#; 101!&0D1D 0 &0 08 Ơ n.8! 匨匘 (@mFd8pl aP,Ơ 0aF`pW ȟ 8 @T:00C0)0P0c1*Up,0 I@9#9S @0^:B7AD@L*0 1P0b*U`0W I$IT0ǟ0H C@7\0g:0 0C07*`Ɵ0C\  Vr:0 0C06*KƟ 0|Ɵ10aB\0[:0 0C0t6*4`Ɵ4 0 Ɵ1B\80a0C:0 0C06*Ɵ 0ş1B\0a0+:0 0C05*şt0 10b%0Et5EhştE\%hEş0 C^:0@ş0C0* E$UA! E2T PT?C ET P4`@DeEN@ 0`$P> 00d` XNE4 :`ß: `: `#: `, 9 xS{o  P:@@UL3@ß 0?? 0S  p   : 0S 2#. 0aŸ#60B  $ p2"LLB<",2ŸT2T"T P2P"PL2 D@D  !0 !D,15#~8!00000)00@4!1Q4 %0CQ3 D81 (K{EyE`D0S @ 0 Ơh}D0@SDHrT0Q 01Q(kDfDcD`DKEXrr kpkt8>Btur؋Bpkrk\ur8rr0rr`rrLB  KP 0 &S  R0 @ 0 60 (K#( !B !$ BKp 0S  (0 (K31C01$0 V | 0d#L\h0Td`0 ϠXB(loB @ 0 <iB8@`0dB>vrHBE.,B$BBȏB>B40  -L|@QgC 0  frk 0-Lp@  "!0Sx b1!P@3HT]  01 0!!|h0P  "!1!@ 01 0!!eh0P  "!1!@ 01 0!!Nh0P  "!1!@ 01 0!!7h0P  "!1!@T @ 0!!,0 0!!k frvrk (00-L P@! `|A0vr fr-0  "!@ @0  "!0|!D frvr 0-PPL  R*Q U3AA8CSD>C>$C>$C>$C>xC>hC>$C>DC>nA01P0@dA J\A  WA  RAP   @ 1@ 60\0#60 0! #60 3ABBturBАBB`urlB/0/k0 p-L0`SP R8 R 0@SቼPp@pAk$B0=A -L0tp3 x1-L MlAp RH 2X1R= P1R/H@g@!@10 P P(@K % A 1(` $ @ \P P `P @PK0CR @ A @@)T |00t@8 h00`@ T00Xrr LBvrkkkD>BBB@=ABpBHk\BkXB 0-PLmH@T+  @T 80 eP80 P \> @THP P 00>800xB`B -@L380H0S4>r H0SL80ꐒB< - @Le  @ !! p-@L004004PP e>o`p004PP hV>`TP`PP80 400,PP80ꬒBȒBa 0-PL80   0804HP @T0H D0L H0<00 8080 0-@PL80 080P =0hKP p= P 80 0800h,="80 80BB B 0-L00P4 P 80 00800h80 0@80T{X800080800 -Lq`P0SXP PX@T0  P0S 80P0s80 080P @ 1P0s @T@'Tk B -LM@T 0@]P  hM=HR>|pB(B A-L@Q$T> T>T>S>hhXh800P0 0-PL@"=000 4 0X80 H0 L0d d0\`0x HXhld@|@b800800hꈎBY>Q>lS> -L0np3 80R/00  ( ,100 !0 $1(!/(!LBPBXBhB p-PL 0<<`1>@0@S V<0`S@<!1|<t < Q \e> -P@LPDp@*Q0`,r 6&(D 0P@ `V :( 0P V𨝨<ԿAD]p p-@LP0S p  `P <Q8000p\0 R lpDBTk p-L@0`0RP -8000pD` L0 `L P<0SpP000P 0L P <0LSp 8000pXBpB 0-L@M80080 K5P 800800 80080">P<800800 400 0 4 P{P 470  P0  70鐕BB -LPMpP`0x0 M@P xO(KtKL<1<0 D @p 0P4X0 0KX 80 T@P80@ 5[S L㠲0+8X0 08 5K?@PT0  L㍲<80  05K/@P  -LPMpP`0x0 ,@P x(KtKLg<1<0 D @p 0P4X0 0KX 80 @P80@ 5[S LG0+8X0 08 5K@PT0  L40,8X0 08 5K@P P p-LLM`Pd@KLs>w>w>w>X5P`@\ 000a cR Pb^T@pX@4D1\ 000a cR Pb^t@PP@Lq\ 000a cR Pb^T@pH@MQ\ 000a cR Pb^t@P@@Nq\ 000a cR Pb^T@p8@OQ\ 000a cR Pb^t@P0@Pq\ 000a cR Pb^T@p(@QQ\ 000a cR Pb^t@0P @RqS1\ 000a cR Pb^T@p@0T1\ 000a cR Pb^t@ P @4X1\ 000a cR Pb^T@0\1pp@\ 000a cR Pb^t@P`@0D1\ 000a cR Pb^T@8PX@#8H1\ 000a cR Pb^T@pP@LQ\ 000a cR Pb^t@PH@Mq\ 000a cR Pb^T@p@@NQ\ 000a cR Pb^t@P8@Oq\ 000a cR Pb^T@p0@PQ\ 000a cR Pb^t@0P @QqR1\ 000a cR Pb^T@XQԕB -L800P`v@ Pv@\ 000a cR Pb^T@ RP0!6 @\ 000a cR Pb^T@zP'z'@\ 000a cR Pb^T@0 0P#H@8!\ 000a cR Pb^T@@004@APDT@0<Q"08!81\ 000a cR Pb^T@ 0BS0! h2Rk L2pr@\ 000a cR Pb^t@P6 @041\ 000a cR Pb^T@zP'z'@\ 000a cR Pb^T@0 0P#H@8!\ 000a cR Pb^T@Y0P(@00\ 000a cR Pb^T@450 581@9400@=BB -LLM`plKL2|100 05K<P% P#80JH RG @ 0Rs@s P@LKP6D0pSDP L 0dWPL0H@T#000 @T L 05K <(00 P P LKbP \P @T K@1*0HB-40 ^1 <1< R<0 ] 0-@PLT0$0 0(00h6$ p-@LD`0l 0R0P d pk -L@Pᄠ 4p0`0  0 4 P0(00 4 k -pTL P0@d0|`hpl@p@|@ | 0p000 o  do꤂>>k -L@MЀ `0R$0 P0 0(0#$ 0R" K0p^@K: 0d VK[K\KZ0K^pK嫬0@ NK08 >K⢬ :R: #p`BhBAL=A -`Lp᐀0S | Q00000|| @P@@@|@0|0 `ik p-P`L@T | Q00000|0| 0 p -@LPB00 p-P3!@L ePp`0 0 ``^d d0)U 0@|     |\0p>h> -PL@T|p`P PP P 00k -LM`  P@ HQ Rʨ0  QxpP /K0P0: $@K 3sH`DP0< $ r P@ /@;tB>>H?B p-LMP4@0 0P!`0S 0S 0(0Z"Kp (005S >>>>>>>>>>>>>>>>>>>>>>>>>>> >>>>>>>>>> >>>>>>>>>>>>>>>> > @K㏪ 81R #0C0K##Ƞ#4 KK0K<10K#̠##4KK0Ky!50S 08 <0 ă$08 Q 0Q:t0P 0 480R,/T/L// Rp-L@`P 004.,@DTTp004.,@T p Rp-L@`P 0@D4.0\TTpT 004 T0.0\p .-L00p4,04.@0\  3  004@.P\`,.<6/@X0X0X0s$8X \8 X \Xh K/-L004@pP\`,K/O06/ {y@T 004K/,0 T< -`L⸐@X IPXpX P p 0#PX0)X @\@ P00 X0 kB -pLܠ04M/0\0@4N/0\P004@K/P\`,K/86/04M/80\0@4N/0\ k70 -L00Pp`4I/,O@T 04I/,0S  @< -<04`@VLp01ȐP`dVP 0Q  P 0P80<V@@@  `dVP 3P<0@0<00<0C -Lph004@J/P\`,J/<6/X9 T0 K` L L004J/,004J/\004@J/P\`,J/<6/hK004J/,     k' -LM4@pT80T ePI  D+-` @< @0T T$1 wBHBXkhB\=A - 0 L0R s  0 00- $@PT,00 L0P0 P00@T0 0-L$@PT0P0 0@T0 00- $@LTP,00 0P0 0@T0 0-L$@PT0P0 0@T0 -LMQ@ ?.0A""* *鼗BB -PP``L' 0$QpU 80S T W0@T40404 0@0040TV H0 SR+B -LM00`@X 0| pp  0$  0Q"P< $ R 800 QPR 4 P00P0S  Y00S P<0W(K< 4< 8 4 0 @Kd d0, @@ 0 4 P $0S00$ 0040$0$40HP(00(0 * >>B p-L(0`pX@X080X0 T0P$4P0T pk -LP0/0S 0 3@Ń 0S 0 S ?>#R// 0-LX0@  8T0 $4T0 8P$4X0Q;+S  ; S800  ;  S00R@@@X  (RP/H0RA/0R /#R!/&R/ /#X0/0X0lLTp -LX0@ l 0-LX0@ TPN \0 B 6 +  `0   Y f t ?\00L  00h L (0L0 &\0L0 &\0L0 #\0L0 #\0L0"X 0@ X h00<0L0 0\00LX 0 h0X 0C+ `0  LX 0 h0X 0C+ `0  X 0@ X h00<0L0 0`0 z 0-LT,0@ P0 P0 g0St0  gPS  tx00PPx0S -LTP `00Rp @$<0 T ,00LP@~, \00Q0Sk p-@X0L$!;98T8}6P3dU 8 T0$4P` L0SpX0 p8;T$8p 0-LX P@+ `0   @  P0T$8 8T$8 <8TGX0700l@X0 8}0\ <C3  `0 + +0T$8 8X0@ `0T*, ,0$8 8T$8 <8| 0X00l 0XY0@}T 8 T0$4@  @00>CP>>(>0% 0 0 L0"S 0 L0"S 8 T0$48T ;$80 L0"Sp p-` @LP>& 0?.C""6&(0L0 P8 TP00X0T$8 40 \ \0 `0  ph0ph&T0$8 4`ꀘBB=A̘B/ p-L`0P@1phk p-LP`@T 408 ,@P@p<p -L43S 1 -LM@`TJPP ; K1*J7q040 (4R,000 (2D0!(0 N2P, ,  040K|V54 FL0 D0"\ $Kq<S <0$; 00\< l0P <(\   $0  BA A B,B p-LPB`@uP p04 81:8B-\BcP408B-, p -L(M5P=T@SL HX#\3RF*\3X#0bCX D H ; ` 0 AT< Br0CDQ. %X3H0C0QX#4 B "@0\D RD0D C4H0 B0"@\3S 4H0 #08 ,\(K\3X#0bX3L< q 0P P(00S*1 0 X3L 10$RX3L 10D1S<0  Br`F<(\  $0  B>>P>>>t>(>L>а>>t>BDB A BBB -LMp04X38\3%0\408%,48 0\408 ,48`%C1\PUP冏48 0\408 ,`4 85\4@ 84\4 84\~3}#|4840< 8\4@3 48\4 E8\4\4@ 08\84@PU48G/4\4@8.0\485-0\4@08 \48 0\4@8#0\408t#, \4 80\4@ 80\4@ 80\4@` 8P0\U4@ k@0`4@\C8XC.0\4PD 0`4D.0\@o T4@P`S8,"0\48"0\4@8"0\48!0\4@8!0\48!0\4@8!0\48!0\4@8p!0\48X!0\4@8@!0\480 !\4@8 !0\48 0\4@8 0\48 0\148.L0\S5@0;5x D 2Tv"3! (@ p-@L4 P` 0 0Tph@TB -PLt@`p\1T1 0CT#  P0\@4T  1T* 1T01.@4T5@@505 0SP5 @ @05<01.0@@ @@ki 5i 6i( Q-L@ Q004h ,04P 00\0040 ,04 00\ |0 Pp-L `T@00<P ,0V0<0 00\p P @pTkX 0-L0P40\0@4.t0\04d w0\0@4L 0\004., 0L x 4 dB -L 0 0; 0 p0p 0 <.0 A`40 -L D0S 3/kB,>A @-LP> >>>$$<B@>A 0-@L004 P,04 00\004 ,0 P-LP `BT>A -L@0 \0 a0q 004 ,04 0\Li004 ,0 40\vrwrvrvrB Q-LPp `AV"004A-,0@Ơ6 4A- 0\0041-,0041-0\ GB`>A@0 -L H0S  3/3kBt>A p-LM`0!001 PRX 30CRT 00@4 0P=L0S.P0S 00@< 0P+004+,  @0S 3/ph0R 0R0@0 0D H000@8 0P `\ 0D H0P@0L<0< @080D H0XrrLBB $>`>(B>T>>> -LM@KP400S0>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>00A0000B000000 @  @0( 0 0-L@PT0p0S,0S 0S 000 04 X00Dk8TA0 p-L PRp`@0S,@0S 0S004 (0 0RU 000ppDk8TAD0 -@LQ0 00 4,0Dk@0 -L0S04 0\Dk p-LM`PQ0400@0 PKPP  4 !KpDkBHBlBDTABT0 0-L@PQ ,@Q 'P0@08TA -@PL`0S pP 0 04(V< 000T$0  !  00Dk8TA -LMPp0@S P t@P, 0S@ ۔`P PU LLT4 ,00 004 XDk8TAXTAB000 Q $0Q 0Q//Xrr (0 - L1\k(0 - L1\k(0 - L1\k,0  -L  1\k 8 -L00@4,@0  -L0042 \  -L0042 \ -PLx `@008 4p,T0 0 0420204 \k  -L0042e/\  -L0042.\ -PLx `@00M/4p,T0 0 042020M/\k -LPPp @004M/@`,P04k 0-L@PP 004N/,030004O/,030 0p-LM4@`0@P P:0 Q* 0Q 0Q$ 004 , "0  0 (RHp04] 0\p0h 0d0 0\ \0 00L 0H0 0@ @0 04Xrr  B>4>h>>>8>l>>B0 -L R0  "!Ḁ 0|S02Sp՜`ژ0!p`@P" 40\0PS 0UH 0\ 0!!k$r fr r(rwr 0 -L|AP frt0- l0R `"X0RL 2 1C 010 P0\$r rk(rwr/ B -L 0|!h frvr @ -Lⴀ崠`0P,"A@0PUp PP 0@  PUH 0\m r(r xr 0-L|A fr -LT0SGHqHH`PE 0\^࠱P^: \B0"P!B ! -00 P0 \ 0"!B ! 00 P0p0!, 0n1\0`Spk40|oBP$r xrwr(r r fr 0-LḾ@q@ pPe0 ,P@  t 0\T1T!Q0HD`000 0\ PR00 @UR`PA,0\2 @P @0R`HH 0\@@|tttt t0t n 0!!(K@) r(rLBXrr$r xrk><>L>>l>X>>>(B 00-@LP  "! R1h 00000  4 R ,㻮 0!!0 xr -LPPp`20 U.0  "!08 R  ʬ@P# 0!  0p 0P4`V0@@  Z 0!! $r\k xrLBpB p-L(`(P@04 ,pPr@rP !7-@LM!Yh1d1Ơ`"100@!10` ?@6clPU/aQT d0 0 R 00C 0 R@Tp( 0,@d0 0 R 00C 0 R0( ,dU*d0 0 R 00C 0 R 00C 0 RʽCY'hH>>@rkxBB80 0-L P@004H ,0 k 1p-LMP 7@Pp!!id1`1Ơ`"100 2 < -Lp008,X0`S` QȁLD0H XL0QX00cL00S: 0@ ύX0fS\P0fS<峌P00C \ T0@00\00  脌\P0fSX00@ne T8< @1@!,`X"D00S*D\`X`004P( @\`,( 06/040h< \h   kCooBxTAB 0-LM$K@0@P @Pw^[0$ 0\00$ ,`pWF W\|10@$ p1<  84 0< \0$0@ \0@$8 0\!9@ 0@P0 Y00$ ,0$ 00\00$ ,? !X Kl0$T 0(L0\0@0$8 \00,0((k\r k>d>>LBlBTAB 00-LM4@P0@ P&0 0PQ 0h004/,l0  P 0P L0PDD@,0h00@,Xrr`r LWBBNR0Bv>giV>Thb Q-L Q R 0-L@ZPPP Vt"R0l2ptR00 0-@0L SP 10!0?B3c=Y ]0l”<18p \l2p ,PEP u0h0CABMbHB -`Lp@P7PS (7s (U@XYl2 ,P@ <3Pq l2 ,'R:0!  2R 0000l–0 \l2@ ,'R : 2RZ l–0@ \Xl2p ,l–p @88\7pS @TV @P7PS (p sU@ǖ'\7RS\ R S7SL S? SQ 7SH SI S T|'1R R7S SBl– 0\00 S1@D0!0?BCcl2 ,@D -tl– H0\= 7 4 pP'CMb -LM`0Pl2 h"0lB `2t" $0(,8"'΅Q0("74' 0 0P h0lB̅ 0PS 7S lB<0 00P xl2 l•pt"0t2447S 3/@Pl2p $l•p0p xX0 (0pP"  NxXP 0 %h hdFl•0 4x(vXrr ?hBBO0BP@BBB Q-P4`pL8 \0 R @@D0 T0   0T贀 0p-LMP4 @`0`0 0P <<ph(p@ (0 plpkBTA(00 -LPp@@00 4,0 4@ <\LT0040 ,040 `%0@0\06`V00A@@4 ,04 0\ hrB 00-LM4@P0@ P XX0h H004 $   0P0hlBTA'LBhr/000  / 0p-@`L P`@p@.?0@- @$T P@  @ 00 0 00bS/- 0$ 400`S -L  $B (0  -L000p P-L7B p-@LMP\0U` U U p1  p0 s03R0S0LāS????X? MP pP) @P <1Q Q 0RS 0R S 崈 0 0  0 0 x@0@0 P0 c0\ 0L  08  oTATAXBB0BBBBBB$B B -LM80,Q$ 0 Q@PpphA ? 20 @ 5 2 x. p+ h( 20,X# L 20,TBLBBBBBABBBBhBTB00H@ R  t0sPUuL  R  pPm  `Pe  020 a0p 0 P P PQP JP\s0@,0  Y0 040  8 0<0 P 0  8<040P  0@,H, P`0@D00P ` 4  p0@ P#D p<P80` !(< 0@p#L4P` P`  `@0s H K P`P`(KY0P`0P`GP`AP`; NiA -L M0S` Rp0@ 0SZ" R <00SN >0!0Q\ 0(PP6 04SP0Z00; 0>S< P:<00S8  R00 0S 0 48 000S# 0 8<04@(K  0P PP"P0 SP R00 0S 0  4800 R 0 480@iA N -LPp`N@P P 00$0 0"U0P  0 P -LpP`*@P P 0000 P`2 %%%Ġ_0 P0pP -LM*Q# QC @Q Q0 8<04@  0(, $  Q (Q Q |0 8<04@ 040$K0 480 @ P``0S<0Q 0@,0 (@  0@,H`,0KPp0@PD0`p0@ L #D <P`0@(!(D#Lp4  0  8<040tB -L0@S`MsPP `H ^00 R00 A ` 00  0#40   0 0`P>00;00`0 P`80:0 0p0 p00( R00 R 0)P e0 0 00 000000C2Cp P 0 0  `P 免` -L0PSpG 0SpC`P p>  200 P700;00p0 PpQ0:0 00 @ @[@B Z (0S>?>?>?>?x>?>?>?0[0 R 07P  %P p 0 00[0$ 00b $0[ | Y 0(}0[0 Y 0(}0[00[0 凌pPp!C 0-Lh\P T1\ L1\0@!Q*. 1\( 1\" 1\( :1\ 00@T  04/02 <008 00  0 000h50h02d 022 022@020202QQQ`hA!C Q@/ 0-L P@| 0\ 0| 0\004P/P 0S0S/P/4004/4 R040/ 0S00 /R@-@ R R R R R\000QA S S S S SL\00\ R*R Q 00\  R\R R R 0Bs0_S Ĕ\00 "#0  0@801000  0  0  @000/00Cs0S0/ -rPLppq `;P@ 0@p0P ⚵ -LM A 0` 'pP 0pp(K  0P pP  \0 ,0 D @]L Y U,0s 0xᮙk -LMsA 0` pP V %(K0 $PY 0 pP8@0dS,K 6)[ 0b S @/+0[0@ QY,[ 4 00 < 8 YUYp00P P Py408 AQ<02xX pk p-LMPx@Tp $>0 0Q`# 0$ bP 0ă \ #\ @ 0S@ S Q PT  $phUP iAk -LMR pO , 4 P`,  VP- 0`S0S{8 4{P {4 +{P{0 0  "{84 000 P0R ,P ,(K Q-L @!C -LMp< =0@P,0  8`P \\ß ^PKD `K=@KL \  0`@2 t "20 x@T ] 0SZ 0CS1L?K?L?J?P20  P XwxL?L?L?L?8L?@L?HL?PL?XL?`L?0L?0L?0L?hL?pL?0L?0L?0L?0L?0L?0L?0L?0L?0L?0L?0L?0L?0L?0L?0L?0L?L?x 03 0SP U0S sx 0P@S QQ 0As0_S3|cx P@0S0, 0RF(K>0@!@0P0;,90SPDx P@0S;x 7x 3x /x ĠFD꼠B긠@괠>갠<ꬠ:ꨠ8ꤠ6ꠠ4꜠2꘠0ꔠ.0pX"CLBh"C"C"C"C"C"C"CprB"CiA"CP!C|!CB"C"C"CAB!C!C!C!C!C!C"C"C!C!C!C!C0"CiA Q-L@ |pB -LMp`PP% ᴕ@P 0  P4|  (0|P庀`000 0S 3/P Va (K0S 2V02 : "PP 3 < : y:Z V2 z000 Q 1/<0 @R xRy R  `v`308` PP0S2  xQ xP Q R 0S ! 0,K >0|"0Q^C 202202 202,04PKS!2 022 003S2Ա02ı0 4@ `PX 80S 2 7>1 -T 1b2   㽖X1 -@^`Rs0So$ ۔P 1!W2:2C2<2 P 0S:^P 000  뼀 :xxP9 Y70 RfxPa< : xP Y@?kjAiA@?8M??H?lA0@-@QP0 2T?\0S 0R00@ -QLp`@0P02^-?\0S' 0R$@P! 2`,`P2 00 0S 3/xP ` -PQL`0p$2U!2S 0S @ I 0@P P00P00S 0S  -L0Pp2S``@ "@P00P00S`R -L MP`0pPP  P 2 L 0S@ 0S 8@P(K>0 !0QUP 0 0P)0 8<041S,0  p @,0@S 0pS Z    iAk' p-L0P`2S@2@Sp -L@YP40S  0 A"C#C 0-L@xP T,P T0[00 -0LP 0pS` `@ 000@ P`R -L3PpS` `@ 3@P`S0@-qr@P\^  0@00@0@0 0p-LM` Q08`000 2S020 23 0S0 003S0 @00H040ph?0(P0\k$#CkBD#C4#C//- 202 0p0Cs0S0S 0@ <0= ($R 0A0 0 -L`Pp@P P 0000P0V0B0 P00%$P00@00p QPK 0-Lq@P P }>0?P90 0-PL_@P P  00}.A0 P0'P!0 -LpP`E@P P P 00  00G0P0p`0000P N -Lp#`P @  0L 0'̠''D;0(T @0pP@@  p-L`P@P P  0, 0f0C P0`Pp@  -Lp@` ^PP p @P p  0 0_0C p P0  0 0#40pW 4 0$ R pu0u -L@` &PP p# @P p" 0 00 0R0 P0  0 0#40fp`W 0 $ BQ pu0u -Lp@` PP p k@P p  0| 0_0C p P0  03 0 "$ )p#W +^u0u -L@` PP p# 6@P p 0 0l0 0R0 P0  0 0#40  pW00  Q0u -@Lp P @1 PP @( h$00 0` S#\a?a?8b?b?b?a?a?lc?d?td?d?(e?[ 0  00 ;0@T0#30@@\0 @00 30 0t0 @:0@T00 [0 0030 0 + z@tT t[0 0030 0 + b@\T t @\0 @00  30 0t0 @:0D@>T0000[00 0 ""Ġ" 030 0 + $@Tr0 3 0,à 0#200Stb[0 0030 0 + @T000L[00 \0#? 0@> [0 00 ;0@T.0#30 !  000  00\00    0 :0@ 0u -L@PT V`P e @P \ T0 0t1 0R0 `0  0 0#40  XDP@hps0T00 T"" 0T00 T"" 0T00 T""  0T200 T  0T#20 T0T TT(, $ 0T T T T8<040 T0TTT(, $ 0T@T3 0PT0u0Stg?xg?|g?g?g?/r -Lp P`V@P P l 00 P `^s WC00000&4 0`P  p-ML@`0 PPP0\3 : c 0PKp -L M`S@P VP K z pPP% T%J 0S0a0a010 P0 Br R@0Cs R@J 0 P@P P0EsPU ;@J 0p-P@k0@`2L  p 0 S:;;S `0S 0@0@p0cS -LMPp@`$@ P   $0K `@@@@P $Q 00  00   K -L MP $ p2L@1`P @+ (K $0K@@@ pP@P$ R@ 00$000$ 0S (0S T0 @j K0 c@ N -L,M@`,@ pPP @I ,KN 0@@@@ p@P7,\:  04 <  @8 0K@@ p@P, R" 00 0 <0,  08,0 0 40 ,0 0Q t 0 t@(K@(0 @ N -L M@`,@ pPP @( 0K ,0K@@@ p@P,0S@ ,0 ,  ,0  0 R T0 %@(K0 @ N -`LepPvq d0( 008,d 040" P T -r 00 @'r00 '7<u  @P0 0bQ 00  0  R10SN'88'#  4000i  q000&C0AWEVu?@&C 0-PLD0h#88#!@P00 <( 40bS<0 000h,k -ML0倐Wh]0"040 @p m 0hJ(P@V>,kk 8 8-#DL$`PP0@ +0p |@T .20" "2  d  2<2,k Q- L Q 0 @00K0S A  8 8-#DLMP$]`P 0@ p0 qpP@0T X,@ @@S 2Tp 0, 9pP202Q N2T-0. 2&Pp W T .2 02 .pP2T02 P 2p02 .vp0 U,k 0-@PLm#m000x? 0p-@`` (0,R00Ɓ0L0LP=m2  0\ 0Q000L@4  (0X00ph]Y?iABs?P#? ,-LMK0  K mA -L Ƞ Ƞ M,dP@, &pP 0@ @$K 9T ,9Tz K0CT 0CT 9T 0S@; 9T '|9T Xd9T :c Q<@72T 0T-  0@' 0 @p20S @ 0P@P @ $2T 1T .@ 0@1T 1T@ @ 0@P/0S 0"  04"40  BR !{@8 0~@00 0SJ!0  00002  <4!4"<0^!LZ,kc@c Q Q@c ccedA c@qdQ ccc cmhdpd dc c c cQ`dc c k~rdA (,0(-"!0202Tk 0 R 0S S00" #042/- 022 0p0Cs0S0S0@ <0= ($R 0A0 0` 0-LM@d0K0  0S0d0Khk ,-LMK0  KmA -L M`P pF 0 (0K 8pP4(PU7  00480 04H0,0K Č< ČL Č@ ČPČD@ Tpppp,0Sp W 7$Kp0Xk\k,0  0X0 P\ 0 202 -L0p`P @ 0PS 00h 0C 0J0C p00)*Ġ''D0@ p0@}蠆 -P0LSpP)1 H00CXP!08`@P P  00 \0 ) 0 40q0!$#40 0000MPG蠆 -L M @RbQ_P\1P040 H04`0CVU1 0 H00C^M10,0 H0,`0CVD \0S1=  \0S08 088`8P:P @, 40,0p  00 0 \ B0 4@q|~$4!$,T.d@0 P` 0 00 00 00 0@ (K@@꠆ -LMp @RAQ>1, H00CP91 H00CY2 X0S1* 088`P @ ,0P 00 0 ] B0 4q|.4,D!$@0 0 00 0@@@꠆ -LM0@1PH R(K  {8 `0P08p <0  V 8<0S /0  Ă0 H 00080 88H `0P0<0 0 HY<  3 " 4  2Y< P@, @0 X PP@ ,0p00  *04 <x@- h@X.\@ @1\ 81\   $1\& 1\% 1\ 1C\3 0  0@H00CQ80040 0\ 0\ 0\@?@D8 400b0H  L00P T00@@f8 400b0TkFc@Hc Dc@Cc EcAcBc 8-LM8 #P30AT/ 0 2 K020-PH0 0 L|0 P  T00 RP  K H0R\80400 202Tkk <0-P00 00(  ,L @q0hꈎB?@-Q0 0""D0@ 0p@-Q0""H"T *(,d @P` pA-Q0#l#x# 0""H"T 0@P `p0G-,MQL.#L$@( #H#@@. 0@@ "$"h"DLh# `@ #x#T0. 0 @0 @0,ЍR\ \ 0Ls0_S BR00/ 0-PL2 0@P0 5000 +0C0 P0 000h꠆0 / -LM@P <0 Rs 88 #1)"Re0!R8 ` `( ПP@ Z ?K0 20 , YQp4 900 B ğ@4 0@`P0@P`/ R.+ Y#80s`P+ ,0@ 0ʌP P@@<@ P 0@,@&T 04 0(KQ ok' p-LM@`  PP @  0`@dp p-LMP  `@@P P @ 0PPP @Ip 04<S-P0 8<04 1 0(, $! -LMP  aP=  0@P`P 0tZ   JP& 0 @P`P  0S`W S Q 0 SQP-` ` 0-L@PP0rP00hR - LM0  ,0 LP * ~pP  0\ 0\P00hP01S01S00hiA 0-L0MP<0 ,0 00 40 80 pPE0EP Pp`' @@K P 80K @@@PpP @0S 0S 202" ` 0SYPp` @ 0 0S<0S< 0 S  S  S (KP000P Pp` S  S  SR0@#P 43 00 0ğP0@00W00U ? V0 `0S<00S S^ 20"S b@~ 0#@w Q@p 0 P@i @d%$ 40H -@krdAud@pd Q Q@qdQ`vdhdtd@AedAmk~gdd? -ML0噁̣?d? )-ML0匁̣?d? -L (0`lp,@ S ?8?0?0???8?0?0?Ԯ? 0SK0C 040<S04000@;000 $)a0Q@a0hkp04 0 00Cs 0 h<00 $)a0^R0F00h轸040<$0@0EP4<$0@0Up0 0k -LM8 , 4 0@P_82^ 4  , ^P0 R 04D0 0(20< i@$P0p00<< 0L g820 0 YF 0@Q _  0 U0&!:0 0H001< p0 ,l40_4 0 00 4 0001 (K (Ko4G_ !;0 0H000< p0 ,l4088 2 0@Q  R0S0  U,/^P 40(KoQ R 8#8 S  0 c0  H`ȭ? -`LD0#88#!pP 0@ 04000< ;00@ P@K/Wh002004040p {^h(P@%/kk 8 8-#DL$`PP0@ 0p K@T0 !22 022  FW7}ؼ  2<2..k A-L@Q H??0???0  0 \0   H 8 0@00p 8 8-L#TM@p% `P 0@ }p 2 t p0 pP P0U Z,P PPS 2Up , 0pQ0"22 02 J0" U-.>202.pP U2"02P 2p02.<.80 mPk 8 8 -#TLM%Pp 0@ p  P0" 0" p\  * 0P 20 R(PpT00` @u(  0 *, 6,Pk 0-@PLd],Q t]0l0x?ȥk 2-LM``t2p"0 Sp2`^<24(,pS2֡92ơ  0("0Q000N "( FL0" ^ 2V P@I 2AT7aAO0 0^0`0 `0@=<L(@K>] ^ P(0S1  0ᷗP% 0c KT c@ B @ 7 d[@TV0 @(0 kT?iABx?P#?&Cud@ȥkܕ?&C&C$'Cvd ,-LMK0  KmA-D0"  \00S<<<08080Q000 R-Lp`P@9 %:RJ V D@P   &&Ġ00`p! 0C 000000C=X: 0h0d00 ' Q'>00J <`000000  Q 000 ³0 `F ?0 4<`0000@@000  000000W *hq 0Sh00h0Wl0s d0hd r 00hl0 d Sl  vP0 -@0L ^`Pp |0^ ^0000 P00V00Sa0 hG00 -LMPp K0`@P00'>00DPP @ D0DW 0 p0@Th@d@0u 0-QLMp@l0`d0h0  K0PP40D@P P 0L 00 p0ZPTWP P 0-PLDp@P P U0 0 4 4 0C000  1P+0  -`D@Lp2`(PP `" C@P ` p0 00  P0 `V  04H0 0$( L _0u -`RLpP D@P P P00 0C 00 `00 &8&$`0 P0008Q9 8 0  0-@LtPPZ0p00 s0 00x  R| 0000 -L0M`@,` DP<pP ` $K8K(K0K @ ,0K @`P  K00S0022002280K($ T0X@` \202 0-L(MP,0 D@pPY PQ 40 @J2l8K ~Z00< 8 K 8010K#(#43 K20K 0K ,0K```T@P,Q 00S> 0 0b@C ና0`V 000  000 0{D 0 k@c @(K00#400 @ 000 @0[LD 0 @0 4 $0b@C G0u -L@(PPp+ kpP P% ; 80 R 00`000Q 0 PP PP V 8 V R`00000 0-PLD0@#88#!P@P0D 000hZk -ML0Zy?? )-ML0My?? -L (0`lp,@ S??,?,????,?,?? 0S0C 000<; 4 00@P@*(h4Lp0 0 00Cs 0 hV!00:00h茰040$ @ rP4$0@0k -`LD0T#88#!ɵpP 00  04000< ;00@ Q@'Whõ<P  8@>P#Wh豵H PL0S Pl040@LP@'L0 040kk'C'C -LM00@ hp`dDP  K@0V -W00;00" "@ -~W @  -L Ƞ ȠM,@.`p7PP@ 0  @38T<( m; S Q Q Q K 0<0 0PUO W \P\ 0l@L00Tq@ ;P ; S 0 @0Es0 U:S00P 2UP 30Es0S0EsP8UP 00Q10sPQ0 *@K kQ ;q0 9c0 0]0 0W0 0Q0 0K0 0E0 0?0 @090 030 <-  0pE p@0Sc00 RLPjYD0WB ;l:0Q? 0Q3>  0p-LM R3 00S 0S, @P`0S0C00 00 ,Ar oR: S>+  R0S0C00K K 4 0 Kpoopkoo Ƞ00 Ƞ-,1XP ,k -LD M\`@ %(4\ :40S P 4\# 43\i B3\ 3\ 0d 0 0`P K3\ 3\ 3\ t3\@< S0< S< 0S@\RP43\= 3\ 0\s 3\0SJP2\ 0\x 2\2\ 2\M 2\p0P       00  0P0 0 t   x  | 0 00 d00`P!0p }k ^PPB Bmq0P0m 0R 1  _P`sPP8Z0P     00 M   0P0  Bd0p 0psPP{ 2  嗈\ \0(K $@ 0(0 6PP3 W W WW @W W@WWW@ W @dkW WWTk -LM\ 0\ 0\ XP* 0 P0\ 0pXQ 00S00XP 0 r 04 Q}f~fvt|f 0-LM@00CS0P0Ꮪ0@- @.@,k Q-L X*C 0-L Ƞ Ƞ,A0SX0SD0400p00CS0W,kd*C (L0 (-"LX@T 00X,k (-(L" PP0AT PP0SP X`VP 4p0H0PP X`~P,k -LX@pT` \+ 0 ! PaU 2p`P0S 0S0 h胅 4h00ڙ0Sh*C|*CD -L0S , 00000 0.oo A*C*C -LLp`P0S 8@ :0P0` 0oo A*C*C -Ll0PS t!0S00SX@T( 0S% Hq00CS0`000 R00I0S00S'0 3 1C7P0Q!ڰ 0 S00 S P0 =h0 00;,,, ,0okC +CHkk?(+C A*C:+C -p0Ll0 `R$1\0/ \0 ` \` 0 d0 0 Bh 0 EP(\0P p@000S 0 R 0S`)|h& $i\00 \qD@@@ @0I,,i/00DoTkdkoo|+CBH+C A*C*C\+C0Q` 0c/p ; S/P/ 00S/pA -L@Q @@@$@@000000<00000000p00s00p000000 <-@00000 L pW`V0S \ P0 UD*\? ό@9 0B~S41 0< R 0@0 4p p<` 8pK00L@K80080S @ l K~@P0kUUUUU@@@x@ 0-L@P:0h  0-P00L="0 80S @0S 4 0 8L\ 0CQ 0dP @0 0d20 0 @nlkoo -L`pP@T! @T- R00000      GP 00S0=@Td_ P0  koDr,C -LaqP@T! @T- Q00000 0 00 0P 00S0@T_ P, @T0  嫐koXrPr,C H-L< <0_P, ,,0 _P X"@k,Ckx#@-C-C,C -LM|rP`Vh 0d000DR0 }?3H2`BT40 0=2$KTK p`0S0 <20<20 @20@20@1\PX0`pd`00 _d0d2SO 4 0@`P=@T0SO 008 R 0 @0 <20C<200="Rh↓00`"R!000 008$KmTa0 @0 @```?^ e00=r0S \00=r00T 800T=r$KmLkL-Ck`-CB\kX@Lr 0R0P@ p} 02K*K2K1PK0PK/PK.PK-PK,pK+PKp pPP*0[  D01K p2pK0K/K.K-K,K+K01C -LM@0K p-LM@0SP Kp `PPV e\PTP0 0K K0C0KK KPKPKK0KP\1C p-LM@00`P0  K 0KPKPK0  KPKKPKPKKp p-L 0@Sp,` P  3 1C0 0SpC1C qp-LM`0@rP^ 0S 0S 0 S 0S P Kp  0SK0(P 0R 0 0 0  @00 q-LMpr` 0K P@P KPP`   0` @ 0 $P 0( 00P` $@ 0(@ @ q-LMr ~ՉԉӉ<0 -L( @ 3 1CP hC1C1C -LMrP0  @P`pP(  ($KUx 0hPU '(K 0 (P (<@k -LMrP0  @P`ptP(  ($KUx 0$PU (K 0 (P (<@k 0-LM@ 0K0KK0K@K@K@K@K@KYK p-L@BdM ~0AT 0KK0 K0KKPK`KK@K@Kp #0-L@MpBTAd $K$0K#K!PK`K"K pK@K@K(K #0-L@MpBTAd $K$0K#K!PK`K"K pK@K@KK 00-L@MAT K0KKPKK@K@K@K@KK0 00-L@MAT K0KKPKK@K@K@K@KK0 \0-LM@A0KKa0K0KKKKK@KK 0-LM@A K0KKK@KKKKKK  -LM@_0K0KK@K@K@K@K@K@KK  -LM@0K0KK@K@K@K@K@K@KK 0-LM@ KKCTK KK@KPK@K0K}K0 0-LM@ @P0S -L Mp`@PP   K !0' K(0K&`K%pK (K$K#K"K!KLK -L Mp`@PP  (K^0 00K/ K.`K-pKJ_0 (0K,K+0K)K*K)$K -L Mp`@PP  (Kp!0 00K/ K.`K-pKJ!0C (0K,K+0K)K*K$K p-L MP@`P  KPE !0# K!K$0K"PK $K KKKKKp p-L M`@ePP  K0@ ^0# K$0K"@K!@K  K$K@KK@KKp 0-LM@FPP0KI  04R:Q0 Q05:0!S0 S0 -LM@P$K`pP@ P @ 0 mWP@ 0 $!@P,Y00 -L Mp`@PP  (K!0 00K/ K.`K-pKJ!0C (0K,K+0K)K*K$K 0-@LHP<0S(0 (0,0$ @,0000kkk  0-L$0S 0h0HP@  ,0S0 0 0@ 0kk 0-LM@P(\0   00XeS\0I 0\0 R0X0R \0 S08 40 L0   T 0P 外@P \\e QPX| \X0 AX\!m` d0XgUe@Ta @PeSU ! 01 R011 01XQY QP@S G 30+1X P@0Q0U0SU2G? P0U0T R 1\\ T 0\0 0S  04 \\T 01[O2 H0KhP!  -LCMXJOKP@D`K p0,P 0  !@T`3W p@ = p<0d FR3@;0E:PD`d T d9E3 @d">3x Pe+73 @d03 0@ `, 0R(Ktp3C3C3C4C4CqA  -LPp (N;` W $@TO /Qq \'q L"W O,q@A 4C44C4CA0@- @ 0 XPX ăP \0S $0R Q0 0(rAXvAR R/0@4W -L00T`V+ 444O pW0P0@0 RP 0W@P fpO8P fkO0P ffOfcO0 0T0 Q-L00T X Zp`000 PU XP P @X0@PpZ` -LMpT 4 000 >P 50 @0S0 0S ,4  0S'`T 00@C P uP0 DPZ P T0S 4 ` 0S(K 0S 0;   M K nP> 5P 04  0 00 0 `PP6 T0S  !0S00 0  ,  0S00, x0 l ޵00 Pص00 <ҵ~00 (̵ L5Cp5C5C5C(5C5C -LLMt`0,0 P 0P,P< 0S?_0`KTpK`0K_K0 ]0KZKYK^K\K[KR@[P00T00SdPT00TT↵8P f4NX 0P f-Nf*N0T0, 0RR(K 8j4f JLP f@ CL P0\ 2TH0S 00S 0SBX KPXspP< 00S X/0B 0Q1 0CĠ YKZ0K<Bf< KP8 <X 40 `P w fMo_00>0S Sf KP_ T?p00  P0S}?d0 00  00>0S0 S1 C00 ^pT p 0pT  qP v 0l宴0 R 0@0.T 00p46C6Cn@P6C6C6CvA@m@6C6C7C -@L 0S 0 S $P/Q0/H p-@R4  3" 0,0 1, R00 D0  P  00S S@ A<P fH0<0,0Ȑ0S,0 0C40p @TpW@k7C0  -L0Mß  2Q~0QUz 3 RvD 4Q]P040Y 3" 1 <  D00` 0S]  <D 0 V 0SS 1"0<0X00 = D0p `L 00S2H@X@@`@XA  0D9 f |F8 <8p< dŸ@0@ @1P <f2H8(K0 XPXȐD0401L0X  0<P 0$, ,0!@ C@b@fA )F 0@<@HD@P.`0 Pp0@P4 - T, 00r!2 \0P  0P4 X@L@'040 0 `R<fG00 0PP00U"Q1Q0PP0R@PJPU@DZ ukH}@d|@ -LM@0`50 SQ hP 0S P1 R  @@ͮ$K  P %K @PDp, *%0[S4%0[S.0P x, KP,&KP&0[S,@Pu&[,@P^0 3à"10 0 0`I7CvA -L P@ @$K3"  D   0PL0 0 @L00a 0, KyPP @4R. R4R 4R0 @P WbF@W 3"  D  0S P @ 0 000@ 0 0 0c@P 0s p PF@0 @p'p @3R1 3R$ 3R0 5@P 0s p  0P  aVF@app 00K0gP @O0  R Rh 2Re  Zb*Z pP 0@80 0PP0 L@ 0 8K <0 TP X @ 4 H Dp ID@0SPq XA10 @Pp0Z Q @0Sb Uy E@0%KP%0[@000 KPP 00@^ࠁ80K0 X0 0P0 L@ 08 X KT @p <0 4 H Dp a@E0 PP  PE@0, KZP,P 0@0 [@E X KapPX KapHrU~fqUhU pUAdU@iU@fU eUkUmU jUoUnUlU p- LMx @.hPA`   0 0 :00CS0`KpkD 0-L@P0@wP Ä0 (@P0 X␬P0  080Q P ‬0  0I88CH 8C0D0 0$0(0,0004080<0@0/@-`pPW@U#(\0 0!`! T 0' B># g!R p-P`L@ &C@d0Pp -L` p$RP |R60h t44P0S* QG \!1  @0!\ |@t@$@@Ԙ@  P0S: 048T **0NS;꼚@@t@H@@ 0T ^񟗾T@`@h@p@x@@@ě@̛@ܛ@@@0 ā0 @T ɫP ^;ؚ@$@\@@@@Ě@@@@@嶫PX0 0C\ X0d _0t4 4S 0t4x4%PtX0 0X0\ Te _0t4 八P[\0  \8 #8t$,R10 tt$H\0 x40 \8 #80:\0  \8 #84.D,<*@(8&L$P"H d0(l0h h!Bh @_Pp@ p@lPh _lPCPl&P8 0 $@\0`/ h x4$S 0|4h 04Q t$R10 tt$P0x4t4 0CQ01|$10t , h :_l0d 0 l0d 0,0h ,_hdl0d@<"tDl xDXh8C8Cx8C8C8C 0-PpLP d@tCTp@0hmC -LhMr `ePPpK m@P <0S SXp0 S$KD0SlW@P -LhMp t s5`KP@@P @0S<p0St0 SZ80K 0SZ @(K -LhMp sPp`K@P p0S<0SW,4 00*Pkg0P$K,pW (8C -L 0q 0Q 00 00s00 0\00`/ -LM L0S $@T0K@K8C -LM@04 400 Q-L@ ٩Q ԩ8C8C -LlMp4`\P  @ cSK `廩 K ^4@K00 40@7 0RK~p9CwA -LM4 `pR004pcPP n@40 @0]004 40PNP,B 1-QLMP d1Q& 1CQ KD1Q400Q* Q< Q@0 0 & 0$K KD 0$ S;#0  0 ]Q Q Q@0 0  D0 0  0P D0 0 4@ 0p@T@0 7T` VH0 0 H0 0  e]UDUU@ 0-L500@0050l PBUlP0PP TP LP TLoLP8P M8h8PDP0fADP0 -LM`500P@050l  Rl  @KHP f?40@ @ DPH80@ j@P@0_P< @ Xq  q4L0P@ 0NPP 0IPTL @8DfJA50p050PlpP8pLp @PpTP ;Tpئ@ 0-LM@P0K  T Td0DS Q020C0 !1*h0\ 50K08  < Q$9C -P8LP \P f@d\ p p`@h0!R h 01dp@\` Qp-L@ `pdQ `P h0!R P00-P00S`dd QPp 0p-LhM d0 @`KPd0T@P$Kp -LBM` P0004Pb pj @ X 0S@00SX 0@StP   00S@ 0@S@0s 2R| (K$ Kf0( Po($\`< @PaP0T 囧T@2T<"< ᒧ@,叧f p>Phz 0Td@H0qCKp Hw0($ PpH0PHWH0PT0H08` 1<K!4P h0P <0!S8  PW u@0 $(0 P$(P0$ (P ? K:60S S Sm0@$0 x$f >P( $ r[v p0  `@0$0 0T0H0@ j9CLB\-C9CBL@`@@9Ch9C9Cpk9Ckk9C -L @P sP 0S 0 PP/Q/ p-@ 0@S<0S=QX0S S 004 D0PS4< @0xPLX0Sx 0`@01`P? V@X 0BS5P2 X R[ .:R,1T0Y 0BS;P@@@P@@@t!p!}l!{h!y@!w0Y0Q0Y0M0Y0I0Y0EPEimi>X@Y@\@`@4`PY0X0P)=,iTi%>0S}=y`0T04> H0P =C=CB=C>C$>CؓA"C >C>C >C>C@9CX>C<>C̓A -@L01 04JS00X0ĵX0ĥ -L@4k0S0 0$ R 0R  R0Y00Y0 ?00-L M8P0ED0KKB0 KK@K0KKKKPKK04 p0-LMq3 gA p-@L0`0S00PPpk 0-PL@000kS010(0RR00(0(00 (0S P( P0(0 0(0 -LM@Q` $pSJH@|@@@2 %㼠 00 " 0>00 01 0@0 T0%(KQ( 0 R* 0Q'0(00 (0S P( P0(0 (Ko蹈`0(00(Ko00 0 !0(00(0@>C<0S8<0ů0 -LMP@4`0S3 pW00 0i0 0 ! T@  0 P0(KoN0+ R  RW\崕0(0(KoTT@$ 0AP(K4@>C p-L!M`4P00 R  0RKp0 "K@K;Q PK 1QK1@K L4 30 xjp>CxA p- PLC,T T0@`ᾎ0201"(08P40`) "`p4@@k p-LM`PK 2@!<202 N00004  p00CS0p pH? p-LM`0PK22 @< ; 2#00004  p00CS0ppH? 0-L @P ; 41P 0᫹@ -@3LS## 0uP P v7 -@3LS## 0ZP gP [7 -L(M< 8 Pp0_4 4 P9@ U UU(K/PiUn <0$< 08 V8H8 ,0KP,9H00)#@ , B, *4 \ j1:, fpP, 0P`0@0@40 0'  H  PxP M@ 4dx0,\ \ 0K0 0@0@ T@k>C -@L.D30CSD3h D30D3. Q-L0 -LM 0S0 P 頙A -@PL0P0h 0-L@Ph$30 # 0 0-LP3S CT ck0@T0hh @0p-L M !DP_`$K0 K$0K<0C@K#K0KK"K!K PK@P  嗓Kp?C 0-@L 0(, B$PP00 A$0h 10-LM@0  6P:)<3 <Ä <9s  7<37<3 C <#K0h2S:P<3 PP a0K U 010K0A ?0-L M!DP^`p0(K(0K KD0#@K'K"0K!K&K%K$PK@P   00KD?C 4p0-LM@P  KPP1  ((    ;PP0 0 0?Cp?C p  4p00 p-LM`p9@p 3$0 S$2 p , KP%$60 <#0,@@ &<#00000 0  GP ,@@ p d囒p T喒p$30S S $<#@0&%00 <#@C?C -@PL0?P_Hp`g4 >*ek -LMp`P@$K$0 AOdT  @ P   p-LM @ PP @L1D -p  q  PPPU @(0.PP `K PP @ @0: 0 C8 ?l*; `P7 1 - -`P01$ 0 !G , /`P#,<30 <3 <# <#@d ᮑPz@L ᧑Ps@4 ᠑Pl@@CACx@C@C@C0AC8AChAC -LM`P 0P2@T3Xc\C`C*2tcp3xC|C/P tr$K800 R;J<440PS@Y0P 4`.N4pd 2"91!1 0!43 B B, KPM __@ 91!(31,# 03#|!|1se 0f#R>  fYZUa> (a00S#0@St8@P   0P# P# A( KP,0(2#̠#!$#4"2"0e"e@ACAACk AA BC ApAh@@@d@AC -L@0PMhw 0-@L9PX=9>bP P;"P@SP P?PD03P PB P03P W03P 703P K03P0+0305 n/ hP & p_  \YP  <P (JP BCBC[akBC -LM@laP`Q=7P& T7P) 8 ?P  K8 9>pP  3`/ p9>@0;9akTCCtCCCC8CCT@ -PLd@`pL1T' 0CT0  04^@4T 0T 0T0/b@4T5@ @ @ @50@5 0 R4=@@ @=:@ki 5i 6i( -L4S@Up`PE P F%# E0E Ph7h3CCCC 0p-LM@0 P`$E P |[p%#EaE PF K[p F KCCCCOpenBSD5.4RAMDISK#0 @(#)OpenBSD 5.4 (RAMDISK) #0: Tue Jul 30 11:47:32 EDT 2013 OpenBSD 5.4 (RAMDISK) #0: Tue Jul 30 11:47:32 EDT 2013 root@build.eutonian.com:/usr/src/sys/arch/beagle/compile/RAMDISK comstartehci_root_ctrl_starthotplugclosehotplugreadhotplug_device_detachhotplug_device_attachdb_fncalldb_commanddb_print_cmddb_examine 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-|db_show_regsdb_printsymdb_write_cmdextract_entropyarc4_initrandomread n;AvXaM ְdx coredump_note_elf32coredump_notes_elf32coredump_elf32elf32_load_fileCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2013 OpenBSD. All rights reserved. http://www.OpenBSD.org )1(1)1%1&1(&1D)1(18&1T&1x&1&1(1(1'1`(1(1(1l\1\\1?? $$ABAAAAAsched_chooseprocremrunqueuesetrunqueuesched_idlecoredump_tradcoredumpsysctl_diskinitkern_sysctlsleep_finishsysctl_tc_choicesysctl_tc_hardwareresetprioritysetrunnablemi_switchupdatepriconfig_detachdisk_mapfindblkmajordk_mountrootsetrootdisk_attach_callbackextent_print1extent_freeextent_alloc_subregionextent_alloc_regionextent_destroyextent_createextent_registerdb_show_all_poolspool_do_putkprintflogpriassertwaitokttwrite@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ttyunblockttypendttnreadsoabortsofreesbwaitsonewconnbiodonebuf_undirtybuf_dirtybuf_putbremfreebuf_free_pagesbuf_alloc_pagesbuf_unmapbuf_dealloc_membuf_releasebuf_mapbuf_acquire_nomapbuf_acquirecache_lookupvprintreassignbufbuf_replacevnodebrelvpbgetvpvwakeupvwaitforioAAAAAAA A(Asys_fhstatfssys_fhstatsys_fhopensys_getfhsys_mount  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????msdosfs_lookupUmsdosfs_mount,5T5|5 5O35H5O35\5T5O35msdosfs_createmsdosfs_mkdirmsdosfs_renamemsdosfs_readdirbpfwriteifpromiscifnewlladdrif_getgroupmembersif_getgroupifconfif_clone_listif_group_egress_buildif_downallifioctlif_upif_downif_startn; &C vkkMPG&"֊/aK+d 5ӆ1 [#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@ffs_mount9|W9d9W9hW9p9| 9< 99999tX9 ufs_makeinodeufs_mkdirufs_linkufs_renamet9P9Bp9P9T9@9X9BP909B`9 9B(999 9Bd989D999$B9P90Buaddr_pivot_removeuaddr_pivot_insertuaddr_bestfit_removeuaddr_bestfit_insertkkkPkPkPkkquvm_map_printitvmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVEENCRYPTPMAP0PMAP1PMAP2PMAP3uvm_unmap_removeuvm_mapent_freeuvm_mapent_allocuvm_map\uvm_aio_aiodoneuvm_aio_biodonesys_swapctlin6_pcbnotifyin6_pcbconnectin6_prefixlen2maskin6_prefixlen2maskin6_ifpprefixin6_delmultiin6_addmultiin6_ifloop_requestin6_update_ifain6_controlin6_lifaddr_ioctl0123456789abcdefin6_update_ifain6_ifdetachin6_nigroupget_last_resort_ifidin6_ifattach_loopbackin6_ifattach_linklocalin6_ifattachin6_selectsrcfrag6_inputicmp6_redirect_outputicmp6_mtudisc_updateicmp6_redirect_inputicmp6_notify_erroricmp6_reflecticmp6_rip6_inputni6_inputip6_nexthdrip6_savecontrolip6_setmoptionsip6_getpcboptip6_ctloutputip6_outputnd6_lookupnd6_ioctlnd6_freend6_rtrequestnd6_na_outputnd6_ns_outputnd6_ns_inputnd6_na_inputin6_ifaddnd6_prefix_onlinknd6_prefix_offlinkdefrouter_delreqdefrouter_addreqnd6_ra_inputnd6_rs_inputrip6_outputrip6_inputrip6_usrrequdp6_output>===I3j=j=I3rBܾArBܾArBܾArBA `A`A rB`ArBrB rBrBsB sBsB sBsB sB$sB sBp ,sB4sBp 08sB4sBp `@sB4sBp pHsB4sB@PsBLB`TsBLBP XsB4sBP \sB4sBP @`sB4sBP PhsB4sB psBtsB|sBtsBpsBsB|sBsBhsBB`sBBsBBsBBsBBsBB  lB0AlB0AsBsB@sBsBsBsB sBLB sBLB sBLB sBLB sBLB sBLB sBsB sBsB/sBAosBsB0/rBAp sBA LBsB tBsB @tBsB ` tBsB tBsB tBsB tBsB tBsB  tB$tB 0(tB$tB @,tB$tB `0tB$tB 4tBsB 8tB(>>cpsw_miscintrcpsw_mii_writeregprcm_v4_enablemoduleprcm_enablemoduleprcm_am335x_clkctrlprcm_v3_bitprcm_v3_setclockprcm_setclockBXBhB(pB B0Bp BBBB!B̝B؝BB"BBBB #B$B0BB BB$B0BDBXBlBB?BBBBBĨBبBBB@ BBB|B$B0B@BPBXBA`BBlB|BBBBBBBȩBةBBBCBBB BD(B4B@BHBCPB`BpBxBDBBBB$BBBЪBEتBB\BBlBBB(BF0BA>Asitara_cm_attachsitara_cm_padconf_set_internaldmtimer_intrdmtimer_attachomapuart_attachomusbtll_attachBBBBBBBBB B0B@BPB\BlBxBBBBBBB,BDBhBBBBBBB0BPBpBBBBBBB,B\BBBB(BTBBB B B XB B BB@BxBBBB,B\BBBB(BTBpBBBBBB>B>B>B>B?,B?XB?pB?B?B?B?B? B?(B? DB? TB? tB? B? B?B?B?B?B?$B?@$@c@c@eaQ@X@W@0@ w@Q2@U@4@F s%^^uhub_attachDv@q@dm@8/?9:;<=>?@ABC D E FG HIJK,L.MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.eh i jklmnopqrstuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    \@@@@@@8@@H@@5dd5(I*LCDEOMPJQNRK$@@@,@@t@|@t@@<@@@h@@@$@@(  v      W 1 Q `  @@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   @  L+ L (@L2 D   O  {@o  A umass_scsi_probe@A A@$$0$0$$$$$$$$$$$$$$ $phytargetlunconsolemuxconfigurationinterfacevendorproductreleasereportidloopbpfilterhotplug%s: probed fifo depth: %d bytes comcninit: mapping failed: unknown uart : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : st16c654, 64 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: console %s: can't establish soft interrupt%s: %d silo overflow%s, %d ibuf overflow%s comprmcomehci_freex: xfer=%p not busy, 0x%08x ehci_freex: !isdone ehci_ctrl_done: not a requestehci_device_clear_toggle: queue activeehci isoc xfer being freed, but with no itd chainehci_idone: ex=%p is done! ehci: isoc xfer suddenly has 0 bInterval, invalidehci_check_itd_intr: not valid itd ehci_check_itd_intr: itdend == 0 ehci_check_qh_intr: not valid sqtd ehci_check_qh_intr: lsqtd==0 ehci_abort_xfer: TIMEOUT while aborting ehciiawehciabehci_alloc_sqtd_chain: curlen=%u len=%u offs=0x%x lastpage=0x%x page=0x%x phys=0x%x ehci_alloc_std: curlen == 0ehci_alloc_sqtd_chain: i=%d ehci_device_intr_done: not done, ex=%p ehci_device_request: not done, exfer=%p ehci_open: bad device speed %d%s: Error opening low/full speed isoc endpoint. A low/full speed device is attached to a USB2 hub, and transaction translations are not yet supported. Reattach the device to the root hub instead. ehci: opening pipe with invalid bInterval ehci: zero length endpoint open request ehci_intr1: sc == NULL %s: unrecoverable error, controller halted %s: blocking intrs 0x%x %s: halt timeout %s: reset timeout ehci: isoc descriptor requested that spans the entire frametable, too many frames ehci_device_isoc_start: requestehci_device_isoc_start: not done, ex = %p ehci: unexpectedly ran out of isoc itds, isoc_startehci_device_intr_start: a requestehci_device_intr_start: not done, ex=%p ehci_device_bulk_start: a requestehci_device_bulk_start: not done, ex=%p ehci_device_ctrl_transfer: not a request EHCI root hub%s: port reset timeout ehcidiehci_sync_hc: tsleep() = %d ehci_abort_xfer: not in process contextehciawehci_allocx: xfer=%p not free, 0x%08x %s: disable schedules timeout %s: run timeout ehcidbehciRAM diskfictitiousrdattach: out of memoryrd%drdattach: device name too longhtplevhotplug: event lost, queue full Not set. All breakpoints used. Already set. Too many breakpoints. No breakpoints set Count Address %5d the kernel did not panic Bad function Too many arguments Argument missing ? %-12sNo such command Ambiguous Bad modifier Count missing ddb> procscalloutpoolsmountsvnodesbufsallbcstatsbreaksextentsmallocobjectpagepanicpoolregistersuvmexpwatchescrashdumphaltrebootpoweroffmachineprintexaminesearchwritedeletebreakdwatchwatchstepcontinueuntilmatchtracecallpsshowboothelphangmandmesg.strtab[ %s symbol table has bad start address %p ] ELFbad e_machine.symtab[ using %lu bytes of %s ELF symbol table ] bad magicsymtab unalignedsymtab corrupted[ %s ELF symbol table not valid: %s ] ELFAddress missing Value missing : %*lx%*ld%*lu%*lo\%03o= 0x%lx %-*s%-*lx%-*ld%-*lu%-*loSymbol not found Syntax error Divide by 0 Negative shift amount () Score: %lu/%lu ^R Bad character in number Bad escape String too long Bad character Faulted in traceback, aborting... Starting stack trace... End of stack trace. -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*lu--db_more-- %-12s%s %s+%s [after %6d] [%s:%d]invalid symbol table nameSifting table %s: Unable to find symbol table slot for %s.No slots left for %s symbol table%s%s %s bsd[ no symbol table formats found ] After %d instructions Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! Unknown variable No value radixmaxoffmaxwidthtabstopslineslogNo watchpoints set Address Size %8lx %lx All watchpoints used. Too many watchpoints. Unknown size %s = %s Nothing written. cnopen: recursive%s@%dOpenBSDcoredump: offset %lld != notestart %lldcoredump: offset %lld != secstart %lldcoredump: offset %lld != p_offset[%d] %lldexec: a VTEXT vnode has writecount != 0#!exec_script_makecmds: epp already has a fdexec_script: copyinstr couldn't fail/dev/fd/%dexec_process_vmcmds: RELATIVE no basevmcmdset_extend: not necessarydiagnostic ../../../../kern/exec_subr.cocnt > 0/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedscheduler/sbin/init/sbin/oinit/sbin/init.bakbqquiesbqqueuebqwaitbqdestbufq_init: type %i unknownbufq init failbqinitinitclocks: unable to register softclock intrfd_unused: fd_lastfile inconsistentfdrop: count (%ld) != 0closef: count (%ld) < 2fdlockfileplfdescpldup2: fdalloc../../../../kern/kern_event.ckn->kn_status & KN_QUEUED(kn->kn_status & KN_QUEUED) == 0kqreadkqueueplknoteplexecve: argp == NULLexecve: no vmcmdssys_execve: falloc indx != i../../../../kern/kern_exit.cTAILQ_EMPTY(&pr->ps_threads)waitinit died (signal %d, exit %d)thrdeathcpu_exit returnedprocessppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d ../../../../kern/kern_lock.c!((flags & (LK_SHARED|LK_EXCLUSIVE)) == (LK_SHARED|LK_EXCLUSIVE))!((flags & (LK_CANRECURSE|LK_RECURSEFAIL)) == (LK_CANRECURSE|LK_RECURSEFAIL))(flags & LK_RELEASE) || (flags & (LK_SHARED|LK_EXCLUSIVE|LK_DRAIN))flags == 0No KMEMSTATS compiled in ../../../../kern/kern_malloc.cflags & (M_WAITOK | M_NOWAIT)malloc(): allocation too large, type = %d, size = %lu malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_map???%s %zd of object %p size 0x%lx %s %s (invalid addr %p) Data modified on freelist: wordprevious type%s %zd of object %p size 0x%lx %s %s (0x%x != 0x%x) %d,%s,free: non-malloced addr %p type %sfree: unaligned addr %p, size %ld, type %s, mask %ldmultiply freed item %p free: duplicated freedevbufdebugpcbroutetblfragtblifaddrsooptssysctlioctlopsiovNFS reqNFS mountnamecacheUFS quotaUFS mountshmVM mapsemdirhashACPIVM pmapfile descsubprocVFS clusterMFS nodeExport HostNFS srvsockNFS daemonip_moptionsin_multiether_multimrtISOFS mountISOFS nodeMSDOSFS mountMSDOSFS fatMSDOSFS nodettysmiscfs mountfusefs mountpfkey datatdbxform_datapagedepinodedepnewblkindirdepVM swapUVM amapUVM aobjUSBUSB deviceUSB HCmemdesccrypto dataIPsec credsemuldataip6_optionsNDPtempNTFS mountNTFS nodeNTFS fnodeNTFS dirNTFS hashNTFS attrNTFS dataNTFS decompNTFS vrunkqueuebluetoothbwmeterUDF mountUDF file entryUDF file idBluetooth HIDAGP MemoryDRMsysctlklk%s: lock held%s: lock not shared%s: lock not held%s: lock not held by this process../../../../kern/kern_rwlock.crrwl->rrwl_wcnt > 0rw_enter: %s locking against myselfrw_enter: %s downgrade of non-write lockrw_enter: %s downgrade, not holderrw_enter: unknown op 0x%xtodo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy brokenmawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-12s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-12.12s %-16s %-16s %-8s %18p %s PROC (%s) pid=%d stat=%s flags=%b CONTROLTINMEMSIGPAUSEPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCISPWAITCOREDUMPINGSUGIDEXECSUSPSINGLENOZOMBIEINEXECSYSTRACECONTINUEDSINGLEEXITSINGLEUNWINDTHREADSUSPSIGSOFTDEPSTOPPEDCPUPEG pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p process=%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u, swtime=%u user=%llu, sys=%llu, intr=%llu enterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession but not curprocchgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplidlestopzombiedeadonprocplimitpl../../../../kern/kern_sched.cp->p_wchan == NULLp->p_stat == SRUNcpu_switchto returnedci == curcpu()curproc == spc->spc_idleprocfork idleidle%dstunrsensor_task_unregister: unexpected state %dsensordev../../../../kern/kern_sig.cpr->ps_single == ppausesingle_thread_mode = %dsuspendsigwaiterror != 0p->p_sigwait != 0usersystempid %d (%s): %s write of %lu@%p at %lld failed: %d /var/crash/%s%s.corepostsigpostsig actionProcess (pid %d) got signal %d issignal psignal signal numbersigaplhashinit: bad cntureadc: zero residureadc: non-positive iovcntuiomove: modeuiomove: proc%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx%s:%s,sysctllksysctldlktsleep: no identtsleep: not SONPROCwakeup: p_stat is %dsleep_finish !SONPROCthrsleep%s%s(%d)Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %lld.%09ld to %lld.%09ld dummynanosleepdenied attempt to set clock forward to %lld denied attempt to set clock back %lld seconds ?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func timeout_add: not initializedtimeout_add: to_ticks (%d) < 0boredunexpected %s wq state %dunable to create workq thread for "%s" wqdestroywqtaskssyswqsmashed stack in %ssetrunnable../../../../kern/sched_bsd.cp->p_stat != SONPROCp->p_cpu == curcpu()preempt: cpu_preempt not yet implementedphzconfig_activate_children: device %s failed %d failing resume cannot be handled resume %s config_pending_decr: config_pending == 0config_defer: can't defer config of a root deviceconfig_defer: deferred twiceconfig_defer: can't allocate defer structureautoconfconfig_detach: bad device fstateconfig_detach: forced detach of %s failed (%d)config_detach: %s attached at %s config_detach: detached device (%s) has children%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe ../../../../kern/subr_autoconf.ccd->cd_devs != NULLdev->dv_unit < cd->cd_ndevscd->cd_devs[dev->dv_unit] == NULL%s at root%s at %sroot device %s not configured not configured unsupported /dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read:root device (default %sswap device (default %s%s)%s%d%croot device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%croot device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not founddisk_unbusy: %s: dk_busy < 0 ../../../../kern/subr_disk.cpart >= 0 && part < MAXPARTITIONSdisk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)%s: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx extnt%s: extent `%s', start 0x%lx, size 0x%lx %s: extent `%s', region not within extent%s: overflow%s: start 0x%lx, end 0x%lx %s: region not found%s: extent `%s', size 0x%lx %s: bad size%s: EX_CONFLICTOK and EX_WAITSPACE are mutually exclusive%s: extent `%s' (0x%lx - 0x%lx) %s: region lies outside extent%s: can't allocate region descriptor %s: name == NULL%s: extent `%s', start 0x%lx, end 0x%lx %s: end < start%s: fixed extent, bad storagesize 0x%lx%s: storage provided for non-fixedextentpl%s: already registered%s: NULL result pointer%s: extent `%s', ex_start 0x%lx, ex_end 0x%lx %s: substart 0x%lx, subend 0x%lx %s: bad subregion%s: bad alignment%s: extent `%s', size 0x%lx, boundary 0x%lx %s: bad boundary%s: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx %s: overflow after alignmentklog page %p, nmissing %d item %p, magic 0x%x POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%s): free list modified: page %p; item ordinal %d; addr %p (p %p); offset 0x%x=0x%x pool(%s): free list modified: page %p; item ordinal %d; addr %p (p %p); offset 0x%zx=0x%x pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d items per page pool(%p:%s): page inconsistency: page %p; %d on list, %d missing, %d expected usage: show all pools [/a] %-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s NameSizeRequestsFailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdle%-12s %18s %18s Allocator%-12s %18p %18p inf %*u %*lu %*d %*s %*lu ../../../../kern/subr_pool.c((((vaddr_t)pi) + ioff) & (align - 1)) == 0pool_put of NULLpool %s: putting with none out pool_do_putph->ph_page <= (caddr_t)vph->ph_page + ph->ph_pagesize > (caddr_t)vpool_do_put: %s: page header missingdouble pool_put: %ppr_rmpage: nidle inconsistentpr_rmpage: nitems inconsistentph->ph_nmissing == 0destroyed pool not on listpool_destroy: pool busy: still out: %uLIST_EMPTY(&pp->pr_fullpages)LIST_EMPTY(&pp->pr_partpages)flags & (PR_WAITOK | PR_NOWAIT)pool_get: PR_ZERO when ctor setpool_do_get: %s: crossed hard limitpool_do_get: %s: curpage NULL, nitems %u pool_do_get: nitems inconsistentpool_do_get: %s: page emptypool_do_get: %s: items on itemlist, nitems %u pool_do_get(%s): free list modified: page %p; item addr %p; offset 0x%x=0x%xpool_do_get(%s): free list modified: page %p; item addr %p; offset 0x%zx=0x%xpool_do_get: nidle inconsistentpool_do_get: %s: nmissing inconsistentinit pool already on listpool_init: pool item size (%lu) too largepool_init: too much uptimepp->pr_itemsperpage != 0phpooldma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %dassertwaitok: non-zero mutex count: %dpollselectpipeplpipelkpipeclpiperdExpected pipe buffer wraparound disappearedExpected wraparound badPipe buffer overflowpipewrttrstrtttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %lld.%02ldu %lld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d ttyfree: tty_count < 0b_to_q: required clalloc putc: required clalloc mbuf %p m_type: %hi m_flags: %b M_EXTM_PKTHDRM_EORM_CLUSTERM_PROTO1M_VLANTAGM_LOOPM_FILDROP M_BCAST M_MCAST M_CONF M_AUTH M_TUNNELM_ZEROIZEM_LINK0m_next: %p m_nextpkt: %p m_data: %p m_len: %u m_dat: %p m_pktdat: %p m_pkthdr.len: %i m_ptkhdr.rcvif: %p m_ptkhdr.rdomain: %u m_ptkhdr.tags: %p m_pkthdr.tagsset: %hx m_pkthdr.csum_flags: %hx m_pkthdr.ether_vtag: %hu m_pkthdr.pf.flags: %b GENERATEDFRAGCACHETRANSLATE_LOCALHOSTDIVERTEDDIVERTED_PACKETPF_TAG_REROUTEm_pkthdr.pf.hdr: %p m_pkthdr.pf.statekey: %p m_pkthdr.pf.qid: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.prio: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.routed: %hx m_ext.ext_buf: %p m_ext.ext_size: %u m_ext.ext_type: %x m_ext.ext_backend: %i m_ext.ext_ifp: %p m_ext.ext_free: %p m_ext.ext_arg: %p m_ext.ext_nextref: %p m_ext.ext_prevref: %p ../../../../kern/uipc_mbuf.cfrom->m_flags & M_PKTHDRm_zero: M_READONLYm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufunknown type of extension bufferm_clget: request for %u byte clusterm_defrag: no packet hdr or not a chainm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLm_copym0 overrunmbuf prepend length too bigmbinit: the largest cluster size != MAXMCLBYTESmbplmtagplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersrequested tag size for pool %#x is too bigm == NULL in m_pulldown()unixsoaccept: !NOFDREFreceive 1../../../../kern/uipc_socket.cm == so->so_rcv.sb_mbreceive 1areceive 3so->so_rcv.sb_mb == mnetclssoclose: NOFDREFsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsoqinsque../../../../kern/uipc_socket2.c(sb->sb_flags & SB_LOCK) == 0sb->sb_cc == 0sb->sb_datacc == 0sb->sb_mb == NULLsb->sb_mbtail == NULLsb->sb_lastrecord == NULLsemi-panic: sbcompresssb->sb_mb == sb->sb_lastrecordnetlcknetiosbappendaddrnetcon2netconacceptunp_disconnectunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqCurrent Buffer Cache status: numbufs %lld busymapped %lld, delwri %lld kvaslots %lld avail kva slots %lld bufpages %lld, dirtypages %lld pendingreads %lld, pendingwrites %lld bremfree: lost tail../../../../kern/vfs_bio.c!(bp->b_flags & B_ASYNC)biowaitTrying to undirty buffer on freelist!Trying to dirty buffer on freelist!bufcachepercent <= 90bufcachepercent >= 5bufpages < dmapagesbufplbp->b_bufsize > 0buf_put: releasing dirty bufferbuf_put: still on the free listbuf_put: still on the vnode listbuf_put: b_dep is not emptybiodone alreadyClean buffer on BQ_DIRTYneedbuffernobuffersbuf_get: dup lblk vp %p bp %pgetblkbp->b_lblkno == blkno + 1bp->b_vp == vp../../../../kern/vfs_biomem.cbp->b_data == NULLuobj != NULLpg != NULLpg->wire_count == 1size == round_page(size)bp->b_pobj == NULLbuf_page_offset > 0(bp->b_flags & B_BUSY) == 0bp->b_data != NULLbp->b_flags & B_BUSYbuf_needvabufinit: can't reserve VM for buffersnchplcache_revlookup: found entry for .cache_revlookup: found entry for ..wtf? leak?cluster_wbuild: size %ld != filesize %ldvop_generic_revokevop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dotleaf should be emptyrelookup: symlink found.namei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiops vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b AGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERROR INVAL NOCACHEPHYSRAWREADWANTEDWRITEINPROGXXX(FORMAT)DEFERREDSCANNEDDAEMONRELEASED bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} tag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %d holdcnt %d numoutput %d clean bufs: bp %p dirty bufs: flags %b vnodecovered %p syncer %p data %p RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSvfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %llu free %llu avail %lld files %llu ffiles %llu favail %lld f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %llu asyncwrites = %llu syncreads %llu asyncreads = %llu fstype "%s" mnton "%s" mntfrom "%s" mntspec "%s" locked vnodes: %p, %pall vnodes: %p, %p,vfs_register called with vfc_refcount > 0 bgetvp: not freevdrop: zero holdcntbrelvp: NULLvref used where vget requiredvref on a VNON vnodevinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d %p, type %s, use %u, write %u, hold %u,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT|VBIOWAIT|VBIOONFREELIST|VBIOONSYNCLIST|VALIASED flags (%s)vflushbuf: not dirtyvflushbufvflushbuf: dirtyUse count is not zero!vnode already on free list: vnode already on free listvput: null vpvput: bad ref countvput: ref cntvput: bad writecountvput: v_writecount != 0vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvrele: null vpvrele: bad ref countvrele: ref cntvrele: bad writecountvrele: v_writecount != 0vrele: cannot lockvgetfree vnodefree vnode isn'tcleaned vnodecleaned vnode isn'tClean vnode has pending I/O'svfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done kinfo: vp changed VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSNTFSUDFFUSEFSsyncer vnode mounted on: %s sched_sync: fsync failedsyncermount: lost mountunmount: dangling vnodevn_lockgetcwd: oops, forgot to null lvpgetcwd: oops, went back too farspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_fsync: dirtyspec_read modespec_read procspec_read typespec_write modespec_write procspec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode fifo_badop called, fifo with %ld readers and %ld writerstag VT_NONfifo_write modefifo_read modefiforfifowdos2unixtime(): month value out of range (%ld) msdosfs_reclaim(): pushing activedetrunc(): can't truncate root directory, clust %ld, offset %ld msdosfs_inactive(): pushing activedeextend: file too largedenodedeget(): pcbmap returned %d fatentry(): function code doesn't specify get or set fatentry(): get function with no place to put result extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath: source and target on different filesystemsdoscheckpath(): .. not a directory? msdosfs_sync: rofs modmsdosfs: reducing max cluster to %d from %d due to FAT size RRaArrAatag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_create: no namemsdosfs_mkdir: no namemsdosfs_rename: no namemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfifa_update_broadaddr does not support dynamic lengthegresstoo many interfacesifaddritempl%s: trying to send packet on wrong domain. if %d vs. mbuf %d, AF %d %s: can't handle af%d looutput: no header mbuflo%difmedia_match: multiple match for 0x%x/0x%x, selected instance %d ifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedcan't establish softnet handlerrn_init: radix functions require max_keylen be set rn_initrn_init 2Mask for route not entered rn_addmask: mask impossibly already in tree rn_delete: inconsistent normal annotation rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation %s %p at %p rn_delete: Orphaned Maskrn_delete: couldn't find our annotation rn_addroute: t->rn_p is NULLNon-unique normal route on dupedkey, mask not entered Non-unique normal route, mask not entered next == NULLraw_usrreqrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rtflushclone: called with a non-cloning routertflushclone: no rnh_walktreeifafreertfreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrplrtrequest deletertrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 rtinit: wrong ifa (%p) was (%p) rtentplroute_init rtable_addroute_output la_rt=%p la_hold_head=%p, la_asked=0x%lx [NULL][, ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d rtentry=%p flags=0x%x refcnt=%d use=%llu expire=%u rtableid %u key= mask= gw= ifp=%p (%s)(NULL) ifa=%p genmask= gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) arptfreearp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arpintrarpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arpresolve: unresolved and rt_expire == 0 arp_rtrequest: bad gateway value arp_rtrequest: malloc failed in_controlinvalid argument to in_lifaddr_ioctlin6_pcblookup_listen: laddr= lport=%d in6_pcbhashlookup: faddr= fport=%d laddr=in_pcblookup_listen: laddr=%08x lport=%d in_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d rdom=%d IPv6 pcb passed into in_pcbconnectinpcbplin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinterneticmp_do_exthdr: m_getptr failureicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp lenforward: src %x dst %x ttl %x redirect (%d) to %x save_rte: olen %d ip_srcroute: nhops %d mlen %d hops %x %xipintr no HDRipqeplipqplip_initaeshmac-sha1deflate%d.%d.%d.%dmalformed IPv4 option passed to ip_optcopyip_output no HDRrip_attachrip_detachrip_usrreqtcp_pulloutofbandsynplinvalid sc_tp in syn_cache_cleanupsyn_cache_insert: bucketoverflow: impossiblesyn_cache_insert: cacheoverflow: impossiblem_pulldown malfunctiontcp_input: TCPS_LISTENtcp_output REXMTtcp_output: options too longtcphdr too bigtcp_outputtcp_output: template len != hdrlen - optlentcpcbpltcpqepltcp_inittcp_usrreqIPv6 inpcb to udp_outputudp_usrreqipip_input: should never reach herestart = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_checkblk: bad sizeffs_checkblk: bad block %lldffs_checkblk: partially free fragmentffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost block../../../../ufs/ffs/ffs_alloc.cindx <= 0 || bap != NULLmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free ffs1_reallocblks: unallocated block 1ffs1_reallocblks: non-logical clusterffs1_reallocblks: non-physical cluster %dffs1_reallocblk: start == endffs1_reallocblks: unallocated block 2ffs1_reallocblks: alloc mismatchffs1_reallocblks: unallocated block 3 %lld,dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credentialdev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknoffs_realloccg: small bufdev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimffs_realloccg: small buf 2file system full %s: write failed, file system is full dev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizeffs_alloc: missing credentialffs1_balloc: blk too bigffs1_balloc: ufs_bmaparray returned indirect blockCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: partial truncate of symlinkffs_truncate: newspaceffs_truncate1ffs_truncate2ffs_update: bad link cntDisk overlap start %lld, end %lld overlap start %llu, end %llu Disk buffer overlapsoftdep_flushfiles calledffsinodino1plinodeupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsroot_deviceffs_fsync: not dirtyffs_fsyncffs_fsync: dirtyffs_write: modeffs_write: nonsync dir writeffs_write: typeffs_read: modeffs_read: short symlinkffs_read: type %dufs_getlbns: Invalid indirect block %lld specifiedufs_getlbns: indirect block %lld not foundufs_bmaparray: invalid argumentsufs_bmaparray: indirect block not in cacheufs_reclaim: pushing activeufs_inactive: pushing activecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_makedirentry: missing nameufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_makeinode: no nametag VT_UFS, ino %u, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lldufs_strategy: specufs_readdir: lost in spaceufs_mkdir: no nameufs_link: no nameufs_rename: no nameufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quota- uvm_addr %s: NULL - uvm_addr %s: %p (%s 0x%lx-0x%lx) entry %p: 0x%lx-0x%lx G=0x%lx F=0x%lx free: 0x%lx-0x%lx start=0x%lx, expected at least 0x%lx 0x%lu entries, 0x%lx free bytes pivot 0x%lx, epires in %d, direction %d empty 0x%lx - 0x%lx free (0x%lx bytes) contains pivot %d (0x%lx) %s: entry was not in tree%s: duplicate insertion: state %p interting %p, colliding with %p%s: duplicate insertion: state %p inserting entry %p which collides with %p../../../../uvm/uvm_addr.cp->entry == NULLuaddr == (struct uvm_addr_state*)&uaddr_kbootstrapuaddr_hint_pool.pr_size == sizeof(*ua_hint)offset < align || (align == 0 && offset == 0)(align & (align - 1)) == 0(offset & PAGE_MASK) == 0minaddr < maxaddruaddr_pivot_newpivot: cannot grant random pivot in area less than 2 pages (size = 0x%lx)align >= PAGE_SIZE && (align & (align - 1)) == 0*entry_out != NULLuvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxentry_out != NULL && addr_out != NULLdirection == -1 || direction == 1(hint & PAGE_MASK) == 0 && (high & PAGE_MASK) == 0 && (low & PAGE_MASK) == 0 && (before_gap & PAGE_MASK) == 0 && (after_gap & PAGE_MASK) == 0high + sz > highuaddruaddrhintuaddrbestfituaddrpivotuaddrrnd(map->flags & VM_MAP_ISVMSPACE) != 0uaddr_linuaddr_rnduaddr_hintuaddr_kbootstrapuaddr_bestfituaddr_pivotuaddr_stckbrk../../../../uvm/uvm_amap.c((offset) & (PAGE_SIZE - 1)) == 0amap_unadd: offset out of rangeamap_unadd: nothing thereamap_lookup: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in use(((entry->end - entry->start)) & (PAGE_SIZE - 1)) == 0amap_lookups: offset out of rangeamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpage((sz) & (PAGE_SIZE - 1)) == 0((padsz) & (PAGE_SIZE - 1)) == 0amap->am_ref == 0 && amap->am_nused == 0(amap->am_flags & AMAP_SWAPOFF) == 0amap->am_ref == 0amap_wipeout: corrupt amapLIST_NEXT(&marker_prev, am_list) == &marker_next || LIST_NEXT(LIST_NEXT(&marker_prev, am_list), am_list) == &marker_nextamapplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference count((entry->end - entry->start) & (PAGE_SIZE - 1)) == 0((addsize) & (PAGE_SIZE - 1)) == 0amap->am_maxslot < slotneed(entry)->end + (entry)->fspace > (startva)(entry)->start < (endva)anon_pagein: uvmfault_anonget -> %d../../../../uvm/uvm_anon.cpg->loan_count > 0uvmexp.swpgonly > 0anon->an_page == NULLanon->an_swslot == 0anonpluaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP object../../../../uvm/uvm_aobj.cslot == 0uao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuao_getpageuao_getudv_fault../../../../uvm/uvm_device.cuobj->uo_npages == 0 && RB_EMPTY(&uobj->memt)udv_detachudv_attach../../../../uvm/uvm_fault.cp != NULL && &p->p_vmspace->vm_map == map(map->flags & VM_MAP_INTRSAFE) == 0start >= vm_map_min(map) && end <= vm_map_max(map)uvm_fault_unwire_locked: address not in mapva >= entry->startnext != NULL && next->start <= entry->endanonget1anonget2flt_noram1result != VM_PAGER_PENDuvm_fault: fault on non-pageable map (%p, 0x%lx)fltamapcopyuvmadvice[ufi.entry->advice].advice == ufi.entry->advice(pages[lcv]->pg_flags & PG_RELEASED) == 0uvm_fault: uvmfault_anonget -> %dflt_noram2uvmexp.swpgonly <= uvmexp.swpagesflt_noram3flt_pmfail1uobjpage != PGO_DONTCAREfltagain2flt_noram4uvm_fault: want to promote data, but no anonflt_noram5flt_pmfail2../../../../uvm/uvm_glue.crvva == sva + szuvm_init: page size not set../../../../uvm/uvm_io.ckm_free: unmanaged page 0x%lx ../../../../uvm/uvm_km.csz == round_page(sz)kp->kp_object!kv->kv_singlepagekp->kp_object == NULLsz == PAGE_SIZEkm_allocvakmallockmthreadvm_map_pmap(map) == pmap_kernel()vallocwaitkm_alloc1w!(flags & UVM_KMF_VALLOC) || !(flags & UVM_KMF_ZERO)TAILQ_EMPTY(&pgl)uobj->pgops == &aobj_pagerkm_pgrmuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kerneluvm_km_pgremove_intrsafe: no page../../../../uvm/uvm_map.c*start_ptr == uvm_map_entrybyaddr(atree, addr)*end_ptr == uvm_map_entrybyaddr(atree, addr + sz - 1)map->flags & VM_MAP_ISVMSPACE(flags & (PGO_FREE|PGO_DEACTIVATE)) != (PGO_FREE|PGO_DEACTIVATE)pg->uobject == NULLpg->uanon == anonuvm_map_clean: weird flagsOBJECT %p: pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> PAGE %p: flags=%b, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] vm_page_md %p >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found in uvm_pmemrange >>> page not found in uvm_pmemrange <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< MAP %p: [0x%lx->0x%lx] brk() allocate range: 0x%lx-0x%lx stack allocate range: 0x%lx-0x%lx sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) vm_refcnt=%d vm_shm=%p vm_rssize=%u vm_swrss=%u vm_tsize=%u vm_dsize=%u vm_taddr=%p vm_daddr=%p vm_maxsaddr=%p vm_minsaddr=%p - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d hole=%c, free=%c, guard=0x%lx, free=0x%lx-0x%lx fspace_augment=%lu freemapped=%c, uaddr=%p (0x%lx-0x%lx %s) exeany[%d]brk/stackvmspplvmmpeplvmmpekpluvm_map_pageable_wire: stale mapmap->flags & VM_MAP_PAGEABLEuvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries sel_min: 0x%lx, but should be at least 0x%lx sel_max: 0x%lx, but should be at most 0x%lx sel_min: 0x%lx, not aligned to 0x%lx sel_max: 0x%lx, not aligned to 0x%lx sel_min: 0x%lx, aligned to 0x%lx, expected 0x%lx sel_max: 0x%lx, aligned to 0x%lx, expected 0x%lx uvm_map_sel_limits(sz = %lu, guardpg = %c, align = 0x%lx, pmap_align = 0x%lx, pmap_off = 0x%lx, bias = %d, FREE_START(sel) = 0x%lx, FREE_END(sel) = 0x%lx)uvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)(entry->etype & UVM_ET_FREEMAPPED) != 0 || uaddr == NULLuvm_map_uaddr_e(map, entry) == uaddr(entry->etype & UVM_ET_FREEMAPPED) == 0entry == NULL || (entry->etype & UVM_ET_FREEMAPPED) == 0uvm_map_vmspace_update: vmspace %p invalid bounds: b=0x%lx-0x%lx s=0x%lx-0x%lx(map->flags & VM_MAP_ISVMSPACE) == 0(min & (vaddr_t)PAGE_MASK) == 0(max & (vaddr_t)PAGE_MASK) == 0 || (max & (vaddr_t)PAGE_MASK) == (vaddr_t)PAGE_MASKvmmaplkuvm_map_setup: rw_enter failed on new mapuvmspace_fork: no space in map for entry in empty mapuvm_map_splitentry: split address 0x%lx not on page boundary!orig->start < split && VMMAP_FREE_END(orig) > splitentry->start < addr && VMMAP_FREE_END(entry) > addr(entry)->end + (entry)->fspace > (start)(entry)->start < (end)last != first(first)->end + (first)->fspace > (start)(last)->start < (end)(iter)->end + (iter)->fspace > (start)(iter)->start < (end)RB_EMPTY(&map->addr)which != NULL(void*)map <= (void*)(which) && (void*)(which) < (void*)(map + 1)fork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_map_teardown: rw_enter failed on free map(start & (vaddr_t)PAGE_MASK) == 0(end & (vaddr_t)PAGE_MASK) == 0 || (end & (vaddr_t)PAGE_MASK) == (vaddr_t)PAGE_MASK(start & (vaddr_t)PAGE_MASK) == 0 && (end & (vaddr_t)PAGE_MASK) == 0(sz & (vaddr_t)PAGE_MASK) == 0uobj == NULL && (flags & UVM_FLAG_FIXED) && (flags & (UVM_FLAG_OVERLAY | UVM_FLAG_COPYONW)) == 0(*addr & PAGE_MASK) == 0(map->flags & VM_MAP_ISVMSPACE) == VM_MAP_ISVMSPACE || uvm_maxkaddr >= *addr + szUVM_OBJ_IS_KERN_OBJECT(uobj)../../../../uvm/uvm_mmap.c!UVM_ET_ISSUBMAP(entry)start >= entry->start!UVM_OBJ_IS_KERN_OBJECT(entry->object.uvm_obj)../../../../uvm/uvm_object.c!(pg->pg_flags & PG_RELEASED)pgs[i] != NULL!(pgs[i]->pg_flags & PG_RELEASED)../../../../uvm/uvm_page.c(pg->pg_flags & PG_TABLED) == 0dupe == NULLpg->wire_count == 0(pg->pg_flags & PG_DEV) == 0pg->pg_flags & PG_TABLEDsaved_loan_count == 0obj == NULL || anon == NULLoff == trunc_page(off)pg != NULL && TAILQ_NEXT(pg, pageq) == NULLuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of two(alignment & (alignment - 1)) == 0(boundary & (boundary - 1)) == 0!(flags & UVM_PLA_WAITOK) ^ !(flags & UVM_PLA_NOWAIT)uvm_pglistallocuvm_pglistalloc: Upper boundary 0x%lx not on pagemask. size 0 uvm_pagereallocuvm_page_physdump: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init../../../../uvm/uvm_pager.cpseg != &psegs[PSEG_NUMSEGS]id >= 0 && id < MAX_PAGER_SEGSUVM_PSEG_INUSE(pseg, id)npages <= MAXPHYS >> PAGE_SHIFTswap || pg->uobject == uobj!write || (pgs[i]->pg_flags & PG_FAKE) == 0pseg->start == 0pseg->use == 0pagersegsize <= MAXBSIZEpppp->pg_flags & PG_BUSY../../../../uvm/uvm_pdaemon.cp->loan_count > 0anon->an_swslot != 0uvmexp.swpginuse <= uvmexp.swpagespagedaemon: pageout returned invalid 'unlock' codep->uanon != NULLpgdaemonpagedaemon: deadlock detected! Ranges, use queue: * [0x%lx-0x%lx] use=%d nsegs=%ld maxsegsz[%d]=0x%lx free=0x%lx #ranges = %d pagedaemon: wait_pla deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx ../../../../uvm/uvm_pmemrange.cpg_prev != NULL && pg_next != NULLpg_i->pg_flags & PQ_FREEstart == 0 || atop(VM_PAGE_TO_PHYS(found)) + found->fpgsz > start!TAILQ_EMPTY(pgl)pmr != NULL && pg != NULLsz >= 1nw != NULLpmr->high > pagenouvm_pmr_split: lost one pmr drain->nsegs == 0prev == NULL || atop(VM_PAGE_TO_PHYS(prev)) < pagenobefore > 0after > 0sz >= high - lowFlags: 0x%x, will panic now. (pg->pg_flags & PQ_FREE) == 0 && VALID_FLAGS(pg->pg_flags)atop(VM_PAGE_TO_PHYS(&pg[i])) == atop(VM_PAGE_TO_PHYS(pg)) + i(pg[i].pg_flags & PQ_FREE) == 0 && VALID_FLAGS(pg[i].pg_flags)pmr != NULLstart == 0 || end == 0 || start < endalign >= 1powerof2(align)maxseg > 0boundary == 0 || powerof2(boundary)boundary == 0 || maxseg * boundary >= countTAILQ_EMPTY(result)flags & UVM_PLA_FAILOKpmemrange allocation error: allocated %ld pages in %d segments, but request was %ld pages in %d segmentsCurrent UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p ../../../../uvm/uvm_swap.cuvmexp.nswapdev >= 1sdp != NULLsdp->swd_npginuse >= nslotswarning: resource shortage: %d pages of swap lost vnx->vx_pending == 0swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel region/dev/%s%d%cblkdev0x%xswapctl: copystrflags & PGO_SYNCIOuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplkuvm_coredump: user process with submap?sbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_getpageuvn_getuvn_cluster: offset out of range../../../../uvm/uvm_vnode.cuobj->pgops->pgo_mk_pcluster != 0uvn_flshuvn_flush: PGO_SYNCIO return 'try again' error (impossible)uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressHuh? Thought in6_pcbnotify() never got called with mapped! in6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_savemkludge: no kludge spacein6_unlink_ifa: interface address %s has no prefix ADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix invalid argument to in6_lifaddr_ioctlin6_ifawithscope: output interface is not specified in6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) %s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) ia == NULL in in6_ifattach_linklocalin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6%s:%d: ip6q lock not held ../../../../netinet6/frag6.cip6q lock check%s:%d: ip6q already locked ip6q_lockicmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerOpenBSD-currentip6_nexthdr: m == NULLip6_pullexthdr: invalid nxt=%d ip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_setpktopt: impossible case ip6_getpcbopt: unexpected optionassumption failed: hdr not splitscope error in prefix list (%s) nd6_init called more than once(ignored) ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) default router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s nd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_na_inputifa == NULL in nd6_dad_ns_inputnd6_na_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_na_output: insufficient MCLBYTESnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_ns_output: insufficient MCLBYTESnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p dr == NULL in defrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) rip6_attachrip6_detachrip6_usrreq db_fetch_reg: botchaddress %p is invalid branch_taken: botch address 0x%08lx not a valid page Faulted in DDB; continuing... spsrr0r1r2r3r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spframetrace: pid %d not found at %p scp=0x%08x rlv=0x%08x () rsp=0x%08x rfp=0x%08x%sr%d=0x%08xBad frame pointer: %p Bad user frame pointer: %p frame address must be specified frame address = %08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbuscortexampintc irq %dampintc_intr_establish: bogus irqnumber %d: %sintr_establish: can't malloc handler infospur ampintc_attach: ICP bus_space_map failed!ampintc_attach: ICD bus_space_map failed! nirq %d ampintcamptimer0: adjusting clock: new tick rate %d KHz tickamptimer_attach: bus_space_map global timer failed!amptimer_attach: bus_space_map priv timer failed!: tick rate %d KHz amptimercpu, rrx, %s r%d, %s #%d%s%s#0x%08x[r%d][r%d%s, -#0x%03x#0x%02x{r%d-r%d}^f%d#%s0x%08xcpsr_p%df%d, c%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d[%c - unknown]und%s %08x imbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtdsbisbstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpnopyieldwfewfisevdbgmsrpFmpF2bxclzdmbkptSdn2eorsubrsbaddadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcNo support for this CPU type (%08x) in kernel../../../../arch/arm/arm/process_machdep.ctf != NULLprocess_read_regs: Interrupts blocked in user process../../../../arch/arm/arm/syscall.cnargs <= MAXARGSUndefined instruction in kernel ../../../../arch/arm/arm/undefined.ccoproc >= 0 && coproc < MAX_COPROCShandler != NULLreal mem = %u (%uMB) avail mem = %lu (%uMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock uvm_pglistalloc returned non-sensical address 0x%lx _bus_dmamem_alloc_range_bus_dmamem_mmap: offset unaligned_bus_dmamem_mmap: segment unaligned_bus_dmamem_mmap: segment size not multiple of page size_bus_dmamap_load_raw: not implemented_bus_dmamap_load_uio: USERSPACE but no proc_bus_dmamap_load_mbuf: no packet header_bus_dmamem_unmap_bus_dmamem_map: size botch../../../../arch/arm/arm/bus_dma.c(va & PAGE_MASK) == (pa & PAGE_MASK)_bus_dmamap_sync: mix PRE and POST_bus_dmamap_sync: bad offset %lu (map size is %lu)_bus_dmamap_sync: bad length%s: curaddr %#lx not in range_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-SARM1136J-S R1ARM Cortex A5ARM Cortex A7ARM Cortex A8ARM Cortex A8 R1ARM Cortex A8 R2ARM Cortex A8 R3ARM Cortex A9ARM Cortex A9 R1ARM Cortex A9 R2ARM Cortex A9 R3ARM Cortex A9 R4ARM Cortex A15ARM Cortex A15 R1ARM Cortex A15 R2ARM Cortex A15 R3CPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA1100XScaleCPU_XSCALE_...ARM11JCPU_ARM11CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0badaddr: invalid size (%lu)kernelFatal %s mode data abort: '%s' trapframe: %p DFSR=%08x, DFAR=%08x, spsr=%08x Fatal %s mode prefetch abort at 0x%08x trapframe: %p IFSR=%08x, IFAR=%08x, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Non-emulated prefetch abort with intr_depth > 0 UVM: pid %d (%s), uid %d killed: out of swap data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x V7 fault 00000Alignment Fault 1Debug EventAccess Flag Fault (S)External Linefetch Abort (S)Translation Fault (S)Access Flag Fault (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)V7 fault 01010Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)V7 fault 10000V7 fault 10001V7 fault 10010V7 fault 10011LockdownV7 fault 10101Asynchronous External AbortV7 fault 10111Memory Asynchronous Parity ErrorMemory Synchronous Parity ErrorCoprocessor AbortV7 fault 11011V7 fault 11101V7 fault 11111mmrwpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %ppmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplalloc_l1_vaalloc_l1_pgpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lx%s: va %08x ftype %x %c pte %08x fault on exec pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufarmv7_io_bs_free(): not implementedarmv7_io_bs_alloc(): not implementedmutex %p not held in %smutex %p held in %splatform_smc_write: invalid operation %dkernel does not support -c; continuing.. board type %x unknownbootfile: %s bootargs: %s unknown option `%c' cpu not recognized! OpenBSD/beagle booting ... arg0 %p arg1 %p arg2 %p memory size derived from u-boot bootconf.mem[%d].address = %08x pages %d/0x%08x Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: out of memoryinitarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables undefined page pmap board type: beagle board type: beaglebone board type: overo board type: panda boot: howto=%08x curproc=%p The operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Attempting to power down... arm_clock_func.setstatclockrate not intializedinitclocks function not initialized yetarm_dflt_intr_string calledarm_dflt_intr_disestablish calledarm_dflt_intr_establish calledarm_dflt_intr() calledresettodr: failed to set time WARNING: preposterous time in file system WARNING: preposterous clock chip time lostgainedWARNING: clock %s %ld days WARNING: CHECK AND RESET THE DATE! atag core flags %x pagesize %x rootdev %x atag mem start 0x%08x size 0x%x atag cmdline [%s] atag serial 0x%08x:%08x atag revision %08x uboot tag unknown 0x%08x size %d %s: omap_devs == NULL: BeagleBoard : BeagleBone : Gumstix Overo : PandaBoard %s: board type 0x%x unknown%s: device %s unit %d not found %s: device %s unit %d not configured prcmintcgptimeromdogomgpioommmcsitaracmdmtimercpswomapidomapomusbtllmmcdiemmcdly%s: i/o init failed %s: mem init failed %s: can't identify card %s: can't supply bus power %s: can't supply clock %s: can't enable card %s: no functions %s: init failed mmctsk%s: can't create task thread sdmmcSpectecSDIO WLAN CardSDW-820%s: CIS version %d.%d %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: wireless network adapterunknown (%d)%s: bad CIS ptr %#x %s: CIS parse error at %d, tuple code %#x, length %d %s: bad CISTPL_FUNCID length %s: bad CISTPL_MANFID length %s: CISTPL_VERS_1 too short ../../../../dev/sdmmc/sdmmc_io.cTAILQ_EMPTY(&sc->sc_intrq)"%s(manufacturer 0x%x%sproduct 0x%x%sat %s function %d "scsibus%s: can't read CIS %s: can't set I/O RCA %s: can't select I/O RCA %d %s: can't supply voltage requested by card %s: can't send I/O OCR %s: unknown MMC version %d %s: unknown SD CSD structure version 0x%x %s: unknown MMC CSD structure version 0x%x %s: can't set mem RCA SD/MMC Drive #%02d%s: can't allocate ccbs %s: can't attach scsibus hcintr%s: data not a multiple of %d bytes %s: too much data ommmc_card_intr_ack ommmc_card_intr_mask ommmc_sdclk_frequency_select: command in progress divisor failure %s: bus_space_map failed!invalid capability blocksize in capa %08x, trying 512 OUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmediamii_phy_setmedia: MASTER on wrong media: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphycan't load rx DMA map %d: %d ../../../../arch/beagle/dev/if_cpsw.cx < CPSW_NRXDESCS%s: %s(%d): Invalid Ethernet address! %s %x FIRE CPSW_CPDMA_DMA_INTSTAT_MASKED %x rxhead %02x CPSW_CPDMA_DMASTATUS %x CPSW_CPDMA_TX0_HDP %x CPSW_CPDMA_TX0_CP %x CPSW_CPDMA_RX0_HDP %x CPSW_CPDMA_RX0_CP %x (val & 0xffff0000UL) == 0%s error won't fit rdp->tx_mb[sc->sc_txnext] == NULLx < CPSW_NTXDESCSeopi == TXDESC_PREV(sc->sc_txnext)sc->sc_txrunsc->sc_txhead < CPSW_NTXDESCSpwned %x %x %x sc->sc_rxhead < CPSW_NRXDESCSdm != NULLm != NULLrxeoq can't map registers: %d can't subregion tx ring SRAM: %d txdescs at %pcan't subregion rx ring SRAM: %d rxdescs at %psc->sc_rdp != NULLunable to create tx DMA map: %d unable to create rx DMA map: %d sc->sc_txpad != NULL, address %s no PHY found! device timeout CM_IDLEST_PLL = 0x%08x %s: invalid type %dError: HERE failed to enable module with clock %d Error: 0x%08x => 0x%08x %s: module not found %s: not initialised!%s: invalid clock %dprcm_attach: bus_space_map failed! rev %d.%d output_pullupinputinput_pulldowninput_pullupi2cGPMC_AD0gpmc_ad0mmc1_dat0gpio1_0GPMC_AD1gpmc_ad1mmc1_dat1gpio1_1GPMC_AD2gpmc_ad2mmc1_dat2gpio1_2GPMC_AD3gpmc_ad3mmc1_dat3gpio1_3GPMC_AD4gpmc_ad4mmc1_dat4gpio1_4GPMC_AD5gpmc_ad5mmc1_dat5gpio1_5GPMC_AD6gpmc_ad6mmc1_dat6gpio1_6GPMC_AD7gpmc_ad7mmc1_dat7gpio1_7GPMC_AD8gpmc_ad8lcd_data23mmc2_dat4ehrpwm2Agpio0_22GPMC_AD9gpmc_ad9lcd_data22mmc2_dat5ehrpwm2Bgpio0_23GPMC_AD10gpmc_ad10lcd_data21mmc2_dat6ehrpwm2_tripzone_ingpio0_26GPMC_AD11gpmc_ad11lcd_data20mmc2_dat7ehrpwm0_syncogpio0_27GPMC_AD12gpmc_ad12lcd_data19mmc2_dat0eQEP2A_inpr1_mii0_txd2pr1_pru0_pru_r30_14gpio1_12GPMC_AD13gpmc_ad13lcd_data18mmc2_dat1eQEP2B_inpr1_mii0_txd1pr1_pru0_pru_r30_15gpio1_13GPMC_AD14gpmc_ad14lcd_data17mmc2_dat2eQEP2_indexpr1_mii0_txd0pr1_pru0_pru_r31_14gpio1_14GPMC_AD15gpmc_ad15lcd_data16mmc2_dat3eQEP2_strobepr1_ecap0_ecap_capin_apwm_opr1_pru0_pru_r31_15gpio1_15GPMC_A0gpmc_a0gmii2_txenrgmii2_tctlrmii2_txengpmc_a16pr1_mii_mt1_clkehrpwm1_tripzone_inputgpio1_16GPMC_A1gpmc_a1gmii2_rxdvrgmii2_rctlgpmc_a17pr1_mii1_txd3gpio1_17GPMC_A2gpmc_a2gmii2_txd3rgmii2_td3gpmc_a18pr1_mii1_txd2ehrpwm1Agpio1_18GPMC_A3gpmc_a3gmii2_txd2rgmii2_td2gpmc_a19pr1_mii1_txd1ehrpwm1Bgpio1_19GPMC_A4gpmc_a4gmii2_txd1rgmii2_td1rmii2_tdx1gpmc_a20pr1_mii1_txd0eQEP1A_ingpio1_20GPMC_A5gpmc_a5gmii2_txd0rgmii2_td0rmii2_txd0gpmc_a21pr1_mii1_rxd3eQEP1B_ingpio1_21GPMC_A6gpmc_a6gmii2_txclkrgmii2_tclkgpmc_a22pr1_mii1_rxd2eQEP1_indexgpio1_22GPMC_A7gpmc_a7gmii2_rxclkrgmii2_rclkgpmc_a23pr1_mii1_rxd1eQEP1_strobegpio1_23GPMC_A8gpmc_a8gmii2_rxd3rgmii2_rd3gpmc_a24pr1_mii1_rxd0mcasp0_aclkxgpio1_24GPMC_A9gmpc_a9gmii2_rxd2rgmii2_rd2mmc2_dat7 / rmii2_crs_dvgpmc_a25pr1_mii_mr1_clkmcasp0_fsxgpio1_25GPMC_A10gmpc_a10gmii2_rxd1rgmii2_rd1rmii2_rxd1gpmc_a26pr1_mii1_rxdvmcasp0_arx0gpio1_26GPMC_A11gmpc_a11gmii2_rxd0rgmii2_rd0rmii2_rxd0gpmc_a27pr1_mii1_rxermcasp0_axr1gpio1_27GPMC_WAIT0gpmc_wait0gmii2_crsgpmc_csn4mmc1_sdcdpr1_mii1_coluart4_rxdgpio0_30GPMC_WPngpmc_wpngmii2_rxerrgpmc_csn5rmii2_rxerrmmc2_sdcdpr1_mii1_txenuart4_txdgpio0_31GPMC_BEn1gpmc_be1ngmii2_colgmpc_csn6gpmc_dirpr1_mii1_rxlinkmcasp0_aclkrgpio1_28GPMC_CSn0gpmc_csn0gpio1_29GPMC_CSn1gpmc_csn1gpmc_clkmmc1_clkpr1_edio_data_in6pr1_edio_data_out6pr1_pru1_pru_r30_12pr1_pru1_pru_r31_12gpio1_30GPMC_CSn2gpmc_csn2mmc1_cmdpr1_edio_data_in7pr1_edio_data_out7pr1_pru1_pru_r30_13pr1_pru1_pru_r31_13gpio1_31GPMC_CSn3gpmc_csn3mmc2_cmdpr1_mii0_crspr1_mdio_dataEMU4gpio2_0GPMC_CLKlcd_memory_clkgpmc_wait1mmc2_clkpr1_mii1_crspr1_mdio_mdclkmcasp0_fsrgpio2_1GPMC_ADVn_ALEgpmc_advn_aletimer4gpio2_2GPMC_OEn_REngpmc_oen_rentimer7gpio2_3GPMC_WEngpmc_wentimer6gpio2_4GPMC_BEn0_CLEgpmc_ben0_cletimer5gpio2_5LCD_DATA0lcd_data0pr1_mii_mt0_clkpr1_pru1_pru_r30_0pr1_pru1_pru_r31_0gpio2_6LCD_DATA1lcd_data1pr1_mii0_txenpr1_pru1_pru_r30_1pr1_pru1_pru_r31_1gpio2_7LCD_DATA2lcd_data2pr1_mii0_txd3ehrpwm2_tripzone_inputpr1_pru1_pru_r30_2pr1_pru1_pru_r31_2gpio2_8LCD_DATA3lcd_data3pr1_pru1_pru_r30_3pr1_pru1_pru_r31_3gpio2_9LCD_DATA4lcd_data4pr1_pru1_pru_r30_4pr1_pru1_pru_r31_4gpio2_10LCD_DATA5lcd_data5pr1_pru1_pru_r30_5pr1_pru1_pru_r31_5gpio2_11LCD_DATA6lcd_data6pr1_pru1_pru_r30_6pr1_pru1_pru_r31_6gpio2_12LCD_DATA7lcd_data7pr1_pru1_pru_r30_7pr1_pru1_pru_r31_7gpio2_13LCD_DATA8lcd_data8gpmc_a12uart5_txdpr1_mii0_rxd3uart2_ctsngpio2_14LCD_DATA9lcd_data9gpmc_a13uart5_rxdpr1_mii0_rxd2uart2_rtsngpio2_15LCD_DATA10lcd_data10gpmc_a14mcasp0_axr0pr1_mii0_rxd1uart3_ctsngpio2_16LCD_DATA11lcd_data11gpmc_a15mcasp0_ahclkrmcasp0_axr2pr1_mii0_rxd0uart3_rtsngpio2_17LCD_DATA12lcd_data12pr1_mii0_rxlinkuart4_ctsngpio0_8LCD_DATA13lcd_data13mcasp0_axr3pr1_mii0_rxeruart4_rtsngpio0_9LCD_DATA14lcd_data14pr1_mii_mr0_clkuart5_ctsngpio0_10LCD_DATA15lcd_data15mcasp0_ahclkxpr1_mii0_rxdvuart5_rtsngpio0_11LCD_VSYNClcd_vsyncpr1_edio_data_in2pr1_edio_data_out2pr1_pru1_pru_r30_8pr1_pru1_pru_r31_8gpio2_22LCD_HSYNClcd_hsyncpr1_edio_data_in3pr1_edio_data_out3pr1_pru1_pru_r30_9pr1_pru1_pru_r31_9gpio2_23LCD_PCLKlcd_pclkgpmc_a10pr1_edio_data_in4pr1_edio_data_out4pr1_pru1_pru_r30_10pr1_pru1_pru_r31_10gpio2_24LCD_AC_BIAS_ENlcd_ac_bias_engpmc_a11pr1_edio_data_in5pr1_edio_data_out5pr1_pru1_pru_r30_11pr1_pru1_pru_r31_11gpio2_25MMC0_DAT3mmc0_dat3uart1_dcdnpr1_pru0_pru_r30_8pr1_pru0_pru_r31_8gpio2_26MMC0_DAT2mmc0_dat2uart1_dsrnpr1_pru0_pru_r30_9pr1_pru0_pru_r31_9gpio2_27MMC0_DAT1mmc0_dat1uart3_rxduart1_dtrnpr1_pru0_pru_r30_10pr1_pru0_pru_r31_10gpio2_28MMC0_DAT0mmc0_dat0uart3_txduart1_rinpr1_pru0_pru_r30_11pr1_pru0_pru_r31_11gpio2_29MMC0_CLKmmc0_clkuart2_rxddcan1_txpr1_pru0_pru_r30_12pr1_pru0_pru_r31_12gpio2_30MMC0_CMDmmc0_cmduart2_txddcan1_rxpr1_pru0_pru_r30_13pr1_pru0_pru_r31_13gpio2_31MII1_COLgmii1_colrmii2_refclkspi1_sclkmcasp1_axr2gpio3_0MII1_CRSgmii1_crsrmii1_crs_dvspi1_d0I2C1_SDAmcasp1_aclkxgpio3_1MII1_RX_ERgmii1_rxerrrmii1_rxerrspi1_d1I2C1_SCLmcasp1_fsxgpio3_2MII1_TX_ENgmii1_txenrmii1_txenrgmii1_tctlmcasp1_axr0eQEP0_indexgpio3_3MII1_RX_DVgmii1_rxdvcd_memory_clkrgmii1_rctlgpio3_4MII1_TXD3gmii1_txd3dcan0_txrgmii1_td3gpio0_16MII1_TXD2gmii1_txd2dcan0_rxrgmii1_td2gpio0_17MII1_TXD1gmii1_txd1rmii1_txd1rgmii1_td1mcasp1_fsrmcasp1_axr1eQEP0A_ingpio0_21MII1_TXD0gmii1_txd0rmii1_txd0rgmii1_td0mcasp1_aclkreQEP0B_ingpio0_28MII1_TX_CLKgmii1_txclkrgmii1_tclkmmc0_dat7gpio3_9MII1_RX_CLKgmii1_rxclkrgmii1_rclkmmc0_dat6gpio3_10MII1_RXD3gmii1_rxd3rgmii1_rd3mmc0_dat5gpio2_18MII1_RXD2gmii1_rxd2rgmii1_rd2mmc0_dat4gpio2_19MII1_RXD1gmii1_rxd1rmii1_rxd1rgmii1_rd1mcasp1_axr3eQEP0_strobegpio2_20MII1_RXD0gmii1_rxd0rmii1_rxd0rgmii1_rd0mcasp1_ahclkxmcasp1_ahclkrgpio2_21RMII1_REF_CLKrmii1_refclkxdma_event_intr2spi1_cs0mmc0_powgpio0_29MDIOmmc0_sdcdgpio0_0MDCmdio_clkmmc0_sdwpgpio0_1SPI0_SCLKspi0_sclkI2C2_SDAehrpwm0Apr1_uart0_cts_npr1_edio_sofEMU2gpio0_2SPI0_D0spi0_d0I2C2_SCLehrpwm0Bpr1_uart0_rts_npr1_edio_latch_inEMU3gpio0_3SPIO_D1spi0_d1mmc1_sdwpehrpwm0_tripzone_inputpr1_uart0_rxdpr1_edio_data_in0pr1_edio_data_out0gpio0_4SPI0_CS0spi0_cs0mmc2_sdwpehrpwm0_syncipr1_uart0_txdpr1_edio_data_in1pr1_edio_data_out1gpio0_5SPI0_CS1spi0_cs1eCAP1_in_PWM1_outmcc0_powxdm_event_intr2gpio0_6ECAP0_IN_PWM0_OUTeCAP0_in_PWM0_outspi1_cs1gpio0_7UART0_CTSnuart0_ctsnpr1_edc_sync0_outgpio1_8UART0_RTSnuart0_rtsnpr1_edc_sync1_outgpio1_9UART0_rxdeCAP2_in_PWM2_outpr1_pru1_pru_r30_14pr1_pru1_pru_r31_14gpio1_10UART0_txdpr1_pru1_pru_r30_15pr1_pru1_pru_r31_15gpio1_11UART1_CTSnuart1_ctsntimer6_mux1pr1_edc_latch0_ingpio0_12UART1_RTSnuart1_rtsntimer5_mux1pr1_uart0_rts_n pr1_edc_latch1_ingpio0_13UART1_RXDuart1_rxdpr1_pru1_pru_r31_16gpio0_14UART1_TXDuart1_txdpr1_pru0_pru_r31_16gpio0_15I2C0_SDAgpio3_5I2C0_SCLgpio3_6MCASP0_ACLKXpr1_pru0_pru_r30_0pr1_pru0_pru_r31_0gpio3_14MCASP0_FSXpr1_pru0_pru_r30_1pr1_pru0_pru_r31_1gpio3_15MCASP0_AXR0pr1_pru0_pru_r30_2pr1_pru0_pru_r31_2gpio3_16MCASP0_AHCLKRpr1_pru0_pru_r30_3pr1_pru0_pru_r31_3gpio3_17MCASP0_ACLKRpr1_pru0_pru_r30_4pr1_pru0_pru_r31_4gpio3_18MCASP0_FSRpr1_pru0_pru_r30_5pr1_pru0_pru_r31_5gpio3_19MCASP0_AXR1pr1_pru0_pru_r30_6pr1_pru0_pru_r31_6gpio3_20MCASP0_AHCLKXpr1_pru0_pru_r30_7pr1_pru0_pru_r31_7gpio3_21XDMA_EVENT_INTR0xdma_event_intr0clkout1gpio0_19XDMA_EVENT_INTR1xdma_event_intr1tclkinclkout2gpio0_20EMU0gpio3_7EMU1gpio3_8USB0_DMUSB0_DPUSB0_CEUSB0_IDUSB0_VBUSUSB0_DRVVBUSgpio0_18USB1_DMUSB1_DPUSB1_CEUSB1_IDUSB1_VBUSUSB1_DRVVBUSgpio3_13sitara_cm_attach: already attached%s: bus_space_map failed! sitara_cm_attach: read revision: control module, rev %d.%d %s: Invalid mux mode "%s" omgpio_attach: bus_space_map failed! omap%d rev %d.%d huh?intc_attach: bus_space_map failed!intc_intr_establish: bogus irqnumber %d: %sgptimer_attach: bus_space_map failed!attaching too many gptimers at 0x%x%s: negative duration! %s: time lost! attaching too many dmtimers at 0x%xomapid: bus_space_map failed!omap4430omap4460PHY reset operation timed out : cannot map mem space : unable to establish interrupt XXX - disable ehci and prcmTI OMAP%s: init failed, error=%d %s: bus_space_map failed usbtll enabling %d unexpected opening returnedDiagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Setoff INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %uscsi_ioh_del: unexpected state %uscsi_iopool_destroy: scsi_iohandler on poolscsi_ioh_add: unexpected state %uxs->cookie != NULL in scsi_xs_syncxs->done != NULL in scsi_xs_syncsyncxsscsi_link_shutdown: scsi_xshandler on linkscsi_link_shutdown: scsi_xshandler on poolpendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsi_do_ioctl: impossible cmd (%#lx)scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial.~ offline../../../../scsi/scsiconf.cSLIST_EMPTY(&sb->sc_link): %d targets, initiator %d, WWPN %016llx, WWNN %016llxPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMcdNEC CD-ROM DRIVE:260SPECTRA90000200SCSI opticalSCSI disk%s %s(unknown)%s: %lldMB, %lu bytes/sector, %lld sectors, thinsdattach: unknown result (%#x) from get_parms%s: WARNING: unable to establish shutdown hook sd%s: bad residual %d out of %d %s: block wrong size, %d blocks residual %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d %s: cannot set selected mode TANDBERG TDC 3600 TDC 3800 ARCHIVE VIPER 2525 25462SANKYO CP525 ANRITSU DMT780 VIPER 150 21247VIPER 150 21531WANGTEK 5099ES SCSI5150ES SCSI5525ES SCSI REV7EXABYTE EXB-8200 263HHP T4000s ????TEAC MT-2ST/N50 uksoftintr_establish: unknown soft IPL %dboot device: lookup '%s' failed. boot device: %s wdraidwsevent_readwsevent_fini: already invoked wsevent_init: already initialized wskbd at %swskbdread: evp == NULL wskbd_input: evar->q=NULL %s: event queue overflow ../../../../dev/wscons/wskbd.cwskbd_console_initted!wskbd_console_inittedwskbd_console_device == scwskdetwskbd_detach: %s didn't detach cannot load keymapwskbd_console_device == NULL: console keyboardwskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmouse at %swsmouseread: evp == NULL wsmouse_input: evar->q=NULL ../../../../dev/wscons/wsmouse.cev->value >= 0wsmdetwsmouse_detach: %s didn't detach wsmouseusb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task threadusbpalock: USB revision %s, not supported %s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d pre 1.01.12.0usbusbd_desc_iter_next: bad descriptor usbd_desc_iter_next: descriptor length = 0 usbd_desc_iter_next: descriptor length too large usbd_get_quirks: dev == NULL usbd_start_next: pipe == NULL usbd_start_next: pipe=%p no start method usbd_start_next: error=%d usb_insert_transfer: xfer=%p not busy 0x%08x usbd_endpoint_count: NULL pointer usbd_abort_pipe: pipe==NULL usbd_get_interface_descriptor: dev == NULL usbd_get_config_descriptor: dev == NULL usbd_free_buffer: no buffer usb_transfer_complete: xfer=%p not busy 0x%08x usb_transfer_complete: pipe==0, xfer=%p usb_transfer_complete: actlen > len %d > %d usb_transfer_complete: bad dequeue %p != %p usbd_close_pipe: pipe==NULL usbd_alloc_buffer: xfer already has a buffer usbd_transfer: has old buffer! usbd_transfer: not doneusbsynusbd_do_request: not in process context usbd_set_interface: NULL pointer usbrefusbdetusb_detach_wait: %s didn't detach usb_block_allocmem: in interrupt context, size=%lu usb_block_allocmem: in interrupt context, failed out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbd_fill_iface_data: bad max packet size usb_disconnect_port: no device usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS portusbd_new_device: addr=%d bad max packet size %x.%02xvendor 0x%04xproduct 0x%04x"%s %s", class %d/%d rev / addr %d port %d configuration %d interface %dNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: strange, connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: hub depth (%d) exceeded, hub ignored %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubugenpoll: no edesc ugenpoll: no pipe ugenwrite: no edesc ugenwrite: no pipe ugenwbugenwiugenread: no edesc ugenread: no pipe ugenriugenrbugenclose: not open %s: secondary, not changing config to %d %s: setting configuration index 0 failed %s: setting configuration %d failed ugenBAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d hid_report_size: lo != 0 uhidevwiuhid at %s reportid %d%s: report length too large (%d) uhidev_intr: bad repid %d %s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no report descriptor %s: iclass %d/%d, %d report id%s%s: no memory uhidevuhidrea: input=%d, output=%d, feature=%d uhidno usable key codes array%s: was console keyboard : %d variable keys, %d key codes, country code %dukbd: %d button%s, Z dir, W dir, Z and W dir %s: mouse has no X report %s: X report 0x%04x not supported %s: mouse has no Y report %s: Y report 0x%04x not supported ums%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: waiting for refcnt Bulk-OnlyCBICBI with CCIISD-ATARBCSCSIUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%s%s: usb errors on rx: %s %s: warning: Failed to write register 0x%0x %s: warning: Failed to read register 0x%0x %s: warning: failed to read SMSC_COE_CTRL (err=%d) %s: warning: failed to write SMSC_COE_CTRL (err=%d) %s: warning: failed to read initial AFC_CFG, error %d %s: warning: media change failed, error %d %s: warning: timed-out waiting for reset to complete %s: warning: timed-out waiting for phy reset to complete %s: warning: failed to set the MAC address %s: warning: failed to read HW_CFG: %d %s: warning: failed to read HW_CFG: (err = %d) %s: warning: failed to read ID_REV (err = %d) %s: warning: failed to read MAC_CSR (err=%d) %s: error: smsc_chip_init failed (err=%d) smscmii%s: getting interface handle failed %s: couldn't get ep %d %s: address %s %s: abort rx pipe failed: %s %s: close rx pipe failed: %s %s: abort tx pipe failed: %s %s: close tx pipe failed: %s %s: abort intr pipe failed: %s %s: close intr pipe failed: %s %s: usb error on tx: %s %s: detach has active endpoints %s: rx list init failed %s: tx list init failed %s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: warning: MII is busy %s: warning: MII write timeout %s: warning: MII read timeout smsclrd'(3  AAAAA3C AA(A0A8A@A   ' &%"$kk؇CCkk؇C\Ckk؇C\Ck0k؇C\CHk\k؇C\Cpkk؇C\Ckk؇C\Ck k؇C\CLk`k؇C\Ctkk؇C\Ck@C؇C\CkC؇C\Ckk؇C\Ckk؇CDCk,kCPC@kTkCPCkkCPCkkCPCkkCPC@k,kC`CkkCTC qAk؇CdC qAk؇CdC vAk؇CJC kk؇C8C vAk؇C8C wA\k؇C8C LwAkCXClAkCXCAkCXCAk؇C8C A$k؇C8C LATAdB`A6@6|0}0 A%%K 0p 0, 0AH0o0N0k010f0[0/0/0h/000$20/050/0h/0/0Z0xZ0Xj0k0h/0p10X0W04j0k010C0LZ0X0Pj0k010P20V08Q0,=0 10h/040 @ @ @   )(WEVrdroot2.5M@ NWEV%  08`Q<  QH`/mntrp Q`@@<@T 08`Q<  QH`[~ [~Q`@@<@TU Qp` bQXZzWA QQtdQtdhaAQőQőQőa5?;AQ(L Q۶Qtdpx V/MQnQK4>QK4>bpS QK4>QVI QVI iOiHQ!QLoQ d1QLoQ) Q m Q) QQ (08@HPX`Jjq]?K%IBb:ֹ ]=}rm&N[qi I =iM}Ifzvn"lfTApyXZYJܥe;] ;Ƹjm?',#:+R#D:QpC]B9w i{qŔR1Q<N5qs"jrg"8TSx{O޺BsNqOU?M( lXLOȊo,A`6/I9Bp^lhz XfQV~ =puTwQ:ϒH2tT#FOxZqgr#k(%8ZgR ҿ!\ݳ;<;$@?r Du&š-F^f`1p^Q!X@ak:ņ"x=Oji.,YfB9M*z&?p42ʥHs(\[pHpLE.0yP^HsBE7I*nx>;^t v ... export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- $(dmesg | sed -n '/^root on /h;${g;p;}') rootdisk=$3 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo ! : > /etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT while :; do read REPLY?'(I)nstall, (U)pgrade or (S)hell? ' case $REPLY in i*|I*) /install && break ;; u*|U*) /upgrade && break ;; s*|S*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED." ; exit ; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED." ; exit ; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!" ; exit ; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startftplist munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!" ; exit ; } mount_fs install_sets finish_up  . .. bin@ dev etc mntAmnt2[sbin[ʢ tmpB usrvarinstbin.profile( install.mdupgradeinstall  install.sub md_installboot() { local _disk=$1 mount /dev/${_disk}i /mnt/mnt /mnt/usr/sbin/chroot /mnt /usr/sbin/mkuboot -a arm -o linux \ -e 0x80300000 -l 0x80300000 /bsd /mnt/bsd.umg cp -r /tmp/u-boots/* /mnt/usr/mdec/ BEAGLE=$(scan_dmesg '/^omap0 at mainbus0: \(BeagleBoard\).*/s//\1/p') BEAGLEBONE=$(scan_dmesg '/^omap0 at mainbus0: \(BeagleBone\).*/s//\1/p') PANDA=$(scan_dmesg '/^omap0 at mainbus0: \(PandaBoard\)/s//\1/p') if [[ -n $BEAGLE ]]; then cp /mnt/usr/mdec/beagle/{mlo,u-boot.bin} /mnt/mnt/ elif [[ -n $BEAGLEBONE ]]; then cp /mnt/usr/mdec/am335x/{mlo,u-boot.img} /mnt/mnt/ elif [[ -n $PANDA ]]; then cp /mnt/usr/mdec/panda/{mlo,u-boot.bin} /mnt/mnt/ fi cat > /mnt/mnt/uenv.txt<<__EOT bootcmd=mmc rescan ; setenv loadaddr 0x82800000 ; setenv bootargs sd0i:/bsd.umg ; fatload mmc 0 \${loadaddr} bsd.umg ; bootm \${loadaddr} ; uenvcmd=boot __EOT } md_prep_fdisk() { local _disk=$1 _q _d mount /dev/sd0i /mnt2 cp -r /mnt2/u-boots/ /tmp/ umount /mnt2 while :; do _d=whole if [[ -n $(fdisk $_disk | grep 'Signature: 0xAA55') ]]; then fdisk $_disk else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in w*|W*) echo -n "Creating a FAT partition and an OpenBSD partition for rest of $_disk..." fdisk -e ${_disk} <<__EOT >/dev/null reinit e 0 C n 64 32768 f 0 e 3 A6 n 32832 write quit __EOT echo "done." disklabel $_disk 2>/dev/null | grep -q "^ i:" || disklabel -w -d $_disk newfs -t msdos ${_disk}i return ;; e*|E*) cat <<__EOT You will now create one MBR partition to contain your OpenBSD data and one MBR partition on which kernels are located which are loaded by U-Boot. Neither partition will overlap any other partition. The OpenBSD MBR partition will have an id of 'A6' and the boot MBR partition will have an id of 'C' (MSDOS). The boot partition will be at least 16MB and be the first 'MSDOS' partition on the disk. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} [[ -n $(fdisk $_disk | grep ' A6 ') ]] && return echo No OpenBSD partition in MBR, try again. ;; o*|O*) return ;; esac done } md_prep_disklabel() { local _disk=$1 _f _op md_prep_fdisk $_disk _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ; AUTOROOT=y ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel $FSTABFLAG $_f $_op -A $_disk return done fi cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel $FSTABFLAG $_f -E $_disk } md_congrats() { } md_consoleinfo() { } ELFa(4"4 (|M|MQQ88]TTTۣe$$OpenBSD -LP@0! MP@ -0L@ 0pS`0& 0 /R0 R S000  P P00<Q  A P 00  00PL 2 h0-L` 0 R   1S0B@Ct1P @D0t0($<0< 0 R-L @ R0  0S00l2 -x@x @0LS ``00T0H 0S 800S$0h 82  p-L 0P `P dpxP E@POU8 y (4iPP n8TЃ -PLU`p 0S /t0PPQ @Q  EP P0 /iЃ Pp-L@P`D ph0,0d -"L<MȂ0r"`8K01P@H =DP  P0Sl @v`Ÿ X08@ T P4  0` $8 000P  10S000 B <1 0S0 Sv10S 1!0!0S !l 7000@1@1@0,10S0(!1 P R `@T00SRT!0L$0S 0S  0L$0S 0Sl 1u(K, (d>`t̎ ܦd@\ -LM K `wp@Pqx1 pw 0SM bR KR MR(mR wR kR!$+%$+*$&U'T$0@P 0 !$/UT0 0 @P 0xS S *Sd1#pUT D0"@ 042u 0 -u@P td -L0 $, -L0 $d 0-LMK PWp@1 cw 0S7 bR KR MR mR wR kR$%*T0@0 !P00 @0xS S *S T <0"@ 0,t0 t@8 td -0L00(d -0L00(, -L0 -L P00 -Lx0 -Lp 00d, -LM$`K✠p圀& @PBP @Q` 0 D Xt 0R00 (0S0(kȧB0 R0 ,d -L 6tt -L -tt -L $tt -L tt 0-t0LP d0  a0R00BAq 8@0P 0R0 : 0,d -L1P``8q8L  rXPP  / N0S 9vP00OU0@0V 0000 00 0U0 0 0 0S0|0 0  `se0 f` R*Rb0 00d@t$Tx 0-LMPKvP \u0: S D4 K@QP0: S S000K0tm @ -ELP40  VUPD40S0o DP4000 T0$ 47UP 0l h4P$,U0000S|TD$(4 0S 0@<Pc0S 0<P 0<PgudpS $0   $0 D0; S 0 @c$ #"yu0,c`V rTQQQ"0spy2Q 0Sl*0  Q @ DP Z "0  lud0s0 0W0#s0 0 0 0  P0 0 0 0000000 0 00 00P 0 B00m0 Ha00ؐ0q@P00Cs01 1R 0R!0R 00 l R R *p bQ u@0 00$00S8,GdĨ(̨ܨtd -LMb,K$ (0 b,0P a,  B=9, =( ,(0 % 1',@(P% 0* 0pwOKP PP0t!dphPP?L@ @ H R <1<R^OKd0$!?D@ @@ ` R 0REOK$KQ0d ?(@o@$,0(O/=@0 N d0+ 0e*`K$Kq0dP P?(`M@ $LKU$K.A?,4<Th -Lg@Q -L@_ݣ@ -LMpa0@ 0P$ 0$"VpLq  G@Pp: 0,0 00 K3KNP7 s P$p0 K03K,p Np   U0P@PX`$0 p S  0S@P$0S 0S(Kdmt -8QL0XP0 @c$ #"0#Vp8q 0 30`p @0( fP0 `V`@ Pl 0S0C0TpP 0  Z <Bq s0,(t -LB 07(d -MLM\"0`p( ,4 4"_p, R0@!S!ꔟHHHHHHHHHHHHHHHHHHHHH|HHHH\HHH!2pt1 aARB^KPEPE@PH ,4004 4 J>K 0C8t 4 D , s|P20-S) 6pРBKAL L P0 0$RpB.K0 B Bxpppp~0Hp0<$kr $er뜃Ī<ܪ`8ȩ Ъ -LM@pP4 PP 0S nS6 =K>`P00QD @ Q? P 0V0S D 0 YppV 0`pY" 0 0 p 0oSP00 ,KZ, ?R0S@p @ `o0 p000"S 0(o$P 0 0|okxp -LM`PP( @(K,pK 0 g(0@S *3$Kq -0L ث -LMP@`0ppT U@ 0S T  0((葡 p-LP@ Q`P P@Qqp P@o@t -2L`M2\Ÿ\[\ @ll2`  >~> > .~p. 0b0CS/[>KQ0C 0C /p g>K0C 0C6 cP$ϟ@T |6: S-  S lK`F `F؝@ /pW@P  :/P @TDP ``= t=%p=^<= X=T= L= R =.4=0=I<\.=@<8.$><7<,2<.<<)h< << < 8< <|< l< < \Q9 Jv$@T , 0RP(K [ ([ K@ @y5 K@5 ?%pP9 % R%6"&  P660X*0 ^PPS00SB %5R> P;X9:@X &0ST#3*&p  6PX&  \ 6S X*cQ&P50U&00Q* ^ 000S 0@6 # 06U0 $!4060!40 4 05 0!4 0  40 ,40!̠!4!05#Ƞ##0  %$0""Ƞ"$ %@"̠""    $ !$ )0`L(00ST \8 4  (0d8 [NKR@D@D 6(( /0S66 { &d?p 6P & )GX $9Q  ( 520#$ 0 0 P0C"$ "40 && 9  0@!Nav. 4 0 %9R X2 5S X R 0SR0aA006 6 r0CC C C C CCCU B!!!Ƞ C CCC CC  0C0 [0C*00S @T ,'&U0& U 0A Ah 6,%PD az[NK@D@D6d+3(P \00 5 % \6 S(+p 5S,+h 5S0,` %?RM5 c02?  5 % B QT<Ps 5P n @ S%<T E I @ )6S >PPM&Y<Q &Rp5F0%Y%\=R 66  Qk T  UtX%YdY p0Y |YY0YYYT{ 0Y Y 9[&0zY&[sYA $6~0#0P`6 S ^ʠ 6dWY5oxRY|Y LY[FY' -LM00PKpa@ 00p `7P2 `00PU4 @uT <T  0BS0^T0(@ 0 0 K?P@ -P0(~'P0 0( t'P 0`7Py$K 㢩P@$0 R 00(@< y$yоp P-L XX\x -LM( :'P( (( Q5 (K`P0 0S- = '@PS 00$pK PcU% iU, lU3 oU: 1Q@ Q 0S&P0$ 0 Q (Q K( &P($00&P($00&P($0 0&P($00~&Pt ($0$0T&P@ ($0(0b{о8 0-LM 0 P`pX0Q @0D0 f Q<@ɓ 8hYо$0 C 0+ 0| B-00 $0 0 0+ -00S 0 $: 00 $ 00 $: 00 $ 00S 0 < 00 00 < 00 0$ 80 0 ( =K 0  $0 $@+0S  $", 0 0 $ -LM0@S 0 K0"050 00 K0" 50 0`t - L4PYot  - L4PYnt  -LM K00"4PYt( -Lh薖l0$吖4 p-L MP@`0KP 0S00Kp }Y< p-L MP@`0KP 0S00Kp aYD -0LS@ h?@Y 0 << 0 -@L圧t;0 0 -@L吧J0 0 D0$ D0 -LM Pp0`-S,0C000P(K 0(P N5@P  0SK0 Q0vC$v>  ćpL$ p-L0 `RP @ R $P0 00 0 0 0 p01Q @ Q $P0 000 00 p0Q @ Q $P0$ 00$0 0$0 pp0Q @ Q $P0 000 00 pp\d 0-,PL0@S vp000@0lp -0L0CSQ 0M - LP^0? 0  P@ ^00 ,00$0 #delH p-x`L@PTd0 \p$HP@8p$ 0plpdt -LMR p, `0 P 0LS < PC:@NT   ݔ@Q Ք@T` @a Rb:          0 Ql }@!` y $T u L &q?QPP  ( gU b  ^U XU RU  LU @  AU   @ 8U x 2U  d ,U T    H #U 8   0 UP0  P U  Ua@  U@ U U  Ut 2h@  < S S @8 U $    U  U U0S k\0 `p \$ ^ 0 R AdPd␐K 0h'l"0 ^K0p4'a" W Ƈć pG\W K⼇K⺇, 0R(Kp0S i^0b ^ R@ |W0S  dP^  L/ E80A$=@061U4  +@3'5# 7 U6 i@8  < S1x 5 U2     @U.  ., 0 2 *0S2@T P`K0 0d$! @TO0xtld0-W  R0Q4@eU   L@ZU _ 357 9.@< 9{ [ wU8 @8pq:dm <Xi F LeU;  ;8_ B ,[U:   9S@ U S?  SsGp mX @ R @; 8  45 02  .stS@t$+\!"0 04 t  21PF-PB)P>%P:!P6Xz뜃dpYX hxD I <-M\u!pо iyEq Ht =,L]tu <HX 0` -0L ˷ -#L`M#0㘣p , 0x0 0S`pAᏎP UH#op a0@S<D`0`K1`x ` ~Pxt K/P4Kx /PXqL\\B3Px tLT`0S0 t 4` l h 0SD PKx@K 00 Q/ PP;P `000C S61|K 3|0`SpP :6  0l0 00 Ql0S$h0S x#/P(, 0R((K` t `` K P  0l0 xVPSqxQpQch`SX\Q0 S뜃8<08t@ht@`8tgthp\hP@ -0L 0㼶 -NMLM0S( `@p2"IK\A2A0PR2 R4: S 2"t2Q0T/ 5@P> B^KPEPE0H"@ PINK2@D2`1@D2k*HP0S: 2 RV0S% NPP( 0Rf$KINK@D@DP4: SLQlGQ<1c\ 0倌P1K0PA A P+%4R%4R0 R p?P0S?00d Q00HP@P0*@>$x|tt -LpMP@"*np1 F0@-SD41 0bSQ`( S+ S 10pKᤤP60: S" 0 0 0 0 0 0  v qQP @P PQa  :R8<|tx<t -LP(@`8-p?(B@D 0 TX!h!\!\!\!!\!\!\!!\!!\!\!\!\!\!\!L! t0 l 0j@8P - 0a ,0  0  0 p=>P?> *Q-L QP!00&Q ڎPWP PX -@L8 0< 0+ 0@ 0t05 d`c TT 5 0@08B t0\HX -LMp0moK@e/_K 0 e/ K 0  K<0CK0H#2! 01 "2(! $1 "2d! `1 e/ 0RKd뜃\" @ -L4 :8 6G<PP@ 0x+ @P\0@SlPUPJ0p,0 ,00P,0 Ap0@ @00@0  00,@ `Pa0P`0 ` @@0P0 P 0S S/`!1X  0S ,00P,0  (Ko1 0S1  03  P0   _00C  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxhpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    h p x  l 0BX 0:@HPX`h|4t p-(@`TL:P0(@e/LP 0S0PpG -1L M @R_1 R 1 RI a -%P|Vxx a0(Kpg@ A0BCGpD@EPF`H,KP`@ Pp`g)`1`V <(0aPPP,@4@PD(*P,*P`V\),/ (- 0St$Kl0ST`h $PTIP$P@I8I   rdA, ,8,edAsd 0 p-0008L`@P0S pd $P PUDD $Pp(pfIWEV-gdedA l p-L`@PbsP e/P ,V  phSp F -L─ M0 `("HPpP@0,  40 0 `("8@@p00@0N 0  0 00C 0SX 0㠹Pl08#HP P0@@4Pa 4B0Q0, @P: 0S# ,3 0S% ,!,10!R ,$1 RX, 00CS0W, 0 0(K h1,!`  0S Ƞ,Ƞ,8 0 00C3 0 01 0 0 0 00C 02P ("8 Ƞ @,HP``pP00@p@P,0`a 0p, (Ko, (Ko0[, 4 - LM,0 x3  Rp3 !hd 0 T 0 BCD@EPF`Gp@ A0$ P@ P`p 0 _X02 R00CS00  0( d, `0 \8 X4 TG<PP@ 0 TI7B0S007|"0002"000-HB0S00&{2~Ta @ᔨTW<@TO1 RE ET@0DS?e/PZ`PG <0@PD0@0- 18!0*0DS* e/P$@P @@ 0M>0 0 |@Th lE \D< , -  `8,-     t820P#! 00"8Q#(-0 P`0@p` P0@ ` R VUQ -LMPP`0 ` TP4`@p080 00 R0  允    -LM@ pN 0P`PBT 0@i icxd -LM, (0 |@T 0p-`\ 0G`P 0p<,K 0 XXX 38S P 0< 8PS$K   0<H  -p@LpP20` ````aPUP0SQ p-L`P@0S P@@T 0S0S pp -Ltht -JMLM⼒0 S, r JKHH x 0!S00R0S P@2 R[ 4"42A@CB0DFPG`E  P`@PB~K@pGpGT0! (0K@ 1Dje`P& J^KBKPEH@T p1Ra0X @PU 2 0Qa0 P|U , 0R.(K`@ P0rS /@P PrUB~K0pG0pG0t PB~KpGpGH @08N ,  -YL\HlD -L`pPA@~0P 0 P@U @TP 8@P@Uc@> -pPLH ^#`0S S 9@ @00@0 2001` ^V$ 0#P BVp -LM< P 0P@ 0@p" Xli 8 < 2 4 0 , ,0X}y 4 R0 P0`@ Z+y ,0Rea R(o <  P1 P 0p`@p@0 p pZ p 4 R0KZ  R8 2t0 8< 8 P80<" 0@0 @(K W<0@ @00@ 0 @<0P 8  P8 |0Q0K0W0pKYy p QY  @P`P`$0$  0 @P`   -rp㠠L⠀.P9`@ 0ᠠ Q PX Q PPW 0-L@P @TP@P  0 -q0LP0xA P@0 S 0C00?S6 U9 S74+*0?S0UaA!   C~ yP0S02P 0S 0`00 `00CS`0X0  X0 3r0?S TP<壃@0 R 0X ,[  -SLMn UP !dP( uPYs  -LMCDE@FPG`@A B0pP@ P`| 0S aP P0P H Du0P00 KhKH|< Qp-LP4 *P. a`@V00?(V \9@ @0@0 @0@@|P@@Ap(``` ph PDphphy 44#P(0 ph,@|< Q0-LP0 a@Q00?(Q` 0h \ \\ \ \ 0h(9@ @0@0 0\0P!T0h HHP< 0 0hw $0h@<| p-LM L`,K$ K0K0`,@ (P `^ p $KKp< -LXM`K@X p !PP 0prSP00Q} @@Qw  P1( K0T00C8Spoo{{q`1@ 1TP`{ T@T`0SP`00CS`0NX0  X0ll GPP \/PD ,@'P2 @T { 0{`0@ 1TP`{ T@T`0S x ,0ሠ0C8S(K@@ X 1004<T ,DP -AMLM08 ,0 0S0 0^<4 1 \|, 0R(K P0p4t 0 `p@4T0d P@ `P`4T 0d 0 P` 440D0@pT44 0D : 8d0 c0c#"raa`  {!{8 08 0BKHHhQ  `z@ ,DK"P/ +4[,$[ SSa B RR8t20@8 <01p<4X SP0`@0D Tp4TU0 R `00CS`0 X0  X0hX ScX e^꜃ `,  M-LCMT hITTBK8PH0@0pHPT , ,4K PP E(0K 4R S 0C4BP,[?\8n,[?\3X 0cz ᙏPh,K0So02P 0Sxȟ0`00h`00CS`0 X0  @PLD HT X0,, 0LHR(K*\ \UL L H D @$  LD0t0   D\ P 0OT$8 P`LH 4$  0A LH 0p5  B$ 0S @L4 HD 0T 7 R4L$H4y_P M 6D @$ <$ 84 p-\+\PP `0T `lBK0A0Aᾃpl0"S 04 R@TUTD@ 0<$84CL H +V -V~LH$Y L H$ wHTu{{+4[Sg @0D @ LD HT g0E(@Kp4WS%000ӑ%0COS񟗣8{zuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuzzuuuyuuuLyuyuuuuuu - 2L(M 4 R 08 R (KP6 00C BC1  >Pɯ* /0 , `p 0h!4d@P `p0a`vp v 40(@PU 0  !  3 00 ,0 w 0 w 0T @ , 0@0ᖄ## @84 0@DgPt @@0MtA@@  <X  -L(M280 4 400 , 8` 9ᘀ@\\@P`pP@p@ P04xx! @P0@K0p0pp* w1 P8 84 0P`0 10Z  0 R00衼$/ ,0X%! 8P4O p徉q 0px h0gh L0`(K0@W0 K $4pY    <   -QL M, 3 aIZ00,0(Z` (KoJ,  20P` p0@ (Ko8,0(, $ 0 Tr, (Ko6 88bP,0 (Ko@|   < -$ML4 `)p@@0P\0XX"`p `p0Pp] xi 2 R B0  00(Kf A0 SP40 @P 0P /0U T04 P ༙9@㘀p@ 0`Q 0 , 00K 0S@P`V00 ,@ :,4@0 O09 T 0 TSq 0q0Sy h0cSQL# 00U U    <$  -QLM`N aP@U00? (Ur \9@ @0@00 ,@K$P K(` Kh)5PPaPPP H<Kh  44DP(0 Kh@|H \ < -LMPpd U a@Q00ϓ4 TQR4 "<  0S 9@ @0@084\20    8408#8^8<0 @ 0 @ 0  P `   R0SRP `  hp d劺(K. L2Lh<4 8 8Q`P弙ᘀ4O:4xP580P`0(0 @ Q Pd&  V]Z V^[  Pʀ q @<04P4P 4P4#P @00 0000*PK0@ @00@000\00S a0*PK*0K 0xx)0KJPP P0\x\ @(oUU@ l <  -L M<G 0PP@@P!0 `p0 `p0 , 0 rT 7<@ 0@,@Q0 PG 0PP@@PDL1` X0K0@TP !p0 `ppP`+ 7<@  0@ 00KQ V$ 0KP,0``|dTP00KP0(K,0s\\0 (KoOq880 (KoFU    P l < -LnM0e/ K,0 ~t6to0hFh!dP2 XgP: Lf@P _PD p@PT`U o 5oP` 50P@!`pV5 R`00CS`0X0  X0Udo00@@V UP`8#8@00, $P  O<,@P0 $`p `p0p pw ,0@P0 $`p `p0p p} 08@P0 ll$`p `p0p px 84@P0 $$$`p `p0py pl 484C 0C`F ! R! _ 0SST 0P`@@0@0Q a H $0p`p@ p@ pQ    11({ |1yP0@`@w_K`0@a0@TḀp+r?K 0S@ $@0PoĶ K !_0B 0S" 0H @P2 0<S0Sk* P0x~.Ke/)PO 0<p 8唎뜃@Tp 0< -L*MgKJ0J e/ ,0 0: \P WP QP ; KAA  O PP[( K0S@ (K0@ @0@0 5 S:5 5S:5  e/ K\ e/KX `:K@0@: J :   P @P |PuQUQ 0ApS t$pl<, ܯЯ|P\ ԭtȭ, T 0`p: @P 0STHK@ @H Lp 4iPP  0O6i  0  Ke/PA =P< NKKAe/ 37 RR  `@ h f d Pa ǟ, 0R(KTk 47 Re , JP7ǟ e/SNNK@D e/LK e/He/KD x l _UR lô@Pl  0Fቶ `@0p`p @TP0,,@ P0 0  0ӴnU @@ 0 c5 R  [ \WU $0N VK0 $YE PB > <: 7 3ğ$00s03S09k' Ke/P NNK@De/ Ke/ e/K @ = :d/_04 R L4 R 2 44C ( < P3 @r|#00@@T  ( P~ Ke/s:^(K0S (K (K@V0`@ N lß(Kh3开(KⳀ 廅Ką 弅KNKe/K@Ne/ KJ    3 R `00CS`0QX0  X0q0 |:K{*KX U`2 RT2 Rf "+P P|"0000ӑyS PX"0000ӑnSP4"00ӑyP/ @pPYA^`A 000=00C0V+S+JX # PPE 0SB 7 1x兽;  @P e/K ,0e+(( K%L e/@PD^ 5刋J@/*뜃 -6j,,>8@PL-x$  ,8`    rdAhnh `|<3 -X0L R H0P808 0,bC]C蔉--t. -Q@PL0. P0 R 0 0Q@P`0 p8W  0 tQ\d cC0@ 0PV0@0Q@`p꜉-X -1LM RKxa0S l!00CSP\QT1  L1\*\&81 H@ T\q 0'Q_ 00@TP 0Q00 BL\ 000SBQ0 0 X0@X$ KK @ PP@4B-- --m -?MLML$LD0\,0 P`040S- S! Q4 0Q Q R30QC00, 0 R(KQڐWB0p0\?KK(@D@DV ?{KL(pGLCpG(0K8 P0(K  0P?KK(@D@D?+}PŸ?+}P㨢00?K@ 3N@PdŸX@'  Pw ?K#N @ P[0":BR?+}Pʡv[!+BC1V\ pǏ 0(@K 0?KK\(@D @D PoP[M[0L!B0 !0T01 R DWFPDQBP@+1[  A0@09'[  A![ AA[  AXU [X A[T ꜉m-h|L< 0-QL@T0 R 0 |P0 @ 00 |Pڜ0 P ;;Sx0@@0P@L0 D(A0Z, 0$ bA꜉---  -?MLMt0t` R   0RKHp0S?KK@D4P@D?+|PÈ딉 -r0LP@4 TP< P002`V%Pyڀ;;S@[h00`2 0SPPU>TA y42 Q @P>@VU@@Tʼ!000PZ0 SX Z0SE Z0SA Z0S= TU@H}@<1 4v@$q@ 0 Q 0O Q *P@`@@Y0S Y0S Y0ES0X@0yYT 0P ~@@6@00蜉-\ 0 -t0 l0RL T@ 0`  R)PY I@蔉$ p-LMP K`@#P1M30P/T  M-J-@ C)A) 0xePKpT 7- 1)/)/-,-@@ '-(;) 8) 4)묉dDTh -L$MePp )x5tp5 llu d%d5P<<HU  %P4p 5Q ~0STP uP T)Pd0: S   S  S00  0 p 0Z0X4X$T4L4DqX0S0C00Z0 P6U #?PX0#j?Um t#/P00pn P3Q  0SdL3L# 03 (K# <003 "?;00Zr H2 ARRŸ:0Z P% 2 ZN 8pxŸ?;0P`? 0L L9 T2@P`? uv ;0Z 2?+ "2 P1!1 1!0,H KLP00Z00V;;S\ @1`V 8p ?q1!``0Q 0 vW0 >W0 >LW0 >X0 [>' 00 KW\ 0x >꤉--- -------|m @ -LM T0St0Sfc0S3 RCu'P$K d0S 3 R 0 0R R3 KtC 0 S `#000 R HS0S@ <3 R(00CS00  000`V 2@_P[2@0} +0 0冭r00d2 Rl2 Rd `2 RxL00CS0~0  0(24 abĸ0Sy B'Ps0: So<08@@k1Nk@f1!11 R^ XAP[aXP0  000X`D0K'vR 0 )9v|00 a-zDPK`<0K-|圀\0 H0  w ꜃L..D.,.. ..<. H.` L  -L%M$MŽK5HU@(KHd%,@  P-KL' 0Z/S /0 0 0*KL5%K(II (tKLPnKHD0: S p8, 0R (K.0[/S b8Q0$8G.PP-PT4 RmK(`F(`FP% 4 (K )PPt0S3 R5 :KH5@/Q  zKHP #8ZP  /,4 PP|0Sx H3 Rx a=( Q0 <SHy/P%P,:KL%.$PB0S2 R  P0Su 2 R a=( Q0 <S`R0SBTT2  Q 7 P 4<S S8 0CSWP[0Sc A0S_ 1 RK!00CS0Y0  000Mm-PF"d1 Ra=( Q@ډPX1@1  p(KP$@P'( K K(A,Aa=( Qڐ.b0 wE,P <7UK(A,AO {꜃TX.   L.D.,. .. ..-4.<. ! -L Ml 0,0 p@WP P0,P2,$00Q./?`CPz(P3 , Q# .Pd.P V 04  3 R(K,PI+#WX<30 SS S p$P,Ks+R P, EP0"6+2 R6R0S S=ڜ2 G"000 P60S \R0S P2 RO4"00CS0r0  000,K+`p-P,PU~\,PM11 0,4 K@,K`0S XQ0SV^4KQ..PWb=0Q!&PO`20 ],K(+@0 R 00CS00  000P`P,K! L@0 0 DL.D...!h..-<.  -bML$Mx0x@ R  v.P P L0 DPb K@$@ 0RK }D. -bML$M 0,0 @P T T 05, 0Rp(K0DPA0 P0SN0 XN!0Sb}K(pG$pG h1h `[b}K(pGT1 $pG -PX ,PDPK`<0KP AP&P0S 0(@P>*wP0S @0S ,-P+P8 D0 00(}뜃0!D..t.`!<.|0 0? -1- -T2LMR`u<0S1,5P}""0\ 0 0"Pl1!!0ȁPp P+0@PB 1 V PaB P 0O0@U <01 1 U Pa`n,` pPoP` , `, 00 0Q ,@P 0  `P0SPQ~8 @0 0@,0 --!---8. -PQL`tt 0hpcPP@@ o0Pd0U`00<P-- 00b0T- -ĀL0S` pP@P 0@`Ph0lP/`T0 P<0`  `00踉----8. -QL`ڀp P P@@ 0Pd0U`0 0cPʥP eQ -- -a=LpM00UpE``a 0 cR#?S }oP/0@TP0U0 P-0 0 30(KR 0 P0TKPa=p Q 00C h3T&M< 0< 3M 0 3--!!! -LM a a= 0T ^,  r  K PKX0S`pP0 PU ?`p n@P 00Kڤ\,K  PU ? U?l1 R \1 P0%3P ,\ 0S4  (KL!0R30SK9P$ a=x Q 00C 020S zLl 0d *3<0 RhL$ 0$ 3갉-Px"(""P"" -LM Qa  0p" ,0   KP|X0S<0 0@W0 m 0 cPL@_1UC@ ,K  00Kg PKڬ1 R000  PJ0 RZ0O`VpW' ,Q 0SE  W+ڰ 00 1 R `(KT@PPV0 R  D2V K0T u2<0 }V,0 R --h."("P Q-LP`.Āp 0cP 0OT @ ^ ?PU`V S0U 0cP,0PP-- 0-D0DP LP0,@  `*0 0h--- - LM q00l ?S 0P`PU`@00(KR`1 ȟ 08 80 4@ !,0( K@"4@@4@ 8K8P6 0r00KP`PU`8KP` V0 0bQ  Q 0PU`0V0ʴUP QP---- -@L0S< 01 R; 5P=qaPP RPR $P PP 0@Pڠ0/0P0 l 1PPPH1PP 0@괉----@## -@2L @RPv("0S "00000aPv0 0bȟ` 0 F!#PY(% &P@T PUJlta0`!0Q0:D0 R 19P0X@P`P0 00 0 0 0S @0  NP0 pj0 <D 00 00T8.-----#--h# -0@ 0RL0 0P00 0 0 R ? Rʂ;;S \<"0P4?;0-1------$# 0-A!0QS0 L? Q!ʁ P$~ Q0 09P 0@ 00 ~<|/0 h?;/0 P3ȉ[{W|Q  @4S4S  P00q-& -$L00; Px0F#0  00 PmP 0N0& Pc0V#0  0 PX P^0 PO n[PDVP? Po000c@`P300S S, S* S[ 4b-  0@na- p0P`@0S@b-P ``6 0x P] T0 t)hsq (0 P)꜃0h.q'q`' (,$',8' -LTMs0 $0 PP2b@ @0R2  0@`p@KStlttA 0 P| 0z P d2 \L)$ 0R K a=0A 0 P 2 4)1 0S P1  0K P1 0C P1 0; P1 03 Ph1$ 0+ P 1* 0# Pa=0 0 P`0;  PLZP UP00S S S S  DPT0 l(z`pv(0 H(o꜃0q0(' (,$(8'0 fh.d0 h. mQ-L }P `( mQ-L pP h( -2L pRPk nPdb0@ N 2 H 댢  B x2 < d2 .6 P2a-0C 6 am` &% 2 > @ F 40@44!00 N @ V 40@44!00 ft1 ^P@nzP0@0Pn000c@01P 0: S  0@P`0@0S@P`   mPP` P`PU`0@Pmh. (,H$0 KQ-L P p( p-PL`LPpb-0 @ y1 s1 mp1 g\1 aH1 $[41 *U 1  00P ?P+ !a= a= 0 A aM@ ;5P0@05Pl 0: S 00 0 <n? KH 0P &? K 0( &꜃`((L( R0-LP@0 0Q D P?0 00hu&? 00hn&(( -RLp`` 0S 00000SPP0e00 R  R0S@0S@Tz /0EQ'`R=  00z z  P`Xi@pWvP  0ipt@W? 0d  &O? 0H &,4$%@|.x. )()P) -@L!TP*? 0h%`) -!L@P? 0h%`) -L@)Pd0d P ?0S >08 %(0 R*P t. ). -L@ -Pd0dP >0S >08 %(0 R*P t. ). -L@ Pd0dP >0S >08 ^%(0 Rh*P t. ). -LM\@ 0    |0 R p0  Q KGP K@0 R0 K0 GPm>0 !%) 0-LMPQ@0P-0Q   0;0Q*0 R0 RP 8a= 0 P2>h 0K0h$P0P 0;P0 l.. 8)(, -SL0M@  0 0 0 R0  Q c K0OPKL0 R00 c K0@P=0 $) 0-0LS@P 04 00S0 0  000h.8 p-LpM`@KP X0PUH0 Q Kp0 Q $.) -LpM0P/Sp/00/`K@P+ 00P vpP0 R PP0T@  /0pG0$Kl.? 0-LpMPK@nPK00 R |0: S xQP7=0L #-PU (=0 #.H*(* -ML\4M T4` , ( pᤔ ,$00CS66656l65 q#ß, 0R(KhPB <3@P Yڌ3 R3 =P0\## HA#  $3 +3P2 R84S 2P 2 Ru 2 pB0SF R0P0Q0S<"0;0QY0S8 TB0SH2 R. <2 0a=Cf}I.K B B$ (K0pCP4: SB^KPEPE!p@[<! 0 #U\1RP  P 0S8A0S,1 R  zj0 t0C @IKAADP40S$D0  d@ <4p " *.(,**0t.d.l..8\*T?* -LtMpPK@P1 R! 0R) 0: S/  PPP ;0` R "P X  KX;0p e" 0R H"P0 @N"..<++P+(0 P0C 0 p-LKtM @`KPP0: S  0Kp 0!b;0 "+p+ -0` LK$KP P0P p P8;X0p RD0D P0$ ! .(,+0 R00 -̢LP z,봒00@T) "0S@T B 0S 0x0t2l 0P P2P~0[P: 0"! 2 `R. qP00CS00@0;t0  R P- U. 0S ܒ@;t0 U@@0S0@q< \P  P@0S10 2 V0@0E 00CS000P p 0 S 坒  ᵒl j:\ !ďP @--H.,0. , ++`  -<#L M0`S$$/P 30C S1tAA\AAAAAA@@0" " 2 R D0, K(0K3P0,( 00\"  P b]b-0@ PpK| |@Dp g2 * RV  R,  R1    R 0! P;01 1$K R1    R!  R`1  aL!0!00 +P590 0 h h0 0S 00a͠ 00  00~PJ90SuPC9X ; 0 | -,x,.\,<,  ,80, 0-0L R0@T P@T 0S0S 0SU 88劏@T0P._,d0 R00T0 RL0  D0 R80 R,0Q 0 x*@.-$. p-@PL` 0SpPP [@P0/S/0C0T 0SD0 00@ `PPPPpcp,- -0 0R000000L R0000 R0@00|0 Rpl0P PT0 RP()d.-p.`. -.8-@-PP:P 00S S R U3 /R07Rࠓ, /R7R10P0CUࠃa0AVp7@AW0A  W UPB0A A0A R` S- L Q0000L B 0Q000B 0Q00P000BQPQL0 S0W0 ̕0̅  RL*G-MP : \ 00S S R 0 SY/QV7QpQ/Q 7Q 0AA1/Np 0\Ѝ Rp6p  RP"00NPo0A@N S@'.@a0N ɯb"T'nɯR'.0 0@ pS 0@ p pA- R`PN) \1>A P0 0` NA 0\!00 ` P0@ 0\!00000@\\N@0pXW0@ W@%2>&BP` PA:@0pXW@-@S1Q0 \ \ PT00΅ p-0LM @RP)P Q `K0 EQKpYPE  -0LXMp Q P@ a Ѳt`K 0@0PtK4@K  0\ 0R Ka=@%HL( (0T@@5eP. -t-h-` -3LpMß@0 ßT S, pP`$T2 R0 CR s00`, 0R(K6Ep2 R GT2@K  D2 R@u a `뀐K 0@ ?2PK0C@1Pf0 @P @@後!00CSBa 峌tA D0S'0 CR F0  0@10 CR 0,S 0S0 CR 0R X ݌ 0` 0,8,$8 #4ka-0x8

@垌0P 0@WP 0: SU /00K40LSP  ,Y0 9t -LM K`G 00s@P04 P, 0b0CS|Wg -= /0CQXZ] Q1pZ1@TZ pP0`VQ T=pPHPxN:!P @ P,PyP%X= R  !Z `PVJ@bP\ x< p TE@P <Pp=" P < -RZ < t < ,00 \xLAP040x+8< L< ,+00`D; x  R4 < I: ; +0*00*; *|; *l; *\; *L; *<; *$; : ; ; *000P+00@+00: *000`l: x*x: V): |9P sP=Z+@T @PPU p PPJ *YPPsP@9 R  Z PUJ P 9P pVPI hJ@P |)0Sp)8 X8 t0SH0S 0S P 0S70(K#PkP8l8D(8 @Lg ('dp 60@DSeeeeeeeeeeeeeeePe4eed4eeefee4eeeeaeeeeeefeeeeeefaffefeefpfaPf@fe$ffefa|dpdfeee`fX&6V HPi4&5  &p  00@JSHpgggggggggggggggggpgoog|ohogggToggDo0ogggonggnnnggggggntn`nLng4ngg nnmmgmflgllllkkkgk6Pp00AD4D$05:LUDH0pK @p g4P@+ LH 05Ml4$ dH@bT 5H@40 -R 0 T@PPՈ3 R 0u04@O33+ @$00x#h3 3 $00 30#03H#00L3 "D3 4#43 #00(3 00"2 2 2 "2 2 2Pi[,@PD@P xP !p000Yx2 O>B  P!1 h" Q<L"0S(!x1 4"0SHllkk\l "\!01@Q񟗲PhPhhhth@P0 P@ RP 0 1P@0SP1 bt.33-l33ȋ43(.|3p3d3X3L3@3d4.D43 `5 4$4ԊDn9-4LV44@4.<X.D..4l..@.4..,3-L.-$. .- ..`.-d.p.<5,.`8-0.55p5 ,3 04l43.8wP1 R (Dy R0t0 0 0 x0 S@P  P ! Rh 1R B P 0 0/U!d1 4QAH0pK @p 1P@  T1嬏2` H@T 1<埏BP2  `B0X000X0+KP*B0X<00X07PB0XHH! 3 3  $3  2+P20 R @a0BSmHmHmHmmHmHmHmHmHmHmHmmHm|mlm Rc3 3 4 4$ 4 $04 <4  DL4 〠 ?\4 @ :l$l4 6t4 1P4 4 +4  &4  !D4P 74  5  5   5Pl,5Pd`5  x5 5  5  5SPI5@P5   L5P36  $F$VQ^8 `0@0X6  l,``&0 0 R 07 Sa6  s@6 @0 S:i ;P6 R00CS010  0 <HD'0 0\\'0 0l 㜄P ql  e ♄o DY` p-0@0?PL`A PQQSp[P$ 0QSA?P0QSp*P0*S0*S S 0S P P 0SQ\ 0!SPPU0]S@ S -R \0]S@^ T P ]P \@\ 00 R /Qp$. p-@PL/Q@d ^`\0Q\0@0CR0QR0@00p 0p5 p-@P`L 0P@ 00CSp  0Pp 0-\0L@T P @@V@T 0UP0؋_5 -LcMK M <KK(@D ,@D KK(*K, K$8 岹 KP b-K( BŽKHK(B:K(H K@ KKK8  Px3(K -KY X1 p! * p00Q  X #R X[ K*K0* R &R@P \R  U+* R( &R@*K80/S89S6 K00CPaK2@0Q S``V 0eVO P& U:hPEK"(K00a Xp 0S  K@0 S@  X$:0 X0H KQ *K(0 -<[SL:Kh(d倂-<[S<, 0RE(K0 X*0S:K8S K(K:KK A(KT"K KR(/0S K\  K>K(\ 0CtK>K@( 0C(1,:Z-Kԋ Xd6$6@6|6 -MLM`s0\cP$0 0S0S 0/SK0S.00 @ b00C00S2 00S2P  0P 20SSQ SO 2 R0$ 0R KK @ ,<B0C<0S0S PP `PyP ` p`P8 400PPPP<8؋܋T8 -MLM`0PP(0  R 0`S @\S@ R 0S e`( 0Rd$KpP<  :PX00 R @\R@ 0S  R! H5R 0000S!  PS GS) 0 0gS pS0000 S0 0P 00pppp000\WBNK@D@D ;s 04κ꜃88 98ԋ8 -0LTM0 0P  d@KhP  i-@0 R d@KO ꜃.<.p9.H9 -L(Mp4PPP 0S s@P  0R/S 0R B/S@T#cP T /003HPKP P Pv Pi E3ß3( ,PK ß8@K0 $0 , PF8P>  P=80Sq  P480Su  P+80Ss  P"80Sq 0  ,0 P PP"00CSa؈Ј P(!E1 KQc v@0KH0 D@ @0KH0 D@ @0KH0 D@ s@0KH0 D@ |fa(!1 yP0 lP eP ^Pl0 RmD<H.9T.\.9P.P.98.999-:-1^ 1!3,H -L` pR @00B S R ;T PP~ .RT@ *000G S ԋԋԋtԋ@ԋd0!000!.CDRk?C `0 0!000!>C s 3 S R00C0` 1   !.B0r03R0S `0!000!>CS0`0!000!>C;S0Hp 0!000!>C10!0v>C 0C0   !.B ` 0!000!>C=S0pGҁt -PPL @TU /YpP 00@T`  `00D0 S 0,TV`0B .TQL@Tν@Pv W 0S 00 R MR- (CR1 0  0020S&V 0S00L! 0P@!<10@ @@@cR mR000 R000  P000  ῷP000 R 0` ᪷ D ᢷ, <::$;T::;:x: p-@PLp R @a0S6 #R. \R' ᦚP@9 / 1"#200b100c!QR 0S  RP% @ 00 0#R@ @\P DZ 4 T  O />3=`;;; p-@PLp R @a0S6 #R. \R' P@9  1"#200b100c!QR 0S  R㳼P% @ 00 0#R@ k@\㻺P D 4    />3=;<4< -@QLMp)@0@P`@^ K00\ 0U@V 0Q 0  K0P0 0@9!QU`@ p-T`L0S P0@T  0@T0PUp -pL0S& 0`SJ2ጠ匀PC0 S@0S  0RPEH Q S`VZO000 . p-LPP`p0"#200b10 0c1@T0@S 0 S0S00 00p/>3 -\pL0S ` PU 00@TP0`V,' -0L^2 0 R.x00S* S( S& 0<%100b1010b 0c1@T0@S 0\< 0S00彵h躵,$qv -MLM440S, `p 1 RQA0Q( @P:xBP) 00(00 徠 000, 0R (K0/S BKAAa8Pp ` 她P (0  ${ JR ȋ-X<p< -L@L0S 4 @00P[  -< -@@L0S (PD =< -@@L0S (P- == -@@L0S (ٸP  D= -@@L0S (¸P , x= -LpPP 0"#200b100ca R  R 0S0So@P ZwP 80pP  00@ᨴo />3= -p@LP 0"#200b100cQP 0S P\ 2`P 0@0 00` />3= -1PLP 1!@ Q0``ppP  R R 0S0HH!00 @T@p qP 0$V00Sp00S@0ڂP0 P  2 / ǹP 00 tp 00dP 0S 㳹P `$ 000=4> -0LCP -$L@pTP> !a@T vP @T {@P fvP avP 00@PYP 嫳ᩳTᢳCvP( >>l> -|0L@`TpP \ AT #P @T خW0G0  -鰁LP\^ 1 RS x0C RO0Cx0%100b1010b0ca@pT#0p@S 0P!0S ! 囮0  S;00 S0000 00CS 0"Ӹ@P uP 0 0  0  00@800,qv > -MLM"@0T,0  pP! @T@T 0S030S3 l!!!h, 0RH(Kp@PJ Da 0Q : kP K!!ᣲa= 000@ 0SnK`F`F ICP  ᆽPa=0 S0Ÿ!\ H_O!@ ,$G(>,??L?l? 0-@LPU 0)P t0t@p ] `0P#50 08 0$N0$G\.T.?(??  P 0S  PR00S0S 0-B0B N N S0N0B S00B N N Q0000L  0Q000B 0Q00P000BQP 0N0Bp@-^ 00BPB ` @@ ^0@0B ^00B @ @) \1> A0 P A0` 0\!00 ` P0@ 0\!00p000@\p 0@0B-P0!̠#*̠ 0 R0 R*0P  -t6LMl P, f PK PPKR  0P T4 LR2010"K+1K1K d4".K|0 P"K  ۹"K">KAЃlp ҹ 0P S0S 0\  0P"KXtp 0P 8S0S ,0\  0sP2".Kd 0jPa=">K  0P2PUwl2b"KB X2".KJ }"KcK 0>Pe"K}Pb R7000qa-1K1K <P`@0S@p">K|  0SP^ d1 A".K|5 0K P2L">K|6 0KP'A0 pV L0"K#0  0P$wp_ ">KB <"KJ 6 P 0S S00#~4@ -?@0@5(<--|@,--@ (.T@t@[ -3LM3 0A, S ,|Hd||<:864;0Q xt#lhd#T!PhH0 $#$(,"(h# Q Q  0S#hC <8#"h#EEEE FdF@F|FFFFFFG4G\GGGGGGGH0HTHpHHHHHH,I IPIIIIIIIJ8J -3LM,MQ (K@ 30S  lldx K(@T*kT IK@3(@D8#0 K(@*\K(HJK0#(@Dbڱ*M0"ѱ*D20S "ű*8P% `V"己!@P 0O L2ם 0m 0("垱 KK(@(A* K*(@ 1 Ra 10S] 1K@1@P 0ၺp` 0z6(J@P/1)K0 B0/0g9K00C/0*/0Y/0/0 M/ 0 K0L/0@)K0 B0/K 80 2 K(@ *㤱JK(@D (K PJT0TJ0pJ`0J\0JJY@J0hpX`J -@LyT  p3p3vH`0 -L M@D 0KH D000T 60  H Z D@j 0 S<@ @ 0& S6 0 S pC @8 K048,< 4 ,$!4 !$, <c00Q,, b=90 = B, 0 ,0 0&,02#`pǏşP ` P`0S%0S0S*@ 0#p5 ` R0 H 0 0 B0 00 0403  rH0@0 04!48#8<!D !|40S /0:/@0 h!Y`!<0XD C0RL5y!;@D4p0 S Ai!@PRb! _!P<0 T$*0T@:< Q* Q:L30  @< 0010RPH0V< X7!@DHP`Q @11:Q1 Q#!p@WJ*P 0@$4,<4("4 !! %!pGW JiTO "0S=l j0 JR !pR@T 0W T( ኁP 0 00@ c>'W` pV *P 0@$4,<4("4 ! d pW\ J TX RPfP Bt PJ 0.RP00@: *K LP A  1eD R k 000000]00z0 0w00t9 yeD d9RG 0Tˌ 0eeD )KR4 0  0UeD H R0d(H0Kap0<11 6eD t8R 0dP(upD8p 0gS0HPg ׬肑004 077 㿘wg A ¬0P0P~PP  000 eOKK,㜝d7@6 0SL   <F0S,7 0080 ЧP F p60! 0 Q:460  6 60<2S4&000 FP c50000 0PP<+E0@ x5 40K0 L5 40K   50<2ST%;0000U B>BS3  % 4E 40K{00@000 ' 0)[R00@ 0  0 00  0400L40 ! 40<2S@K(P #K K0 KP>Pl30 3@ *0K@,P(30 P3@ )0K@Ph30 3 00K PBH@KP#<0K@P Ps< 80R\#80KPPLe0;CS00\Lb$CP#0PP 2Qx"_ې"XR0S@ 0 z㗻㔻㑻@p a0 hA0 02qሦPP@lKPKL`K<0 @2 X0 \@ 00     \K0PT TK8 0j@PD0S :  P0 ¦ @ ṦP R ,0S:რ5B0`L@`8X0{Gz?0LLLAL?L0tM<4MLM`M!xMTMM</.At0MT0MN0/d0(N0N/xNNNNNO$O0OxTOOOl}'O`0 -1P p0u03W0SL`F 1ɧ`P,*W# L0S'0S 0 U0/S \0S /S   0S /S  \0S*`0X=|6 - @L R000!= -LA6L 0CR1 0P 0" `000 L0S X1` P1 P`(p@W  0000 嵨0001dU0 a`o@ 00C0S _00 0S 101>,a0` 000|6== -L4MP04   0 < @0  K00 ,0 (0 $0 0 0 0 8 p@Kz K` -ML M P00P0Sp, M3Q  0P1#\CSAEKI I0#X `$ d 8 4K\ 6d3&?Գ( 7 BnK`F`F 0$l#60 c S1 Q PP1t4 p(0S, 0Rq(KS"V0EOo 0!5!,@ = JPh 01p4 ( l ( h(,"6O0@ 0l0!0(0PS1YpP^ 1&屧!h0PS" ᕞp$t( 0P( (PD0&0b0(!6 OQ a0h0C0^;0&偧ml (w0PS0&  l 0 R t 00 v\PP < 80m?뜃X=|6OPH=PP p-,@(`LP0S p P  L0S `00 0p 08#80C S xp8h8`8X8P8H0 0p0000000|6< p-L@Ah1PS* 0S" 0 : SW@ fQ0S V` 0S 10f1ph}l|P p\0 P@ph B,e=PDPH=PQ Q|PP -LCM M$E~KpGpG 0,           `$ d \$ `0$: SYx@p#d0S0X,P$ L0S@{0 44 ,4P\4 0$KXT }@T40 0SN h0ࣟ: S= P, 0R(K 0S  3 @CPP[ H3 PT DS@#004K\$ XD @A$0 %2 Q  20S BKNN"1A\0A 2 0!00c000l\#0 0@PRY B Y00C0%u!0S 1 Pd  bPE l0SZ H WkPS  5d4s d!G101T0 00(:dp  0S 76 1W9BKNN+4K@T 10C1$p(0SZ ꜃DP(QH=DQ=|pQQ4Q=0D=R|QX=QPQpQhQLRdR$RO -MLMp0P@AnK 0 `F`F 0  U00U0S0 Ut 0RK&@eP < 80 Q ( 8뜃X=xRDPRO  -`LMd&0 H" @{P 0STYPPW 0SK 0Y,0 ,0@0 p p @TP@P!RP YU3jP\1 PF@p`0OQ PP P  @, T000000S0ST0S  @wh 0TP0PPP04 6  6OPy|6R -LMܡpP, h 0Ql$0S V0 P# /00S@0@,%V E0 @0 o 0 J 5"@0@ /P @ ,,0(0  0P` d,@@.@,0S0S,՚$ 0i<|6\=>R p-0 P!`UL*@PP 0S 0 @0VP \ 00\ <0 0S \ PpL6T6= p-@L,},!PL0(S `0 0S0 0 00 lSp 08#80C S $, 8#80 0cP 0` ,_ p````````|6< 0  = p-`ML@P0 dP T0 `0ASx M00x00xR=R -\0L@ᠡL0 P 0S P 0S *=H6R 0-P(L@T0,凤P T00T0S 0 T @0X= 0-( 0LS@P 0 ,Т, 000 p-d`L0S TPT 0@1@P䧙0S墙堙000pH6T6L6 -@LP㒙00= -@!LM0\0>$1 \:q`\!50: 1 Q@(@F@  ,6" 0 0 6P,0 $F! 0  0  P00@ ,0#0Z0L 000(K H{D0D  =X==0=|6===P6=S== - @6 80(P@ 0L 0cp`@徠먠@@娠P300@ 00`S lPᩞP P,&|6==0=======,S P00P0 S-L30 P/쐟0S P-*`$F(pP@r,6 R0`00Uc뀀m$FZ00D0# 0 `$F0P5P@2*X=0|6=TS -1` LV@p$`.P  %#T*V&0 R  05"| P%#0VL0 R @ 05", =|64=xSSSS 0-PLL@T d0h0 R \d0T@0d0x0000,0 P|6H=T\=S0T -0L: SpP` RHh PR@l qPqLT -PLM@ l1 Q PP1P*<1P 0ES0S PUPQ z W W  W؀0 0`DP( 00P蔀0 0`3P( @$K$ `@0 0 /&8$ 000a 0G =X=|6P=< p-0 : SLP` V pu6pl0@@0P` 0-LM@  T00T0S0 T8{P'0H{P 0 R d0K0 寁 D804(|TX=TTH=TTCT -L`p1&@B_?^ PP1d(PĜ@P( 0姞0V 10 A `   g! $ ((dPd 0RX` 0 A8`d00P|6=H6L6@6T6T -LML 0C\ß, p@  L(,P dß, 0R(KPCL8j6@GTPo#1D 4H <8  #1<8 6"0\P`u!#Znk 0 0@ @ 0ͬLH2 Ra D8pW8 :O4HLT >L@?88pS@Y RLH00S00   LNK @D@D01PLg@  Q $1D(000yL4 0] D(000mDH000gY<< P*D< 10pSH8  H(pR0S L(BNK0@D T P( P@D0 2LPPP0D0`0DjP2L@ $꜃|64%U,U @, 0Rx(Kq BNK @D@D0Q35P@1&C1`/E1P@! VPP1\p&t 21C` OYR+00S00   BNK @D@D0  P & 4P0U4 6 #1@`p YR   0? ;PSd1"@p  Q ,(0$ m꜃|6U,U0P"Sn@00!0002  0b1  d1 RO 1P4K0Ad2@0008 00 |tl d\ TzLwzDt8Z0W0(s`d(->K P j 뜃=V<lh 6 Sh (KP_t3 R  X (C H 008 P0\ L (< flPU=  PE 5(K0 zpB0 0S1P ,00XP!D2!0/1 R ~ _ 1 R V0 m 0S1 R ` AQ;P:00@@# P@ 0@S 0&"!0l 0CS @bP p00d0 St0p0    pZPe QSP|6=<=4%P===H==<00Y$Y4=4YY\U<<XXDYlYTYYD6YX_[ -L4Ma1&0R P L H D @ < 8 4 0 , ( $ $p@ 0 0KL (0SP(0@S T00T0SPRPPK H0H@ 0S T K6pS|6<02= -pLWP,ڴ`z@PT0T @T 0Sh 0 P0T R 0R pW P 0=]0 ((` p-LM4 ( 0AS84L4874 P P 0:90{EKAXD AT$  D40 D! #Y0\$ 04K` M*& RMQKS60CO ZMNK@D @D |3$KS($ (}0X4  T$  X#PX@Q  0  0Q s S[" PPXBy( 0R$KpIx2VߕL@0 @ PG BNK @D@D0  6  0SXV0EOo 0N 5"@0 @1 R Pzs!@ P h0X00 0P0C0  oXw P&  P  PX e0  0P0CX0Jdl Px*뜃=\ZQxZL6T639|6DZZZH= QZ=DZ(Z|ZZZ_[QXP -LM$ ` R0,0 (p0 R 0S ~0L 41 R .!KQ `00-1KL KK ˆ0.A[SN 0@PUʅTt8(K MK@[\ P $ R0Sȟ, 0R(KQ0.S $ 0'$00\ \\PGF  ' X 0 00KKp -1Ks0.A[S Pd嬗P T$ $0SQ4' 07 R$'  P 0: S0006  0ASh@X=<<0;0;d6(KPMK ו$0@e $ d6 00C0 (@ z Pk$ j$ R{Q 0.Svf P] 0S $0Sڒ^K PEPE0RNKh @D @D0|a 0t%p4P5 R> \$0S00$L0S$ `0! $5 ("( B RDA.9! Q ! E 0!R!0P52 5:1  11^ʤğ0S ,6 1R 0l p JKJH$ 0 f,6 1RK rK }P$0Sh# 0 Q&FePM0S{ 0# A1&6eP`1!̑0  1 +d3 0ASH IKKK I ?,1   1pG1[0S1 S,6!0  ,6!  eK P l2&1ˑ001&dP,B HL4F eKP 1&ᨑ00&dPA{ )!#o,6KQ01,&K p,6hAQ000E0S%\!)0 R !Q0 S  1 0`S rKP A?h, 0R(K! |@1! 0 w000SL_H %뜃|6=4=]X]]]=\]]]]\=](^(P00 00ᴌ -LJP L^ Q-L@ "P Tv\^ P-L P il^ 0-/LPB)@P 00+8./00,+ p+l000|^ p-LpM/P#)@P KkP0: S Kp0`rS@ᐒ c P0-L@P0 R 0 R 00hEBt0 R0h0l H0 R <0<808)0긌^C^ --LM0 0 ( --LM0 0 K --LM0 0 K -L@+& h. -LMH0@K0PP`AK<P0: S V@@ S00S F`PP$KQP T P`0 R000 ]K@P l1: S 8a((rV괌9^^^ --LM0 0 n(@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% |6p@-`L0(&SP d0 60PpP0\ lSQ!A\SQ0|6 -T L@HP4T5% f4edA^ _ -L`p@ἐPPP5:Pa0@0S 00B S0"a>CPP R R,1,,!!00@ S c.g P 00C %`fᒍP0Fx3 @O&6F n  P~ @06w  ဍ?P00`C8PX_(_ P-L@ 00 R$hm1H=_C -LM0 Z3 ?ʘ3s ;@P (K謓k  `収#3R 0X 0@cX, 40 "8 @0E8  OƉ 6F&V3 ($6 0( "0080S2 4 ,0|B 0S<PUL2   00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  `0d0 1 R0H0C+`P 0 R04 0 / d0\=Pd0L `P@ 0R@X  aA* T@==P6\=|6S_X6\64=__d`_ `8` -kMLM0',0 7K@0AA`@`6 P6P6: S 02PR ።먦P%0S~ 6 Rn 0`St0Sn dfd6d&@`v@@ @@@@ 0SL PJ P(0%%<0000PF%0S 0Se.K B BPL, 0R4(Kp5p@d5 R\U,3S. &(0<%04%S $R2 %P0S ~g4 R}T^T0Sph" pK0S 升P, 6S!@Ƒ` 6S3Ɠ,6@ \   0P VX`ZP `3 00B10@Z3P LHCP`3P HD3P @(3P 6cS00 ,20!6 S 2"  B0"S[ PY &<" p`\P@5͜D"D2yܚj@@)1 R_a,YP @0S@@0@S H6<4"D0#@1 ]P @0T!1zxtA1\kHg@8`(Z 1R  z뜃X6=D=`XP6H=T=a\===\68==@=4b4=|6X==ba`Xbb`` c==<==L6@6T6H6`bb?8aaabXalaaacc8c0P\cc_[dblb@-0 @BTx00 Q< 1P 0<000  ==<= -L@@ 0-LMMpPANK@D0@D\ 0 q, 80 ؜ 0RK0 뜃c=P -RSL4MP`p \1  B R do}$K Tj}^0@ X 0X@K( L (0KT P H D @ < 8 4 0 , L % L 0T0 P LP ,p   0U0 ?00j  jŌ @` ݊D0/ Z D:PPU P0P X@KT0 , PP  00Č=9p -L4M00 @K,0 K -L: S S  S  S 80P , S  S  S4= d 0 -@@@0 䠟`L @@``)Pp#p 0XDP0@@ @ PP00TQ KIX Py=>==|6|=4d -2L `R^Ջ@p@3 T1 RL1 RH0S?T 1 R9qQOQ0SK00CS0JX0@X0FTI T00CS0)0 R0' 02P0S G P 0S DPP c^G PyTYT nTNT aYTyTXEG@XEG@00H=XT=D=L= ,ddtdTd -0L@Sllll|00S \DX0 R L)00,FP0000dtH=dd 0-L0L PR@  ,)(+P 0  H=dXd -LMpP`4p 8 <0 Tt@_0/q,0p , , 0K裡QH< 4<P1  8 80K40㏡Q0<\%0 4۠ ` 0P @_4 0K@P o ć8 `0<0 S (Ko(K,88|==de0ed -0LS@p PU 0 嗇0U ` 0`` r0T xP 6Sƕhp@X0Ɠ,6@ \   0W 6S=[8eDe\=|6D= -TLP@ 82 R),r@T T~ `U@ PU` Qm!0Y0011 RC1oa  ? @_ᛒTG p1 Rd"P  ?㌒DA P PaP[Q30 R% @C~@H0 R 0 @P2!0 X0o落UdP `fHFD=\=X6|===4=P6=H=he\6|6e>=eee -LN  -LM< !<@`_',0 , , @0 @00K8 >Qb8@ @ P4 V <W0K80+QS@ 2PI@ R 4 ?0440 <啀 m@i< 240040 0@Q$ 8V `P0@_8 0K@P |0 d0PR U;< L 4(K0< <=ee8=(f0ed p-d0@LP`\ D0l88 000 0Y `Pp|6D=>P6 0-PL@T 0!S0S @T@T @T 0 d 000X 0000 0 @P@0B|=|6>=4f -$1LpM R  1 qf0S!  p@, P1 P@T P ឞP pkp`0SxKPL0X S;30xP<Q808p00 $K ,Ȍ>Ĩ}>t> -qL0`S8P00@T P@T# 9P0SP@`0S t ᣛPP@X,T0 @T$@PP ,>Glt> -\v0LS` PW00CS00@0tR U T` T 5 Rk 0 0S`0 CR` !X0M  X0`0 CR` )X0-  X0@tO 5  0 H 0SX`0 CR` X0^  X0`0T C?@R` ş .X0 X0p P0S C@t0S40#3P50S$6#3P4 R 0Sh`0 CR` X0$  X00SG4ğ`0 CR` aX0X0pPPAPP 3j0 S3 0`003 R TR 3 RW # 0T0Q0SO pp pA0S06#3PA 4A03 R 0SL`0 CR` X0^  X0`0 CR` X0I  PX0hp0R QAAC@ $xApP} YZNMDApP 0S< -${ApG^ uApB 0Sp T?@kA.^gAp4 0S] I_Ap, P"P4p0RAX$gApp0RXM]Ap 0S `0 CR` p0RX-KApp0RX^BApp0RsX^9App0RtXI0Ap P^PJp0R RXAT@X >,>>t>$> >>Lf >Ĩ -0L0@`TPp B@T GPPp@`8U|0 R0`00@TP)@PP @0p,2$0 G>,l t> 0-@PL`!ep( b0@SԂĂ\1\ X"@L1 (!<p,1,!0S1 R% wAP2 帹d 0000 0 000 0000 Rl0 RX0 R00 RJ<0[xfTf><>>Ĩ >$> >>f -LL0 L \ 00 (0 $0 0 $F4F̌xC(F -0L0 (F -0L0 (F -$$ 0L00  $F(FQd d00A00d0XF( 0 QPlHq-@0 0 S RPlXq -(0L00S 0 (FԌ0S 00S0 $#$("(  @-0S\\ @ T2  R T2  R 0 SR 0-h0L0 X0XPT0 P@0D u40, 0hѓ0 FTFDDCDF0F5i 0-LM@ᨄP@K㿀0[P00K_PPdL\@\ Pu0 000 (坓P K0lqtqCDF0Fi q 0-L M4PK @0 ႓Pptl !u[T0DT 00000 40402KkP$]K0C0Fi qDFCi q p-,`M@_L0 Pȃx(>, -T L0R S S0RS  P0 孃p(?q p-L$M<@K$ ``P׃\ tP P< 0,` P Kp0FDFi$qi$q 0-L M4PK @+0 Pxt t[T0D\ 00080 <0<02KP(㮷K0C0Fi qDFhT>h9Xt`t  p-LM*@KxPx` ~h @ pP  ~0 01Kp ̲KpC0F:i ht9i tt -L M K0, @6$0 x\p  0K06@K|P`x  `~d @ʍpL  @rKp0Ꮂ KHtDC0F:i ht9i tt -LM"@K X~TT0 L@堍p [Q"0[S "0[ S \KC0F:i tt -LM0@KQ 2~!.~  P o0 sP d- 03`p@P0S (0  # 0S-|-80lS v P8PU@K0?DF0Fittttt tu -81LM@8Kq`P  }V@! V/P  0p@ 'PK 0~}P !400`ᆲPO@P 0 >| LP  Q$K$ u$uHt p-L M.@K `}P0 @Ȍp'  fn00SA[T/90K 50SK XT001K,0H 堌p4mKpC0F:i htD8uH9i tt -L M Kp,`0 q5$@\P  0 t000S \ڮTL}PpH0 p@h  4B}P$0 t@l  K@Bdu(FxuuXFuuu p-x0LP @ T 10S ] p7lx0 XLX<S`RV( @da@c]bd0SB0S 0B00S " i75P +X00SL  8V7x07D phpu uuuuBuuuuv ->ML@M|10ld@K P`|L Qm 8始pP 0S=:>[KD@K$PE@PE >kF| B| ,P 0` 1m 凋P x40S >KK$@D`@@DPW?-0tS  X6P|@40HUZ<V$K,AT 1S1S1S(Q$!000C S0:S Q $ s4P`T 0S,4,{3Q]V@P T "R0S x@K0S,PEK 2S*0S' ,80  10 )0 "0ZhU"Rd0S`t2S |[`1P|!A tg0l 嘇P01S H10S  3|0 10S  x200S 00S `p@Y(KC0FDFi i8i4iiiii$Xydylyxyi|yByyyyyyy[(ykyyyyyzz0z8zi Dz@F,F -ML MPp4 4$4Q|x4Qpl4Qd`40ST ? @2U 0S 0SS0pSL@KJc( w h PW |,PLxupPx  \( ІPX㝫P <0 <0R$ 30S  /220S(($20 20S))|2p20Sd  P 2@HUZP20SP` pA00S UYP@ M`,0V pWP`lZ10SAQ 4T0@$0$@SFNKP@D/LRKLQKv g1H >P/K4[S SoKL[ <P RP,gK[K[ 0QppPK OKL[K < PRP,g 0 $KCDFC 0 0 !8 a Pp8  P`!$0 Y,0pW @40Sڠ!0S`0 CR` #X0  @X0`!0ST`00CS`0<X0  X0000 S00 (K O @ J p0RX Z @0 R0 R ` 0BO?=q }l #_@P 0P 0@kX 4 00Z$ 0@@0厗dF ,@GGG -0L x p-LQP@4 `@q 0  00 R?`0 CR` X0X0@Q 0S q l0  0X0 R?L@Qpp0R0 S G, -pL@P`nP`  ^p00pT@P a@Tl0 P @ dP@0㕓#PU`pW*LG@ <lPG 0-LM@P  K0K PPbp (00S K0LG\l -L MP@ `$K 0PPbp $_pP 0 PPbp ,00S p  KLG\@0P0 R0 RPM -LM0 Cr  0Y0 Cr P Y1 @,K@P\,PU 0   0 R$ PUQ ]PD 01(1$1 R Q @0׵0@S,Z&p`@dP @ T0 Rż]pPh` d0@pAP 000 ,֗$ӗЗ܉ x -p-M L M0` R P  0 R 0RKp  \|ST ANK@D@D08 Bc $   p-LM0 0`L0<0@0R h H   0``!Kp800 S80<@080<@8@<@LQ6 K0@!<@ 0Q =9A =CD H H00D R_0 040S@<@@<@_0Ϡ AIl$!B30b0@@<@LQ 0,D a<0 R@0<@L0 꼈?BL@BC8 -LpR`PW PPJ`,^@PV ` b` Ạ`P/ X^PL z0V\0PPPPPPP$0 ( h(0S<0 0P000 P0000B 0S0@ 0,0 (X0dh PX X0$8 XXM܈؊Јl  -@PL 0S@R 80&b0PdS J 0 &ꌋ@ -L$MP`U@ 0S XxXXXD  ұpH 10@<S< ቱp7 7pg RP0S6  0S 0S  ) :  )P .P0 80 @ #KP\0S1@TTPo@ PPz0KU &@T PL0SGD00Q  R4 0S0%000S lX,,5 C00@00=L0090060030D0 040SPL0S DU9 W 00S2Pp@TU 0 R 00S 0000S_0t$ pD0Su Q H R 00S T0Sl R(KHFP000 P0000000`V 0#@i0003 R 0ST3  0S/P  㐳30S 0@⁳0S) /P :*P )%P IJPᰳH ,0R  (Q  "31C0La1 @KiP=ں3[ 0KU "@T"aH0S00;,00cS b0=9 = B 0C!00040 Q $0< 0bS$00$00p,0X00#0S @0:Pm0  l ~Tp x <MTGlLMbX8|̌ -LLMsC0 0 嵯Pp Q20S/  0)SP`02 000 R%U ^ PO0PU3 ^ K.00K@P0"@3 0RK")S  0)S00.S /S00Q  Q `0P0PU8PU ^ K.0d0K@0!@0!)0!V- 0S% ^ K.0>0K@0@T!^ K.0 .0K@0!@! 00S@P ^ K.0 00 T00 0RT0m04000gx^ K.080K@妰0@ U꜃8MMLMx(؎ -L(M⼁A0@K$0 `q@0KP0\@0(P D0 X0@0 ) R ࠓ 0 .@0@@@ PP00 00 P0   DK+ B|]P0 0+0 iPX0P 02S T0TX 40$040 Q K00 R %뜃TM(M$ -"L(M0Sr 0S\ "P@PPP PPPP@XP`T: ㎜8P_(@K`$p)$ 0ptP_0)% p,` tP`@ : L0K0P < LP HP DP @P 8P 4P tp@W x!10@Pp|!0x1 0p1@0 `P `(K0{YP((!p!0p0iY0P vpL0 lpB0 bM8l0| XC.D0X Np<8|MTMpM\G8MMM4\8)̏0 0 MM0S GS  -L$M,  (K  K0K,@K$ @(  \PK -L M@   (K K0K$ @(  @[PK 0-LMPKcPP@@T ]P 0SX0P @ \EB@8 -@@0LS  GS ,, @0 h[d -LPM☡0H@Kp⌁P `(0 HP DP @P (0 >8P0 0 PoP<h@@0` 'S0-LP@ 0h*(@0dS<Q< JJJJJJHJJJJJJJJJJJtJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ0h001@U 0$ 0h 0$ |0hpl0\0h跸T001 80h,ꌕ$ؕ\EEԕ -CML Mw@0 @ 0 PR񟗋MM0NPNMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMNNNNNNNOOOM|OO, 0RKQ񟗜PtPhP\PPP 048< ("#Q{ Q Qt *t 048< ("#<4,$ 堷NPK .0"P  .0P urp 048#8 $#$("(RCDQ8Q,Q QQH\<Z 048#8 $#$("(RtQhQ\QPQP\yC@sSpPmMjJgGd.2  @ Q32#8 pl2  / 0`S fC -*Rb L$< 8 0( Q 3-SRNPK .0yP 1 |/V( ppMK @D K`@D @@ 0Td P 0$. v:. q+NPK .0FP꜃ܘЖ HE4DTdx̗ܗHX FE0HDoԘ8l,   I X<*x -2L4M  , P@A 0Sp SV 0gԡ0S[`00CS`0cX0  X0TTڜ1PZpK""2! T`` h`00CS`09X0  X0@DT$PV @D <4("4! .0P V x 0S @D T, 0R(K. 㺎X  d T`XPX 8>DoH ,( -FML M,ENK0@Dp, P4 HW `V Q 9   , 0RI(K0SX 9    np 4 P| 0S - Sl ,I0     ȟ08 R`00CS`0FX0  X00 1 P ȟ0 ȟ4Q8l #8 4  0x$ t4 DH(04$48#84 TM$ R000 P0 ǟ0 0 BP0 0r@D  Rf CP 0GP#|7  $Mdǟ R000H'P0G0000H@ 0Q :Q $j巡2 u2v#4 L&0  H@ 0@ @@ <@ 8@ 4@ D@ |D0G0KHK0@K00 HK4Ɵ0S xt$U0  E0 P4  R b5Q% Qa00X P$R0 S 4PP  0 S Xw FKAhd , <$ 4!$EK 4A,,.<A`$ \4 X4 42;@TP4 49 09D 0x t 9x$t4T; 9pD xtPxt$LDxt Px$t4 X  048#8 $#$("(R * R 0HS0∄ l4 P4 DTmK`F0`FHp4 P4DPT :@TJ4[S QO(K#D@PT $$ ߿P4Qw ßp$06@Pп`@"0 N ɿ@TK TPPD0jS'U <4("4!L,Ś0G TA`媿V@! T,D墿l$R t ,㬚l$$唿d1 R X`0 CR` X0)  X0l4P ST,{xPp0RX)6 ) lh`d`\P q 01  0 PP4$RP `x$ j jr꜃Do48KK ,PooD OLoLHtHșNK@@px`h ؙ[D<HT\phD0H -NML?M? $ $ $ $ $ ,  h$       \/^p= E0@2S2sbbs`sbbbbLsbbb@srbbbpbbbbbbbbbHon|nhnTn(nnmlbbllxlbTl@lbkkbkkr d. pX>@dXXpHI^P00 p Ο1 1 0`JKI I8^ " 0@D >!Pt0 R=|= `0Q  K=VP-0 k4S- -K B B@@@@@F>K@0C @"0C D !Pl$0S 0͟0   00 )qcPul,0  %cp` ̟ 0Sa  ,0 R t,00`- AN.HP : T̟0Tڴ+00B0S ^w[+0 00000000`@TI`@ T @D0XD @;˟@ 0\$ SE>K0C0C5  \ d)* 5\ cp D-K B B0$ * R44:0  4 4 ˟: 4bP0 ʟ$0R pspW@$R$ 4S P 0s 00) /d:   t)00P@@X04 .PH] 00) 30 ) B0t]pP UFnK`Ft `FP@  0 PGl4 RL\PDPlU@(ɟ0) h$R ɟ0RFNK@DPh(0PfbP9)0P]bPsɟ@)$ 5\ @QbP+d9)% 5@HbP9(@7 @|AH;Q @$@T8\(\ǟ0@ g00K @w娗FKKAHJ A H0 J PUT@T0SX'0 08@6t (K@HxP PP7PƟ 04 H0K4 4 4 ̤ D (Pz $46 R Ɵ0Rڈ&6  0 aBQP6 50SPU %5 &0:;:0{%0<0v%0:;70o꜕EKAA 6Pb0 R^ `4 RZ%PY|X%000QDş 5   H %080C ?PRДEKAA P-0 R) `4 R% )ꄔEKAAP0`S `4 R 4P/t@@C0 0E5 36/T3P#000CEKA A>4@ R `4 R0 S Lu|`304 ꒂPd#0 00vD#0600#0@00bEKAL L0 P d$2R 0G|뵮R0EK0AA `4 剜@h 娮0S 0 R `4h$TQ ()|P2, *++ 0S @A0C2S2pTppTpTpTppTpTpTpTppTpTpTpTpTpTp|pTpTpTpTpTpTpTpTpTpTpTpTpTphpTppTpTpTppTpTpTpTppTpTpTpTpTpTp|p0SL!0<0 0:0 0;0 0:0 0;0 090 0:;80'꜃NN<@$ 4 /20GP-   z 3PW03@R ]PKT0 G dC&0S? |5{&_:0S6 ,{_13p3"=K0C 0C 4 HI3 P |1 0`POMT3F>K0C0C@)& lD _P8 `| 00) 0t   0,0Q @@$ -C4P @p$)+ 5\ ^p|X$E>Kd 0C^bb0l4 ~@Ph5P 4 xx%S00  4). ^P u|0 Ps `) 0`^P0s 0) `^P (Y|Q 0)3 ^P hH|pl$tPF.K B B$|P|LXGKA  A|4 xD 4 D ^6 R=;yl$E.K B B% ) 5H^p3L|tYT yTlyty y y y y zz00~y00xy tyAY oy{ {{{${,]y4{'Y$0DTyPQyX{`{h{p{x{?y{9y$5y{(0 SW˴8ɠE>K@(0CX @]a 0-8P8@L4 G  0$p[ - L.hꠠ -AML MpP!E0`00 ,0 7rP dP jP4`- aP* uP zP# tP#P, 000I`|4pp zp `000C Sp0 $$倖p00S4@,0S 0K~P {Z墙p 1 dR 0+S 3D4  D$ H@TPp00F S.VWpqP`V &W0P 0p `.GP` 0RR!>C 2#=S0W!G@ PRP~~@ Td0 T?#C0 2#0@0TT!>C 2"0r03 R0S 00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0%XQP l781@T%$10S @KՕp0M @0 c8K8 4@ Rp 8K8 40 ~P7z P %ΘHQ 0+SD HXڜwY T yD%CNK@D@D0D$6"P04[`8oooȠ̠<ؠE(H<P`oC0 S S  -`0@P@@T0 La <00S 000S.99oؘ -L?@PM/ p-L@$FP `6p p-2 B 0L`@0PP 0S00 |2P $ -8L2@E0P/S @P,EP$2 B 30S ", ,,, 1RjP @EP`F ,V 0+S-S0SZ*PW*P *_L10S S*PT1  @` XPg,P`T@D00S<PUPP 100S 00St0Q. +'29s8P1PQKp贘И4`@DHLDT\X 000Tt 00@`Ȏ 0-L@PU0 0 LLE0PHKP @P@DHP00 P00e-5@K 44444P4P4444444ŬPŨ40$4P 4 P4$0tP`4h$0\P@4P$0DP<$40,(P 0S$0030 K30S P 0S#0030 KP 0S#0030 K#P 0S  30 \C\S\3c pK LL0`444#43Pp   # 3Pp # 3 Ppze"0P00IPBYP 0S20 KNP2 PP0PS@  H|"  `2 @A00 0 P"bH2 K@-1 `P0`S@ 2  BG!  `1 @A00 0 Q >1 @K1 P  `PPPp0P0ASP `100ST1  KPt $  ܘosZ88[@tDtHtlLt@tt t@4 tttxĺ t$t(t,t0t4t8t 06S000Ἆ,0 0@S200 Xt 0PXt 0- L0S( 4 @ 0   04@0Q@ DLP 4r 0T4v40@0h%0Xt -0L Up0q 0 -0LPU5 40 0@044D 0S040P`0$44p Td$T(d,t$0@044D $ 0Upqh5(Xt -0Lp`PP#70 4@0$($,T044Dt T$F P 404(0$00 4siꈎXt8 p-L@ 00s'0@ -4LtMP3 Q $$0R($0R,0Q00 :$($? 20€0 S 0S0,$R030 5: Z02Z00 L R 0s0s* 30S 4 3 R 4SU7P3 3@ 40 400@000  D3   0 0 0 $4(D0@0 00 2$($6F`Ip\ 20S C. rs SʝR4S4S 4?  0Tp@Pq4.'H20dtŸ q 00010*b%ph P'(1 4D0O4D0P00/0d4t`10S% 0S0+K H&S<10S01pKP1 0S1 0S 0 +00 00S$00 S 0 0 0  0 0  02 0 ,0PK*0(KXt ,̤ؤt048 0-0LPU ,4S0C$(QP40@eP $4(D 0@$4(D0,40h0Xt -l@L0S{p D0,$R0,4$4(D 0@$4(D0,4Xt -1LpPW`` 10S CVYqr V0U00I0O,?   69F$4S4S  P4S* 4S&p" 0ꀀp 4S4S:AX0Q$(0<0@00,00Xt, -LP l0 P 0R 0R Q0$4(D0,4Xt 0-PL@T 4 j 04P X00S Cpq 0hH0 0@ p0Xt,p$ 0 010#Q0S4:Ss0p 0 00  p-L 000 x 0Pd `,P @ r 0 04 (0$ Y; \t00 , (0$0 0 0 vdtlvdvpvtv0 0 0 vhvdvdt -LMp@P `@_00C0 S%"0 .S0K0 $ K Kdt p-RL@Py0` ;TUp -LM`p$ @PL0 `pdt -L|@||PM$pK(`K  R(0S0C(0 0$ 0b0 0R 0 000 Kdvhvlvpvdt -LMP@p`i;   e0` p-L@LMPK@%T;`@@00S xdt -LMyP@܀,pK(`K, 0(  R,00# (000 0S( ,0S(00#D@(`K,PK 0S#@0 S$Klvdv -H0L0S00@@Y$ 0@00dtpvlvxv -P1LMH!0SK$@K0$p,`K0PK),0S(0S 0 ,00R$ 0 ܠ p@4`K8PK4  80@00l?T 40S4 h0 c\0@d0 ]H,0 ( c,0 0 ]00S C$Klvdtdvhvpv 0-P0@LT0 0S0 <@/800 0P0s300lvdtxv -0L M 0 PK Ѐp %@(`K(0@00l?T $00S, (0S ,0$0 ,PK(@K$ 0S$ (0 c,0@0  Kpvdthvlv p-LM@ 0S0 K K 0P 0 0 R0AR00S t 0 d@0000"`K PK 0S ʉ"000 0SKplvdv - 0L00S Llv p-PL`@90 Rpl00 AP@*D0P0A0Q: gpdtlv p-2b0@S2LTP00P P} P PS PMP $ Po  P> J1PD eP PyN{yJB00S SAA00 S nrQA0S0S S gQA0S\0S SXx1@@`1pDA00SG?/=-p1 1R0R S P@0S00S S ,P@0S%0S S!, 00 S@ #h@00 S 00 SS 00pPphpĎtv|vlvdtpv -LMP8|||p`,K  ,P }@TN!,0PT@:0S0 0 0 0SĎdvhv0PPv -0LMK0 ! Kd -LD#P x0pq  T0 hH00S <@ L*.0S.0SPK !>P 2 P L>d P p>0S E P =D>U Pz 8^0S2 @T1$@$PZT 0S:8NP>0S 0S6>(0P 5?;r>`-0SD0eSKpd](4-@TD0eSe @D 0S Sf Sc S S/S 7S[ S00G.W S}dPx @,0S P0!W@  +W W R0R00@0#0<0WT <0WP <0WKE+Pn@ @K0@0SP +aGQ0+sx;/$P%W} W W W !Ws W*W @W07S,g 07S+b07S ]*Z W W LP 0#0CS<P9&0S <P P )0K*pK*K 0K0 @0PuT 0DcSdX4<H@pTľH(8TT,p( <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<ľ 0IRQ|80S0SL80S8q  2RQ80S0Sf +0S0S0@W70S 0S0S@7=  ? 0S0S0@9 ) 0S0S0@)60S'0S!#0S 0S0S0@0S0SmP60S6 (6  5@T 0S5 %0D020D0 50S 5RQ45t50S85 5{RQ44~ )# k0S0S0@!0S0@40S0dSd0@h4\4m EQP < :{0S0@(4 8 /,m!8 8KR%f{"00S0S00S00 0S0@# a0S 0R<00S0@52P0  0S2P0   ,Sl2 0S0@02P&0S0S0@GP hP P %g 0S0S210S0S0@P 0S0S1x18K80 b0S0S0@Pdzw0@ P P kx h00 1! j X0H0p0PN 00PJ 00 PPE PC ,AvvvvؘЎv\<X\vv[<,THt ХvD8 vv0L X0p0P h00P t00 PP P : 0GRQ000S00գ?0O0 R0S0,! 0c0RQ\1h10Sp10գ?0O0 001 0S  0 `p10S !1 !0SY,00"000SĎ -LMS0P`p2p (K0`!00 40 0@80 < K0 40P00S T AQ:0 6 R0S 08 R PP,00,0  ,0 P ,0S:<0S r 000 R00 ӑX 0e!0S 0f0@,Y: T00"! 0T S@D0Z00e0X,0 e0f1(K -L@0 !0S@-P@p`E5 p-0SS%0P gP' 00dP ^S0gS 0S 0S  0S  \:QfPd 0܎ 0؎ -0LM0@P3 00P/ 00P`+ P=pK,KUF@@ PP`  0@Sd`0dV0S0E@U@DPE,P `(K 0-LM@PK ^P8d/P  0S NP 88 -LM@R,  *P @- R P`Pp /1Pڤ`0 C @R`0P R0  0S0@  0R@S  TP1:, 004 - LPh؎8 - LPh܎` -L h -LMph) 0-L MP0S$ @Kg 0s0s cdP@T L0UH0 %00(0 0 0 K0舎pv04PM -@LPE舎 -LMB0PP 0S U E0,K0 K00 `P@@00SpJ<0P42p0,0 A P8  8Km8W%X 0 zO%D K%I%Z f fCP, 8 8K|10SP ,!P P8K8` yPYP ,cpZ$1 w10 @ 1 P0 , KŵP 0 0 0P@ $PG0 0R0 A{z0Ul00S(8K8` $(K舎lltpvĘԘ04x̙ 0-LP@6@P \P0h$0 -`LP`pW!&`V@ZP PT 0  0 ꈎ 0  ꈎ 0 ꈎ 0  ꈎ p-L@P`P U  P V  P php -L@h P-L 0hꈎ -00LP T hll -L@%/ 0r/S@ R -LpMK@jcPHK 0|EK -L0Pئ -LAMPP2  0bEpq) NK,㰴PKp@%`@ 0S PP  } 0S*# P fP` 0S:VK謙 -HHaLp@P#R %RT0TS 0S %R #RP I.PP@ R_묐0ਠ`P@#R %RU0US 0S %R #R P ! dt.@ P R 茎 0-D@L0PS0P(000-P0谑 -L M`?, H.@pP@0S 0S P W @P RX Y"'.@XP@ d \00T @Y- P  d,@000S0(K͎̎ -LM@pP 0S `PKh-@-@@L0H P`-" כ@"KX  -(1LMP, UARuOpP; -@-@,-v@`PZ0%S00sSZ,  R- -N-,-P@00@-T:@"T o5И, -2LM0S4 8 2@TtPP 0|S0P0@ 00 0-SP < -P U-@R- @p`Y0%S 00sS  ,:-@`00@1-T:+P5"UV 00S h10S@ R@)K P ̚B)[980P40@p9d0p@d0S 00CS00`Ӥ0` V g0H v R @R!,p@`00ዚ0Sp(K脙И8l  -L@, 0 pS` R0S000S,`PUګ,P@000S 00͎̎ 0-LpMKPTP@|0: S@@!K0 p-LpM0`0SP m,@1 P K)PPl00S0: S N,*@ P, +PI!Kp蘙t<00S,0P 00S00CᴑXx'00SfL 0S00\@ -Lp@P`WV 000CW`K@tPuZ :X`qgRpWZVX (00S8 mW d -LMp`p@P qV i 0 0-t0L0Spq p@Pq0T0U0000, -LP  00SR -L@pP`\T p200CW `20SWD200CW @w$200CW |UV jUVP@ y1P @1@T@ ZZP`!hpP`qX:p4q2P P AP!=T 0 0S0uv 0 0S 0S0x  Vp 00pWZYT+00 o\ 00Su|xD@< -LMp`iP P &@;P9  Ki`p@P(q&V 0A9P 00S CP@P 0p@Pq Kif 0 K,0PPἑ0PPἑ< P000S SP000S0ἑ0P0000000   -0L`Pp@)P `VV'(` W  00P`p0@ 0 @ `000pW 000輑 0-@PL tP 0T T00 00C0 R( 00C00h0舎 p-L@Pq P`pyp P P@P40`0pl@Pp P P00蔎 -LMpXtWr`#0S PHC0S <#0 QPW 0@PQP B0S %$@ T T "06 P P p/ `B0* P 000 ,0 p|0 , 0KP0K0PK`p@ !0040  6` P P=ڄA0S9x!0S5@K 00< 80  @P(!0S!0S4@ 1@O P ` 0P`@DTʵ0@0Y@XW40K@Pp6T00S 000K@P*(K萙h`D\ -LMpwx 0S P#0S t3tC 00S@_ 0kP0p , @P0p P:0 K  00 ,0 80K0KL0@K00# k @0P`Pڴɯ`V* @T PXW5 p@q P P`pR0gt T"@sTP`80S4!P00PUo-b  + TPPx1@Tl0ST!0; Pp@@F41P`@ ? P?P`@0K@PpA00S ' 000K@P*00SZ 0 P` D@ P P p\(Ko(K萙h,D\` -L MP`, *P,0@cT D dqw@P X(Kopw0x0XW0@,@p(Xy z  V0 U00 1 ,0@c 01pP`q @,0T (1(,0@d@ 0@7pP`q XW 000S (Ko@00CT{ h00S]D0@@]$0 0@@(KT@8x p-L`@PP  P p "@P$00S phꜙ -L`ppq|Dp@PqTh 0<UT0 hxH -L MKXK  K p-LP phP`pqP0  Bph4@  B@PQ php谧 -LM`pp@Pq DP |00Sh0 W V @P,0 $K!oK蜙ḨP\0 0TSP0 H0 D0 @0 <0 80 40 00 00hvvvvv|vv000 @00txd00S X00S P~0 @P 00 000000vlxt0 0 vv -p堀0L@&PP  `PPrY `L% `G%P`@tx Q-L?P=0@P60 `Cp, PP 0p V@P  @P@P 0`d0`FP@PZ<0000Y$000C0f0@Pt p-Lpq0 9PP-p@) 崠`t T 0 @P00CV]P y@P@P0@`@40W 00 X`@Pt -L0<0  000 $00 00 ܘ -L0<0  000 $00 00  Pp-LP@1 00S PP@&` Rڔ@00SP 00S@@P @0 R 4000SP@pĎvx P-L0X$Pv P-L@ P0G$Pv M-LMP0X20 p@ 0(K>P U@P20S62 0@ (`K( PP P& (0 S P1P-!0 xA0(0 P (0 SPP b<1 F$10SWW 11 0(K(  4``P00S 0@0@0@Tʐ0X 0 K0 0CphRd\0 0X0H0P0 0 0P  K|tvvx -LM0@#`p P@D\0@@0@T 7P \ 0  vȎ -PLM@`pS3 R 33\ ڼ0Sڰc000S0  R0  RtS(@K  00$ 9@ p,0 0l0. 0`  0P0`0 2 \0S000S0 2 Ÿ0S#ڔ2 t2Rx2  d2 0TP _TPP^@20SPPX_TP@` _RP0P0P TJ10SnSSjK11 1 1Q0cڨ1!0\A1!1@ ``` 0 B\AQL!01`l  @0J$!00 0S10! VP`F(V(00S TP 00S STT0  0 -P(KęvvvxtvĎ|vlp  -2L M`2 0 f0fR R @, oP"0L"S PP02P 00dp@40  004 0PpL 00WI 0SEPP &PpP3V!p0ŀ!0S0Wx!0l!ӷ0P#L! 0 P0!09!P0W !0P P  P0W !P, 0iSC`@,0Y| T0  000 @ `@HH0T,80 0i `0 (Kvvvtxv -qL0PS`@ 0 0Pp1 T 0P0p@0`$0Q 0p00\p0p 0 ?R\0X0 00lW 00psp3vvęĎvDvtv0v -2LM0PS`prp10S' 11 001st TS !0S0S1 @0t1 0l0 L1  010S (1 @ T 0S0S: p\ 000  P`0 Rh0P0 RQ0@^0 00 vw  Q-LP`pr1P PU 0 S0S:Q R`\ x1U 0Q 00X@R%Q#@zPE(`@0 -0`p9pq7  0@P Y0$X!WP"`@0 0`ppq 0@P U0T 0/`pv$$0S0  00ltT8 0-T@L0S0dS0 PP(000P=000l -2L0`Sp pq WVP2 X 0S0S:0S 0S{ 1X1 0 0Q 0 @0S@T6S4P[1刡@0l0@P3pqI  0 W0V  0U5T30@. P'0帠@00@P Jpq R 0 U0T 0 Z tv -L@P`p@Pt 0u 0 X00S L0XR@P*TU0@0 50S(, -50 S  R(a0@ S-00LA0@S0F 0-L MPP @K0 000K0舎 'Pp-L7 $P'.P ^P"L1L!@00 0%cP !1 !1L0 0 0  P- 0s0sph0^ ND3s H3s 0@D3HCP0 d00@#L3800 `P0 ,P php舎hH -L M@KB0s0s ?00@3K( -,0L R00F0舒@BH -,0L R0030茒@B0P 00ᴙP Pr 0 ᬨ -PL M P P"P00  R 0ShX0RH0  80< (0K0 K0K0 0K0K0 ? K͎̎ -PLM@) T TV\Q@p ` "00C0 S10R!@š0,STT901 0b 00@0PK U  0Sp` T1` @0|T @KaT @K,0`04 0$K$@ KpllHkt -@PL ThL0 D5@3<18/4-0+,)h6萎d LP+ P P0p 0-PLM@& P P*0mS MS hS =S sS wS pP hPdP`P\PXPTP@[$808 0K10 cK0ܙ048t P-L (0 00Sh脒9 -PL M0 " P P>00K.S K 000 0S0-0S $0 0 00S00K,@Kp 1@P0t @0S  K0 4 CK,0K0 K,0H`| -PL M0 " P P>00K.S K 000 0S0+-0S $0 0 00S00K,@Kp @P0t @0S  K0 4 CK,0K0 K訪ĪHت|Q PPP0SP 0  0Pᬓ$0$0S0SᐒT -LMK h K$ -Q0LM00SK0 W K@ -Lp@P000C0 S @ h,,@0`0 C0 ST @DT  0@TU0 `0 p-L`P@0-S000C0 S ph!!00 C0 ST00^ap -LM 0R0*, ,0* \xd -0Lhdꬓ -LPPM0 pb @`V0@ , `,KWV0  , <,KM 0S SV000S`B V? i 7 fV V V 0 1 0 0s03 V V V&@  00 0FSPV V V 0K$ KO$0S0e90S V0V 0 @00SSS 0010,K0,0 @V 0 \0   000CS0,111111|1 Kp8 -`LPpP`$T X P$T T T-T00@f 1W 00P@T -L@0 袓 -PLM8 B Rp,K4K 00S S 0 8K@h2 @9P8@ 0Pz`#80 %5*$P  P P+P -PnP! `$0+SX080 p!000 l, 8 0+S0,0 =1[X!0Sn`z`@YPPT 4@ p,p 000CS95666666D6X@ 00s03X@ 00$aFQ 800S8 80 S  08 800SL0P8K @0S,80Pi(K謓 < S 0 Q $ 0S C ᔒ -LyP 0S0  @刐匠匀pP`0S dR`P PP pP R000 $@$ TR<Lh -p@!`PL PQ  0  0  -LM d 0 K p-LMP`d@H002 0@?Kp'@B -LMp|v`e@b@@%0 P`d -LMKj -锠PLp` 0@SP0000ST{0S{0#S , -L P P Pp h -0LMo@p@`!0K!PK  000e@PV-00e i K -QLM@Pp@tPp0%0K%`K 0$00 f 0@PW-00f ?$K -QLM@Pp@tPp0%0K%`K 0$00 f0@PW-00f $K -\0\0L@S L0 P\-P p5 0 0 (8 0-L L0PS000@00 R+0 P00 0Й(ԙ -L@0@S -LMpP`5K+%P0 p`$ pnR sR dR @`0@SP  1 06(`P K 0-0L0PS@ t00Sx P0@0S @00S `$00S0 Z0萎8 0-L@PSD 0 0Й p-0L0 S P` 00S 00S -0@@ct0P0S h00S ph1XJ}P0 @@@400T,0 phꐎ̙d8 -0LM0  l0 `0Pp `K  0T0CP`@PA8ؙp3 -LMP @` a\Q  0R QW@X@T11: \ 40K]p3Q 4 ,0 0 0 00S0!P$K -@LP900 -0LM0@SpP s 0Pp@ @8`P  4@Po9@@U Pp p p @00C000C 000C?001,0@-<0  0|0@P4 p 0q-  + Q 0%P#Pp@q 0Q 0r S 000 JP mP808 PHZ0P:j|DltԘ[(0$0 0b0c0AV8 -p0p 0LS@ 0@s@3H0H0@0<0 80b0cA6$0 萒4ܙԘ0&0 -XL9P@L5D2</804+00,'(04ܙh|0С4 8@-p^ 001`0S10tu 0S 0Sqr, R*Q'00S  0S qr 0S0S:\^00H00S 0S000s3hP 0-L@PL<0  0S0S0 R0< -0L  0SWp3 -L& h記-  0R 0RQ^  QP 0 0S  SR 0 0 0R 0R 00 0- LP@ R  0@ 0脘<P -@LPf00h.$00S0 0  ꘘP -@Q 1LMPp@  PP=0T0 `Kp@&&P@ p 000  0S : L0R  @00S 00 0 0 蜘P 0-@LPT 0S$  0 0記8 -LM` 0 , R\4 ԠP 0R0pK0 0f 0O 00f0pK0O 0@ @T U @  0d 4PP(K蜘P -L@MP`X T0 d@P <` @p < P`00X r T0s  T@0TX\00 Q R` 0@0C 0 , K00K p 0@, K00K p 0@P`wx R@0K0S @ 0bS0c S  0>PB0SH 2Q H l20SHH  S H  H QH ,B00SHH Hk@L H@D ,LD 00K@cP  AP 8K00L 4@K @sP ` p\XPB H008KL 4@K@ WP3 PQ 4H@8D00L  @"AQʸ00S C4H@800DL  @LDQP 0 `LD@@(Ktę< -L4MP43@(3$H D @ < PP Z 08 40 `8 4 8 4 V8K0`2pq tu Q P`2YXtu 42 0@_` pH D *tu UT@P1 0@_ QP1 0 QP`p` p`VpH` Dp t u  80s04q 00 4 U80T8@K0t u U0T00" 0 0K 0 )Ph0qr ,0S00S0K@ < 0HK@K 0(K脘 -LLMvwJ 010 @0R0 , (Ko00S )p@Pq , R00Sp q Q0P 00 t8 00CXZ (Ko(K蔎@ -0L0@SPTpW"0000S `zpI@tPq Ab9`00CVw0p@ 0-LM K @K0tu  0K0 -0QLMp 0S#BP 0y:*R B0S 0S"0S002 d P\B0S vH2 V0S YP `@P1p@Pq@P$10S S  1 ````KV@P 0@PLa0Z @Pt u Z J@Ptu t,@ (P u(y$,K  0pP h00S00X0S  D0,K q $0P$K蜘Hܵ -L 0 0S0 h萙 -<L<P(h+ 00s030hꜘ 0      ᜘ 000 000 000 -LM0 $ KK0 0 %P$ K -@PL \TL h g8gPg -1LX@ @@ -6Izu0  @`Pp0S0S 0` 0?0080  N000S i8g8 -LMLp`KP p@P0[SPKT[ - Ls P00C -0L x -LMP@ὼP 0S 0S1 S K R3 ╼P 0B?S⳽P (K⇼P (0Sp`$K $0(RpQ tP` ⒽWQP00 -L 0KM#+N -L(M< @ 0<[ ,0 8`pZP<@d @PP 00@@P 44 04R0  00 4 8  00#0S83C尠o,0Z0 C@ 08 S00垶P8S0 00CS00S 00H@P!>>>L$000<!#0S 0@Sv #0P o00g< \x2 ` R p @  0SO ,K04 胷@T# I\24P"L"l2 0  H"<0P P R0|\Q0|  001 `80S1 RE |`\Th4 ,0K]@hu|b0 , 4"4@ 000 00D(Ki@P 0 t#g>:<m @PLP`D r @2@ Tpp -@LMh w&>oo`p20p0`W` K -LM @`, pP` poO&>@P2Ό P, 0U@(K -GMLM䐟0,0 qoK 0P@4t K@PLL 00npK`2@PΌ  0`0Vp, 0R(Kʒ뜃t -P<&> Y0L\"]280` R0<2<… 0S30@20D2 叏00CL2 0 0CH20P20Tr( $@S 0X2g0`TX2i=ST0S0@2U D _R 0S2! 0 ်0S0?S4 0S 0S0?S0S -!0LS PU  0 0       0@P@c@@cPE@@PcPPcP@ -`!LQp 0 P 0CA2$,0 %@$U00e0PD100e0P00 -LHMpD W@ !!8 2@  `0 @Pp1C4p 0V< 8 `*`p,0 <040(@00`@P 0@<P 0, D 800$,p(K >d bU -L4M0t(K(0 O(0`S $pK0 p尵$@\P  ~n Kb0( p噵$0`Sp ( gnP# 2pL`K2A@ @N P0LK000 ;n  -L[ -L!M(1`"( S92RS]2S\@NAP KP n/0p 0 00`( 0R $Ka@0/0`@?뜃L| 0-PL@Vm0 -L MP$K@p`0 $0S  m K"100!aRRl@0S`VXaLmDm@_ ?0m< -L M`(K@0 蟴(PpU  `mm$K A2@ @ 1P p-`L|yP @ ;`P J00ap5 [h5 X8 40R00 40 I80<@ 18 IS0$00< 0>4 8$0 $04 @4 4 '4 $ 4!00 4 $0@|P hP0LP @1*84 (4@0p`S`@0 @HLD 4@GpP3H 0cl@80T 3P)`ps@P 0 S 00KPX0S0#3 >\PP   D,PU< @R@X00SX00SL0  %H20S\"0000SD"0000S 10S`\B\TRD2p` (,"0QP 0B1 aP !<&!)Anp`0Wp10SMeX 10S00S1  XSp3 0P @P PDPHx@U1 P 00S0SȎĢ`8Тd `آxhԢlp < t0t̢ܢ| 00 0PT0P$ 00C0 R0 PXT -LP -LP@P-  p-PL0` 00 0@ 0T0000D S0`8``0 0 0S0ڬphpPTX`-0 CR 0R0 S伱00 -h1L0`SPp@Dzi@<10S T (10S 倱g@00S T 00Skg@T 00Sp`YWc80 ׺400S h  hBꨢ lH, -L3P*  -LP* L# -LPx* } -L 30S:S0S6R) 20SQ b 0R20SR Zp2 2R T"&p2HR 0R08 KPK:r D2b PKR8 K-i00C020S 0S0`KH Z\ 0S00R0S QPK000`` ``` `P 0S!0S D10S`10S h10S`@f X`f`0P <0KD0 @@ TPK H  -0H +0K) K$=p; T0L%S񟗰l,#000C+K *KH#J=p30V1P@`P@   0] Z P@, "P Py0P p@`P P P 5"000s20K ?p `B0 0cX2P R^ :Py 00@Td@Ta  P  C1 妧|!00070SQQQ4 F 0SC nS 1 4@K t!,hPPHP 01oD10AD0 @@ <0 8@ 0oS1 4@K 4 0PoH0S @H`K0 0 (K P | pt<l 0`8[k l^00 840080, -LҤP  L^ Q-L@ WP T \^ P-L P  l^ 0-/LPw@P 00+8c/00,+ +00|^ p-LpM/PX@P KrP0: S Kp0`rS@   P0-L@P0 R 0 R 0C]0hzwt0 R0h0l3] C8H0 R <0<(]808$]M0]048^C^ --LM0 0 4 --LM0 0 K --LM0 0 K -L@P` h. -LMH0@K0 rPP`AK<rP0: S V@@ S00S F`PqP$KP T P`0 R000 ]K@qP l1: S 8\((P\,9^^^ --LM0 0 T㣂 -LM @Tp`P0S ڈ 0P P 000@ -L,MD H &L0 0@  0 40 P @?@Pl HP U@ `0YX 4\{ V 4 R08  C@Vp<@ 0S00C S000C S BV0VPpU @ xP0S PUWP80 0 %0 00 ğP0P00 @TT@TQ P<@PX! 4  Y4 @0T l`VR h[ @T P[@T 6`V$`>SVXg 0 0(K4 [k 00 U  0L P0 I @8 <00  0@@30f0cß`D0S D0XX @T` LP@ 0 ,K ppq Ÿ@TM@TJ 0P,@,4pp PB ^^I R0000 0W G 0020 0  0PP2  A R00C0VV X0Q1 `V` 0S 0SLP 0 Yt; 0`Z, ^^  0(4P?p][Y0\/ @T3 0Q  0& P 0@TRf LEPa 0 ||;0 FO0  < @,<T[أx -LOMP"\垣NKp5QnK @ dp➀@T:+oPP@@K ᵣEL_ P-L <@< 8墣 ,,垣t0 嗣4 p-0LPP` @`P PS`Ppt -LM0@0cSz bSz8 PK ; 0`S R  : 0 S PU0$ ā,40V,((0 "4^ LD ;P pPt -LP@@s<1<Ppp`!08p mP Z &8p0 !0@S( W VVW# ]0`P 0jP P /0 pRpp8&"V[<`8 @-1PR  P @^! 0n <,4$<, 4,$. !,00 0 0@SQ:00a0\ <# \ 8#,8# \ 4("$$#  4S,   8#8S,,8 #  < 4<( "4,  8 , #44,  괪ح-0^00 *0Q AS^*0rS 00n00 0S 0 \*00b\:\00\ q00l P: !00S괪8P84,,,<,,,D,,,,,,,,,,,,,,,,,,,,,,,L,,,T,,,\,,,,,,,d,,,,,,,l@<840,($ [| p-@L M0KP`  @ሟ0S"V8#4,|4 <0 @!0 0 Kp@8<#4,4 < @0  -L M A`+QO`0  Qp &0S 00000@0 KP  0SKt|XX0  QPp <04  Q  d뀪D -L,M0 K@ Ҟ P0U`p@K$ K(0K@< 0@ ,` ( @ 8P 4P PPp KJ -  -H@L"0 0SP 0;0 -0@LP pF`0 A0 S` a0A0SW`AA0A0S7`AQ\ hdXTT0d0P*P2 -L Ml pR R P P`@0 (@K@`7(\;@^ ^ T$K耠P`0 Q  P  R t:  T1<|0حXԭܪHt P-L 0=5,0, (幝$? 0噧z0D P-L@ L02p pS,t_GP~G t p-L@P`@DT(0-S<@P|    l         d \   H @       @DT!`h0h ph`@T y``(0 `}z 4 -pQLP@S \ 0LW3@ \ \\PB T1 RG0 CR F0>  0aP0,<S*0 CR )00 \ 0 CR 00 \0S N \0 R \X>0R PL>h00R>h@  -pQL@ᬡ0S:`00CS`0YX0  X0xmp`_S``!o0SD@`00CS`0FX0  X0 Q 0 CS  \  XQ P`U I &S0S0C000@` VP  X U0 㿜X ҜX Μ , p-LPL`@LDR0  0R$  phpH -LM`@ RQ |o3Q P 0^, ` pP , Rp RP R0S0C000 \  R  R  R,  R P @U@00R pRT dB0P0 LRPW 0yZ  ${RX  tRY %@  iR @ bR`R!p m-, R TRhF(NR00 L 4GR8@T700 L T=RP1 R) 0 43R0! C$1 R)`00CS`0'X0  X00Sd0S`u o2 2<o 3@`8@% RH o講X o进갭8 4T\dl ,h4 -L M4B4r0 S P Q 2 0RvK0A0SQQ0 0CS`1Q QQN QO Q , lQ 0 XQPL!0S 8`V;0 40 L @L@(`@~Qz0@KwQ1P oQiQ bQxx r xWQpTQhr2``8`ꄪxt4 L  -LM0@0 4 80 CDxu/ aT,  cT ,  gT0,0 ) ( (@şş0`4 ğ4P 48 4X0 P$`0 4 dX@ 4d0S0C0Y  @  \\@a0S4$0 <400S0C0PP  N0@Sß0 30S0C0PP  :0@S0 30S0C0PP  &0@SD#0 X30LS0C0PP  0@SŸ0  30S0C0PP  0@S}0  20S0C0PP  0@SmT"0  t20hS0C0PP  0@S@g@02 R (Ky0@gS@ W1 RQ bPR,0SlA/UeP 0SL 0R!0S|B  ) ( <@A0K0C0C@ @ap> 1 R1 1R w8s`9 8  0@FpnK`F`F+&bp@@0S p.$ K@ @ʻ HL0(뜃 (|` -4L0M@PT`4\+PEU50-S"@P,**,,,**p,*****`,*********+PU  ,K@?0貓, RPEUʤ30L0  0CLpK0PKH <0 4 D @ 8 P  0@@py?0 S@ 0@@p 0QPr0SX X *0@P0 0S" @U(K2! {2 wp2 s`2 oPUt 嫐Pi 4 0SP 20S 2  Q 0QY 0 SZ 0 S0S 1 R00P001 00l1&`PNP00P0 `1 R0S?0 `7 (K0S0C0K?00Ps?0 Rq Kl=S 0|O =\X PKY| < 8@Ph -PLM`P0*ē#)p1 T0@"S"2000000000000000200000000010010010$03 ")p2p2A*"P "P0`gSX@@cP P 2 Rj |t2p T"0SXc 0E2Sj`22`22`22222222T222222222222222222222222222222222222222h1 `d1 \X1 XL1 T@11 LP =    00  p0 0p 0x0@ @app pF7p ;p@  <T|8`8`$0 R P"!P 80@-t0Q Pl@ O\ 0 l# BN0R0.0N0N 00B0 Ph4`4X4H4P4 ($- 0`S$1S00CS55 5 5 5 5 5 5 5 5 5 5|5X555 645P01 `R$0SX01 `R:H01 `R:D01 `R:01 `R:01 `R:L01 `R:T01 `R: P-L   <4("4#6$ $d ^0l -LQ 0S 0S S h-`h=0 ?00 -LKM−0HK,0 @T`? 00CSPPU`p@\K P0 0Z000 00 R@U0 0Q0V @0S <0S80S40Sd ZDX1R_K@\H[ <@P;0!`, 0R9(KP` P` P` P`P` P` P`P P P)`4 `Ej뜃|80L8 p-<L 4(M"4Q l 0SPx1 r3VQ0X1@@UT ,80Kp <4("4!\ZP@ 00@U FIT!P`UU U&Ƞ& &< PP;&Ƞ &<t hP1&<X HP*&Ƞ& @&<, P@ P8|0h\Tt -LM@0DS<T<T<T<T<T<T<T<T<T<T<T<T<T<T<T<<T<T<T<T<T<<T<T<T<T<T<T<T<T<x<00 0(hkhhhM0 -T0 ML\@4 <@زP ,K80 p-PLM@  0 R (@,h`xK ∨`P @.PP (P@T |800 p-L$M|Ÿ|b0 S P? R6 @!T#>>8?>>>>>>>>>>>>>>>D?>>>>>P?>>>>>>>>,?"RH 90!M 0RYKp|,qlpA00P! 00t8@K0 0 80 40 00 ,0 (0 $0 0 S08 K70K ?.wP ,< B700[S S/0[0S S Q"[-K04"48#8 0 .K0h/0[0Sܡ0|0 0-L(MtP9@K0l 0 0KS00 R00G 0RK0nh뜃 p-L`!\P@ p0R0S 4 LF. 4F$phF# FЇ p-L\P@` !\ "10Q0S 0S- S ]T)0 R phFpM 00S S 0004"48#8008 phF 00SphF8Їt p-L@\ `PFTN  00ESCCCCCCCCCqF00CS\DPDDD8D,D DdFaF^F[FXF R R |phPFNF RxphHFpFFhCF`@FX=FP:FHph6F@4F$( 0-QLMP@& 0S S Ux0 R h 0K0hF U04"48#Ƞ08hE0 E880t<0@SLF$F$F$F$F$F$F$F$F$F$F$F$F$F$F$F$F$F$F$F$F$FDF$F$F$F$F$F -0PLM 0-D -dL @ᰍP H 㪍P 4 㤍P  ZPT\dl -pPLd!`P 0@0P +R %R0s 0D 00s 0D hP P@ Rd p 0-@LtP 0000 hP%T r 8000D p 0D00-0 CR 0R0 SR00 -l?LhϟM080 0 P<0 ᐉ P" 4s 0 P2@p  P@p  P"@p`r ,"/`P 0S U V T x 0  S2  0S` UT8 "PB B U0P/S4P 4 40S 400ST   0&P00S 2 s 8 80S8X ㎌P80p 8< ㆌP80p 8 "P " " W 0S "}0\/S/00LP 0S00@@P2 0S/ PP:P   0Sp "R o*PT   "*0p( @008:*  0@Sp  "" V *< <@t P02 2<K@p0@0Kd,<@T 4  , @ @0S 4 B <0S; V@ 0D0 H0 P D0SDtH0S Hn h[0D0 @0x@K dP  8UT`H :R0@@Zp@4 KHwP P0P0`P0 P R 0S *0S ʟ0S#g#寊0`0S0S*嫕*<!VP P H :0S/ 90S+:R&Q$90OTS 90S9#-9#t90S9  p9 g`9lP@T `g890SDPQ0[S ]fP 0 :SSp`  :wf@P00 Ko7T00 00 7PK0`K 0@px70X p@K d'P0 0/P  02! 0P0lK<0 B 00   0 P,$ǟ0S' 2 < <0s# < PJ30S F3<0@A3`0@<0  00p@K00@ 0تPPU0k<0S 50<6 0S6 OdP`@*P@PUPx@Pd"P00  0@PUPP8@T 50S58  "R ğğ $ 0nEğğ $ 0d;ğ$ 0\:P ᵆPP\ %P@@$0H#0@X  P0#5ß3#.`40SL4 Έ P p@P " P K(P K0BP0 P R  00 S S  WP P,@K LK> ^L0SPKPP 2P "0 S00`ڔ`"0@LKP KP @0BP0 P R  00S S S  ㉉PP@ᝉPP0 L0 "S5 V2  nPP,2 @"Pp @P\ #1PP0S18 \ ᝉ<0s<4 'P!T,\Td8d>D3CPQ h.x3qr P0S0S0S 30S 3?30SDP 10P2 2 )P\ 6 <0s <7`'2 P8 (K -MLM0X ,0 \ `$ $@P 70Sk,0@ =PH  0 S H$ PD  0SD 6C.K B0 BT4 d$ ,0\: P ,0\$ 0PP4 H D ぇP P0 {P  Ɵ0PD`$0Vpa^P k@PH$R P`$FpNP4/p:`@@P00T00S/ T-*P0#03V0S& H@ P@@PTT*TlW P$0S,0\ pL  L$ 0[S]P P0#03V0S @T 0:S*0p0@T# :u/Pq U P00S P:R V  R0305P1 :P:ZPt`PL PW 0S V @@V 0S /bP@@@`@ß0Si(#U0 @0 K  8K DK0 K40KpK埤 P 00Sd40Sa80S^ V [0[[(,[ D0[@[$Č<4 4 "<, 0 K0 p @P`$,0( 0( ,00 K0KK4 80< 8K4 80<p@DDKP0 K40KpK@P`$DHCP 7500S40S80S  [[0[`[ [P[[p[@[h1 [唠[lXᤀ[[[\`@p[D0[H[L P [T d4@1 D|<, ă $x q  1,(p,4Ɵ&<.  01*$t$%,.t0pMD@Po86D@ 00CS, Kq4H K1@ţP ,575-0[ [R~[Q}0[S q5 @ Ƞ,Ƞ0 4,40&0S le@T f$ 00 p`'D  PP0S((0K  # P `K` |ğt\hğ\p/D 28$P,cV 0t0p0S \,0KkPL4ȓ0S S ß,  ,0KWP |, ) ,0KIP,@P00HΟ@P 0 , 00 $8 X` Tp L PD D0S = 0RS 0S  R00-S 4> {0S> {=0S D0S   \= 04 S< 0@ D00S0H0 , ZPMr0SMP00<0S<80S88=P`P,=`*0<0  8 RxPQ 00|SM P>~$0S z$0 S $ <z8w< /8W@P000T  T T/00P;0SQ$0 S P|;0S D$0 S X;0S  0S DQ(;0S  ;;0Sz :P P-D0S :0 PbPU   POx 0 00S `V%$PH:,0 :`) 00|S @ 8., ,0S  (*P0S00:P9 y, ,0S9p 40 90S,0,EFKeP0S;0 \i0 SLI 彺P0P0$ P0: S ,)0S009  M80S N0CSK8 00 80S,0,FX80<Q $40`S|8 `t8 j#,0lxL0JHP0S,0,E7 rp@Q#0 S YPdU<W0/S' g0S 70S0SB#y&0XKPo@0X0 T@ 0XKS#0S*帄0S000Ef6 'E`PYPPv000 # 60S3 60S 60S+6R&Q$50OTS 60S46# 6#py50S6 5 cy5hV ` V "Sy%0@Uz Yqpnt,E  , 6PP@",9p50S,00#30#,x"p3P "00 P@T@, 6P"0S @0240 S4P 4P 40,N TL00L0 Q N0Sm#xX0K 0OX0 T@ #0S #0S @#0S 0XKS#0S*0@0 P@H0S 0S,00#3 ,"PP)0S, +, xT t T 0S,,x0@R刂尢`p0p@`20S000@0!P ,20S,00@,!P ! L0S BL xO010S. 10S <10S&XK0S0S *h10S1#p1#Dx410SP1 <1 7x,1<00S000#3 0u!PP 0 S QA 0@00S3,00#32l,0DP\pLuhwl 9<8h tLQ <8}$t|T\D,+!PP @Q \140PSl0`Pt0`40,<481@0S@ ,0x0RnD0Sk RQ610S` 4 (1R\ pP V 0` P0`K\0 pKt1PK@P尜1 0(w?@0 S1P 1P@ 10S1<  #Q01@P@@40S ,0S40,00S0xH"0S0S<8(K -\4LWMPpP` X@K8k g$4X  00KT P LP ;p!xPK劼P 兼P#xK 0{P#xK P0x0[S xKX K00KP pd  PH3 004`Q,,#30P ^K E000S  <ܗP,0S2 ev`P( P 0S* 0S 0S  <㲗P(,ˬ  @@`PUV1 0 3w\xq X0040 @'w4 K0@ PB0S (0K  # PLHx@A@x00QS Pt  00S 00 uiPPuwP qw 80K8 ,T0<0 f(K\,lH4<d@ |<`0XtLLp -,0ML  0utR 0-LYPH10S 0P 00SA@ w00@P 000 t00S h0P \00SAD@ v00$0 (0  P0@L  -L\ -4&46LAM (&(60 S&P 0S605+ 55PP5uP5eP5܅P55P5PP-@P 0S ѺPP ʺP xúPP d彺PPPPl L5L峺P5  40%P 0S50T0S 40@TN @@P 0S 叺P 劺P 兺@p@3@40S@_4P(4  h4p0Sh4T4@OPDTHDHP l660S5PU   P@ş` @Pşş!`@`0#K%0 p90#K%0150``Vdୱ#NKP\ş<şea0@%p0ş_K`pP`%5V;FE  U WX#NKṴ$0 \ Ba$@PX0 b,L$^4B0=ɌBJB ͌BS08BS *Z?K00K3 3 0`^c=iB@B mBb@P^ 3冞 0o@BT-P6@P#K ia0#妳 `ah#垳#^K`T<@<pP$#Ld0k2WV  0gXPڌ24^ 8"R#NK*"aZ#NK "a^B2#KP@P 0 0 0-PȰ@P a0!9 a!1ᙰ#^K`<@᫰<p፰P|!Ld0d1d0S0P :P#NKʳ <2S v]!@BT<W00S 00CS0 n0  0 mH@P 00x0x(KTH@T0D[$  L .A ܤ     |x -LMH@0s0 K7p 0S茢wt@ -L@P 00s@T -LANKM @D+`᳣"PP ~K pG'+@Pp8[/S)@ .P K08SS/SK<  0-0L0M0@S DPK0 ჲ 0PD0SHa) 40jP K0  -AMLM4 p@8 T2 0S2@ P 0S 0S4 00P0SxPP 0S`Rᱲ0 S0/R0 S?F0 BnK`F@+(0K 4R/S@/04B+d[PLh !X0080 0\0 ,$ 0BnK1儑儡4D`FP t1p3\\ PP 0P @,100CcSX108P 0p30$0, BNK0@Dk**P X000a$P 7@Pm@hhm00(KP99$ H $LX Lp<L |` T -LM0萢 -PQ00`R0LMSpF ,20SB K"@f,^KbHPPAZPQPOK@D^Kl0!Q`$3PP,EP PU  0kt kPd!7P Tl(0KP@x0[SPlH0x@KU @p KPV`APT @7pP 0w03T0S +P X0 SpP h00S`0  (KX!    ,|      p@ p-2L0PS 22 .k2 p2 R22PR x2P 0S\k.P 420S 8P(20S 12 j1@ @偡1 @{1 @u1 @o1 h10S1@1 T!0`0PV | ㅰ@Ph 〰@PP 0T.S@D0P008,!jTP$$ ϰP10S 1 1  V  d0 j R00 V   㱰P0" 00`p@|  `L x    q<h;P P L pH   0- LM0P@0P  P Kh0 R r X0000 T 8@,y" >j0P8T L| -!LTM1Pp`PPW1A0 @0s 0 @0s 0` !P P1P>"000 0000,K0K4K(0Kd@K$ K8K 岐, v80$ d0 40(`0 00v.B\0 ,0A BX0 0D0 T P Ŏ0V0p0S@0@@ p0x\ i V P@D! i@0tp0 K\ Ld |h    -00L((\ 0 0ikFX[  -5LLM % , 0-S ``P@CPp00`lp $p d0@ S 444444444P$wpD4 U@P ZY $咲W p  pL p@H P9p Hp hpP UX@KvT00 T0 ,,#3b0S0jl0 `pl}`K 0S `0#40Sj@\K \@ *PS WV  p@ @ T  p0S 91p ^ h d `KN hK0P`@ 勬pTa0-SP pMU@P9 Q 0" l0S$  @=F0S (U"  , \EP 4515P@@uB zTh뜃XȤ<L<[`h(8 <,x<tP -L+ 0rD -GML1M a |!@0P$4 X!*p oP9 4!!p 0bSQ`A~K pG0pG4 %P3 $$004 4 =K 0C0C gP"P -P P A0$tA.Kh0 B B\T0$8D ,i뜃<d8(\\`8Ъ -LM@pP4 iPP 0S nS6 =M`P00QD @ Q? hP 0V0S D 0 YppV 0`pY" 0 0 p 0oSP00 ,K\/, ?R0S@p @ `0 p000"S 0($P 0 0~kxp -LM`PdP( @(K,pK 0 g(0@S ,$Kg0@-PQ @p`0N S3. P P 0 CS @ Tp@-PQ @` Q 0 CS @ Tp Pp-L@P6 PQ5  0R1$ $0 0R+P P% Q# qP P`@PP Q bP (0(PS ,,}P`@ Upp - LMp@`,K4K+0 0` 00B1R bP  0 <4 !4,<00 ,` ,00  , 4` 刪40S 0,0   0 R:(K -0LMPp`4K00 0, @4 c,0PS  [4,0 400S ,K:(K 0-LM@P  $ K@ @  $K00P $0K0 0-L@彫PP, $2pP@ 0hA $p? P 4P 1185;$%$0hY0L`x p-`LP֠PӠ P Ϡ (0PS,ɠ U@phà@P -@̠Lp`.0'.TP! .U.S Ut! 000t0 00000s03-T0S _T _TX00`@T -LM pAn0 `, P00 I@P 00X0+4Л PP:d'A n t,0400P4 .0@pH?HC)p>?$(Ko7(K 8,Ll -LAMJ_K, ,KOKᕪgfp`P#0S @ fP @T T | R 0SR( K0ACp 8=f`V000 JKp, (KLL 0-L P2p@z>8 %pn> 0h0 -L@㑣pP`8 0 0 $ $0 0 $ $0$ 00 $ `P DbP P =bP((gP, ,( @❨TP P@`( -LM, P<0<0S`A,i(, 0V 0Vd18S_|a@(0S,M01(00Ea@(0S,A, 0p1(( P,B 0!B0,( ,0q`(0S,#,0@1((P,$ ,( &, ( 0!a@(0S1S (00ԢP, 0! PU `X,P`L -LM@P4K H0S   Kp0 0 ha 0S 0S  4@K$ $`K PdP 0S pt @T `Pᔩ4pK@0PS @ UT $1 1P @ሞ`40(K  p (pPK`P ( (m   g@4pK0S  \@ T<0 80Q K[  (8L08Tp -L$M@PPT ppdW @@K$ ឨD Ꮩ8 p  0SC ==0`P, 5  ̷p  =),P@Q#PUT@D0 XP <`,\@0 EP,Ki$84P P-L@`Pp\i. r 0000SR 0 ᝨ``P'R"R $R `R \R `F0 `F P@T:V00\hHx{ p-0L0S00@T,``0@p Pp 00\PD8, php  -L Mp@p P lZhHp`U \2\D٢@P<H Ấ,R,,Ka( 0,0 0 2K1p  0S  < P 2[ p ;`P S"0S tA`0S p ; 8a0S D@KP C 30X 04 000 5@T00\0(@^0^0@N ; tH0s TQ>$K98( Dt,H<X -L M`*1$ PA1@'qP0!0裦p Pa*0pSj` !嗦pPU*``p0SR l!勦pP``0p0I:F1=U(0 (0S $1 AO0!opPp``+*P U {0 lP @`Pp0 aP @`Pe0| VP @`` BpP 5:DP(K\j8[dpL @L p-ML M00@S`0 ZKPE*QTP *ㆦ P%*FP  K@*v P\%*TJK@DᲦ 00i/@.KpDDLt p-DAL0S8 k$1` P@00S  0S $0 P @T00Q P 0rh@kp00S0@ ,@8P  000S0,ph\@0)  -LMMD1~K pG`pG@P+PK尥_-૥1!0x6 p& V !0K@QF t6 l& =8 46 p@ 06S B0 ; ;KSK?;05 050%50$H0 0 &&&&a  K@L08 -LMMA~K pGPpG0`+0KS_-N0Kt6 ,0x6 d& <0@h6 0S1!l6 p& 0SS0 ;0& 6 0ˇ0S R0 0 PK @@<p@ 06S 0 ; ;KSK?;050 0505 a0$ 0CST0%0060 666 0 ⊣K@L\8 -MLMq`KP @@+@@KӤ_-Τ`1V 0Kt6  0@0f@P# @1S 10p`00S ŜP@T   00 ( !L!(!L@D!l!! -LM0B0p` 0 pP0  0 000 p00匹0P0 @ @` ?KAQXtX0$0 40 $KΟ00X $0$#R 0?X@0S D@ K⶟0 0X c01S0X2P0X@ 00 @T ~ 0i/@h@0P 00 00 000|0$0 K@!8L -LM X10PU R  00 0 S   00A`p`@TUR Kj1S0P0 0= 000  00}= 00 00'<00 00 00 00 0,000@%B@ -\1pL0`S@DP K#rPH @T @@PiK P61S$00$00 0^ ,0P0 @ +0S 00@0@0000 000 0@0 @<UiK i@!Lt p-1LM0`0SS S SnPPfxAa0P0@P|10 \0 0S100 0;S<000@1S  0?0 000@2S  0S  B!   K 000000 R100  00 000 R1 00 00000 R10*x@!t -0L Y6! -LP H0S L0S 8P $0 [0 K08** -LM,KKPH,`@@A0pW<PP6 @0S#05 000p WP=SpP 000 E}00=0D0S ݐ@PXL  ㉆0D@`V$0D0S< ,PK)8L*  -L\R\\r\M,Ks`0SDg X@?T,A0S * ,0R0``0c!S0/0S (qA!0 D <0 0KKK40 0S #K DKpc0#S- _0S) [)4 3[ R T0S (0s3[ 0S2[ ⸒p2[ 100@S 0S 00M p0s Lw*,(K8P+,+ \+ |++@+X -LMPap00˒NK 0$K( $0_. 4@ 00 , 0+s( P4pK0, BP@K 0 L0 0P` Hp D0 0 p@;( K@8+ p-LMP0  ( ,  p@}(` 0K`?pn(T0X0@ `0p_( 00@Kp8++!+ -L4MPNpK02 } h`PP 0S :(XZP@P0D P @+(@0 HK, ,8lB 8, p-LMLS8 SS<7fS7 bS4 eS49sS- tS% lS-&TJp +4 $ 0s Lp0 QQtx0:p@p 0 P p 0 @ @@$4 (o0ST3 0T00w0S 3 0W pWڔR t30C @P W@cXP pYH H bQ IQT BQLQb SQqsQj fQ lQTtQ xQuT0S"PE- r 000X0SR 0x"7P``'R"R $R `R \R PE0\  PE `@X0T:T0Q"  PE0O4 < 8#" ᅨ 5PY   0!pPKP`@.8C80@!pP9P`@ !!0؏pP* 0Q   PP`@P`UP:Q X` 00ƴPE XDYP PE ƴUY)(K`.L./P/t///H8lHTL''/aK -0L0 S 00CS00Ӥ0-L L \00! P 0 000p0 T0 p LPQ(0  B000  \ hb    -LM℣儃C`Ppp 0  0#Pp P "P*3@P3pPpUP\PPP" P 00 U@T00S Rp R R2匂7\00A S-Q5P"T2PH"@8TpPpY0%xP00S P0p 000D1 T1 @ TA1弁  !0Z\JqH d0 00A L!P1PD!pTp Pp@B0 -P_P p 000 0 T0  p 000D @ T@" 0P D0 P<0p\0 00i  lX /0 @0  H0Y<`  -錠0LSt`tP 0lpl@ 0\P0 H0  0 0X,0000 lX  h`  -L@\ pp00S`0 \0 X0 T0 0000 (0 T(0 00 l \` X  -PQ@`Lp "  0|0 `t0Pp0pl0 h0d0 `0 \0 X0 T0 P0 L0 H0Pb    h`dp      Xl\ p- 18MLA10 P`垍   PR^0Ӆ۸00S H@ F@0P80 D @@ KKOK p @0PK  c?[ 0, ?KP @ 0@K/Kp0 @@PK O/[ 0K 0?0K< /K@@Kpx@|P0 @PPK 9/[ 0K 0O0KL /KP@Kpx@|Pr@KqP 0/[; K0 " "0/Kpx0|@@PK 7p@A0S =03S 9$9T K34 -LXM pR,1 (1!D  pux@K@ ܉ P`010P D` 0HKhKp @R lL8@K´ ᶉ0H80 0(0 800 $0  0 Kt3i@84T4 -LdM0 X0 0@`XK,KPT0 D @ P L H  0 PPهpu ,0Sp ?pP 0 APPŇp`0 S ~|AT  ,0XP ap`$,0@C $ 0CSL'@B]$K+8EEEF,F@FPFhFFp@-<@< `P 0000PQAp -$0@LP @ ܣ -d@LP t@PHKDg0,0( 0@ 0 ܣF -L 0LR RP 0R >|F |00-PPp0Ll Pd,u\Vp@ L:AH0P 0(,0'FܣFF -DL@ P(0( 00000 S,| 0-@AL81 PP,1, 0P  R0 L\00P  BRʔ00 0 0 QT0@0<0UP<@00{00|( 0-DP@L0000@@0 0 0 0l -`L~pP_{0 SPfu% ࠟ0S @ PF00000 G`PV p 0@.\Jx@P`0 @0O>GG(G1 P-L`h 1 @0Q0S 1 00P\DX` Q0DQD0 Q@L00|pP00CS04@0U0, )0@0CSp0@0B0@p00 >PP \, 0O00|G>(@GG-鄠儐Pp0 0S0 0 BS00R \P@`A-D0D@00  R P  p-P@0|`00t0L@l0@d0@`0@w0@0CS0 @@00 ph&p( -1q00SL-P`0L00| P100CS0#@00 0@0CS 0`@0x0(000   >( -LMP@0 22PB ,K A@P zhhhrhb`"PYm 0 P40S0`00P, 000S SPp PP aP PTAZ,KPPU 1 ,0Q.0 Q@L00h{ PzH00CS0<0A004 [100CS@ 0@00I,  @p0P@ e P P \0P 00S Pp(Kc,l XGpGtG>( -LMP0@ T T4pP- 弐0帠S0@0+@P`P 0S  0  01p3PPP0T@G-0 CR 0R0 S;00 -@0LP`rPe`Z !`0Vh`c0SUJ L0SF I0S\\;@U`T x߀P 0`!Sb/*0S@,0@0f;0US8080W;0US00J;`zUB;PX*\00S` lP 4; U 0@0^S00\P0S GDGG -LLrLLL`~@0S 00CS00PӤ0<<PuG  Q/0 Q@L00y P00CS0^A0w0V S0`0CS@ 0 L!0d800 S0!00 U`!00000 +0S0#3 PP 0S0`00` 0S0`00|V @V00 00 0 <0 ` ,>(pGG -3LM, 0 0 S@`TA9P, `3@, P00T$(XG p-L`P@ ,9P pP@T*pG -LPp` \ P  |@0UPh0S \0S@ Pp `0U0U0S -LP!\@`8P@3 pP0!SI:P H;<0<80P ,8V0fLGH$l[ - c L@p)"pW0 WP\00w PW 00CSP 0 "0a00 R0 Ch"000S 00CS00Ӥ0a:=:x0S0  p7P 0S0@ P X R/ڈa刡0 RP\00w Pd00CS0J@A0 0B u?0P0CS 0P00d X00p 00S0#3 PP ]yW d0 00l0 pD0 00@00S <00SWpGp (>H -L M4 pSŸ`2 0BP00 p30!00P `X`1 P00CS0\A00T Q00CS0 P!0q( 0-LP9v@P(0  00 @0> p-L 8 0 00 01hyH -PPLpx00pPü`@ |P 0 PPP@TFl -0p0`0L 0P00CS07@00/ P,Ġ0GP{P x0@0S@P0 0C0f00h0@B`0T@ 8P00 $(l -2L2@ 2B0PT@ P0 P00aS000 / ,1` F  P 1 0R P00CS0MPA0j0E B1p0U @`` @000`000@p U0 00 b 0 00Sd 0@Cd0T@ DP0(0 (l -lAPL\1@T1 TpP`dU0de`$A=000PP ZP  P00CS0*@00" J0 0CS0 p 0 \ 07p`V*40`apVl( -2LM 0S0 G, Dr娂@`7P "00S&00000 SP\r PD00CS0c0 0CS P0  "0p0 w0@`, T R ڐQq0 R@L00r Pd+0@0CS 0@A0=0q yw 02P3P@0 J0 0:P  5P00CS0@00 0@Cl0T@ LP00 m(KPx>(l 1-qL`!0S+PP^ 1@00S S |1|0S0`00U@0SI 0 R0PdU0.S0 S; 0P00@P V N `P 00CS0@00 T0p 0CS0T 0 @ 0 l ,( -5LM 0R,0 ,KR5P^ u,0 QtUte0 Q@L00q P" 0@0CS 0,E0=05 dp!00!S3 %S  Q0 Q@L00q P 00CS@ 0 t$0`0{00@0 0\S 0 0@ X& #@T0 TP\00Tq Pr 00CSP 0 #00G0  l#0S 0ST;P00 Q0 Q@L00"q P@ 00CS@ 0 "00"0 0Pp0L0 0P:Ox"0Sl(&\Pw02 , Q/0 Q@L00p P 00CS0oA0h0g 00CS@ 0!0Tt0 0P0p,00Cs,0 @00p 0 S  R$P`0 R@L00p P00CS00@0CS 0@00X0\@ NuP0 p000%S!S HTX(tG4H>h -"LM00 S1 100 r 0 R R$K!P` 0!S 00RPXp1$ \1O$0 SLQ@ Q.4Q4q0K00p`P! =00CS03@00+ 0@0CS`0@00|0\0$0 $ 00$  Q000P (0HH\`>( -0LMP@( pX 0@T@@T@ET P`P ` 0S  0;  0pP  0T@lI -2L 2ŸP pqb匢倒刂00 QP0@.TR 'Tf $TL  T T%T,Te +Tp 9T0T1*B?T@ ^T ;TdU!0   r 0 R00B S  1@s^T-T`Pt 0^T-T00PS@  1@s 9S6 .TPP00S. /TBPP) 0T00S 0000LPPS 0;T0 0 0\ P00wPP U(00S(PlIF -0 L`pP0 @000 00 ,S;S;S "PD 0S0S0 000S 0 0 pl -Lϟ @ t 000 Tlo iT  &WT HT ET !T =T` TGTbQTs VT^ PT?eT cTI |aT gTP rT mT kT8 cpT TnTvT< tT +xT N:zTP@0 nR pR lR 0P0P00PP =  Q ,>0S p>0`>PsP0 nR pR lR 0P0P00PP 4=  Q =0S ==~PI==QP?P0 nR pR lR 0P0P00PP d<  Q <0Sz <<JP,0 0SS0 x<0S <0S( p<0S r ;000 8@P P0 nR pR lR 0P0P00PP 4;  Q Y;P+ $P\PP0S!SH +d0S, 0S @P ; ::;0S[ rc T:000] P 0!S4  P0 nR pR lR 0P0P00P\ 9  Q 0S+ ;d U9`V 9sPaGTPPgTPXVTP P0 nR pR lR 0P0P00P\ 8  Q  P(00090SP0 nR pR lR 0P0P00PP 8  Q ) 80SP0 nR pR lR 0P0P00PP t7  Q it'00cS0 `'0S TT-70S. P0 nR pR lR 0P0P00PP 6  Q 860S @7@c(7PP\0 nR pR lR 0P0P00PP 5  Q H60S 66P} $0h&@ 0R P0 nR pR lR 0P0P00PP 45  Q 5&@5ZPH 0 nR pR lR 0000P 4  Q $5 55/PT`pP40Se @Tk40SgV`pT P0 nR pR lR 0P0P00PP x3  Q j30S? h3P( 0 nR pR lR 0000P 2  Q >d3 \3H3P 0 nR pR lR 0000P 2  Q 2 220S;P0 nR pR lR 0P0P00PP x1  Q 10S |1 Rt1 d110S  0 nR pR lR00P 0  Q L10S d10SqT\ P6q 0000 10S1  1 g@P" P0 nR pR lR:0P0P020PpIIp_I``84(IIG<(lhdIFTI4HLLII@l@I$l}P 00  Q X00S- 0S0!S+a0S0S @0P 00P 0 @$q,Q`0gS  S &:00C S#pS rS` 0`0`0`0 1@sTP000`00V FwV 00 S 20S@ p02  1 0 S 0 Sp pRV000|2@  @P00CS0MB0y0E BRT P e 3 @ #00CS0,C0[0VPP?PT3h#0$S0000W0#00#0#00# 00 0nS pS lS0 00 00 0 0\ 3PP0 nR pR lR 0P0P00PP X4  Q N40S# 444 ~g4PD{P40S(0pW50SH'P0 nR pR lR 0P0P00PP |5  Q 50S #50S,P0 nR pR lR 0P0P00PP $6  Q PTRpqW QWPd6 Pt60 r 6000}`P8 60S6 R6 6  68P&0 nR pR lR 0P0P00PP \7  Q 0S0!S+_0S0S`{7WT7 70QP7(0P00 0S 80SqWP<80S0 nR pR lR00P 8  Q D B8 8 P010C0S  I1@s qP00 0 nR pR lR 0000P |9  Q 9)00Q0 mP0 nR pR lR 0P0P00PQ (:  Q H:T 0S8:`:=Ml:0Sx PCP0 nR pR lR 0P0P00PQ :  Q \;%;➇ ;0S, 4; <; P T;  PPt P -LxM  Vl5 InPڠ0000SrSh5hehhhhuhU@sP xP pP00 @ T0  5 (%&p0 10 00b0 0S 000-S 0@S@ʠ000 00C0 5TP@KKP0: S  0Z040{5P } }}}}@P >7*#000S 000S 04P 0oPX30S 000!S 0+L^0S 8000S  20SsRcT0S o'䒟䢟"P 2PB-"0S& <"0S"p820S  p2Rlh2 0E'IP20SH"0`008y"0@09"000 S 10S!@0`00]@00@P @P  @Pt t t$ @!00B,00S  1R 1 0&0 S &#h00Sc 0R0 0&VId $J``8<8J,Hh`$J(J044JHp_l8J[PJp ,XG0^S0]S[S 0.R =R:R  S0Q]S0]S S]S -1L`@[S \S`P t0 S\`0S S,140 pcQ0A0 QP\00eP00CS0-P0/0% 0P0CS0@00\@DP Xj H0 0`S  0o JJ>( p- L P p P 000 S S@0S~ pk`Pp0P 00S{ f|0P@Gpcp\0P@P PP 8 80刚`PppGJ<>p( -L Mğs@, 0 40 0&S903` 0hQ0 QP\00d P{ 00CP|S 0l#0uX0, $3 0P0@ 0Sv\SC00S@9S>400CS:0 2`2 0hQ0 QP\00d P5 0l0CPdS 0T"0/@0,  2 0P0@ 0S0!`V&0 VP\00sd P00CS080t0CPlS 0 \!0H0]01 00@ 0 0c SC R/`p0 RP\009d PKg00CS0@00 ,0P0CS 0PP00(0 00@(Kx(>| -LM  @$" (2 P  Ld0S  0@_K  0 B 9P$" b  ," (2S  S ;#rPU0 U@L00c P; 0ß0CS@ 0 h0KT#00ß0S 0B h K 0P 8"RpW$0 W@L00c P00CS0U0pŸ0CS@ 0 X0D"0s Ÿ0S 0 ;hK`0S 2S ,\    ?K圱Pk  "向0pf 0 Q2 /hQ`0 Q@L001c PC<_00CS0AA009 $60@0CS 0@00W "1 $ 4p00S 0T@ g HgQ"(Kx(>J -L M0P䑟0C0 4 , 0Q000 400pP^A QPX|0`00pPY`P UDA  MPP!00CS0:A0*02 /V00CS0  00 P,00,0 p@0d 0b, RZPP  P(Klx(I -L0  0%Su0 SqB 0Sp  Q.0 QP\00-b P?[0@CT@xR00  0<0CSP 0000  Q@ 0S.@D/\Q)0 S0 @!!0S 0S0`00 tQP d!000S SPFq@a$@00 S R0 a䀟0 RP\00apP00CS0#@0?0 0P0CSp0XP0,0$ H0@00It>( ,| -@p@@0LP` U0@ P0 R00R00 10B0S 1@s @@ gR0000|I -`吀L p Q0@P @\T00Cs0,0 (0000 0謬l -2LM0s22080  20s.xB0Sl2  +`"0X0 @0A0 S6| 000  0' 0 00 0 00L000 000 000 0000 0 00   00#0\L 1   @Bp4`K07# @D0 0C0n##0 C0?^NPnʬ00S:t0x@C d0 \0T800@ \P00 j(K谬lJ( -PpL0` Sd 0 @`@P 0 P 0 5$m 0 5$g0 % 00:(V[@@訬>g -/L@NP  0 ST @T 0/S 0/S @T  -L|M  bP  ) !PP3 30CS|TTT0SB 80Se 0$ p0/S0`c,4@ 0T/S/000h0 S" ߷  PP0S ᆻ(K@s ɷ00 ÷  Ɲ00PKp4 3ST D0 Sp * R2 0: S  R, T Rw  RV QP  0S. O@dp eP$  $ p3Sj D00* RT2 RH2 R` 0Sg 姉PS!嗙$ 0 pf0: SF1 Rc0S? D0g: R5  R+  R1 R q3%P) 0S h@3D 0: S  ĺ00 1 R q3,P -@ q3APv   㟺00 0: S B00tP -H l DMPT@ 븬KdPt4KK\Kp -LM@Pԓ?0 1 p0#gp5 H0@*S*LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLp"1p2`@fT"0Sa 0S !001po2`Dx2xBQ+sU P*dPDd 0 0!KpPw0SkVu8  +!00}1 yo,1 1 q1 1j00g0p 1 b p ! ] p ! X0S 1SX0 0S0S 10 BKr1: S0S BK_. 0 . B0 )kp 0S p忕h引 \ P崕0: S[K<KKt8L 0-,@,PL( A =LLL -0 L8P0S L p-0@L :#:0$ ?RP@3c0(  ,0c?B3c 0=zP`[U  延PP0U* NPP*0U0. L9PP.p 寕PP0 0S 姕`0U<0_PP 嗕0U`0dL{PP u0-SL0S 8(倕`p$z`MbLLLL Q-L@ hPT GPD0P4(Yh[QML Q-L@ dmPP|PD0P4(4h6,ML -LMMpA^K PE0PE`@ 0 ?yp% 0K T04BKP0P 0RK`&P XLHD,뜃L,MMK -LM0S  @T  =vpp D Q ! GD0S>4 R, D$0S PD00CS0 0`0 Pp@@ 8$0S0($0CS00 Pp0@@yVYV u`v兔D{0S 1 ,u`v BKPP$1:( SPPj@P0?8 0 y `. Xxp  0T00(J@PU 2 3P/0xp8 t  00 dP)0?PX 00S 00CS00@Ӥ08@d`dP0S 00CS00Ӥ0$ PpyTp ,8M p-LM`PP@L 410SH(10SD10S  0@O5 000 姲P 0S0;06PLQ $Pt 0$(0 \(0$ , 0 \(K uP(Kp    dYpY|YY - L(Y -LMK }P[ [4 0 S0S 0SHM -MLM(%pQ urPP40S J`240S 'P 40S  K P$ 40S ԰JNK`@DdK@ @DK 0H  P 40S  Ғ`40S 4[S /P `+^+O3 3`V KJ3@T u)Kd!KP04#:  SK RP Pጒ`)KD 4rX20S K  0`x tP `20SX`[K(PEPE9K) 4@P `?V00S 10S t0S o $h0S`` K DK0P Vd10S T ``T0S H10SD R ( ,0 $0V f x  P V-00S)>%V00S D0)KS(0D0 D K d00S<0@K08K0 9K4VS B`(K  t YY   Zd  -MLM99 , 0|igS0,0 pY,@ 0L L( 00D]P 0H( 0 0uS0nS0 0, 0,@]P ]P0H8 8 0@KP8 oN\P, ' P 0@K rP`@p@T k#WPPz,01$ ~r, ,0SU CKI@pKg ID X( 0 0 !0@S0dTL STv 1T9T-LT NTYaT- VT~bT* cTnTI gT4 fT.hT| lT|2rTr oT> qTtGtTZ vTo`0H8 nP M0@DLH gdF,K h,00SZ |娎00?l&BP ML KL 0 0086 @%P=035 +M P 3D( 51:5 *E,p 00.S.0@0KX8,0 , g bM0,0 0%00Il%000 BT000IL $,0P! 5P p@K5@XUP 4@0D(R 40TS4T 0DST 00 RÀś$0s400s030 ㆶP CK.KI B BI`T( H(00 @0-S 0SD8SCC000S30C S;l(4)4))4)d+)4)4)(l30S 㙱0S.P,  @K>\P @KT(#0[ P *TDHPD00: S  JD00: S S0S2P" 8TH0S h"0SP h(D8S)0S D+L!0S  +P10SP嚭 @pK !0pm[ P: ጭV`<d!0S x0S810S  D0x\0p10  L8 P P`0S00S 0S P 0S娍V`\PPT00S    ZZ43ZHM4Z ^E0PEU\EPE@- 0S  00 0 0cRÌ`@0  0"0Q1 P0 0SİM -0L0S -`QLp@00SP(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 # 0 "Q p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K 0@-@P $^ 0 SΎ809P  L0  ( , 0 8 < lPP0P@-@ $P Q < ^ 018 0C0,0<8 0 Rp-PL@4 0@Q1S``.Pp(0 `S00`(0,0S0 ,00(PpUE20Pe$00E`S0,0$0p040$PphpXX0%0  -@PL $Q ,0S 4Q00$,0$0P $P 00  00 0@-@P \00^ ^l\P:0 -LMpPL $`VI 0S<0S0S < 80 0(K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S @ 0 0P 0@P0P $P 0 S<0s3 -P00@Q0SLT$PUQ (\N ,0SK 0(! `P 4P $ 0(P0,p TLS.Q :%<,0Q P0b0bS.00 L P0l0S.0b0S>0Wl0 $0 #4wT4p$`0% -$@L40pS` $P0 (P47 (Q$ 02,(000( PcU4:b JT (0,00 0e0`U`1`!  ;TPU 4e 4T(0,00P00( 0S00, (00PR:0,0 -pPL`P4 $@T1 0S 0 S+0 S  > ;0P P 00( 4UbS(0,0e S,P0 0 -L0MPP  $PU 0S 0S0S0 S00D < , 0H0 8p<`@ 0S񟗗,ERRRRRRRRELFFFGGE,IKLM,N(OO|PPR EED< y< !  ;< 0S  0  Z  0RJv`V0'RP0S'r0$ 0SH͟`F 30 `  0 0p8Z  0RJv`V'4<'<,4<0`80 00p 0S < H  D00<`8p k 080P\ 0S  07s`0Z  0RJv`V 0 S(G0G\GdG 0 0T0 0+X0 00LP 0; 000!q`F<07s` Z } 0RJv`V@˟("('8,Rc`0@ 0p@0Sg DQ01 S@1 @!T`  HR@0D H0d d dD H @0Z M 0RJv` V"'5t  0 0Q\0`d 'w`FR0 0h Z + 0RJv`Vʟ00 0'hq`Fh\0Q* h00h0S S.0L T0l T/p l0PZP< 00<0h0T03L@ C 01QZ  0RJv`P Z  0RJv`V:7q 0`ah UP  Z  0RJv`V:^`a7q< 6 0n00'q`F(P   Z  0RJv`V:71a q`AZ  0RJv`V:71a  s`AL 0S \7 000 h0 0h P*d `0h ^L x:0S! S>/΅T 0 l@L0T l0p` 0P< Kl0`P00X0X 0  p0d P0< 0 h6 05T030CL01 P0 Z . 0QJv`S4  03 @C403<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ L% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`8 03 @C803<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D @,0DD 00`R00< jD Rr @D0 bSH @c 0 bR a(00b@40bRD@0 Q10l@0D0H0lD0 0 R0@0HS 0L H DQC @0H AD 0H 010S4  Z 3 0RJv`V@0Dl00@0@0Q00 H0 a8'4<,'<4 <S D@  00D`@ p0 0< H00D(08pS<`0S 0@P @P0< 09,0@ pc`b0 00@ 0@0 0RV0 f q8 QS@00<`P  \ 00R40 <P<  < <(KZjNMMG-|M⠀P00\ 0 S |@0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q | 0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B00|0 02S0C8#(@  P P@@a800@|0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010p|ЍVjV&UT[ 0`hWE:Kz -0L R0 R P0 |P0 |@||M 0S X@` @PQT0D0L = 0S 46 !!!p\4\\\ -L M0@SKh(P K0 R 0`] 0-L M0@SPK0 *P K0 R U0> ] -L4MP@8*'唧0匇oS000 `gR   0P` mS000 HfR  pT` H` $'ߞp= H0@0S0]\\\]\\\]\]\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\ H ,&塞p 0P0 0S 10 -R% 0bST0SL  H0SOWppV00Lp L0 `QV< (  8 000C0S004K 8@0S540 R- @ D 0@  T q`pnp`kp`hpW0S `:NP p @ ` D < Lڨ`Pp ᛧPP+ 30C S`^^^^8`_^^_^D_D_@ np0S Z 0fP 幀pPPp0S 劂0SH 0!R0S0S Z@Xw [P P R 0S0SH0S[ D@ wPP PQ@  pT RJ 0S0S@000C0SUQ4K` PPlI0S40 R| @ XP D c8K0K, K;rPl0@0 ,00D ,0 TD0 L00L0D, L00L0D LEfPL sD@ (P fD0\z0P0S0L00@ D0 #{P\ 1 0@0 D0 .MpP@  p D @  @ `ܱ"00ǁ|bt8 ^d8 庁X8 V HR 8宁[! !!!0]<dtp@]x]]o@- 1 ,0^:*\7 /+0;;0b p6!  p0p0t@\E\%0\Q) p0! @p0t@(%(5\%R 00OQ  44\%R 004OQ  D08 +P` wFp6 Sp4^  & |6 00P @@b b3a R`QR|6VFU 4@^  850L 0 0 0@4;D$+4 0@0P1 0( R  0 OK,iIHß00 0PSc,[I3 L00 R  OI 0L0 R"0 0\2^ pF1 0p & l&R0 0@S1 p)I d!`2 R T寯0 0fK A ?p6 S1^t  & 6 00P @@b b3a R`QR6VFU1@^  850L 0 p1 0( 0Ox6 tF 0 h04h000O    p l& 1 0(p6! (0 h04Ch000OQ  p 1 0( p!1 0( ( |& pF1 0( 0O6 F gP*P z & ꜃-Dq-T]аP,PP -LP`eJ0pS000000 `S8#80 @0c 0 n)0p0 `H 0-P L@ tP 0 00 S)0 00 -L@Ah:0,qSP: !0S2 0 !: S0Q @ f0S V&0S v*P 0 Rm*P嚮0S 00f0hd0 PHh さ4 -x-DPP,P Q+QȰPP -LMd%EnK`F `F 0,            d$ `$ h P0: S4X@N 4ؔP4 R 0$\Qp  00p 0S#Pm)P |0S!h 0pL4 X4T4 0$KHt ? @D40 0S (# $, 0R(Kp0: SP+  )P 3 pP@{ 3 O@t O#004KT$ Ht X(AP($3>I(0S $ 00Ԣ0S20S BKNN"1A\0A 2 0!00c000l\#0 0@P$b%P$呭<!0S" 2 WPk 1 PP 1 R] tZ`'0X0C0W2)PI  h4s h!000'0 000Hhp  (h'0000S 0"xBKNN+4K}@T 00C0 , 0 S ꜃PD(Q,-+TDQx-ȰԄ|QQQ̰R4Q-$RPQpQQhQLRdR] -MLMp0P@AnK 0 `F?`F ߓ 0'U0 U| 0RK7@$(P 0D: S40P ( 뜃-xRPDR]  -X2LM (40p  f, ;;S  0SSYPPV 0SJ, Y, P` ,,0+@+PU`RP ` YV4 P,$/+0;;0b\c/00S@\,0 @ ( @,0 T0000 00S0SU$0S x( @,0 TP0PPP4@ 0,0P<  ,0~-R -LM⸑40Qp,0 [0P (0 4P* /00S@0 @P, 0R(K0Q`0@0 P`0OO 4D;$+4 0,P  K1E?K0P  {,0@ hKE0 0 0<. 0SP0SP꜃-]R 0  L- p-d`L0S TPT 0@1@P;0S;;000ph+t+- -@LP;00! p-LM`@P 0|0h S%00CS |%00Kp%%00`R -\0L@-CL0 P 0S P 0S -h+R -LR(M00Qp h0b43X^u  0LQ OTUi H 8\J0@O /00@@D @ /T<9 H 0Po 0vN0O<0 8@ H, 0H< 00 8<  5ɯ @0O 0 @T40 0@ 30 ,0O$!D@K0@P U`] S1 R(K  0@OP`0 @肶P SWSH@DPK`0PO` 0 @VU1 R 0 40\<0O TP0 R 040 @/  0$(l--,a0aHahaa 0-PL@T0.EPT0 T @0- - 0LS   }C -((!0S1!1L ! 85H:pp\0Q 0'TP@BĠ``A 40P0Pp0?P|Vd0SP@AL``A88 30!---!--T--|--,S -L2\%RPj 0 0BO?AP PppW1( ?`Pc 1A1U 10aP   @H1\%R00 WP1 P#U 0p 1\%R(0 ?p  ^ $0 W0\%RX0 ?  ^ 0|@|0Qpp 0 aDpdP=PP$ -T-h+--t+aa -1LM@\@c1 \_a \5M:1!P@PP0 <0 A18 @x dpP4 `@P0@ F P1P  , 80Ǐ 87 H$pǏp`1<p P@4@00@#0 09 i20 Y($R>Kh d 0 T5 PE 0BO`E?DE 1Kh\ X T8 4 @E Kh d lBNK @D@D0$P]"2\%R 0 L5O0@2 H @E(0/"08 t2( l2\Pk 0 TuP21COpW<2PoP `H% / D5 0  R+ 1PX0OD0 H 0h!H5DE0@H5 SDE t0w O\&.x1P`pWPX0 S R40S00X 0 BNK @D@D0 H>P 0Wh0SN?hd%T P%  0\Q 00S@0@pKl0 %0 L5O0 @W<00S@0 @꜃-TU,UQ,ʠ0p, @RʬrD"0PBS4000, R|b tb@ 10\1Ÿ@ ,0SDR@R1@O1@0LJ1G1 2D1!0S pA0S 0Sd0SԠPx &KtpPf 0S7 CXK2|0!Sdϫ00!000|1 c 0|t1PdT@1 T 0bqD1  8婫0!000 1!0000z0pJP`g J0 RJV 1P@@ 0T0PlJ\X-lc(c,`8̰U,b+cw,U,,<H' l -X U -L`( pDP(X-x"1> R.#T 0@ 0. 00X000 0@P`Z  P 00X000  0!0@0@Q  1 R=  / 5P1 `XQ 00D1 R R 0S0S R0S 0S0 0S P 4PPSS| 0`p 0@0@QL\ PZ`-,]$!|c,XP-,XXt[Df!tX -,LpM,0SPڼ0@Pt@ pP D NtP0, @tPK`P`RtP p` 8ڼ0p/t@ 00T 0 PoPpǏ`pT 0/ X0P`1> 0P@`UVW4HTLd@b6pǏpX63 -=@PmP -0000h|-|m  ,0 `0 , K\0 X0 T0 L0 H0 D0 @0 <0 80 40 00 , Rg|@ xP |0 l ,x|0 O*| Ql0`  0ǏOP`L 0<\%R  l0SN x< RJ \,h< R\00S 0C1 0R' sR"Q ,|@0A@ +@0[0  |P,0 @|PK`P`Q|P x` ʈk00?(Kp P`0@0@0A@D`ePT@ D[`|0V ` 1`Pa `  :@ P0@` S0 @ `+ h d *Y TlJ`0\0ZE:Q d:Q  000hK@ h d R0d@SZi00 R:Y l@QC:Y@c0T@A Q Q%T1pP RO:)@00pdl()00PO/ 0\u9@W 0T \9W 45S:  Zv H0S Z 9W 0 0BO?CQ6p3@P2 Z Z@ Z8 T1!(0p  P P0S  \d8W00S0S 7 R 48W 1100(p @7 R 7W 0啨   00poP@: g@ 0'\Q 4,6* k'T7Wa 0S0s6 R 7WW `(0  PO   {7P4V 0&\Q d,5%O?@0\ud6@W605p ` P P0S 00 U0x R ! 8S5WXx P0S 0005S:8P TH5\uW,uT` 00$@0T0R,0 0Xd ) DPt@P4PPU^1!X0   0 S PUK\4W00S0S 3 R ,4W1100X  $5M 5D3W  (Ř Q \3W-  0 0 0@1>@ T DR @Ӝt0 BR @P  0@" 000S00S Z 00 *60"2@P00`KD z!0 404 l20 \Ph0O0 /S <2APh00  > 0S 6 hQ!0\Q00h0 00O0@Qpq$kPv1W|0 0@#1?@{W1> 0P@`UV# ]` 0`\%R] 40O0@00L 8P0 c5-`-,,,!T(,T,+U ,d-,cTYY\U+4Y+X,x,@+DYc*$!!c$Y-Tc*YXt[d4d44 0\Q  0  0S% 00 . 0 40O0 @TP L 0P 00 00T) h0SU x $4P44 8 l oL f i -H0 ML< ,0@nP0$ P4PK-,!dd -1L8M11!00, P ,0K` \ X T L H D @ < 8 4 0 , R"ڸ0 @Sp`T`@ wPP D@ 0`KS $ @0S,  R00(K,0!-(\4! -H0 ML< ,0@nP0$ Pq4PK-4!d -LM(`X0,0 90䠟p,0  @,0P0T,0 0T @T 0S0S| 0?0`0T R 0R X 0@P`0,0 ,0!P-]@-0 0 0S@TTS -MLM0,0 00CSs<0|0k |'Prp#P~ 0:0090 446 (6呏FKL0ş !% `@0帕%44K5ZX$ 0h d i0`00 0S_ S;;SV~KpG,3LşL%0\Q@5(K05$( Kɠ0%\Q 0@X5 TE  R01 0#SP $0\Q 0(0 0p0t@  R01 0# SP R P\$0X$\Q0X000@\0FKL4  AH$ Z3#Pß0Z0 0@00 R 0S 0R s S{ #P[PPZ<40@1`8#0T0 *PP 0S <0P0@V Ÿ, 0R(K< 0-PQ"0\Q6 0@0 @C 0@`5 \E [BNK @D@D0`\2 R@ LB 0̠DD9 0S@ 0?044 0 R P!0!\Q 0@0@ !dP 0P0000C0  eZXt HA 0̠T@ 0S <e(q $ P !P a PWW  MB0P0CZ0:Pt뜃\ZQxZt+-8!0 0C0(K 1(K@@@T0ZP00 0 Pv "00C0q00S0S\$ X4 RL4 R@$]PPv @0: S00S00000CS񟗄8dd  h3(KPMK /00@e 0 00C0 '1@!P0 0 R%Q 0.S  PPP! 00S00@0S "20\0P00C000ST" P0S 00Sڒ^K PEPE0RNK@D @D00!1 R a 0kPd0P 0 x0  0P,@0S <P!00n t0(K MK/XqP 80P  00꜃<[<xZ-D\T\[$[h\,+p\-0\\\\\\(e\H[|[[Z[ \][ -|!|01@phh1PL08X0S5 0pGS.000PP 0S0S `P @ 0 R@ P`P 0S P 0pGS00h 00000C00P0@00-t+(@!-x- -LM$$ @0 @/P-@!4e -LM(p`W0,0 C0,0  P0,0 "1> R*A R P) R 0S0S@00%T pW 0@P`0:0 @   0@pW,Q`-,, -l2L8Mddd"P0 0, ,0K` \ X T L H D @ < 8 4 0 ,0S|ڸr a0S:ڐPTD@ 00CS5,H00$`K o P0S@0`!\QB  000S/ `K(T P0S,0S4ڸ 0`K =Q R Q0S R`Kx $A`K6 00 0S 00(K-(,PT]\*\ -@0 ML8 `@pP0$ 0p}.PKD!d-Pe -MLMtXO0 KPK(J8!J,0 HK 4Q.> R K0(K8!Lqt QG >hK8aXQK0 ţK8$UUd~UUP~K8Q$HK8AQ`PHK8A`0\3  BB00B"1hK18a0 000S^0S  yK8$PQP`ӼhK8a`0^3  BaK80@%0 B 0HK0B!8A!L0   XK0L͟ (K8! LqHK8A0XK  Ba 0p@WHKATd7  R\0?00 10  B\ hK a Vʜ (K8!$5S.p`l h0Vp0&P P U 8K81$%U  1P01p`0SVU HK8A$%U  101$0XKXQO0@0@0KOX0@0 @P`(K,!  /  0`O0@K8L#P P8K01S XK8QHK4  De*0 0K8K,,KL0` P@`R`YK8``L5HKsKD!8KP%81X?^ PTD, 0RM(KK$\^K8 K8!Pp(KP `p$41> 0R#4  R`0?00 1HK08Ap80P@`PW8 W#$0#0$0QK`08800cPKϊ/.Q00b\KK8T!0K880O8K 1 SHK$ATXKQ`XKa0XK008Q$%RK8(l 0 0 08S8K>C`(K8!8KK 4L!P2 RQXK4Q 2Q\01\XK4QHK4A\0KH!P KP8 P K41 XKR(K4!\0t1 daR\0H!0 0hK4ax0 R0R0 C(KP P 0 0hK@aVK4p 0Q\0?0`0RXK4QHK\04A0?00SF P!꜃+eePeH!P(L!HbT,\`-+fHflf0f,TU f,e-eele]PU 05 D0RK4K\040?0S5K8K0品!K4PU 8K@1pWHK,8$U'UP P 0Sg cl0S -LM$$ @0 @a)PL!H!f00 $ 0$0 -LP ]L^ Q-L@ 4#P T]\^ P-L $P {]l^ 0-/LPT@P 00+8@/00,+ )+~)00P!|^ p-LpM/P5@P K}P0: S Kp0`rS@)  P0-L@P0 R 0 R 0 0hW?T?t0 R0h0l uH0 R <0<808*0 $^C^ --LM0 0  --LM0 0 K --LM0 0 K -L@ތ= h. -LMH0@K0PP`AK<P0: S V@@ S00S F`PˮP$Kc=P T P`0 R000 ]K@ᲮP l1: S 8s((儍h9^^^ --LM0 0 1〿 -T L@H7P4TZ幼W P%edA^ _ -LM`pP?(@PP5!:Pa0@0S0 00B S0"0a>C0, ,0 ,0 R R2"!2(K00@ S)"', P 00C 4,  Q0 0C#4 4 404P8080 00,4 徐`Bⴐ00($|, $8<0 0@@,@@8@଀@D ?$4$P%402,P$e<@ @ @ T 00S  0D0 00<$40A$40 0$, $0I $ Z 0,d 0S d V`0P3  B  B00B11@ 0008ST0  000( ,0 R $e ^f(_d\- P-L@ 00 R$hkA,_C - 6LM , RvfFXS$3S Pu T$0ȟʠ 0 Pş5 \5 SS SU us :0,\ڴP\%85R h0 S0 0B RR40NRR00^td0OS),`$ ?|/t$0ttS} \%h4R& 0O044D $0O84 R  0S> NS0S \ϟP>.`@P00`` `` `` h / O c 0_Ss Pq nP(0..<0000P@n = R0  TIM0S T^m 84Q ,h\`P &R[Pb F06 00`pW V p0OO  Q^Pa `0O?0@@ c@PQ5P f0,H5P 0%?>T 0 5U  1p5PXE )T5P l|ş 5  05,5  w +h4 H\Ն4 帓 , 0R(Kx0Sß@T" 0o"ßP@C0SI nFD唓+#P, $勓(`SsVL3-K B BFP ^P S@Td 002P c\54 S0 `5Sy@>xEp϶ XS20L,`p|md5S/x5tp d0 pP!tx5/ W.O/0,@`0@L l3B \AQ<0P d5WwXX\\\\"\2Бgttgx2x |2R -BMLMp0 0 Ƅ0P0S ANK @D@DPP 0R K24`Pt0@ h0 < 84 4$ 0D  CKH0 A, A (4 $ 6gTײ뜃(C, ^ -l0L pR:X0 PH0a@p0`P 1  --,4Lk -L`@d6c0`0V@ 0-LMMpPANK@D0@D\ 0   \680 B0 0RK0 y뜃c-^ -RSL8M@P`pE 0S  $K0S 0S0T o8 `3\K(0 <0 (K\0 X0 T0 P0 L0 H0 D0 @0 40 00 ,0 <@ ) < 0L0 @ ,<K0K404Q5@ R*0 4#4@ ` P0@_4 0K@P 4 <0K0@ hю0@@ T (Koi(K4<Kt <Ko\-h-debd -LM 0@S `V 0 V p̐ pp d T 0`V0p8d HDLTL? 0<` @\ l2>4Q,h\pC00p`V\-[8ek-, -LM,00K, K00 0S3\%RX` B2 R7Br @T T `U@ | PU`Q\"\0Y00/H2 RB3Q}H 叢pP4 q   0KH0*3Qn 1HQ4 Y 4 0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA`$ -LP`  PT  P P@  P8  P( $ 0 B ,< 8D F F 3 `$0  00 0( R-C 0 - -@LP P  h 0-L@0PP HPg.P@@P[.P0k -\0LM@(0K( 0 @ K$ K0 P K$K- -0L@P  h[ --@0L M,K0,K  G Kk -`0LM00 0@0 K P @|< K-l -t0LM $0K 0  $  K K0P $0@| K-(l -0LM0S P |X@0 @00P |-8lTl -LM  K K0K p@n|ͬ aKpl 0-LM 0PS    KK0up @J|婬0 ;K0l -L@V0=.)l 0S00h -p-LM@0`P0 R|P0200  0S CKp -0-L$@KM0 0 0P@$0 S000 @ 1 00 0SK0 --LM0 0 OjHj K p-PLP` 4 2  0:ipK rP@ @p0S P P@PpUP@ 0 @pp #lmm - 0LP`p) 0S& 0S# ,, @T0 0pll 0hp\iK PP@ V0(0(0$`@(@$`@Dl#- -T1L 00 0(Q,p5@p 0`MP0 (@T" 0 0R 0 0Hp 0 0S 00 0IP 6 00 0$ FPPF@ 00 0 (@T -i7i, K -LM@Tp`PK! C-P4 0峅 0 (hmmm -LM@6i 0pP,K:(pl PcTp`dP U` (\J,K 㝜P ,TJ`T,PJ0[ 1S00 0KU% ,EJ !)pPhz0S dz0S `z0S (v,(,J* (o,(%J#JS,W0`SʌUH,0S oA,0 $K$0 020 ,N'`Kmpn8n p-`L0S* @P'   0P00 $0( S ( ( R$0$0phSp, ,0 phphp-,< ` -Lpe0@ 00 0(@T dp`P׃py0S P, 㫆p0Sy0 Sy0 S @ T -L<[k-`nI 0 0-L P8 0@PU 0sl `0  0$h(@Tlp b@0S 0`-,< -L@%u+(p$ p&nn -X2L$M0  D2$ ,0 (@  $K,K0mpCy0-SQ1@ 000 0;(@Td!Fp/ Rp`+ P#8@K P 4` 0` 8P 7. 3.P <0!$14`墅,$!1"Y& K 0 @p`P#40S 0:0px0S P&+ p0Sx0 Sx0@ S TP01.@Kdkn-L<[`h(nk-`nI 0:0Pd0 Kd -L$MqRpP*0@K kP ,p (p 0P - -10aS1 @0 8 <` 4p @K} %w PK l`T!f QPm*3 Hp@ =TYx0S  0S( ^OQ 0 0R0$0 $@KK\ |p G"4 H0xxx pQ00 SKh\o`(o0oLoo`3 oI L[= -LMCnKЁ+~K+tPÑQPP|(K 0@K(P v tt0p ,P FX<0 ,P ݂<()=u 㳄P 00p$`K 㧄p@ Tw0S $0[S㯁0S p0@T$00 S\X)$D0 @ KL(ho( pDp`ppI ppp\ G -LDM@,KP ֧H D=P 0(|  e)P rFP l fVP sVp bБЁqP !bp`10SQ  + P 0 P0T  P< (@K `$ ` 0 p , $(p`0P 8@K  4P 0P 8` , ,FFF00=wq qX8qTq\qtq\`I q<q8 8 ,3 3 8 200 "P: -LM@pPg X`P 0S nS0oS` =PP00 @P @Q  0U0P P00 00 X 0000X  DU 0 iv00 ,Kᬔ, ?R0S@pYv0"S4 0C@Pkxp -LMp`@P@( P(K,K&F  0mP(0S$K -000 0LS    U+d/qPr --LM00 @CP 80 jd idbdc  p-\0L0`SP@8 ,!PCphp/gdTsds 0-t L@h P\PP P 000o@P 4,C$@0-edA//LL -MLM0@<0 8@ =P = = = \P |˄ =x* P-] p4`Kl* hz +N0@&S8PT \T X X X T U X X X X X X X X X X X X X U TU X U U V \V V X X X V X W X W X W ,X < +0 `]40S<0x:  x .x dLp RQ8<@0@0 $  < 8 `/4 ;R 1 `4 ;R  1 ` 4 t;Rh 8 `4 <;R0 1 `4 ;R }1 `4 :R m1 `4 :R ]c0 `4 \:RP M 0S 44*TD@(P*ʟ00  P)91 q-Xɟ00)<Kp 80S<0S ] 0s 0 h*  0SpXaP 00h: l*_p0S9P p( 0e 0bS T80S \@K4PT0K\0 X@ L9 (1 R0d: -W pP& l'P! ^KPEeNKPE@D@DH(0<(<8Pp (8p C<70S( PP#&NKe/7(pK `|j J pZ tj <82 =C42 =(2 70C,0P 0sK 1K0" ," $ 6 Rt A 00K|Pt s!  ,K0spP#s  ,@ PPPP P, | ,0?,0 X  P ``rpWZh50S EP zmP g  0㤐|* p: `  0$P| jsɣ  Q| K DP^s彣  pE40S 0: S` ; 0: SL adj@=pPpz  P`P`0P00@ S!| [p 00A Sa>@0 @@00@0d:  0 Sdjpz   (0@Sd*Ph:0@3C 000t30SvL3 Q`0P0 20D080U00@ d j0 0G4K(K//U pwww/  - L0R  P<w -d2LM0, Sʻ,0l,@P,2,R@ d 2 0> 2Q)< 00C 0 ԑP\01 P\0?0 0! @ d 1 0; 0@4D\1 00C0p帀,0Z !0# #,%<+ 0 OS d&0OP `x`0d 0@@0 0P`x00S0 x0, 0 x0,,I $000 (00(Ko //U pw/wT/ -LMK@, 0 K`_0@ P A P @ P {Z " 0!C Bp  0 K4 0@ 0 @ ^K`pL =0@0O$+41 ! d e,04 0B KA/T/ -LM@`pGK,P= 1@ 0 A SA  )0K p P  0K $Z " ,K01B00@S  0K4ZP L=EK0@0O4;0 dD04 0GKDKd/A /T/ -:L4M` ?P L0 X @P T@ ɯ08D`;:Q: `: Sr\ mQ (:  S4Z@ ,08x J @P@PPjɟ 00T 0L59 0$: 049 0B90A  ]8`0UT X0PD RD: R48R0?8Y00 8 04 000cH0 400cL0 H00O854{p{@{L#TT{L /ht@|X/T/{/btHh/d/  ||// ĐY U400S40|  00 00 ,00p0$@QPU``0^3  Ba0B 5 =0 B110L 000@x0`S0 0OH4LD ,L=2 000`1PH P=LV>00h0 h0 S:h082 0<0H2 0\ T2 0 0R0PT0XT0P0P0HU 00 ,00@ 0PP40@0, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0 40S0 8<`4@P4 d `p8<4 00@ Pt@p4P`~ @5P`8 , 0ls@@ < @K8 K00K0 @@P8PK`VP ` Uap` p 5嬐K8 4 6, 帠 8d 0A@@c00@ Zᴐ 尠 0Y @K$'J F%*0)ZTP;T70S@P'D*0\\%7R7\5*0#xG*0P7'8Q0\570S Hg 7P.P HGL8X@ KVp [PxP rPP\80X0 h R01:0-P&{ H *Z`p㤐K9),`0S-80O ,00 /@_d x)P0d P{cP@c@t 0 S M  r s`pP0I,0V0S M :0S :PИ :,0S;P @< ?>0 ?0 ;0 4 D0P  *3J*0`PKTHLV0Od ^00 f0 R 8000`P pV0 008P40 r @@rA@; 008#80(K 0-LMReX0@K P0,L 0P< P [=ePK0///,| -0L i?`| p-LP`@T 0@T *0P/S @0P/S00@T:/ۗP@0.S P@Tp0S .S0S`V (0  0S0R/| -1L MС`V( p1 R 0: S \2P8( 0RX$K dd\a\q^0SB@F00CS0A0P0 Pp 0S0!0CS0 0 Pp0YUyU廼ټd0 S7K7. [0 R@@4P40d6 KHP嵺@FᘼPᵼP(嵒//| ,[ |H| -RLM`p, $0 W @P p  ,fP `VpW V@ PVQ -LMq0@QP(0  0: S ( 0R:$K 0S t0QoK2)P`% @2341  ] ~p` K4P  <3S 83S c00@'43: SK)Up T2 S!3 P 80dP =P3 3뜃|t/P|} -LpM`@T PK(P 1 R c0S 10 @TK0 Q p0S  Q 0 RwP 0S x0 Rh.QT0  P 0 Qb#//t/// } -bL0Sp2 R p PYPP X@P# 0A S5H ĝ ؜ WZ 0Sj P @勓 P1 W@Pc0SchT0SD )P `T0 00SB 0AS) L L ( L L ( @W 00 0S "P 0S00 0 R Q ADwP 0S b0Sl0 RpyvD Pt 22//d/t//p -L@Pa80p0!Mp- P0@"S"ꤠ ܟ ܟ ܟ ܟ ܟ ܟ ܟ ܟ ܟ ܟ ܟ ܟ ܟ ܟ ܟ ܟ ܟ ܟ ܟ p ܟ ܟ T ܟ ܟ ܟ ܟ ܟ ܟ ܟ ܟ < Mp0 bQ!@+:0S I0W 0i0 0|0 t0h0 p0000M(0 R[/ }<///// -000 0LS    V,먷/(}@}-0 CR 0R0 S䲸00 -@RLP 0S Dn 4nTH UF 0@SB 10S<p `(<n0C3@ R 0S, ,]0S|T@ l R @0 S0S400S(>h>h9Xt`t  0-PL@0S(0hxnBQP xqnt d\00SP e <  0Zn (0hUnꬷh}}} }} - L | PJ1m @/} p m -LM@/"P0002BPp2 lR dr`XT2T"PPPfP tP  }Lp2 10 bSP PP P 0@SX :P010S Ya@a,@ EpQl 4  EPP `@a0<S 00K@P `0S 1 0S0.+0S% 3KP ,K  04 P,00S F.040 8K[P @00S d0 0X0=㲓/8`84@3}<}t}4t ~dP -0L 徶㔓~ -LpMp`@ V,*U&/00]j@0 PsP3U @V P X`KrP0: S M`0 0 $K:P =` 9 -Lp`i[[!Kp mP2 pP X!yKpL1 ApPE @` 0@S 0P/S @0P/S00 R:X  xPPP )@P m(PCP00 U030"S 9PH-` 0\-?P` [~<`8t -`LV@pPq \V Vfb[RC[VS  0 ^S0 0]S0 $0[S0.P =P:P 0SE  0]S0\\S0nS  0S ]S00]S*@P"\R0[S  S nSP \SW0R0000P R @~~J -`RLp00@P0@ s0@0S S ;S s0@0S S\ 4F0gPV@v @ -L`?0rS aS bS6tS {S1-000, XP & 0R0 S 0A 0Sp P 0  @T0S04  ` V2/$ p-L`@P @P 0S0  T X0 R P 4 0$ 0S5p2<2 0-LM0 9SP0S*$S /S\S @PP 0@00 00 K6L@@8Ll -LBK@tCM @ P T L$ Lt TT1P@, L4S4nP?@/PLt ,0S , ,0 r p000,0 R#R ;R Pp0000Pt 00,0PPL j,wP,  , ,0 r 000, 0,S0P0-0S,0  , ,0 r 80008,EP, , ,0 rP 000,00S ,0 M00,R @0 S0U,  P0 SK꼴 8  L ĸ ܹ ,00S,0  , ,0 r 000 0"0 00,00S,0  , ,0 r T 000L ,0P$ 0S0L0P0z L0pL4 ,00S,0  , ,0 r 000,0 ;R R  X,00S,0  , ,0 r 4 000,00\S <,00S,0  , ,0 r 000,00S, !0P`0K00 )0 0eS * e 0`S01:-`   \S0S S@000S0lQP 4K@P0  00M,00S,0  , ,0 r ` 000,00S , M PU00B,( p;,@y\، 0t1,00S,0  , ,0 r 000,  ,00S,0  , ,0 r 000,0S 0| , K w,00S,0  , ,0 r 000,<, K 0S$V `  0b0 S01@ 0S 0 P  P 9 @Tj0 @, 2, 0,0 0\SSh% Y,3P, @ ,0@,0  P<$ R<H l 00  `84 @4 D4 8$ 0hS * h 0`S8 01:@@ @4 P<D$\SQ# RD `@T`FD + LP \  0 S0@B 0T0S@\T&T\00<Si@`Hd  S 00`0Sd`P0iH$0, P4 ` 0p40S 4 40 r 800040 gR 9R1R*Rj R;R_epR wRZVk`UpSVb44K ly0@s@\X`@0S40 4 40 rT (000 R  A40 40 0RT0P0- TT"@TT@@"l p ZB$0T$40L40040 wS,0  , ,0 r 000, 0;S}0,0@,@ 0\SS ` @PiD PP`0 HP0s 0@T E 000 S 0 0Q5t2///̷(T|Ā2 dЀ L|2lx// H\Ă@p2222PU,P  , ,0 r h000,0 ;R0,0 R P@ 0`S0 E f@TP U0 0n1!00g1(K -"LM0S>̂r`P y @R"2 0  կPP@Y. 0ld"0S 00CS00 Ӥ0ڱ r@ \w{00010S 00A,K*1P0S00#3 uYPP h1@Y0S Y 0H 0 , P4! 0qa00!<0P 0 0S 0[PP@UY崉 0| 0S 00CS00 Ӥ0` r@ v1 22,Gd x2|2 -@L 000@0 0-PL @ 0P@000, -LM0S`p00S; :SiP 000S S,"PP 0@X? 0l0 00T2 0DD"cP<< $"0 00001,KH@P# Q000 ,0S: , , ,0  RO0#SL0nSt1 G0H00]@$!0S 0#S0nS 1  0,0 ,0S ,0+;, a0 @\ \0 0 0^0^ d 0000H000 0 00,00C(22|22d21< 22 -鐁向吡L`Pp@)fP aP eP EPrP uP nP 41 @@p 1@maf1 ^Cp0 00@pQ @0S@Pd0x@婯P W7< `82222<t2 --LM0@``0 9f0DSL0@ D0D0  n TK |22 -L.@PW t -L@PW t -P@Lp`8 0m"P 0d"$2[ -LP`p/0wS {S& sS'0 p &'P 0@LW嫇 0p0 pp 'P @:W噇 0(npPUd -P` PLpK y@ W000  0 0 -LM`0PPp@0S1 T 00S S@D 0@0V l0 l00 T00:0P S  0P$ hp2 22<-0 CR 0R0 Sb00 -L`zK((MP$pG!0 0R R0帶哬@P 갶*0~ P0Q` P0V00S06#3 dWVPP oV0S jV 08`Q<  QH`[~ [~Q`@@<@TU QhhbQAQ(hQ Q `hAQJU-%QJU-%QJU-%arCQҤ],QҤ],QҤ],b!AQ7QHQHc+CQ7Q7Q7d.BAQ7Q7Q7eXLAQ7Q7Q7fbkdQHQ'Q' ( 0 8 @ H P X D ^(~@C+ia&(,z=icQ@kKc"86m{9X E|Sf 3tKmٌJ=*շt6cqV 'D{!R==U^6 89qIA/8um5@)ey+UM/gi5O!3og:saG<@21**h^K.yWY` B=;^3FRcAiZ <ڗ%{B.o(#C~#5Gx} bzWBxxM}lҺdB b1ZrBIj‚$fU(TmTx~wf@ HB:'Y6` X8 lr}nF1U *\5LY~F 9mqaal.Iz-o cp e3ת!&7"*}`/>KXC*{؏R/E*dʢ&7 V`i#(ـ;qpk6tPC]1X (hGp  eRB  $i8O:6Fm1w . ..arch8 catdate8chmodchgrp cp dd df edexpr8hostname.( ksh sh ln lsmkdir mteject mv pax tarcpio8 rmsha256sleepstty8|sync8 ... ... . .. tmp db runFempty[hash[ʧtzlist ... ... ...Ɇ<  00$ 0$Kd22 ,l2 -/LPM<K0t 0N00l 9.00l0Q0Sm l@PT 0" R 00$P RTΟ 0SH0SPL l 000> D R000P RM 0S͟0SP) l0Q|M 0Sx͟%!%*ll000 R000 R$͟M 0Sl0 p3Pl  g l@0=0C>S񟗭d t t t t t t t t < t t t t t t h t t t t t t t t t t t t t t t t < L t t , H t t X t t D  D t t t \ [k0SK0000P 0 0 0l0 0 @l @ Sl  l L00l@000S6 ˟0S= 10S? R  B DPd 002d 0` c : J0S 0 ʟ 0 0 l 4 0J`0s hP Ps P K#P4[S 0y䙟䉟PD9< 0U UPVp )000 \P 0SqP" P 0S\ \tc@V P 0iS@0RPaP`0VS80S$$=80S  2T80S`86#3 sTPP~ T0S T q880S0S 8 }P 00] tPW70S0S7| m0SH 7rB0S? R  B JPd  00bh@ 0 ,7Zd\h& 70S0S 6I xhƟhf 0SXF 0 zP4 0 0 0l@0 0 @l @ ZPP6l 0p0 @T\@ X 50S  0S0xl 00 " \X0P< E0l0  @` `P\0 HX0T4   00 `Q{l D0p`Z&Up% \U 000C SS p0&S\SpPğ0@0S :K@ p0@` X$P0001 @D"0T 00tu& qr ßPd0@00S :K@ 0@` #T@0X `000PUl0@0S :K@ @#0@` `0PS@`@  ß0 X0 `A` "0XSX00X0 0S @X@0 SS S X0` X0X0 @`0 /Y00 \X 0P'`@TVYXX 0PK  @PK l 000S 1l @P- PU* 0s<@ 01p@Wk `PVk 0S05N KƐ0S2 TPr 0S0PP 1S0S@T 10QT NtA ppQp0_? P .U?0#K"0KR0(0+0@ ;0-Q6  㲔 #K⭔0@ RU t3MM0+0#0K"K!pK  0Q , 0<I<|Mz6|gPxdhth̑gD` 0-PPL $0$@QmPP0gth -LMPP 0-S- `pC#op lP sP ?P`K9`PhiM`PCP#oppV OA0' #0@| 2  0 `Px @T3 3P @, 0T00S&R+PppT] 01P` KkrP@ pKZP=@T 0%SSP`zM`T; 01P `K0S L@T' VrPw !0LSLL 2Q0 dLXL`O( 8L```TL`O0 R @[$ R @LTL`@p@ Cgp`0QU Dp`0@ R V"T WPDpHe@P `D\0pGx4Dpm@g|g `,h_dh -L0M8dP0D($fp LP PP ?P(KC#fp0S DAΈL 弉H X PU 0S xsDl3p0S\jD@P `T @gT 3p"P  "0 @T0 D P 2 ; 80 4 g80 0x@0 < hnj0pK@`K,K0 < ,0@P)00S "0 kZP<k<@rU DD0Sh !bFLw C\.t10S<<@0/S4ZBT0 mL 㯊P  3D0S> !D7  k1P+ 0D0 P0 PH\0P DP P |Cl<@H }CxCl@P<@XCg|g 4PT`,hdh IPl _\0fP -hAPL`!e`pp mP <1 8 jC0hC@u`P- @p ep01 PR @@1ST TVp OX b@V tOX0C@0 pR@D b@|glghT -`L0 R$ p@@ T P 0@P0 s 3T R @0 0S  @ T 0 0dhg -LM@PKp@6c0@0  (ep ?P pP :P8C 0008B@0S  ڄ`P@ PR1S0 01 0S00S 000@$KЖdh -LMQ@   @UϠAl  _0 Dp K`lO LBd,#!BU`bϠ0 Nl _(0` p(pꭋh[ -LRMPp<K`0Kg GKd P`y @@@@@@@  /`0SY DK0KH YKE 0  c0Rc=9 =( (0 (0,  A, B, Q=9A =C, ( , (0 0 c0Rc=9 =0 00 4 00 A4 4 Q=9A =C4 0 4 00 \B ^b A, K0@O4 K0@G_0DKPA0K YK W 00!X 0R=9B( =C , (0 , ŀ0! 0R=9B0 =C 4 00 4 \@ 80D c<0Rc=9@ = AD @0 D ^ @D K0@D K0@t, KX0\@4 K0,j$KHff?B,xf4$<D -LPM@lPK`ሀv dK 0lp 0e  0 0$KHf  -LPp@ cp fP/ vP ?P>@@ ycpp01@T `XP0 [Pᚄ@T W,@Tp@|gPT p-LM 0S@P1  KgP/0S"  D 1`0P @Lf0P0fC10C0 0S0 ,0 R$0xxxdhgh 0-hALM`!Pb?PA 0AT00  KfP5 \51 R= 08S9 R 08S S\ 000 R\ 0 S Q0000 lp0"@0bP[K0@`@ (0@|gPdhtHtd 0-ALM Pb?P80AT KeP%  0 0 rR P0S @ZF[\DP0@0d0 R R 00C8S@ 0  ?|gPfDhdh -DLMKP`@0 0=00 0<00^L@D,00tP@T@B>FD>A꜃|gأhȗ_ p-AL!`*a?P8 0Q@P zP# PzP@ yPp@B^ 0S > `l>T @pT>pP@U 0-S0S>@p|gPjԗ -`L @`?P@ hpM0T 10 00PS<0< Y@s|gPdhghf -0L8MT0 0\0 0CPX0 XEP%`p2 rP ?P pP,K<PT ,I>(KsP uP@PT  , KF=PT , 1>D0$X0 y`p01 `Rl40&Tp=`$Tm?@PP 00TP  n=X0STp 0 40 0 140P0<0 8 `0IVP0 8`u UD 0S C0 P0U u0  $0SkwP 0;0 0S C0lP0\0 hX0S L0 cRLK ^pPp<0  cR<K^`Z4 UJ uPu U0S8V  Vx 00S 0V0 R`FV00Ȃ0`D2 R98 OPf0\0\U00Su U 0!0  80S 0SPr1$ RPkT5P LP1 L PE][  0نfP0==fX0S@x@3u00#T uP0  D0 @ TD0p0H L0 p` 000H>5H@ T;|g.ftdhhg@hTg 0-PLM @C_?P0 01P@PK $C0PS80S08PKCP0|gP p-,QLM$!@_?P5 0aV/ 1 0K&P+ 00 R 0 0  Q  0S  0XPx?o X<xx>@xP4  <xo|gPfdhd  p-0LM` P@^?P 0AT K0M4\0\  00 0l x4O<xG<dh|gP R4 5:0QpBa -0L` Q\p 0PS @0S 0SP00@S - LR@:Q0AS Q 80p3P000 0 -LM0P@ @ P&0 pP#0:0S0: pP]  `PG00< !@@p@3{0@ `P4!@ \P `P  P. @ 0@@ @ P @ 0@L @|4 @u @nԘ p-L@PY0`PP p P P` `V`p p-LP@0`PP p P P``V`p 0-L@0P 0 P 0u30 0 p-LpM`Pe @PT0 RKpK_P@ : S I@@g -LM`PP@p1 0A#SM8 8 7 7 |7 P7 $7 6 6 6 t6 3 H6 6 |3 5 5 6 |5 D5 5 5 4 4 4 4 p4 @4 @4 @4 @4 @4 @4 3 3 @8 KbP0#50#0# KK_PBK_P:p 0RK_PBK_P 1R 1R$K 0O2P000QP0  V_p30  L_8Mp3Gp3KP050#0# R  K_P 0 00 KP\0S0 KPy3 RsKP040#0#i gp3bKP\@ TWKPQ0: SLKPF0: SAKP;0: S6KP00: S+KP%0: S KxP0: SKmP0: S K^p3K\p30!SPPU@\P0 0 e1U ` 0p03 0 0s30S!BKu^PKp^Pp 0R3 HPBp3(K 0,1P 0ES񟗭9 p9 X9 @9 (9 9 $ (0Rӟ$ (0R$ (0R$ (0RÍ$ (0R$ (0R`0SggL:@-0S0%@0#0%*0Q00 @8 @8dt -L M@2@"P40 0 020"P,0 ( @ @ @@1SP1`6 T8` < >@T\J`@pK T; 4P` @TJ4PP*T 04PP<<00C<0 4P`<  @D1`P 8$K@pK 00 RsP @ 0, p3p3@pK 0 0  ,@0 - , 9 9 phgt 0-LM@P$K $Kp  ?<#8K0 Kpq8\`| -@LM`P@Q $K 00P $P 0 08 K0C4pK4@ 0P ,@ (P P:@T :=k$77ꈙh -LL0PS8H 0 S S0 0   0#  A0A0 S00`pB"Zp?@C "P? > > > > > > > > P@ > > > > > > > > > > H@ > > > > > > > > > > > > > @ 0SV0SR 0RQQ  RP A!Ypp?@0!R i7``WhA\!Yp . ?0B"S? ? ? ? ? ? ? ? ? d@ ? ? ? ? ? ? ? ? ? ? d@ ? ? ? ? ? ? ? ? ? ? ? ? ? d@ 6W |Q @x7QQ@T  8P$2D|gЙT0 e0@-@^ 0#S^ 08 S00S0 0#S 00 R00^P P0 SPR R^ J0Q S0 B00Q B\0AZ# 00000 -L@`{AT- p@PP 0`pc@W P`rP lP@W 蠚 -LM@R00?P`p@ 0pUWlŸ (0K P{ T0\\S@DLT\"0'P "P `P =P :P @DL^m0 g'Qe "Qc `Qa =Q_ :Q] PP^0 'Q "Q `Q =Q :Q \QP^TJ q7 1  01 0D@q* 0' \ZU-0/S '0/S PPpp0PdpU@{ Wl{y0Sp(  0 0 008PpPI hO  Q-L@' T# AT *0Q/S 0/S@T:0/S d 0R /S @T:0/S Qd p-`PLP@VP 0R  0RQ^p^p -PPL`@p 8p@@P LThEdh -@QL.0  \00X p`@[T*T ?T $T P(U /TpU @\T0 SP` U~X 0* 0 P WdhĚ -RL|MJaApPD0pp0wF P P4`$KP10Kt!( , 0 0(0Q*PP, 0` 00 @P/ ``QUV V& @`, @`DA A@(@ , 0 KP0 R7`T (0`0}@dhgȚ`h  0-@ 0PL`P 0c0 -LM0K` l lPp   XYP P0xU*YP lPp  (K @`DA }AP@Pdh -L,MP L T @fL 0 40 0 H J40T0<0 8 p P:P8@w  YD  0< 0 bR<K_T@Y R   P /00D00D0 H<0  cR<KET@PH ?T 80 T0b CAT00jC1T@0 $1`p@pW` 0,0 , KP LPQD p@ 9@`WT 1 00 R P80(K,0S 0dh -RLM<0 ; @3P`4`KvH#8#000 40 , ##0@T T@T"0 !x{2P 0 0p400gCz @W `2  @jY8 @ ` P X`P @ 00kV 0P dP XP @  81K- 80 1 RW 1 !0 04 4,0Q8*00040 ` 40 3<  (K !(VIZ0 P`` VP @PA0<x 0X0@` DA A@,@ 0 4  40, 8dhg0g0hfPL -/L`UhHPDp`@PP@ T iKXh -!LHMp0W,0 H PM dpK PLAXK@0[?[ 0H0[XL0D[1EP[C`[@b0X KX L 70K`:K9K8@K0S0S 0S0 S0S0S  㫢P H, 0R (K40$  ' Nc2fn -@TLPL x0S C x  Tp0@ p0TP`\@f(x R p0 Bx p0`\f -`RL@YPPT^ Tp ppTPW oU 00 S/R  0R B/S PUW10@  `1`0V0 T@j DA  1A` 0V@0T00  o{P@j DA  A dhZxf 0-LMPK R@PL40SH0 R l Q@PT[8 h -L M0S 0 0@Q@ K0 K<P1[S S|ࠁ ࠓl 0@zP[yx1[S < 0zP [kxephght@d|ԣ 0-L@P}\ 0S0S @p00S@ @gd0 -@L! @@@ @@44jP, 303 0 h fA nje P@p 00  0-0LSP @P0PS0 0 pC<0404 00, (0 BBBBBB-l 0S ^S 0000S$ >R@0̗?R!00:0 0 BC0@ -tLQhd0d @pT *T0`VPUzTP@00BBBBB - 0pL`P@0 ^000@S@0C@0000`XP  r 0  @2 0p-Lp0s TT 0RHHr P@4bU0c00D0c "S00!000o!0PL 1pW)a0 S@10`PcU]0 0CSX@0 0CS@ TT 0R( 0R <qt Q!0@TtP0S:00 0R>*@DVt Q00 QP1>d\@P d0 R} X0 %>wr@BBBBBBBBBB@hC|C -\0LT0L0L0@DP 0540 ,0 7hBBBBBBB P P p-P0P`0 0LR@ 0 R R00CRphp!0DS Ta a a Ta a a Ta 00C0000BBB p-08`PLP @0U@PpB -L - L p0   B -LM`@p0Pd K"d@P `00`H0H T wBBBBB,0 (0$ 0c0ALghh CC P-L@ p D 00 hK^IT?@hvФ -$0L x vf -Xp@LP P <`0T: 0S0UPBB 0-LPP @@ T0 0-0 L\+ 0P @ @T!:\$Q \ q 0_Qq 0_Q $Q\@T*@00BBB 0-0L@Q 00P:|0@0hlP P: U T00B0R T*0B0R T:BBB -1!L@P\j q``VE:\ 0$R \ r 0_RLUD r 0 R0@!0 ӑ  T q 00 _Q $QUU q 00  Q 00ӑ\`V* `yq 00  Q` 00r 0 R0, 0 &BBBXCL}U{ -4LP $0 A CB -0@LQ 0 Q 0 R 0`S Q0S0S0S0 SS CCQ0y0Sv0S  CBBBg -0LB -0LB -H0H 0L S 40R BBB -H0H 0L Q 40R `BBB 0-0 L P- 0P  @^!: P$Q @ P@ Pq 0_QPq 0_Q $Q@ P@^*0H@BBB -L -L.0 gB -LD0<0< 800 00@@KBBBBBB -L> -0L `R0 PhP0@z|0 p dۻ@`0@dTPT0T @@@Th ghhB CBBBBB -T0L R D0404 00 0@BgBghh - 0 0LB C -0 LA CB -0Lhh -0L|g< P00( 0S P0CB@xC0@ Q-L@!00@0@ QP =D0 @<0 40V 000BBtC -LMpP` ȀȠ04 <0 8 0 00 , @@@@4 0 b00Z<08 040 00 ,0 0DJY Y (KBBBBBd p-0L@`0 ^P :ϠQAQ 00S 0U^@*ppBBBB -|p|0LP R`*\@  ` 力0 0 0 BBB -L@,P嬀`@P0 ㌠ 0 |pS030#0j0V 00@0Ttw0S:00BBBBB 0-1L @Ts 1 RD0S S S "S 'S0S  B0S0S"S 'S 0S S S S S "S 'S0S B0S PU "U 'U PU U U00zP0 D0T'* P P "P 'P 0CT: P P0_0 P P "P 'P 0CT:"P 'PhhBB -l0l 0LS`\00000C0P 80 40 -$hCClCBC 0-PLM T@00Cs0 0K0KPK 00Cs088B p-d0LX MQT@T`0PP88 1?1c"10c QpBBhCCgfff -tpPlp@LX`d@D0 <0 40,0p pBBBBBBC -`PLP LPD < P0P0f 50%QA!V0Pfp p@@Tp e` PP0 0 B cRW@@T P 1U@@+T00T0 0@Pt0S:\CBBBBBB p-0L MP 0 K$KK a0a(@K @`PKp0 !$0 `xV P0APYH aPU$PBBB,r T p-P`L@T @00TPc@PdH@pCB p-0 LQ 0Q` 0 pl`tP0P `0@d0S00CP 0pCu Pz lChCCB -0 0Q tt0 `L X0R 0`@RJ@dBBBBB -LB -L -H0H 0LQ 40Q,BBB000 0Q 0 R BBB -T0T 0L Q @@0R `9BBB -1L Mxx 0,K n0nP(K4@K0K @`P3 U (4 ) ($K,00 (pcVW00S@ X (0  0R/S 0!U00SQ((4 0,-(0 vBBBT,r -L -L -L -Lx -Lp -Lh -L` 0-0L^S@P Pe0@ P0 -0QLp @aT`*@DT:PPX`0@@0@^SDN(0P   CgBhh - MLMKK I0 , -1KZ<p`P@1p@0T-9K.yK@ ^KPEPE@T9 P0V 3 p1R5 h1R; `1RK-0KS20Zp0'81 @nP 0i-![ ^R@Z /`P, 0R*(KV Z ^Y *00hY ND bZW뜃8 | u B -@0 PL 0px@`00Cs0 V U ~PPyPPVBBBB -L,`p 9\ 0S  2 1C P@T@T 0U qP0@T @W0@0 P6} 00  0@@1& 8CB$ -p-ML M` 0 R0 $ P#  $ 0SQNK@D$ @D NK@D$@D $ 00\ | 0RKp$ +W뜃 0-PLM00 @R 00   Rp0 RP0 R<0 R$0008C| { v |[ |\ -h8LM \ T8  ,@P 8P,8  $ȟ@0 i0 d 0@^ b0@X <0@R0 M C0@G c0@A #0t@; 0`@5 0L@/ 08@)0 $$ =0@0 0  0@ 0@ h0@ d0@0  B0l@ L0X@ l0@@ >0,@0 0 0  0@ *0@0  C0@ f0@ g0@0 <0 \ ?0L@ ?08@ 0$@0 0 0  .0@| _0@v0 q 0@k0 f0 |a 0l@[0 XV0 HQ A04@K U0 @E u0@?0 :0 50 0 y0A@) [0B@! [0C@ [0@D [0@  O0@ O0@ O0@D O0,H`@ [0`FP@ [0,P@ O0`@ O0P@ 00@@ 10(@ 20@ 30@ 40@ 50@ 60@ 70@ 80@ 90hPE `F5p@ [0@ [0@ [0@{D [0H@s(KP CBCg8|[ j l n j h b P   ~ | { { Dn h n $j d x| h x Hj $l m ,{ 0 p ~ Xb \c s l p , \\ h |n h d[ u Pz Do @ -0L @ 0S (<=##,h7#0 h/#T\H - @R0 000  0L P〷 h-8B -MLMŸ帢@^(@ `Pp: S B_ @T Q 0d @"T( 0R$KP" }낎KHH0"~V^ 0S2@T@S PP0"1@T r@TUpAp t1@T @S P0}< 09P9U @8 P P0@T @S P0[21C 0@T @T PP"|TP Lh"t@S<x"mC _t8d(v |H -3#ML M3#3#3 `3 S3#帓K@A A@`, 0P48#`0e0||#Pp@@90c00 F cDCD3  00S$C\ 3" #0l0cCP00쒟002 `-(K CP40( Ks`(0K A2B"| R# @Z@Vm PF Pb PQT0, $2@ $0 -8KR000```P01@T p@T PVʂKAA PVpW@Z@W00S 0`!Q P0 0c, 0R'(KW! R 0S   ]<gN0b0 0C07P0JRBBBBBBhhd C@hBCB|CBBCBBCggBCpCBtC8(v xC -PLp'`P- @eT: ᒾ PR 0gXR@ @ 0gR00@  LP Z 0gX(00W  ἰ萞 -LM` 1 pP\V 0U/00ń/\@0@0cS HAP@P/\ /ƿPP 0 0BPN 00`3T  P _ GPP 8 0.S 0S .Si 0.SEP 0 0cS A@  0H0Y 1 !0@FPP  f00 lR@@ d*Ჿ1 `Y10I(K@0S `0Vሁ5L* ` G1` 0S KYPT U0U/S0: S SBK@EP1: S  0 SU0U/S 0: S SR 1: S/0 0 NP 1H@` DA HA!`@`BKEP<dh -0LM<p00 , BP@0U @PP0 8K(K8 4@ P(@ 4, `jcFa@f$Kdh -L`pP@PP0U* kPX0@` DA AP@Pd 0A0b CahBdh -L$MpD H0 0{S oPMP0UO*DH `0P(KPQ  z0C RS R {R0 }R0C ,RS  RS0S0Z0SP Z  Q8P ,  P U Q0P{S0P O }S ,,SQ 0 PD+(Koe1@` DA mAP@P,Q, D0H0  @cj804 PBPc4 0``< D@@ d0 8<0 ^ 4 <Z@00< 40 @pZ0 P8P ,00,0 dh -tt`0@Lp-@@PP`0 P 0p0mzdhg`h -LMPHK @  /ϟ0S000  0S0  S @  |? 0 00 , 00 (0`K ``@    80 4 L 80  cR8K>\ 0إ L T  h  Z   R 0SD0\ D0  =Za R  _ 0S    ZPY 0 0 "" "Z  R Y ZS Y 0 -00 40SL  00 Z !  0儠 0C0 p Z n  h P @ ̫ ī D@T QA  \0P00S Q0 T,0P 0`S !0J]Sꔨ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ  Ĩ p Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ \ Ĩ Ĩ @ Ĩ  Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ Ĩ p Ĩ p T R0 B 0Z ZW  RK 0  0 0 R 0 0  䨐 0 00  R0 S0 P(  |9 0 x0 t Gx00| 0 R pp0P/S @j0P/S W :S 0 cR ڀKS= @ 0S 0SS|p0S+ +S. -S  S`T0@Q {Z @L 00 Fp P)0p 0 |0 〠 p C00p p  B 00#0CSH H 0  4@Tp #T  Q00  0 C 00  000 \QT@T*T#0@S  #450SEx00 R 0@T@@@ 0 @PD0   0@ 0` 5P00S_ -Q=Q ?Q@ ğ0S 4P  0S  R0S 0 400c0P \  0 #0C S, , x p * `p $0P $00(   0S @80 cR8K;0Tp00S) 0  `p   $0( 0 0S 0@80 cR8K;0Tp00S)00 `p p  p Yp 004, ` `@TQ P0U*n PZK 0 ( 000 ``, H000 80 4 Yj  20Szuz7JP0 t 3 0 0C   0  oP  R00  P0UT*`ZP(K̊` h[h dggОhTgIP$ Pdh400c0 0+ 儠 A #40SqpP P0Uq*p P UHL 0@` DA AP@P!l1z01@` DA AP@P6@   0S*0 0R00  !` 40 `ቹ!0@Pq ab0Q   0 0  00@"00@40bpP0%S! ڣS S `V0S   0S` p | >PPPEW40 P@XC '   0<0 0`00 WS(pp@`Q `Q. 0S K- I` P|P  ;|n0 @20h$@> 00 D`     v` ` 5 0 | dPK@K0 `  b0S @80 cR8K900 R ` `PV 0S}[;P 0@S*S0]S @V*Vo5@ 0Q  00S00S T  q94&00 >  P   R: AV` [P?0 00 \[P 0@S*S w  =R f 7^Pa@ 0 :S0  0 0S     0 R  #70SS PLU @` @0(Y`0 R0@T 0S 00Saf 00PI`P|(|  p3X@ 00s03S0+S@ 0 ]P)a@ 0]S  #0BS 8p[]PP@ ` aPU 0 TT@g DA A`p@#SKW@G`UD:0` 0R=P p`90` 0F=P`EW+0` ( 6. BpB K041,Q"( 0 0% P I0 0. >$0 P0R@@^F0  0S B h0  -`$0@;F 00dhg`ht -0LM  00  P,0 0P, K  0 ".\? R>0 R@ 00 0;0  0S O@P< 0 @ ñ0 R^ 0 RY `(X >$Q \KP00>X #,QT X 0HS񟗥 0-S 08 KpP<0S! WN= P @0SP  YQ  ;P3X jW 0S 08C80CS4\  < P P \  | L < R  ,pWw 000 00 S<  0S0 00|,0,000S 0  P 0S!M< R0(Kxpy; R 0@H  kWZF @+\0KAS C\K003Wr\+AmPh 0Se 8;Ra0 [0 R  0J0 R 0 RK6P0: S`0Sz ?M0 Rt: @@d:  A4 0 29# R& 40 R" VSZP q?40 R @440 0\9 0_?40 @Rt ;40 R| 40i x0 O0 0 R  C0  + (\0K R@^D 0X (XH (8XX@@HD 00  0 0 0 0 p30 0<P0 000\0  7X 'P0 L 7'\KH0 D 0 0 0 0 0S00Q0#S0<\0 000 0 080K 0Sx 0 64 006V@P t6 ("( [0DSXT0 r00@ 0Sg 0 Rc0 4 40 R 40 qP  5Pg40040 4 0S0 0SB0 R> 0 dP-0  [0 .,5 5@P 5 ("( 0DST0 00 0T00 0 @ 0 @ 0 R@@K <0@0  @J000 00 0S C0 A0 0  @}00 0 4 00 0 @Y4 dJr*04 0Sx|@4`@UXPP 0S0SLS 0 0P0 @=C0 !8 K]p2 K@P@"0S 0SH,R|0 @& 0 @ @`K2@PVTBP<0P0PT @8K &1 00 07 20 0*4K\0K ,!P 807***0 00 60 0  -0  @$@0 0< 0< 0 0 P0 0=PPH|PJ hdhg fԟ؟xf h@gXTD | ` T(`ggfPt(.Pd40@ 0 Rd 4@80[ R`  `0`SQh?TW0SPPl5TWY P(TW0S 0P00V00SP 0DQU000 t0@ 0 0 0  0 S00P0#S\@8@K0S U0 y0 40 RH 0S40 40 rU0 e0 40 R48K 0))A LP -L$M< \@0 0,0 ` 0S<0 SH < <0@T8<0<) Q <0,) Q <0) Q- .PpP(0pP pU H  8 R=0H0 (01@PTs H0`< <0SX 0S <0S <0  x>Y<0S <0 R4 0D0 7 0R Ru Pp"0'0Q70 ;00 R   0WD R I p Q0SO 0 47@# R WDS{V4 ;@PTP  < <0S  `H 0PS @0 0H @0 0SE @\ <FW }T7 D 0@p7W Q0SPU <0S < 00CSY,  L   L 8 <0  005 `0S 0SLe0 <0  8ş#000 < <0#20#0 ,4 <0<0 00Ļ@P 850$<<#04 <00< 0< S T'  @0,(K6. XH BXLD <0 `<0 R <0m@ 08 ~0,0 < 0@<0 R <0 0U)PqcE P 0< l< 0 0,0 <, < 00D0  `3 , 3 R /P  ( 0,0 H< 02Ģ@W`D@ B\ @0vŸ<0  @  0`, s^ ,p n04M  b l2 , d XN 0,0 ]2''<0@?0 < 0,0 K0`H0 <@ K<0 RS <0? 0( ~0,0 7<0  < 000<<0 H< 00<0@  L1@ H@ 00 0P0㢾@0 0S @E Ey <U<0 Rka   0,0 , d0 7'g  L |g@XxfTDԟthdhHT(hCf thjlР+ 0-L M$Q0 0 @R! ^0\ 0A|3SQ/ P 0R+K00ɪp3P000QP ^ K K  L0S0K\ K00{<뜃܊ -8@L Ӽ?0000 dh -LM0@00Q  $ 8 L 6 & &0BS ' "  | 21Ch 0 X 0K 0 K 0K4S0dءp -0L(S 0S     "(0!B "0!B  -`L@t `2  @t 0T(0`0< (Ÿ00:0R _T{ 000#T0Sq 000#P0S _PqPA f L2@;0<000 @ ISPP л'0`0`@0 [T5 0S(Q ` "2@Oᴻ&00`Pp+0 0pS T21C   P0p`040)00`MP`(  hdhh 0-L$M@8 0 0K, 4 $@ @ p%1ظ@P  R050$ T+40S)K00PK1(0(S }#(0(S8 0 R4 8 Q$ [R0C(0  K%g  dhP -0LS@P 00S p `RP @0u@050R0 050p c -`Lp@T  00@@0A   P  LRX @3QX @ - QL M`4 .@TPP!0DS00STk #T T&0DSpQh(K4~!T 0p0 0 "T^ U 00c 0400C00 @pPDU%21C0 40RaT  , \ 0D,0 Q, p RSTT T 0B0DTST UD 0  t \ $  t < ,0 S(0    Qp@PDUT$21C0 40RwT ,    0  ,0 ST  0S 00 008 P 00C 0 0Rö 0R 0R 0PSPUv  p0%SU 00 0  00C 0 0S 00 00 0SL 00C 0{ P [ t P P m 0Rh 0Rb 0R\ 0X 0"T 0P 0RL 0H 0cD 0@ 0S 0SS 0 0 O> 0S. 00 0  0p0C 0 0S q q H p,{!p 0Jp 00s03 0 e0p$S {  00p, 4   $4 0-L M,P0@4K4 0@ (00K00C-D0D 0lCQ  /10 00hhgC - @L00C -L PD -LMP@:- ᯦P00PT"QaA0 10Q*(K媸0100CQ*00 0!  BR 0FP!` pP4 ) P 0@0pP 0 R @40 c0 0C0. 0PP `E̠E-K0 ED,K+K-0K*@K)PKa ᕦ0 Z 0$0*gClhhhgCC -RLM@PB `0S  U@PER(     l 0U `0 d0 h0 lX0 p W:0FS 0bC1AVV0a1,0 PL @a,,0  ``  hhgg -ML3M 3R, , 0R(Kl#00d#dK]OXP L.,P -$@P sTl 0R܂P  0@P0p` 0S0SZfJp J@ @0S00P :S ` X P H 8 P0*2PI P PEV.*0S PEV:U&  RU! BKAA! 0!5-常 P$ cP@f @d DT/ _]P[i@t000^@0 J0T 09-P 3IKAAP$00yP8'7gCC@Cg CClhphĽ -<@L0S (0}/ }0 @ glhghh p-0L R PP P l`PdphpuL0@D@@娶80( ,0 B @@CCCCCgghh -`PLl0V ``p0`C!VQA8 ɶ0`0Qe @vlhhhgg 0-L L0L@P& P 0dCPB00P0ghh -LMQ@,0 ``pዤ PhEQT00?@AP*Z:a@ 僤P X@0fPZ :,0S MP 0hChhg -D0D 0 LS:PS0C  0hhgT p-LMPK`@D*P P11 0 b! PU3 S'x0P?S0 b@@0 @{0P 1xS*U xVSTxD 80 x xChhg|Th -$!$A0LS`: q Q0 R 0B0 呵00C0 V pP oP@ 00 R0 plP@ @0 ,TP 00DghhCHg_g -:LM$ `R pp p p p I)&pV 00@CS$ $ $ $ $ $ $ $ $ $    x h X 0 PPHx(9&p0XA P YW pW 0S㴀 Q Z0S0S  @TK X  7  000 , 004 080 pP ^00S  8  bR#P@  0 PpᰢP `g 0 .8KQ}yu(K6 3^ # Z 000   ᗢ$6@  * pFW  l0S0l Z o S[Qo @Y@X *P X  "X Z 0 r 3 Yy H%H5^ppQjZ00 ` & 0  fB!A0@0@ PP0 d 0Q00`Z  X 3RI,h|dp`d\^ 00S 0Y   ZJ =㡡P 3P (00c  Z  `0P3F/P`U RoZ00 @  $F00S00@Z  X 3R1pZ UG ?IBWPPP 02PP K Pp0T20 (0,0 儳00@ `4 8  1P08 @d\400c00b S8Kژ"8 @` RP _Y   aZ  @0 j5 I1004`"4`$@W5 481?80`@ cR8KT"P@ M4, `2>q@45 gb40E'([@ g|gldh(hChhHf0_`Ԣ,g|X80     g(0$0PQ00gУ -0L`0V`PpϠ@@⻲P,@ p0PP *1r P 1$0  00gHph -@@L |10 x10 Dt1 0 HfC P0-LtP lPP 0SP@0  0,@P00P00g -(@L0SS 00g -8@ LP0SS 00g -0@L0SS 00g -@Lh p-0`0C QL@ R pS0S T0P0Ppph,PuP0&P00S 0P0&10P0` T 0 00P0P0T0P0 4 -LpM|K@Pt0: S K --80LM R 0 0 + ) KCxf P-L( `@T PU pmPp0 -R  *.@T PU 0 S0HL. 00$0$  -R  h.ghxfCT --LM4@0 0 ;+ *)Kxf --LM@HH-0 40 "+( *)TK5`xf --<0LM R$0 0 + K$htHf --LM0 @0SX)0 0 R   p0  KUP0 R 4@-0 0 * {*$hfxfhglgC --LM\0\ @0S<))0 0 * V*$hfxf P-L@ ?@P 90 S@ 댤 -LM@KP0P@0P9K묤 0-LP3@P0U0 S U댤 P0-LP@ T U  0h0(T0hxf0SS   0SPS00Q00Q R 0S 0S R C -LM@K 8㉙00 R000  0gCC 0-LMPKD p<00S@ @0@S b8gC -L`\M0V,0  0p#@00d3 Q\# Y+0x t0  0 S 0-0t0 0PUR  p R 8% $ L$ # 0"#4020lK@ b@VR 00Sn x b,Vo VG ŸR2 T l K0O,p PU  R0SVb V$"Q$2 0  6,PUp0S -,, 0Rl(K0 0@:V0@60 SS@@l K/l0[S x!Tt1 0|l K ,0p0 V0@l0K 0#40/lK@@ @00S $ t0+V  +lK@ ݍy 20lK@ Սr @Q 0@ x P@+lK@ -@ R x+4hP  +T2/뜃C̤ؤjtP (LX T8l،- \\00S^(0000S 0 R00  p 0Sd 00C0X0X L P000P00 $rCDphC DCCT -LM pK` @T P 00CS0<0@T 0S 0@ d X& PT 0@  Cggxft -Q@LP 0= S; 05 @`p40 0^@Q Q 0  P  0RQP tK0^0   ^  <00,h$4CCCCC|h -@P#0L0F%T0?S[+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ d+ + d+ d+ d+ d+ d+ + d+ , d+ d+ + + + + + + + + + + d+ d+ d+ d+ d+ $, 2P 40S 0Qk R0S Q PZT1`@T P0 PUSP@TU D1P(1 P 0R@0R P0PU p0@T `፛P Wp@TPUW |0P P00Q 00Z 00Z 00hC -LM,Kp`P\ ᢖWpV@ 0K@P> U4T P@T ,40#00 W  @ 00CS0<0V 0P T 0@   T  b(KU<0@  T0$0!gHfCd 0-0LQ2 0 @P ^ T\ Q  P 0S R pp0R`  0  H0H0 P 0S 0Cphgg[ĥ̥ԥܥ -LM`00̂000pSp Q  Q2 R  5P 0@`00@ 0060@00 00/ 00 R 2 R 0S Q[ 1Q/PБc 0SY 1P 0S4 ! 0S0;004 S 0S- (h1, ` 0$ 0 P@ 0S 0S $!$p$ 0S 0S U 0S0  aPP 20 6x0;P0h;00< 00aP@!. 00g\hhDDnffxfj -L M0K px,,KPP  RI Wx0@T `0S0C00$3`\# ~@Ty#V @GW. 0SB0SU0000 U00 0S W@ 2 R0x">0@  ݔ(K ה@Z@ 0SrP>W`A00 R ܑVQ0PY  㱔- 0@0 t- hP0 -  㓔0@ hPPb-0  @  —,0!@c#k괐< 0S0n  x 0S T0P@,- 0LgP<DXHfDCD4@dnd -LM$`K@p( 0PTP  KP0 0S$ @ T0d0K0P 0 P 0S 0S @ @  R@ $0!n@gphCd 0-LMPK ؓx0P h  ͓}@8008, @ 㻓8gCئ p-0@LTP` `@T P @P`Tp -LM$pK` P吓 K@P'  R 0S )P @ {KPH, \@UU   _ 0! @gd0000 R 40S0 Cph -LM@K 8640 R 000 )gC -LM 8g@, K%`V00 0 0000S D0S $p0``0$ 09<PP@h0#SqTo 4@ Rjc*PP@@T vT$0S Q  $4 R 4?Y0$(33 T_;V @,K 㳒#pW00x 3P \1 0S, R 0' 0H3, ( $  ,00008 2"0`p` ,K s1A>0@!`X.2    | 8 0p00% t(" 0S DD %0@T $(%@T  q"*!@1 0lp!(@p C^ E ,KX!0S = @!0S 1d`1@!@ 1@ @@O92 M$M 0S ^1 Z1_@P  ,@` PD@D =1TgDCCC(hgD DCphf(4ggxfp\xLCTjjj -RLQ5 0S^ܢ܂P0Br `D@D 1T0rS Bb0S PxP d2 00U P@ P8m] 0 "S Br `D0@D2 T 0S m8! 0Aq `D@D 0T 0Sd80Sh1 R80P0Ho00囫aP @20S#  00R  P) LP00l) A00P`v)x 500xl)T +P00KgDjgDLnn4mȧ -1L@TX pQpqpa@T 0Q 0S S0% P 0S @TP. 0R 0SM 0SP 0S 0 R0Q`0  hT@QH0% P p `CphggL -1QL@P` @d0Ǡ) /Vpp 0S00 %0 S0 R @` PD020@D /T0S80 R h7h{C\hgmLG gDj -LM댤 R x4 R 0S0L4 |00(KtKᕽ,K  VPPڼpKኽ`V 0@T@T 0U0,ß Q,=A A¼ ,(p0(c(Q=9 =t ,,00$b @(( Q$  =A A$ h0 cl Q=9b @ = $ $0H ᓒ,00, 0S|0C0 0SS0000v 00S  R R 0QS4 0Sd S000000 00CS`@ R0S2 s 0Sn 0S& 0 S" 1 R  0S 0SA RA $ < 0S P0SC@ 0S= (1 V 1 0,0 000.`V8H & q"0#400 00CS@0V 8 R 0R 00CS0kT@00OCphC?BgdhDtCC0gT -!MLM,̟, l( Pp8 d ; 0 ST  @T @0Pd( `( \8 , `\b TQ `X( \ \Pr !P- @\XX00SH p8S hx R p0 Bx p0`0, XQd( d( Pp8Sl\, 0dR(K0!S@ :LPK 0*0#JX@ Xd@@hpQ`(\0" XQd( d( @ P P0d8  `X8  P T8S`,`X ` `X \PPU 9 RZ!0EVSVQ $P R $P $P $P $P $P $P $P $P $P $P $P $P Q Q Q Q Q Q Q Q $P $P $P $P $P $P $P $P lS (S $P $P tR $P $P $P TR $P $P $P $P $P $P $P $P $P $P $P PQ $P pW (W $P $P $P W V V $P $P $P V $P $P XV 4V $P $P V $P U $P U $P U $P LU $P U T T T (T S KJJ0 @(p ᩒX@  Xd@6@hp\`\(0! X8Sdd @#@ \\d(`00`X d8 X @x'c`` T'Y`(\0" 1!MK@D@DqKJJ0 '媂p6K J0J 0&向p p00B0S00A0SwKJJ0 p&{X6K J00J0a 0&mp|KJJ !Mpt @h( }{@T@P@Tp!]KPEPE+h~}ᰑP@!MK@D@DFkqKJJ0  Hh}㜑pG!MK@D@D2WqKJJ0 ,%4p6!MK@D@D!FqKJJ0 $#p%7&;@7";ɑPxP 7;pPKJ~0pJL4KKKt WP  RP KJJ+  FP 0p0KJJ +p!MK@D@DpKJJ0 #сpK3JJ +pKJ 0J pd( L4KK$K`3K JR# $ 0pJL$KK4KKJ 0J pd( L4KK$KePu sPKJJo + ᶁpKJJ0 KJJ 5L .ڐPKJ0 pJL4KK$K{!MK@D@DfpKJJ0 $"hpjKJ0 pJL4KK$KaK0J\8 p0CJL4KXKJ\0 pJL4KK$KOKJ0pJ\8 L4KGh6H:@\6D:ᜐP+ KJJKJJ +Lp,KJpJ'KJJ +>p"1K0J1J0  p6: ᾐP0/SX6:KJ0J0 \ p꜃fglHgxfPI9`fChg 0 0 0-0LMPP)@p690 0 / ☟P 0  K0p00`AP-040P(E690pgdhĨ,g@hȨ̨ 0-00P @L (@= 00dh p-@L@`0DSt0 P    $ < (`8 , 0 4 p<408`B400,pP p- P0@S0C0 p0LPT`` 0P0@00p( @` 0<0DgP --`LM 00CS< 00CS,@@0 0 gPxf -0@=C0 0 L m]dh -<L@Pk RV^ \ \ ] ] ^ `^ ,^ ^ d0P 0S R  p, ; bR,P0W0PP} P0S0So )0PP0@0S <4  X`0a0Q Y 3 R 0S  5Q $0 bP $0N <00$ $ $@} 00S44000 00  0R 2 à<@@[2 RY0,00e 2 P `> 0R, SK 0 , b  nR,PL 0 R Pq 2  0 <@@$00$0"<0Q0$ $ $Pa $00$0000<0@ 0  $0S `1 R, *,P`0S7 W@5 * RH  00S< 00S60 S6$00p p0S Y)0t |0,n<0 Y  <@ggf\pgxfPXTdh hh@h p-1L R 0 0P0@0 p`0SP 0  0P0@0phyx@\T0 0R0 P 0 0R@0a P 00pDgD - 1LM  0(,0 ( ,00P40 0 p@`T`\T00S 0 R00 @``40 cRP4KP[T@p ]TpGW00S T000( `ğw3$KdhgD -LM0/K,0  " ?@ 0@ 2 ! >K*.KH! 0  B 募101 ? @  p@`00`" <` `X/ P\PH @ϟ0S00B P P #PL f? $0 0$0.0S, 奟Kb  P\P Ο0S00 X V V00.01 cRKZp Vf f k j j Xj l k ,j i li i h Xj 0S0C0  P\P ͟0S00 )P \X[ `X $X  00p8= R X-!X  $01 P\P (͟0S0@0 @ TT T !Tc 00D-T S}t  l 00  " PK@K T T% T# @-0KU t  P\P \̟0S0@0 n@TPKPU+1PUO 0 !RK 0(n0˟00; 0 0< 6}Xm |X (Xw @X*X ?X+X !X 'X \X= "Xm000 Y 0 p`0)X |Xt (X 0 0 0 Y p 00"X \XP* P\P ʟ0S00 $X> "X; X9  \00 p2\X 'X "X, 0 `0 p(X000 )X p}X1 IY 0`0p"X1 IY{ `00 p'X00p1 IYe ` V 8 00 p B `X0u \X  P\P ȟ0S00$P "P? P \00py)X (X000 'XI 50 V0S0T0 0  Y * 0 p`0Y0Sl l pl l 8l 'Xx @T~1 IY, `@ pB"Xr \X@00@0C0(X@@@ O"X 'Xd  000@X' P\P @ǟ0S00(P 000 Y] 0p`0(P Zt x00 }N[X`  m.P [00 p` P\P HƟ0S00P00pP00p0 Y 0 0 0C%00 pS  `0S CCR 0S BR 0S0C`0L% P\P 4ş0S0P0 P(U| {U 000@ X0 0 1@ cRK @P P\P ğ0S0P0 yP00  0 X  pV $ P\P ğ0S0@0 Y@$T "T  1 cRK pT3 0\  p@) 0@0p 001 IY ` p00 p1 cRK p P$<XPP>X V`  Af V` 00 !`X0FXbSB(@T0"0PQA  `෉T0S   N#@  #@Pz 0w 0S  0To   0Tj < 0S (  @lh0 <0$1 ⹛O 00 p0W S WV婛(X* ;X |X>0 P\PK 0S00EX^ |X&PF+ )000 p`0j\TA `T?  $ ;꜃gf(g0gh`hdhgg ܨDDgXh dhgDШX, 0R(K0 Y  0` 0  p`000CS0^0 P\P 0S00)P1 IYm `00 p P\P? 0S009(P:0 Y 0 1 0c0` p  1 cRKf p X00p0P@0  $PJ p(P 0 Y 0@  ` p 0 0 0 Y  K0P0Pp @T\T 0S00 @WP00S00 &P Z00 0|P0@00 000 0 写7E`KPs 00p0S @1 cRKp00  0pSP(]A0S p:K@00E  KKf  K  K`$0 0 sp  K  K.!p0 Yc 0`0Y` Q@ dX00( 0C p( B`0 ! 0S   0B)000: < 1 ! 10 1  `0P pa P\P 40S0@0 @T W T p0T 1 cRK"`@`P P\P0S TT @ UC 1 cRK@P@8  P\P P0S0P0 P U 1` cRK@`P; R P\P+ 0S00%(P( D  K0PC  K  K~  KM  KH;9  K?P  K7;XȀ |Xㆀ =&XK00  K#AH  PP1 " h=R }R(d= |0(00 00 < ^0`!<000C02 S " :2,,tx  KP  KWh.>X00`0  KF  K>X00) 00 P\P 0S00 -P0 00U000,04D -LpM`P`U @TD P僗$倗00 `P> K:`pP000T\S/ V%P@PPD0 R ㏗00@`P b P0: Sl0 0 0 00W0P `?*@P 00$KDgg 0-LpM|P@Pp+P`'T 0T  K, P 0 0K0|0: S\0 0 Dg p-LpM((!0S00cS1PU3 P K `P0: S 0 0PUKpP L0 `  `  0S h0R|* @,0S\P/Q)`  4*P 0 P0D4DD_ D 0-@PL 4P@T  0R@T0ph -$0L@T @Tdh p-t`LPU R @0@8C8SE @Ty0 0PU 00pdh -(@L0 01h膖dh -laLPp0S  0R90 R @@ T 0Q A@ T 0S 0S Wo 00h. `V0 R:0 xP0@CTT WNHP@0 P42 dhxfgfgj -P`LpG&P@pP P00 Q @dh P-@L 0 RP0S 02n T000e7PPh0 R \0 RHP0h9htf[ P-L@Pp*`@U0S)Q |Q00W0S V  ,}@P`U`V*萞 P-L`H* p V0S@P*T ?T [T ]T$ |T' )T/ VX00S% z3|P XpX0S pX Y 0X0Y0S X Y:0 !S ]SppZJ0S0P ꐞ -LM@PTp p0 `V  Rd @-Q@ 000#0+Q0SY00-SX `SR 0-Q  0 p@ p@:V?V@ ,V;V00,0 0:S0?0` 0402 ,2 ` 0? X? (K#V :|P :P& ;P$ ,P5 #P0 `@V4 !0`W ,0@000@@ R0p00p 0 0Q  0Sp0p @@,0010 ,0 0 @T! 0 0 0`@0;P :P00 0hP0 L0 H{P 00({P`[ Ph{ p-H`LP@@%T 1S {Pp&@Dph0 -PLM@ RPD .R*@ ZD 0D @  ҅< < @ S @ < RD0Y@  RD 0SD ?SW @[S S D 0R< 0 (KS:SI0CSD  P D 0R@ SpBP DP  Y, 3 Z@!':,0`C@Z!: 0P   0P *SD  R @0@C D  0~P T@:,PX<0SD  P D 0R@ S`B DP  Z8 :p@@@Z: 0QP  0JD0P C  0V @P@Z*8PXuD  Po @ pBZk:`DP  @ 0D!PPX  0P`Z*O<0SL D0 RD 000 040 [Rt R R8 QN <0S < 00 R00S 040 QO  R [R 0  S   R( 0:S R@@`:hzP 0S 0S l 1pf@T P zP0S$ @T0-S 0S0 \0]S4 00R D D R0:S<0S 0P0S40  s R0[S#0:S 0 @0]S  S  0^P   0UP 0]S 0k !R> 000 Kp0 @Q X0 R%\<000 0RK0 뜃hgdh\ p-LMH@P4 `0T0 @ Kpgh8 -aLMpP0Pp' PPR 0000p U0HS0 0Q$pP PSQ U00R0S00QR R @K$ d0 Ȏgphgg -LMT0Sp! j W4|1  DK+x t DK|!p@ 40AT00#`9 oT" ?T WsT0x1  @$PP%U 0T0  s%U l(K<@T  PS0S 10   VV<00t1 VGphdS@0PS PQ^@%T<Y4( !ixC* Pix䂟Jψ0S 00 Q0W002|1 t0-S /P 0-S`RLŸ | bd@PpA `AT sx1(K! 0 DAHQp1`Pp P%Up!>KD40D !R 0-S+S00S 0SQ h!0S#0D0 \ t1S P D0! R  t1S 0S w0S  7x\ D 1  Q 01 0Sl t1SD D  ! tD1S1 0D S D<bD8Dh|gdX(@HHf x l 0-@QLPÉ0 00h?0@-@Q$ /Q``V/Q P Q7 .Q \ /000S/S 0S/S/Q00/^^ 0 .^0p/SS0&\00S \/00 0 P0 \.00\ L U*0/S -`QLM`< /QpPy .Q8 | < X 80S40 00 ,0 , 0S:S00S,0   0S:S00S Q00,0 P00<R04 0 ,  0/S4  0  000 4 ,0 Y 0SR0,0  0c0@w P0 bR,@ &u80S<0(K40@ cR4P@4 u4 0 S/R/000@80 00< .S0S/S000#80 Xy8 4 0 , v0@ cRP@ t 0 S/R/00PP -MLM0 c1\, @ TPA @/T@/T T9 />vP `eP V9 V:  @/00 0 0  cR@B^K pPEtPEp _P@'( K0tC,$[/R0  0a P PZ, 0 R(K.T.T0.S Y0y/S0SAv`0뜃 -LM@2v0     00 K 0  fP 0Q/0000 `Kdh -`PL@$ vP0Up tT t0T l0h讇LpP P tT0@P@tg,hPdhg 0- L @ 0  0 0S[ :Q0 a/ 0,0 0 P0  00h 2 U$0 0 -`L p 0SL;z ( S , 0P@aT#T KPP@`)0S[` k`  0Q$ 0% ` 009 0~`j`0i `0` F000 0= S, 8@0  d0d`0 0 `$00 -P L`pM WP@T 0P Wd@ s0 0 dX`0 WXDp X0Q@ q@`Td#T! 圊P`@`z0S#0 ;0q 00$ \BWL <X r 0 0h0 0$8 0-@PLP t 0h0 p-LM @`, v  0`KS' PK+ EP P#0S  ;00`$0x R 0 B `0xTH $0`0p`  Ph -LQ@M0\ ,0 H H X  P %P`  R 0 B 0HH P0 H00H0 @, 0HR(K0pT0 P0 L0 W 0GLSL X @ (  0 ~ @0G0 P 00D@SP 000L0 X EpUpUX `T P plWpL0L@0  `L0 L {L p `L uL0 ` LppL lL p,0 `L P0 dLp `L ^L0p0 `L0 X\ L \0 X   pX `\ P JL p `L DL p `L >X0Sp `\ T0 6 pL\ X  b `L T )+A0G0S 0LP pc0G\L S D L p L L0;@L0 \\ `d0GSD D $ d $ V0X0 Pu`X ,Kh  0d |d0l 0d %~ P`duWt XQ -00lh lL  XL T L T XPL0TPh p L Pe= S L0 p0pUX@0C0 0 @0T 0S @d TdHH US@0 B @Tp0  R @TH  H >L 3#,Kh %2> &BP0`lLT ^x0X00L L00B0Bh0l,Kh 1>A P0 0` lL: 0R 000lhlx,KuL  0\0\  P`P`\ \ &L\ 0 L \ CKC0KL!40#0X0S^ \CKCpK\0\0 02\ d rdh lA-P+PR PP 0P 0pT0Sf 0C0 00 HHXH 0xS0SW 0C0 00 H  H0pH 0L05 +00lhl @`` 0 B p0` @0T  R d &` @0TdH00ePH0 0S 0C0 00 H00H0pH0 L E 00lhl d d d d d d꜃h| --LM0 0 4 K 0-@LP" 50u    P  &P0 : @0 P@ 00 00 0S P0 X0PS 0@0 0p  Ꜯ - L @ 0S# & -*  P 0S0 0S0:0x  $00Np 0+ 0 00$ 0괮 - L@ R 0 B 0,Up RȮ -P L@3 T6 pD `Q!   _8P 00a0S@@ npW   0Xd0P0 `\p Q V` T` -P Lp! X `$R9p R V@@ |n 0`d d0Vp0 V f4X ` 0; 0-0L@P 0P  0000   ,00 0- 0LS@P >P 嗣 0P 0P 0 0- 0LS@P'P 倣PP0  0,宁0,婁0 -L^\`pP@%T㼀& 0W, pE <  p0$ (P PPPB0BSU@P?ppE©k(;0l❁@dh --L4MD@K0B 0 0 SVK -p-`P00PQ0 L4MS P 0 L@K0 0 0 2P4Kp4 -pl`LP@)# T P (0V0W< `0``0$     ⧠dT 㙠P PPp P PPpPptT -l`LPp@% T9 V`+0 0,0$ (` p ` P  \} SPPP P PPH[рP 0\ǀ00@0dh -@`L#0p᱀00 0,0< (0P @P T00ӧ2 0 o3Q00 X@,Pdh@- 00Dg0  D -<0@L b  @     dh p-LP`@@P`p p-@L0`S 0 P p00P@0T * 00p00@X0T0@` DA 7A000 0@@PDD`hPdh -RL0pS@3Q0@A0ZT2 P- T<2P``V 0T0 XQ P@0T*00T+ T4 T- T: 0DSLQB`1 P1 R|1@` DA A000 0@@P41P``(P``Q 1gm`p`3)P``0  0Rm`p`3TEP0  0BS Q` L `P H040R@0@ `wDDfdh`h -PPLML H00@!@1  Q@ - EQ5 Q 1P AQ 0 S P0AS0KK0K@K0  YP 0  QP 0x  XF\ 0KT  0<p @A}= @0@40 8 < 7}ԭ@0l S` 0P0=URʨMUq0KU t tt 0KlpP `p1@U@PBPUt  t 00K00Sb h7 7P_ {P0Cd0 N0 Sh \ i d0P 7@{`0pSr 6 (P0@@P0 &00P 6 |P  U:t@f DA n{&A0P@0`P|P T1@@ f S{)]%0S d0S  O\Q\ hp p0\p Sx5 t oD5@f DA "{A`P _ %h t0K 5t P<@40PT*$! <@ <@40T*4lp  `<@ S P0 ylpP`t E@P $z  0 0 4 3  PwU*00Pp3@f DA zAP`@@3  &0U0;0g0S7<80 0c0S783 RC0S!3 P<- `X :2@g DA zzA@p`@ 00Uap0PhP|t, <80 0c0SX2 R40\?*(00< d P;PppT;p f 9zd yU8h1@` DA ,zA @4@ @8 < ,8(1@` DA zA @4@ @8 < 80 @` DA zA @4@ 8 < 0@f DA yA`P)P806`t w0UgP} gPx |gPLrdhDD t g  `hfgd 04  -LP@Q 0  *=Q&0  "=Q QD1@P U0`0$ 岀00$Pp  000{ 0 @Yy0@Ry P0P0 :00 0p0 p@;y 0p PhgdhHD 0-0L0@  PP0S p0P0S 0 P 00_,00DgXhDgDDD 0-L| Gt0@T P@T 0S  ,0 00 0 0@T0gg R 20 R00 00 0BS 0 0P0 00BS 0 0-0@Lx0 S@P0SL 0 0 R0S0eCA 000dh 6f -L\ P0L `01P@U 1pT@P4U 0S fP0 -p@L BxTP 01 R1 0d?A1cX0@ P. Z$` $ ` V AT 0 K 0B0S 1 P00S@0`0C V0mwwgfff -LMZ, 0 , 0 0J @01P`U ,  1pV`P6U 0S,eP(K0Szʊ x_w,e@w000 @0 0P, c00C0PR    T8 0S 0  0R 0jnT0S R 0S 0  R 0P jn 0- L @P 0Q0   Q Q 0 00  0<  0Q0    0000а p-L M@`!PPP4  "   0 R)00 `0`S 0` $K$` 0 0 }KpT$ K}$ 0R    g| DP 4l -P@L1  !R 11j 0-D@LB^T @ 0 ! T @0j1 0) 1xjt -0L 01!"Q0  !Q0 $4($B0TPt`q40000嘠@0P`0  B@phTPt`q4=  L9  @5<  o0j0lD| Djjtlj 0-P LP@2v0T̃ 0 0R0q03 00S  H0 R00 0h00Q00 0000g| g 0-t0p@l l0LB^T @ 0 0S 0S T @0 hj(hh - pWL` % 0S !RRP, 0@@   p <00l0d@PPLu  @ 0  0  f@gg p- L@PT" P0@Bn0 0S T @0S UTp@80 000 0\ hj(hh 0 R (h |0p-"L@PC`T0 @ H0  0S40,  R+`pj h(hh -LM04!0`p Q 8{P ccP0U) P@T WcP QcP UcPbP| hPMP L0UP K5P R R0Ղ"Phjn( p-LL`P@T PpyP 0@0Ppx\(h -pPLPH Pt0S P @tP0t0S P @tP0t X @T `Pt PtPtt@T|tirt -L0ML`K@ B 00P SP         t `  @$((P P))@$(P P)'K|@(@}P@$p{P PP @0TPS@@ `0-L@P^$?@0h0S 0h^$?0h p-L`P0@ S        l   L L VU@ PEP@p0P@SP Ts0TSU S 0P@SP, p-L`P@es ph_ -LMP`0  s0 00  S  00R  0Sb@s0@0P PP00 R00  0Sb@ts0@0P PP00 pW7 @Tg@WsPU%  , Ls ,@0,0 00 R s 0S m 0S oPU0 0p0 pj0 e0000(KLp -LM`pPG %P?;0@:S:                       h  T               @                   ?P(K0pP @2P p?dP00S b -00@@@0SppX @80CSt \  t    4 @!  D    4      0@,0 0P S X (   H ,   x d  ,0@S `T"T\P,@  pW@0  ;P  7)@}P@${P} PP @0TPS@@"@0,0 "@0,0 |@(@p$}(z(wP P)l)iP@v$c(`P P P@] 0S&$Tok @Y @ @@D 8TT 1@T,~)d0 %0 SG 0S x%  0S @ P%0S 8%4%0 % 0Su @T P  @T 0@TP  00S @TR[  W0S  ڨd$0 P@ 0 <$HX:0 $? $08 #00P0#  $ #0#0 #|#0 R 0S @ #0S R 0Sv @ "0Sm ""P 0  "Z "00S @ "00@S x"C h">X"0@0Sb0"0 0S! 0!@ T! ! !0PU 000 !  0S @\)| t!}0S00T!uPU 0 RH80  RX00  R(l0  R L0 R^FPfP ^@D@TY00S@ XEtUh (0 R00PP0g P-L@ 0 p-D`L0@ PR  a8" e 00b 0pXE p-@QLP! R `0 Q 0Q 0  " 000pT`  0Spp0 a" 00 0XE 0-hPL@T\@D P0R  P 0,0 0S0C0000U`EhMXE 0 0  !XE]U 0-4@4P0L !0 0 0XEU] `,0R- 0!pUXEpMP0 0ɿUU@h -pPLP@`0e R0@00U0C0P 00 0b@~0U00P ~8 0U00~0U00PUU -PL@4M<$< 0,4<<0 pP@p WV0`@T3`VG3 Vb 4 у 0U{3# @<0S 4 _QQ„ V^00@0!0<0pWS0N 040  VP\ 0SYW00S4 0 Q 0 V0WP ژ 0?, PÐ @ 0 ` 0f S,0 0P0@  D `~@TD b$2`?ÐY 0@m 0` S PPT M0 V0 0C V00@p40 W0040  V080   0Q00l 0C 8 00@!V@8 0P 0 qS 0S  }000PU@08 0S  +@R<@ P0S | 0 }0@0004S  , 00c0(KP @>@UXEUUUgUUU -`0` \0@L bNT } }$0$  0 UUUUUU -,@L0S `0000Ug -L}h~ 0- P@Lj`0hf`g -L0L @R TT^b}@@$h^} @}@gP 0-@P LL 0 00h p-X`@Lf`Pb` L0 0 pg -LM@Pa0SW P 00|q$K(K0 @,K @x`PJ (1 ($9 $0V0 P,0AP-N 5xP#U0( bQ P0P00Ť0 00 @@ K lP P4Q (0Ph@@6Pغլ.Pը^0l0ŠnN cR0N 0NRtN lNh.0YP.Y   B > . >.@@LvQ4  P 00 S v@t) R ] 0S 0S 0S# RPP}  d ~ ~ (~ (~ (~ }  T~ 8-0 0 @[00,QB T00^@  T  0 TPPU Qb Q < R B 0AL c0  P< 0S P"0S S S00j000S 00LPm8   T00e ˟0  @0 000D S` `˟Q\;X;  H;  @ T " +0000010DS 00D 0 1:ʟ @ T  *0 00D Sp 0!0000C00 T T`` 0(*TT 0T 0T :'Q{  :@ 9 R 0  R)l9@ M0 0 0C0 TT70  R@9 ^0 0@0$0  00^u@t 0u .uu R8 0 R0W $8PȟȟH yP0S cQsQ CQ d8P#P8 po8   0 B y T TPP& '10DSP00D P 0iǟ`@` P 0 S0@ @@E t t tBuH0 SD Q 06D 0 0 (Kt&0SLƟ00*Ɵ0 ( 0>600u P!s\@T] P6 D 00`0 0Ɵ 00@m5@T5 R@0T 0T 00ST  R %PTdh   x   ( b,P% #@E! 00C0>0 R84 0@ L4 P 3ß P @ğ@$a00@yP P. pc00v3! R|S0 0CR4#@0#Q@3 $ß0 @0S 0P0 0ż/ 20P~ @ R B0 0P0 0 з0C 0 0QH2P0" @0S 0 ` a1 0 f0b 00R0bP0`l"2`<0 @0K0` 0PFP @ `v}PE`X@ ڰ 00z P  a 1 0Pc 0/T PP  XPx\b,10cSsS8 CS6 2 rP aX )0  c 00 0;UhMUUUUdM`MUDEĺ@h\EXEdUUUUUUgUU]UUUfغE8E EElMEg|UxUdU`E9 -"MLMŸQ p,  S P2 R P R+ PP 2 RkKAACxp{ hV~8: S}BNK@D@D Pw CP 0@(K0$S RM  uBNK!@D@D0+xPP X$ ^K!PEPE0+xPZ C`CV_CP +#C+CHt CC 0p~GP0+ C, 0R&(KdCtt ttt wwt|ttvpSht+B0t뜃`p ̶x$Lx 0-L MP@P Q 0SP R:00 0 0K00Zt(Wt Tt PtNt$8Th -LD0"3 00Q@0P 00Uo -LSM✀0YOKp $ Qp `IKPK@dK 0<@g$ 0R Kfv뜃td@A -L$M@0P0 , 0S ,S0 0,SS af\ n\ 4@K 3 XsS 0R KSs z뜃ȷ -GMLMȑ0Pp,0 h 0S@`LS@( ,S0 0,SSBKHH j 2 0ApP< IKAAvp: u41` V,0@SV1S   Q RQ\ ^00\0S l`s`, 0R(KDUs 8uu $uHs뜃4ط̴ p-L M`P 0(0P`0,P 4@0 0 0 =400 PPKpsP - ,` N@P"YnKK`F/>0$K0 ᳀ r NPr( 0R $KD, r 40]p(r$뜃BlpB$B̹ -LM 0/KAA ,0 + {POKℂ/v>;lr 3K; TK00 MP2Sd St ZNK@D@D/[>0 5 M@PvZK@2SXڊK`J/ F>0 8 e M@PXY l>P;5S8ڻ^KPE PE5@S0/%>08 ; i I lMP*_1( K+Q0(K+P( K0+Q8[S K+@, 0R(K2`S܏tr.K1`ҏX\Pr0+@o8q뜃lp$B B"B!B$(ع -MLM/NK0 /`q(0 =0 2 M@P0K00S$^^KPEPE2K=P 00@S/=0x 5 P2"3K2#K3K<Vq8 ,n0 n뜃lp%BPL<ع p-LM@a0_K@/0 = !0d0C S t  n0$0 0 @LP-K30gS 0R|| 0RKp0$0 0$0 0$0 0$0 (p$D뜃lp`#BT|\ -'MLM40OK /,0 <&Ɵ0 3 K@P ٠0So 3ş, 0Rn(K;K0SjKAAI  I / <|%|ş0|e6 9tu4 (K0P)\0PK@PG)R K<P9S (K06PK8C8sj@K 6K $'<( K0S3Sꨪ dA?KK $<3s s 4 R K K?C^ c^ Kj@K6K 0K8K @F3S c'}KpGpG`/<#09 9 g 7 cKP' K@U 7Sx p h ` X P p G 3CSL GWT3 Rt  K>@#(K<0( K0#(KFK#;6[SW V@K ,6[SI PK , 0KχK2 RK3`S)0 S) *x 7K d"y;3CSGWK@<"<2m;40,($ bEaC bAb?a=a;PK ~,V@K x,0K@!PB;  0P勬OK0K0@t!P/;C^*h 0KKjKP!#;HHHH!H1n 3S0C9 # 0KKK6KjKY3S9 WoToQo뜃lp B,."Bغ4hp!B  dp̻ԻܻĻ,  <[,DкȺhh -0L 0a7L -H&LM0@Pp,0 B VC P`C C B B B B B %cp> C0@3S3ı | p L 0  | h X 8 $  Я $$p$0cP1 @ P`T ?K f:tp0 Q"#U U U U0 @ 0@0 0@0 l4 {#0 @P`0# 2 q3 m1 K@"3R_ 0k Xl3x#SX#8 @P`# K8303 G0@P`B(3 >0@P`92@ P00@ S` . 0K@ A2S8#82 "0 @# P `" `"0@P`D" 0@P`02 02 " 0@ P`" ! 0@P` 112 1 /'x, 0RB(K?V=  /V08LTMp= 8..K0@ H@P2K1" 0V cV" 0@0 P #-k*k|'kt$kl0 D0k\4 {m뜃<dp`8̽`phpBlpp<( -LJ -0L wP -LM@P]I!ᭈpt1` fRAP !0000CH!0?A1cS @PQ.Q00A   S$K.Q 0 U0S,K,P ( RP ꜀`0`( ?Vᘠ*Ac 0VpS0C P0V0C0pS0 C RZ00[ <gfffB 0-,@,PL(  t -LM  P: K 㰩p* 0#4 P; K 㡩p 0#4 idK^Yjpjd@dd d0%TjI @,8 ,0$ؾ̾`ľTt, -LMp D K`P= -KPr UP< @ 5R 0S㘂 b@P *p2^NT ` Pj xPU l l(KH0 0>3P@;j@D5j< @ dk@0SO ᩱPG 00L ᘇP4$, x1ϠA/ 0(@@lN#b 8K80 4 0@ , iNP kP  i ik iDP Di iЛ0-SL0S i i<@@  l0 R \iD,ir <itppptMb0xpl< -LsMMxKH0H`,0 p`P%L3Q iP03 R;$3 RA P, 0R(Kn0S  {iviH7: Sl mKAA|`P 6: S ፯PPvH7: Sm mhP, (v"hP mKAAMP;K8n2 [1 R A@k PJk0: KP`R렑0SQA00CS0P0P0 Pp 0S0P!0CS030 Pp0yUYUw {fNK@D@D.P! 'KkP{K6P喈c f^hYZP| p}JL@PP꜃xpp|pt8M[ | ,Կd -GML Mp2 P@, X"p fP. iP% ,"p 2 PbaU5m2IKpJQAA疼P4: S X1 11 1sBKAA +' P: Dgc6$ `0V/S /004`04 X p5 p@/PP 0PST @T 0/S 0/S @TPo60 S`ЇpHX  kPp뜃<|pxpp@-0@S00-\Q\ 0 00L S0 ^!00 000C\0LQ0c0 -L[g, -LM0@S K( (p 0 ilH -LM0@SKP + 00  -0LS@0s30 RP 0s3 -0LS@ h** -L@0P 0\i 0-LPw0@P bP 000Hi 0- L0@T) 0P0Q 0S =S 0S <Q >Q !Q0 0l0 \0 0XP%5P <0 e 0,0 00 0 0 0ppp< 0-\PL0S S0@ S 00@0)pp -LNM`0\(0 0P S:NKXT1*D1S8 @1Ho@RPX0P Sv` %WP V?K|P 4P=@hF@( 0R$KP.@JOK I`$ (0Rpp31<`$ (0Rpp&$/`0D S񟗯p @  h I `dIPpp`VIpPp`IIPpp`;I`/Ippp3`" Kp p-L|`P0S @PP 0PS pp p-LT`@0S PkP 0@S pwp 0-@PL Tl2PX0H0@ R0S(ã:ԗ[Tppl! -0L x-0 CR 0R0 S`00 -PTL8Mp`@MPP NP@"pp3&@pK0K`< , K00 @` 0@P,00,0 -PPd , D20< ,0 0 @@0P \UfXK 0pL0T PR0T0 T0@`5K,0T@X >\P <\00S \ 0   \PPC40[S  5[0Sl|t `@L0VU D00S8 W $(K`8 t -0L = -0LAM @Pp  Mp sPp  Cp0` fRAT +2JPNKPP WƖ.1PPee뜃`< , -@LM `Py1 u100 Q03*,  0,, pW00P0 U 00 @ep 0 F"P02@0P5 :0="P *0@@,0 PdW p 0-LXM@PI! @\@0P00 lK(T`00\0P0  :&K0|6pp -LXM@#!\@0P00 hK(/\00X0P0  :n&K|6pp -Lp`<(P%@P04`0K*K0C8M4>K0C4A=K(0C4$QK 0B*K44(I C:K$$P0B*Kp(I4 0 S90 P 40S0000 0 0*}#p 0%  (00?0bS fS)0S00 (< 4<̠Č8#Č:K"̌,K$,4, (*K 0K 880S&0 0000 0 0:K P$ Z0`<`:KdK #p 0`04Z@`3|0  0KP T d K[P @T`P d &p@ d0Kp @T `| 0%`Г*K@˓V@Ǔ0SS h8J'P 080(x0 0S$k $@`PO dK 'dK<K)K*3[0C3K:K3[dKS3dK ) R)0S S S"Z  Z:Kp0S   p ,<4("4!< 03[0C3KA3[S$`$$VY0 0000'0S<0 00S 0S$000 0T`0 000 00S0T0 0-0 000 000 0(K8 p-PPL@00=&`#@P L00040 P0 :#7#@F&ph -L@M` P. .0 \13000 55:W00000 0 S,0 ,, pW0000P U>*0  0 @ep 0 }P02@0P5 :*0 tP $*0 @@00 PdW p0@ TP3 : 0S 000@ 0@,0qU dP"(K p-LXMP@`c0 |P0P00 pK &md00 `0P0 @@ :f@ #T  00Y@Kp|6 0-LXMP@3u+ P>@lK%9`00\ \0P PP :1@#T (0 $@00SK0|6 -L@000  Ph6G-M T 0 $0@(@ P,P`0`p 4p@0Tp  <0P<` 0Ԣ($ 0,($0P00P4@ h ! @(`$, <@0g\ P. 0@!g.,P(@T<@`0$ 04@, p$0( 04$(0Dp4pHXLP @ @0 ! 0@!0@ Q18 P!@`!@08P! LPpHI$PDHpf.. 0 p 8D0#Hpj!E$ 0#j 0P%@@X@ 0H @^LP@D PpX  `DHL@PPT@00P0 00 pD0 00H000000000 L@000 PP`000ЍH -LM@ D1>?  08^P0Q8 n< ?^Q@ n< ,<P@ < 8 ,<P8 < ,<0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(Ko 0-PL@U  0#<00#800#400 R0 0h},0 -RL`? D@A1>?0( @PcXPp: +@0!0@@0D@e*@0!0@@0D@y@00 @@0D@@H@?X X  P*@0!0@@0D@ 0-PPL 80P $,@0@0D@0H -LXMP`@Ep+ 0+P;0 S 06 0p xK#d0 s000+l00d0 KQ`0 S0$00DS$0 0!$0D -L`pP1#y @P 0V0 P0 W P4 U\   +`P  @(# -L0M`PpP) K.0 P 0S ȏ0"S UD@K +00 K{P(@{u("(04"48#K -鈑LM`, W0RSd0 S SMZK hP0U UP SBU U8p UpK0C*K8M4.K BJK$RMK(@D:KD*KDp DB=K(0C4@ A$$(0B44P@CD 0 S h , h h h h h h  4 00S0,040S l0SJt0SGp0SDx0SA\07@"0"S000`0SS S000d0SS S S000S4 PB$`0S S d0S S R  h0S S R  r 000SS\ 4 <h0SS\ 4 p88q < r qr h0S r q000{0000S2WeEP\0  % DK"DK 0P0<p0S=,0S:70 "p DK P&0sDK0S$,0S!\0 000.ap0$0 00&$0` R$01D0s0,0S00 0i(00?0bS fSa `0|S$01D0P S 0 (S 0 0 0S 00 S 00PP: `X0$ 01D:K$3/P0 K pp` @ K=P`K >"p@T T \0"  `KP 0 S 000 0 0 0:!P 00( r0 `@K$!K #E$:[0C:K:K:[Shh``K\JK #KKK :TRP0"(@K0 SJ|@T:K*K!,K)( K0K~DCoP|:  |K7)*K$^ 4 | K { Kx0 ^#JKDtK0|K{0KK\0 :K*K,!JK):K$(K0~4@ | |KP`9[V(/0 S 000 0 0$ 0 000 0 R,0000H0H0 0 -0 0 000 00M0(KhįȯT4 -@LP 00ܗ -@L>h>ؗ -4@LP :Pܗ 0-L@(>P0P@ P>0ؗ -LM8 Y< pP x4 2n ǮP!X20S002 PP 20S00#30#jp3Ps 0m,`  v(P00CS00 Ӥ0 R r ,Kx 80SW00S b(P<,K0,K@P 0K ,z00S p00RQW00S < P,0S  ω R ,0,SP SS SP00P,00,0 0004  0(Kܗ  p-LM@d`P=P@ 0  ;,0@0S =TKpؗ rS-@L`P"@3:܋p 0P@ы@ϋp p-LM@d`P=P@  0  ,0@0S =TKpؗ rS-@L`P"@3:p 0P@@哋p 0-@LP 00=,@r.0 }= 0hsؗ 0-@LP 00k=,@r.0 e= 0hؗ p-LM 0`|R=0tr.@lL=PXG=\00SgP  0`P@6=Kpؗܗ 0-K*K0C M8>K0C8a=K(0C8Q=K(0C8(P 0B*K88 C:K((40B*K88( C:K( 0 S   8            40P0 P 0000 SL0SRL0S 000 00S0  .V S:Vz` 00FV08 KQPp40p@P  dp 8K pP@?0 00dp 0q (00?0bS fS0S4 0R  0 :K(4x5<*K 0880S 0K P<:K P(t 0S<`:K(05`P0`0*K84pL*KpK %p0`0>:K8S@ p KP@pH KP TpH KPHK P`P l p@p0Kp @ T HK ;p`K*K@FV@P`A0S 8P 080(pw0 0S$0P04 $`J@Px  pKpKHKnK`F4[0C4K4[pKS:K"rX*KpK:K8"`VK0S SE& S S@/Z:K -5*KOP1*K"+Z)*KAP#:K KZY:K A*K Z Y :K 3*K p 4[0C4K4[S @$T0 000090S <L p`뒄0 0+0S00 S0S0P@00 00 0P0S00 00S0P0 0 -0 000 000 0.`(K -L@`pzP 0X@~ -`PL@@P00bpPP d0T04@0 T0L0+P0 YVPeH   -LMB^KM`PE@p x0RP 0 @m@P <00PP<4p84@ K8 -L@P 0@0B -LMBKMH@`Hp 0 S񟗶  X X X X X X X X X    0D00W0 pS048 rP@ 0M0 0J0(S 000,@P. @p0S( 0S%$ 0 0D0 0 0S00< S00<000D0s00 0  00($p-0 0 ?(K -L@`p+P 0@/ -0-LPM@a?KC/_K@0 Q Q 06Kp@ `@ 5,0 pK\ L0 ,P l  K0 -L1M`0pPKA4 8 0 p 1S01 R rP P 00000C00SP0 r [000%R@QgQP'eQG*GQEQC*9Q0Qk*%QA *QP Q7 AQ6 DQd[Qv OQg XQl LQBcQLP aQ!pQ jQ3 hQ4 iQKnQ MlQ1tQ6 qQ1 sQ xQF zQ. uQ?PP0SP 0S0 0C rK@@0hS@@0lS@@L@@ 000C@P  P0# z@KP0pKp"KP0 n0^S  0J_C0 S RJ!- JK0P-S ]S S@Q00]Q0SJ_K0 RLP9"K @P3 0p0p@  0p p @p p 0Oq '000 @P 003 P 0 0SP  00CS0P0 r T000U񟗰$ $ % & X) X  PT0*0PdP # 0hP P 0?P 4p4 X P0P0CU  SP U/0(K 01SSU$@P0X0C000  0SoP Ti (K001SSPTd 43p043 BX @ 0@ B0T0  RFP 0 r U000 !P@ 0C00X0  0S(P 0 r 000 4 0d p4 dT0HʏKS8SJS0 9R 8R%*0R +R+ -RH(XR+ A0BSAaR>:fRxR:0PI0 J"00003 J000S03 03 S  :J   60K0UI0 0 0CS0000PU  ?K0CUUUXPxPPE ;-0 80#G80#   0p@  0p 0p @pp4# 4# 8 0`Y H?K8RPPJ,0 9R 0RJ#*-R .R +R!ER eR  J  J9S:J0 0CS0000<PX   _K@PEt~T-xePEP txq;0 8{0p@ 8㓖0p8W0p4# 4# 8S 0e4P4 4(K -DpL0`S@P8n 0@S2n  -L M0`ჀpX0S 0@P0Gp 宪@ d0P0Gp@  Z@  b$K -L A : A `M `M `M `M = `M `M G `M `M `M `M `M I `M `M lJ `M `M `M `M `M `M `M `M @ `M 4> > A : A = > = `M = `M DE G TH > `M H > ,I `M `M : `M $> d 8g@+)0[S 0)0Kp TU 1cRP@`00C Q$S@PK|H@ K0@ S@0`SAp@G @ 8g P @ @  p@'R[R& b@' p70{+)KQ80*S8 `@ 87@7*T 1cR @`00C Q$S@PK|H@ K0@ @0`S !p8g P!   p/<'  T 1j8R0S@0J Q87 $Z pp p'  @0S1'*p7@ @0S1 8CX0 8CXp@  P 1 A PD70  c`D7 p, 0RD000`D & 0^0 0dP`V U00DD 0DO/KD' H %2 D>&B aP`D D'O?KPbdU<7P7 kZ 0K⠡K)0KP7 D P)0[Pp'PS*0[L L SLL  t' ,@7L@lT(`$H` \0 R0\0 ` xdKPK@DT 0@` \0 0R\0 ` xdKPpK)0[S )0K000`  \0R0\0 ` xdKPZK*0[S 00+0K+0K000` \0 R0\0 ` xdKPBKtP,@L'@bT㜨`$H` \0 R0\0 ` xdKP'K@DT 0@` \0 0R\0 ` xdKPKP7@eTL`$H` \0 R0\0 ` xdKvPK@DT 0@` \0 0R\0 ` xdKaPKp D!` \0 0hQ,ァh d'R80S\H:000`  \0R0\0 ` xdK8PK<7Sp 00h`  \0R0\0 ` xdKPK80@cTkP$(` \0 R0\0 ` xdKPK@DT0`@` \0 0R\0 ` xdKPxK<80< a<0D'\G0bT@T` \0 R0\0 ` xdKP[K\? @cT,lP$(` \0 R0\0 ` xdKPCK@DT0`@` \0 0R\0 ` xdKP.KD<\'PD p7 00h`  \0R0\0 ` xdKPK<0DK000` \0 R0\0 ` PxdK-PPKDX'0B0` \0 0R\0 ` PxdKPPK<7X@iT$`2H` \0 R0\0 ` PxdKPPK@DT 0@` \0 0R\0 ` P D00`  \0R0\0 ` PxdKPbPKXK`` \0 R0\0 ` xdKPOKp'* @7L@lTaP"(` \0 R0\0 ` xdKP4K@DT0`@` \0 0R\0 ` xdKP L'@l1R 0aR\0Sl  xdKP 0㤐K`0 \0S xdK|P0`0 x'0@0l7 Ttp 00lw TY h@P 0KP DO< Ml(K( -DpL0`S@Pb Z0@Sb QRP000S0 0-L9@P& 0S\00R001S @  0T 00 X%T00S <0@@ \ 0 0:<06<  -LMGPPX 00z`10>CNKTa@D @D 0P3KHH v p* T0S \ PT3 4`K Xp{QK0D@K0@3[<3K03K\ Tx  (0!"(80S s00 @3[P3<8P@<0X0P(Kh^  0- L@KMpP  Ap  Ap  ;p Ys0$S Us@'CQsP@0 p-`PLU@`U P`0h`  h0S0#*P0h``0p -AMLM8pK`d P(K,0SF"[3RB2[S?2[p< : 8 CNK"[ @D0@DD0H  ,0S+#[<0R'#[80R#@_P2[  rW0 02["[[AmK0`F@`FT@D,Pd 00S  r00 K -L0MP`XKBhr@p0`h p^r@0BZr0w@0 dp"pOr0 S Kr0WS00 0 0s 0L 1\p 0l0lP@@ X0*K8#8 $`#$0@"K<0 8 TX0( K0`0   0L0 P +w]p@ r0Sl X0 0Rl  0 00l 00A@al0S'p cpD l00Sl07#!dp4 0K<0  L:pq0S&P l0`d 0Cpc@ ֓pq0SPq600 l d0 0Rl jvp qq@sAq0@0q0SZ q0 Sq00RL 0,1\ "d0(0`0$0` D0 0 0A R  0$ (0 7H0S H0000DP* P0 P000-0 00000h S?0000 00000000 0 0p (K -L@`pSP 0F@W -BMLMp`?PP& 0 0<@K*00  X`\`TpmK`F,Kl00S p00 2[34[<03[80P@ .P Kh^ .S 0S0( <0R0(0 -LM`Kp&@P0S@PU_P -L M `p6P2(>@P/ P+ PP&, 00S S0L,0 ,0P4P 0 JPO ,K4K @P C``(K -LMp`P(K @PL( 00S S0B(0 (0 P , -0LStpPB`. T@! 0PU`pPE@TU E000 < -PQL`p@P j P) 00S.S%b P 00S.S 0.S PP*L  P *   P*h> < -p LP >`@:TP@@3 T`h-`P@ P00CS0 -@PL @@ 0!@T 00 h 8@ -LtP =00D00H00L0(0 P00T00X00 \0  0-@PLP P 0000000 000 0-MLM0P S ANK@D@D @0CP @bAP000K0 -LcMXK M`\ , $@P X&KeK @ (K00C0eK S@(K0eKXK@ 0CYP X@`' PPBT0S ZT 0[SOK,] P P0:S 5P 30K 00S8#X VOK`p W1[S S04%40T0VK1`X![|T00T0D PZ 0ST  P\Vp 7p@ P @ TP Wpy<X KQ 0P @  P0b @ ` P 0f@< p W8t<@Tp  PP@P U@ @ X0K@ TWx P*Z00Z0SP IXKAPh P pc P= U`@PX KX PDP@ U$!0@0' H PXPKp @@ P000  P , 0,K 7,0SpP W0SX[T@HAP`*(K48(N(Lȯ p-LM`y;P0:0/JPP JK@D** * |*  P11;d0PP JK@D*L* $*  P11k;Kp 0-LMP^<0SY T0ST 0S OKP. Ph 0S @ . @P@ P TK0$[ -AML8M0PSL $K3pG $ 0bSR@Kℏp:  l0R6 pP3 l00X@P# A K@08@ C0`0S020# p3P` v A=K0C80C  ypG0 P^ pK  p-!L0@S00K`PP6 T:Pi@P@0P!S[P Fp P w 0SHP T3p DBP Pp<<LH 0-@PL\\0 0PS@T0@ 000 08@ -0L@S4 w Dw Dw Xw Xw Xw Xw lw w py<TP 00  `P@@P<8P0 PP0P4P|P `Ph p-LP@ol`P@ el`p -LMpP[l`(K0 S00( 2K 4pJl0S @P Al` K0A>SP00 r 0_R -RQA0 00 0 -QLMD H0  Qz H<̠Č8#Č"̌,,H0 @,̠D!d , 0 @ P ` p @0  < 080  4 000 .2 0$20%20&2 0'2(0(200*280)2@0@0#2H0<0@#2P080P#2X040`#2`000p#2h0"2p0,0 #2x00 , @l  D<,  L8  T4 \0   t DH4 d @P`$p,4<,(KXt -QL MPp` Q QiPc  a$ KҾPZ@ @$00@PP%aP d@PF  f008 K⵾P :8 K⨾P0@  80K@ X 80[S70[0SS 70[0S SᙼP @0(KP 2(0S K p- `LV@P p 0P*(0 0p000p -L M`Ạ pḀ0@P `4 ĠDT"4!Č'(D*T0K 2KKKBKRKcK$K -LMK![K04"4 1K -`LpHX$H %X P p- `@VLP p0lS*(0 0p6000p - Lp @P`p 0$ Ġ4%.$$&Č'40  - L@p ,<4("4!<0 - L@p 04"40 -LM 0`ST8  , 4 8R100 5@1(:=S 8 P60D,0,@ T0*X1@8 T)p& ZY  R !  b0X10000 40 PpU0ZYPv 0S0%50 r(0 0R0 0(K -LMkP"{`@p|yc"Kr 0Sn"[0hS*1 0Q Q Q QD1Q Q6 Q=  P4!Z;   !P! K'# 00S   0S   [`0 $000 0S 0"[0hS,0 0 0S  0-< LP@ P0 -0L.S@P&P-QR00(+P00X0`dSp U `V@1@! WP P0@0S.pJU000 -LM0p (0 PPUoK0K/ KP@'L1[S  E0P,KKL1 H1 D1 @1 <1 81 41 01 ,KoW0 d K/KP@ 8( 0R$K 뜃(  -L@,00S )P -LP@ @R0000 0  -@L]8p- 000s00 (p-"HLPp p`p -LM   PS0  X0  !K  @PK@h@"00 K p@$ -LM pW@P 0\8#Ƞ0`P W@PU ("(pP@00 p-LM ` Ƞ,H@PPx ~p 00fx -1L`PV@  E0pA("S$:V: 00P  000x0 *VT0   @a J,0 @g"0 0 ? -82L8M ,00b@ 040 P#00E.U  0 S00S R40EQ7 Q  A1!O  4  4 P P 0O(,  p^#< a00 (KR P`800S80 o A1!O p p1  0^0 QQ \a00`Yp L1  0@!100 , 0 K 9 QP` /  0/V4A4 ,00 R2"40`S S  0P4Z`000,0 <0   Uja"00zp4 Z -L M4 0 0?O4K#$XY8  0OO$ !5BE;t  8a"0 0(Kr \B 1W2\ , ~  0   @P04K 4 0 0@aQP#o` P`0OO${p' YHZ0 Rr04K@4 0 , 4 00@G ,00|03P 1 0 Z@0\A04K@4 0 ,H!4004!8V V0 r/, 40 0 8B t4cQ4K 064 0  8\ _Y04K@ 4 0 40ds04K@ 4 0  ( -LMȠ0`p  (0 PPqK 1P 10( 0R$KUOK 9 SK9,KK9,KNK/`KP cK]0傎뜃@8 -LM@  K K0K  @@LPK -LMd`0@V,0  pܠK?PK@  T@060#0@@T Sb h  h *i  8@@D0\0#0@@T 7b  h h iT, 0R(KܠK "b@@K h hp` 뜃P -LhMD` VZ, P@ , 0Re(K0Cs P  VW 00p0 0  @x t l@ | TpK@PK|l <0 ( p@ t |x0  0pRZ h@K  0@B0D0  00#0Q Q V@1@# `V |  | d刍  0T0 P0 L0 H0 D0 h0 d0 `0 \0 X0 @0 <0 80 40 00 z꜃\R-A ^ QQ 0SL\* -LßMS 0@p8@ 040 < @ 0@ Z0,K00<僴PP3 ,QW 0U*@@0S 0S Pa ,@0SQ  E04 SA, QP 0 ST 8 `q`3R`V2 X 00Y00S! 80S  P 8@ R 8Y=   0R Y5   R0080 @\08(K00@P@ 0 , 0,08@ 0 `8eQ\,  IP,,A, \ W04@ T@0 Y@0 W 40 S Y@Q  R88@ l p-LM`0`@K KKK`K/ZPP +0 000KpD -0L: dYPD -$0LM KYPD -ML M⌢0划`,0 +PphRpP 0/Sf PKPj BNK@D@D+BNK@D@D+J^KPEPE D 0S :S S000S S:S  0SA0W0 0S /SHBK@@P 0T ]@PV00SV00S040 t, 0R=(K0P 0+Y:bP 0SPBNK@D@D+IP 0S BNK@D@Dt+:8ZPೱBNK@DD@D04  P: 始뜃DxIp P-L 3 c@pP 0S %S@ ß V *00SS@f| Tt0%0CMS ܴ ܴ ܴ ܴ ܴ 0 ܴ ܴ 8 ܴ ܴ ܴ < ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ж ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ | ܴ ܴ ܴ 0PUUwWx 2 Q PP U W1 PP U V*PpgWP Pm Ux cUh Vz*p!?A1c000 Vr*P!?A1c!000c000 Vd*!?2c!  000Pb`*`(P;/".000bPE4p P10/A!b000c"P&0 U0@@P@ V0*%00" U,0 R@EHRP8 T8gfffQ p-PL`( 00@ SP$.P1 *PP @PU 0B8 S8 7B@PڈP@Tp1  0B00@ S!0.PP00@ S 00@ S00EPX8Z8 L"-L@Ÿ  RP`@ j QuN:R^0Cʠ &   B b< 0`C46H&0/p0/Ơ@ Q a@ p Ђ0T/`P@^0SR S PP n B2c `@0 T/ 0:56!ǠP `Uv00p   0F 0P`10 Q 0 0P` -QąL@P$ML@ HP @PD SUp`=TKTA*T 006P%0\! 0aa9s&F2x'x )8HR@J*RJ@@b1P 8#8R0PE*RPE 0U0D L H0 RLK p(KT `V:4V006$0\0@f(&x80 2 *j 0j7C93&x40 < < 4@($8HR`y 008 0pp`= 0P-L7 -`EL MpS@`Hp D P>R[R0:4R005%0\, 0l\9c%>*x'x )8HR@J*RJ@@b)` 8#8R0`F*R`F 0SS:4\00< $ࠃࠓ0^,  VY0!#*0H D0 HK(KRPU:4U005|#0\@e(%x8 2 *Z 0j6C93%x40 < < (4!8HR<0@0C<0 :@b`48#8R`F:@b< h8`  )8HR@J*RJ@@b` 8#8R0`F*R`F80 S00<!ࠃ ࠓ0^, q ,0,p# 0c5'6C93( 00 j @ Vx@ 'x0!8H,0RS@@A@ >:@b R `>0p8#8R`F(:@ b.Ƞ%8 8"H 8R:,00T00S+ N0(U 006R 00R`FRA@@ R`F]R0C@<0 F갈R0@-@P l^0,00 nSBS\N_0 0- L@0@PᘒP $0W0R0A -@`p0 0V@TL  0@P 0 sP 0@0 <0@ `P @0`p?A -Q؅L@P,MT@ PP @PL S0 KUH `pJTzT:4T006X%0\, 0ll9s& < wX%X a)8HX@*X@@h e Q 8#88U0*U0H0eP < 31P T0 T0KL0PS0KUT P TK0 , L0S 0Kp0 , (KU:4U00<#ࠃࠓ0^ WY:Y pH R T Pp PT0KT`VW:4V006T#0\@f< (&x( <0A -OL@dUPO66d"*`"*-R 0R\ p-PPL @T0. @ p  @U *P/P /P BU:R  BU*0/S 0e` V*p@ 00p/P  BU:00/T/. @ T@?00꒠1 xB 02 #4xB 024=> 0&@-/@d4xB 02d @-M)Ѝ@4=> 0 S -L 0KM#' -LMK  KP K -LMK  KP K -QL M@ K0 0#0  # 0p03T0S00#0K -@@L0MP 0 0 D 03000 K( K P(KS00\888Z!* -RL p@@@pT `v%  P DP 0AS2 0SQ0S 0S .P 0S0 .SQ00Q0S 2 0S .PQ00áP00@-@T   0000S  0P0S  0 RR00ӡ? 2 -LMp0 S( @0 ( 0R$KP !ᥠZP2`P8@KE X`PED뜃 -PRL@`pP@ 00PPPPPP p- @0PSL`R p0S 00 ~  01 0 0pQ)03 0 00  F, *FP| xtplhd`\XTPLHD@<,\4lPD* M0-LM0 0 0@ Pu:K0\Q0@-P0@  % < ^9  $ @ \ x ^@7!10# ^00S10# ^00S3 @\^` 000  RE C ;@\00M00q 2  0  ^0^0@0C@0@000*^?^: :!20# ^00S  0D ^Sp 1  0~ ?^*^ #^[^\00!0 !@00 00 0000@@000[^#^ s @1  0y0\  @  0\  @  }\00 L0 R,0C@000ĕ@p0\  @  i0\  @  b0\  @  [0\  @  T0\  @  M0\  @  F0-  @@ p-0LQ`P @0 Qf`00p R-Lp`P@@D 0T 0G 000jR -LM8  Bp`4 -PK 0e@YX: \p`WGQ< L VJ*\Q  Q *Q?Q< [Q#Q9 q! X1  0 *10# Q00S10# Q00S @\Q @Y7@*20# Q00S  0A QSq 0  0  @80S00Y*<Q @-PK0 A0eS`40c(K@* -@LP <00蔨 p-LpMP@T b KpdKwr`P P L0  0: S MPO0 0F P ꔨ -AMLM0唣,0  Ur@P |_d`PW B^KPE PE` XsP 0#S 8 (  P @ @@P BnK`F`F0 P 0DT P 0 P04SBNK@D@D +D @P +PO B^KPE PE  qP 0#S   P@ P~  @1P Po BnK`F`F0 `季0DT`  PZ 0 P螣04SQ%`P& `P `|P `vP `pPX `q@P00, 0R(KT` <}뜃k0  0-L@P0PP 8P0蘨 0-L@P0PP #P0蘨 -80L R PP ꔨP@- ^ 0S^@0 S 0SS00@0DP0 괨 -QLM@<0 zR| P8  h0 p 0Q `pY:%o$<0P  0Q0` pY*0@0 0Q"0h 4 ,0 @ 4 080 R@4 0 R0PI@Y :&D! 0 R0P@Y*U p P8 @<0P  0 R0U p 800 R4, Y4 8 (KPN0 0@< PpPp< P@`* p-L`/NPP!p@ @ ^OP T  0RpN0S p*yy*QQ*vv* 0NW -0PLM 0 K0K0 [P  Kj*f*( ==Z*iiV* P-L `hWM00::E*))A*$ -0L MK , K0 0 0 P 0S$$$  K#*SS* -LM KPwt@* 0-@PL PU0. @ 0 @T *0P/S 0/S BT:R T*0RB/S T*0p/S0Pa U*T@ 000/U$0 @P AM@?00긨 -L M0 0_5 K -LDM`\`, 0 \ M/00@, 0R(K^PK2 1PZM@(000Qq J00A SGsP@g P!00@T8Q 00A S`V:/QQ@ .Q(%00A S"00A S  Z R r@g P!00@ TQr 00A SPL@00/@P00 PT@ 0@dK 诠d0S@| L@00w0XSxS Pr 00 D} V po Q( &q$ !000D  Q|!00ӑlAadPH0W02p0 `VI:00pQW`F/Qt Q@Z t 0h1 T'V00h!. 0T 0Q %{zv 0&0S SS 0h1P@@8e4 80$ 0 뜃0lX -LM 09U -LM0 -I 0-LM4P [[@[0[ P@tK0踬""]*jjY*++U* -L$Mp0`QP 0 " @@K0#" 00 P 0@0$0 @0 <0 80 40 00 ,0 (0 0RKAP `y뜃 -LMX0@K`P$0 p# ׺$ 0R Ky뜃 -MLMK@ , p p`PB@F XN 0QMOKHHV !+ gmpP#  ᚺV'0OPU`>K@ :K@ ph, 0R%(K U CmpP&K@ "KW@UVKAAp X4U0eʶW$Qy  ꜃  0-@MPL 00}K0 9iu - LMK0 @ @ pK..`* -p-LMP0U0  @ 0 ]0Q a0}`PU 0  Kp` 0Pd C ,K K$0K@( $@ P, PP 00̬C̴Dt77** * * p-LMP4K@1 K70! K,@ Kp`( P  K0 4KePa$K@ :W ` KTQv$Kp K x1(pX 000 P@ 00ӑP 00ӑX0 S000д p-`L^P%*00@ S!@ T  00@ S00S !000V0@CT  \00S p@ p@-0p@T` P 0 0  00a^0200C S  00C 00S 1>3 01 -L@ X 1:%\" \0PS0]S0phPU ` P0S PUW kf 0-L @\*0S:00[S.QPQ*0R0.S :06 \:00]S p-0LSP@p `P @ `p p p-0LS@`P\ 0  !p0P  -L M@ 0S-: @0 0 T4 `4\ Q| ?>   cP"T001 X   R!*0^SD ]S5 -S000 -00-0 -  R%*0]S PU-S [SY < PR*0-S& @ 000 T   R: 0Sk 4 0u 40@^Zq9  0#@TfJP0` t4 ]040 4@ @00 @(KoL-S G P0:S% =S0S0* 0-S]S =  000  R*0S*0=S  0S0*p0-S]S P r `ǟ00   r 00  PPg7@T ` fP0S? @T  R*0S*0:S  L0]S -00-0 -  S0҅>]S00:<, 2P  ,P  000(K0P  000   P`0S  @  eo0 `R P .@P@ P @ q mpZ hQ d 0-S]S* \& X R|*u P R,*%PPP 0!0P 0T ^001  ^0 f 040 >00  0 R (KoI & 000Y 4 Y& ^J 0@ @ 000`000^Z040 40 0 0  0 0C0 4 40^ @ 0@QT 4 0@2000  T, /*0,S  T R" ^w p0`P  00 2 0 00QP ^V 0 @R4   bB"(Kos 4 %00 ]00]0 ]   R !*0P0]S Q*-P0@0 @P#:T0]S000 0]Sq(P 000   PE v040 1H p-LM0K KP` 0 ^00K K0C B@0K K#P`x -LM0` @8P pw 0  0  0S04  4pP 0KP00K@ 0]0pK0K K@P -`RL@PpP  0!T000 p-L`\P p@  A$0S0$0L0U0L0 P  1 e! BW 0Ap -LP`@p0 S#T TW0 W000S4hg0f0c0  f00   fA  f" 8 B a  h.@0 fw  f#  f"  B a   @pG`@  f0R  fh-@DpG`s&@D`m -LMP\@, *0^S) `.U ^*U Q*0*S  ^\S $U`\?* RP%*P U5 \U $ 4U* 4Uy p>E0CS<0pC!`H0S   H   0H0^p0 0D4\U0 SP,0X [UG JU0D  D D` V1 0  i R *0Q0\S \) j V1 0H  R@R*0^0\S0)Sn Si3UbKa F\MXVR ;N 0 M J/  0 hb  h   h0V  h@70{S1 `R*0,Sa P 0`@QO* ^C0\S@0}S:= H  (00(000000,0XAo0)SX[  (00(0,00,0P0}S ^  R*0R\S ^  @Q*000C S\VP ){} - LMP,  ` R*@|T T  $0D XSa<$$L$8pL R*000C S  R*@*0D0?TS{T `| R :` VU RZ*0|SW0, 0R1  i00 aC80" 00 P (00(0 ,00,0  R*0D  D D@ T1 0  R*0)S ) T1 0H   R*0)S  x(00(0 00000up 0@ Gg R*00T]\g000C Sc^g+Tj 7*T  R`**0A0?QS{QN0\K000C SG A ` 0  fr  f   f0f  f?T= {T& @Q*0,S p 0s Rd:    000C S|Tp  +T   f0&  f 0  f  f  f/"  B a&  j  G 0  j 00 ,0 0}S00I0}S  \  R:, R (K0  a  i (Koo -0LMS@ `  PPa :P  0    P   (KP00   | @ 0KpK H 0S0\P@40  ( , 0 < @ D P `8H@ K00C 0 0R*K  0R: K8 0A $00S0 00 ) PP QP: (@#L D0 03 0Q  Rʠ    0S 00B\p0S?0 0S7 Q^`L0>#Re ]R R @0^@@R@P(@c P<@ @\ >3S R 0L00QP(@F40 00 4 Q 0眀MQ @00BaVP 0R 0R0\000XwR R RL>310>#R R "R (@@(@0>3S  S S 0>3S )R@(@5\ BK)6KK K 0R:K PP Ee -t0 LR  @T P0R000PtPqPn<PkhheE * * * -QL0 M4 0 0R000(K00* 4南PP- 0 P0S p`@P `@ P$ pW21C0 R4Q  000W |_PP(KY  0W0021C0 R 4 R 4 0W00< p- LP@P` x`P T,03040S000 R   R0 \00p * * * -LMpx`P 0SLXQ0LL!PP00P00@$K(K ]P (0 RP@Pʐ T,LP0SMR kR mR gRPAx,GR KR R P,L(P8PK,PF[ڴ@ Q E-p0 @  R`&@P0 L 0@B?AsP00 R00S 0/S9ST00T0S@gfff -LP( <3aL1aa Q -LMPR, `VP `ZpA  P p WVP,0p -SL M` -= =  , Q qg ͟0 a ,P0s 0 00  P,P r`QP=q@ 4=,-0S0v>C 0C0 000p4 0v^ Pj ,3`20!0Ǔj   0C\0 1 0\00 pp ` 0 K 0 0, %Q`p ,P0S,P (KWp%0AUS1111111111111111111111111111X44d7<7T76667111511115686P6t6P66p5L:111111X449::1|941999771881817819<9X9<3,~pʟP,P ~ 00 +0N, /S<h;<h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;h;$;h;h;h;h;h;h;h;h;h;h;h;h;h;4;h;h;h;h;;WU,P0p X 1 0@p P Ap ᶔP Q0 4W2,P0p  !0h@xp ᝔P 8@np ᓔP Q0  ,K0KH8P 0  8v.B B 000 ,K;0PW,0 ePP, s ,K =0PjW,0 ,K0K50P[,K0K 50PS0(, W,0,P P,P 000C S<,K 0P3,K 0P)W,0Wp  ,K0Kc0P 0010!00 ,K 0Pz 0C000Wp,P r şP,P r 00 W]%@,P ̓P/0 SM Pp,P WG,@0SA,K0K 0EP: 05 B`10`c000 ),K0.P# 0000ğ, ' ,KPc0P,K0K c0PW,K 44P 0C000WB WI 0 ,,K  0P x000d2,@ .PiP ,P X@#2`10!0U D1 V R`c Q P"? 2c10!0 c;Q0 0 0.0MS, ,P0TS,P DQd00N, P@0@K0pp",P p0P,0 ,P"pPq 0 0Xz 0P00,P Zp 0P00,P 00K!P00 0@E{EA!/0C!b10bcd0 B!a10b cR0 0+0 0P,P 0 Qw,P!000 A RPPn:Q{0,P @mp ᒒP0 S S 0P0,P ,0L CA0C0  RSP,P lQ|'$InTh0aj*f*uub*%^*% Y*G-Q M 0ࠑ@90PP@e1A 00 q$b%(?P @RJ: 02!!b?P J$0  ^0 @Z) 0 0 0 0 00 R0P P:02.2"!0Z  01%3 0 =00@T* 00 Ѝ =00ꫪ4 -LPp@Q qP D2  0=QM (b0P TPA8A$A@W8Q@T W@W @W@ X*0f1@0 Z0f A10# @  Zf0 A2"0 Z0 f00TAAB,B=QQ q 0  0s 0 0SW 0S Q q D0  0q 0 0PS40*,*  10BS)000C 00S 0 0S0 00Q:  -0L)S@P 010CS^ 00  ^:`pV`` W0S P`P```00 p-0L)S@ p010CS^ 00  ^:P`UV P pP 00p P  Q10C 0   Q-L@pRPPX`VP V T P `0 B  d00EPP00 Q-LPpR`@@* P 0S @V000 B  e00 0-PL @0 0-PL @0 -LR0L0@@PT@ lR0  0 R B0 0 D -LXpP`@@ R0D0TST0S: 0 TP` @UTW YPP Y I00 P0 0 0QQ00 A00  -PBRU`L@0R Vp Wp00j d00``p P j0@0@@b00P0PjQ0PE0P -pBRWL@`0R XP UP00j d00`@000 R0pp00P  " j0@@@b00uP0PjQ0PE0P"*bb* 0-LM 0@0 @PK0**0@-0PgS6 -S@ XS4 +S6 0oS6 uS= # @ @030 010 000 T 0301000gS80 400S 0 00 I@@-gQ@ oQ uQ =Q! /+Q -Q"\00  00  00 0 +T -T =T000`0R0- 0+\ 00XQ000000 -L$M@`T60 0(K4@K00K 00 R@P@ JP8 P00H S 8P p0P< 30D0 a0H@SX|SlPlPlPlPlPdSlPlPlPlPlPlPlPPSlPlPlPlPlP@ =X @ D0H0 @D 0X0C S񟗦,S\O\O\O\O\O\O\O\O\O\O\O\O\O\OQ\O\O\O\O\O\O\OQ\O\OQ|QPQQ\OQDQI@D0S 0 Ď@D D R  @꒠@I@Z W:<  ₑ < `Po 0e0 F pP8 0D p=X @ " H+X00\0S W:<  ₑ < ``PI 0e0 F pP8D H0X pH W:<00⃑ <0 E`P. 0e0 F pP8D 0w@p_I @H [D '-D DD D0C>0D0 DΌD `   ,KV#,0P R>0SK l5"0 0`0+S -SXS S P0`+S0 -S0   +S0   XS00P^ -0 0 `Q +0 0 `\ X0 0 ` W@1 :`@Ppv C808 =0 08g50 01 -L8M4\( p& < R R S @9WP  ( 0R'$KR Z@K2 |PU`@ PU PZ@K024 QZ@K2 K@b뜃lH99.* R  #R , R R R  R "R, \\R0 0 R00A0"S0 0D0  0 S S S0 0 0Aܵ -,@LP -00 -4@LP FJPH - TL0S D ZVP  ,P q 3  00 qQ#Q cs0 0n0@S0000 0PU L aP q 3  0 00 0y OP q 2  0 00 0g =P q 2  0 00 0U +P q H2  0 00 0C< P q 2  0 00 01 P q 1  0 00 0 P q p1  0 0 0 0 p P =Q yPP@Um0#S+ #U) @0PS0 cP  000 0 R r 00CS0 Q#Q 0P  0 S S 0@S0+ @(ĵܵhT(7\dl 0-LP@P %P0 -LKM䡟0TK(0 p@P4K@P/0j VXW"( 0RV$Kx fl 0@mPP 0l Kh0 0d `0 l` 0dK\ K @P X 0GR8"2 *@P +VP 0R 0GR -SKTPP L1R H1RO)K)G),`\꜃lt 0-TLPA/H0P@ @A/kPP02@P* |8!!* --LM0 0 -H0@L`P8 4啈T   嘈beC\\*;;* @-LP7aaaa4a4a4aaaaaaaPa4aaaa4a4a4aaaaaaa4ahaa4aR0 0" ؾ lҾ X̾ 2 00,   os* --LM00  K p-L@P1X0` PPT  4吽4 0'b phC _ p-0LM@P0 ) 0S& =S$ 0 S =S00SRPd`K P X0 ! 0S0 P x1 00x1 -LM0@=SS00S $  0=SS00SP$Pd$`K P! q$0 A$  ~P $0 1 0S0 pP B10 0p R`  0S0a`LPP  0(pS PP@0 0 1 -0L M`Pp,0 P" 0S =S 0 S =S00SR@fP, K PH ,0U00PK00  00 0(K P 00 1 0S0 PP,@P 1 ,0Q! =Q =S 0S0=000S0 ꐀ R4   0S0aC140 P -PP < 0S  0P P4 ,  1 -L@$y@P0 @s -pLPf@Tx` $*P00 @ƥT R<T",PT0 H贿 0-`L! 0T<P>0!@PP@T 000P00* *- 0-Y+ ̌!00@  0 --LM0 0 -L@Pp/\0` TT3T  8崻8 $0 K`  "bC _ -LM0  K ?0-Pp1@ LR` 0S .P P@ |0S@D0Sޢ00Z0 70, ?0-Pp1@ LR` 0S TP P@ D0S@D0SW00Z0 D@0]]*Q  ;8??*IϠ$*E-M00L SJ20\ p` P0 @ 00L @  S4$ 00L @ UQ | 0D A0a00cB.\! 0W @00L S0\p PX\x\PPT*0S R<8@%Ѝ\ Q| 0 0hC10Sm@nln|mnT0SQ R<84@Z,<$!$$, T*0SL -LMKnP@0 ! -LMşR!  ,   e! e 0@A0!S1S UK  xş@K0 K0 X0 T0 P0 H0 D0 @0 <0 80 40 00 0 0 |0 t0 p0 l0 h0 d0 `0 \0 0 x L  K K,K  K K K K~ KzQX0K1   @0PC⅀K  bPPp0[ Q- Q+ T*00K[q 3  0  Q#00ӑK[ Q #00 ӑ K[  1PPp 00.L0l XKK, 㙛PHK &K "K K K K K K  K Y=P@@!T 1S *7T04@P!TU!X}w Q (Ÿ, 0 R(K  Kp-0SX0S 2p !RK  v X K!  ?0KK1 厑PXK L00L0 60[X KS060KI0@K0 1 K0 0  K K,K  K K{ Kw Ks KoI-~F-0 A 0{A-0  0u [뜃nXC 0tD p-L0M`0@0 P HK@00@0 H KQ Q Q -00 0R Kp0 $>[뜃t,t,t,: Sb00 ^ Sl00  Ss00  Sv ?00 r0-000w0-000!=@Sx00 > SS00 ! SS r0-0t!00w0-0 00Rx00 # RS00 ,1R8 r0-0!00w0-0 00Rx00 - RT00 0R 0 0 R-00S-00 Sc00  Sd00  Sp00t00 00 s00s00R-00 00 -00 -LM Q00    K  Kdd*KK**oo* *zz*R0S 0S0S0  R00ZZ*GϠ*''* -0CLMs,0 @ Q* 1 RPIf 0R) 10CR 0YS!Z0s3(KZ 0S  T1R@Z TK  ,0PD0PSpYW P0`U00S00 P0@U 0U 0R W`P0@U00VW:0S`#@ P0 S@T 10P`@0YS?*!]:-0P P000P R* -`LP p0W 1@PPP@żU00Q R @1@S  R᭼00 -LM`qpP r 0@r   t00 ( pDW PAbRP P  0  R 0S 0{ U@R s00P=  t!, Pc 0Sa 0 0 0S0 g@00PP  dPk0 0Q 0@0A   0, 0STU /0 0 ,\P% 0S4 U, 0p 0  R=*@0p@P  00p  001 0  g0S S1J0 R0(Z0 0Q0S S1J0 R0)Z* @mٻ ix*0 0d -ML M,  @  pT2 /T ` 0 @C@T/TPP  0 W*Plğ, 0R(KRs/T ` 0 W:/@/T W: 0@ 0  0 S00:!*P/@@BNK@D@D+PA 0@ ^KPEPE(P5 0 0Z/S 8: S S 000 0(PNK@D@D+bP( 0S B^KPEPE+VP@)P 0PZ~P)P0SNK@D@DD+ヶ 0@x $ Q 0P@ 2( 8 P. 0  0 S00b* .R2 Z4* @R  W.0S0T(*  @0lP  D0@ PP 0@6 $ W^KPEPE_0.S @P+P^ 0@" ,PU8: SQ0S /0 0IP|  :)P0/00NK꜃<, -LM M:K0P~UK4  >KK0C*K080K₎KU, @H ?U@B [U4 *U00! PU5P(K R*K, Q 0 ` I0*K, 0b5 8 (K*K 08 <R 0 XX5R P50PP!U00S !U[ @DP 0%< 0 P`].P 4!Up0:0C0Pp00-S@= ]SH P`[U8#80@0:S0@ : P 0]SPğ0i@T 8Q:0 RR0SF @T 0 8#8000 @-S@]Q 3 00p]S@ 0#< 0 PUKLK*KA KKA(@4 0 Pa*K, QJ 0y :KK0 4 0Q"0a1 0 0P[Up`^0:S  0  nK`F0F[*KV8`@*0S /S  *K/S 0 R@ 0S00 R P* ̝P*K0 PUP" U R^ 0*K S C  0R0S0 U L1 (KP\/PK0P ]U@Mb< S *K, 0pb@P@ W(Q@00 \  0 0 0P@P  00**?[-]:I -LM0@{SB {P T႞KI p KI0pPC0 P\ @ `{Q` }Q Q [Q]QQ 0  0]SSS@Q  (KV `F0}S0SU0[\ 7,\ T:P[\0]SS   0]SSST0*VU  S:0S0 wP  000{\ }\V`F` -ML M@,K`pPMS P K0 000  <R 0p Qr q 10bQ KK @ @ 0 S L \S0N @9R8#HA@L.0K^: X0 Q  R00   G\@ro80 R00CS000}~~ RR*R0S0  RR B0 0Q0 0Q*__*VL*A*//*aa*P0  -$0L! 0-$@LPdPa$_P\0hY p-LM$`0PK@.0.qpP pP 84,00SKp,0$ -L8M$@ 0PR 0`00\pK@` 0` 0DKp 2P 0 \0 2X00S$K,K,0D0 \` X0 2P  -LMpPW $K$`3S Sh 3S\ S S WS= S S S00> QS0PW @ SO V&Sv S1X 0PS DS S>400 2Qa A0B !>3 S >3 !>3 SQ!1XX 0PX >320  0P0PS "S>0!># R0\PSu0S qXn 0PQ>30Q,  0P,  0,0 ES @J`@` 0P  T00S0 R@ 0 \ (K>3!>3 S,  0`,  0,0 FS0H P0>3@ P 1>3 @!>#"R@D0  @V 0 @_ywQ& .Qr,  0@,  0},0 DSP`J  0`qP 0 `4N 0>#" 0c OEQ QA 0>#" 0c O0 @6G-Q` $P @>3 S Sw 1S S S @XSO <S S S0>#00 00@0S0   @XS xS S 0>00l0 S00Sl@@ S G&Sr S1Z0   @\ p!>3 S >3 !>3 S 0@00Z >320  0   @!1ZZv0   @"Sl 0>00 1>3 S`  00@0Sv @USQ0 S @MZI0   @h80Z @=3S`" Sb JSl >3Sc Sq S S `(KS{ S0^zQ>3S V >320  `0^d&SC S0S00S* Vr 0_R0^JS S V `0Sz 0 S0 0^30S0 0S0V S V 0R` RQ Q0V SG R* Vr 0_R V* r!>3!>3 S0^~S S; Sj @>32@d00 _ 0 0 .P `RP R r 0H_RsE00 090^B0^>30 @C  1>3 S% 1>3@!>#"R@D 0  @P `0 V0C 0 >3 a 0c  P A> 28 0qH D c @ < H  R4 V 4 0lS:@   ᒍP80P 1 0P 4 @>32@d,0 _ @ P 0 PU0,`0  0pPA>3q 10 `g 0dS0 0r~00`0y` Vuu -L,Mp P@6Q >3S`" Sb JSl >3Sc Sq S S `(KS{ S0^zQ>3S V >320  `0^d&SC S0S00S* Vr 0_R0^JS S V `0Sz 0 S0 0^30S0 0S0V S V 0R` RQ Q0V SG R* Vr 0_R V* r!>3!>3 S0^~S S; Sj @>32@d00 _ 0 0 .P `RP R r 0H_RsE00 090^B0^>30 @C  1>3 S% 1>3@!>#"R@D 0  @P `0 V0C 0 >3 a 0c  P A> 28 0qH D c @ < H  R4 V 4 0lS:@   ߋP80P 1 0P 4 @>32@d,0 _ @ P 0 PU0,`0  0pPA>3q 10 `g 0dS0 0r~00`0y` Vuu -LM`< 004 (@40 0P8 Q p0 0 AϠ0 @0 S0 0,, ,0  XPy  X| , p R@ ,0 S T  0  Ppm@TP2W  X* x| p00 00_X00So 000_X0S 2WX ,0 S sS 0 , 00_R00SHA?G0CSE@ 00S 80 < ZP]  4з0 8˷, 40 P0 S,0,, ,0  XP00, ,@ Rp0 0 0Wpp@vp 0  PpP,  R r h  0, 00_R0P Sp X x $v0O0(K -LMp S, WQU Q0 Q Q Q Q  \A0A >Q>30Q,  0P,  0,0 ES @J`@` 0P  T00S0 R@ 0 \ (K>3!>3 S,  0`,  0,0 FS0H P0>3@ P 1>3 @!>#"R@D0  @wV 0 @_ywQ& .Qr,  0_@,  0W,0 DSP`J  0`KP 0 `4N 0>#" 0c OEQ QA 0>#" 0c O0 @6 -LM 40 \  ?R(00 Sp 0 000 $   0  X 00 00_W00S1 000_W0S 8U  Y y 0  00_Y00SA?E0CS <80^  R@ 0t`  ` p(K x0`  `p`d \ |   0'00_\0Sp Y y  0 l0l't7Wpp@0 ,@8w\0\0hH 0S x P H0S `KH0H0   0PP ^u X0S `0D R X" 0@0 @`0D PH0S\0  LPD0S H  0dH E U 0 \PP 0 R HMP P( TH0`0`O/\ `PX`^  D0"P0@0@0@X`VΪDP˪<ɪ" ẵ urD L0SPX嵪 H  R @T 0`   Y y   0#00_Y0SP W w ` 0 00@#3UPP` 0 ,@lS~\0y` \0z` lSH  v ^H0S `KH0H0  0 PP Q X0S `0D R X" 0@0 @`0D PH0SV LPD0Sp H  0*H E U 0 dPP 0 [ HP R8 TH0`0`O/\ +`PXp^  D0"P0@0@0@ ۴ ` \0  H 0XXpWԩDP+)H0STH0X``0`O/ H Q ` H0SaTH0Xp`0`O/  H 0EeE`0DGP`X M<卩 <D L0SaP_X@O`0D+PpX # XoDm<kXgDe@0`0 R T`0 CR` X0 X0(np0R RXn ,H`0 CR` X0 X0p0R RXn,U*E-,1M p 0R  ``XRxR `R,! B00BP@ S0A Vr 0D A0a00c BR,! 00BP@0jC R17 1RЍ.R0X r 0 -pa`LP @s`P` 0`jP0i~V1P Uj!0\1 X -LMßß8 < 4 =@0 `2P j @Ty Pp0 ,P P2@pT&  ~PpP2  0R0X0S00s0P  0 20RE P2, @pT, R 2 Rt2 ? (K<0:S  H0P 0p, 2@ YR00S5 1 R <0:S  0S 11   < 0:S:? 0R 0R RRd1 R < 0:S Pd o0BS-R @0S0 R 0 00 R0 R <0:S @0S 00   0<0C0 :R:?Q l0 R48L 10  4 0L0g<L8@<`8 -LMR4 , 0 80  F0S0000s %0S40 -R 0S+R 5 0R0%0C00%5  huPu` X@t  00  e00b 0 000%0S0 R#, `4V ^0 4A@-QPpU4P @t $0s`U p$-Up 80Sc T 01S\ -Q W :Qs 4影Pn 048 0mpPF 3#0 40P -Rt44 u+Rr44 n-U30S5P(KPsP3PLu0 0 @00#@d00d00P00"0P@0Ђ0s02`p@P:U@30S0002 R 40:S |t2P?P0Su0r0"P,2u a  000 d0b01 r-U0S4%P 8 0R0WU0S0 0;S7 :S 0S000|H00 R@!0:S 0, 0R0 1! 1Q  40:S 0P40 :R:P?PV0 100 0 0L0S0,0Q0 |0l  Q 4 0:S010048 0yP <Pd8`8HD[L8@ -LM@@ZK -LM@@OK -LM 0D K*7*7tt* *$$*6*6PP**33*##*- 0L0 0 0 0 0 0 0 0 0 0 0 0 0 0 0  0\0 * -`L pPIwP%P 0Q @Q PX P @TP k@ - L0 0PLh8 -pL P@ 8`P0SX P @TP k@ - L0 0P\h8 0-PLP k00@@@ @@0h8 -LM0PS ,K,i@P ,Q 0#S S 0i@P $K0 S RA,  #wP0d,0 ,`P , ,0pp'P @p0 S S0 S S '`P 00(K 1(0S ?R0SP("(04"48@#80 @PB `8l'P7 @00T2 P.@]'P( 00@T# P P P@ 0@!0SᩨP 000  b `lliP0^q0 0n ,P@. @_dT -L70Ph8l 0-0LS@P 5% 00 00h 00 00Th8 0-LM@KPUdPPPQ R 0S0S g:d@@84dP@@8 --L]MqPM?KC/`KK `1 4Q 0Q @Q0 K 0KቩP   0 K|1 1 8 喕p@ 1PP 0RKP 01 00O@ 00@뜃Bh --LM00  K 0-@0@LP 00jhT    0hlhC -LM0`0  P@t 0-T^ +T0@,0 ,  v 3V00S 0TS R0p00D S t, (!000& W070 cV \Q00R00S!! "00@0T  Ѫ p㽪 `,0\00S00aS \0E(K@ , 0XSxS@P `r0P0T4@T0|@T -LM0  @T p-LM@K`P90 xt --LM0 0 K -LM@KPTK 0-L@Pp Pp T U 0㚾0X p@   T09 @b2b 9p0p*{{*0$0 -0LL0 -Q Q Q0  0  00  0-@L0PS P00SL 0h -LDMP pħP d`Pd p 0S, R00U@ @@0K LP` 00 X T P \@ [`K7[P0S Wޡܡ0d0 *0  W@P04,"40ˡdɡd@ P0P H0S00A0@!1HuZP! d(K &\P P00  0@Up 00100@ 00*00d@ 00#00p 000@08p 000d 0 t$9 -LTMp \ 0Qt x0 | 0d@ `0 0 @ L`Ro  l 0h0 $ L |00C,̠Č| 0("ČP@|H # P] P0\KPV p0  0PM xt PF lPN l0SO `Pd RA 0A尡L0LPK0<0 8 B XpKP ZP$P (KX0Y$Y$P) h00Csh0 p  0 P$`0SdPl $0S0$0$0$00$0p0 0P0 $0(  H0S 0L0_Z$ P$0S0$09\ -RLp`PU Qp@`P`. 0$0(  -LMpRP(K !31C0Ϡ @l1@8K00 2K}@K 0K` r4 <08R@0= Bc 0 B ABS=ɌBa!@B ͌B31C0/A#b1@TV0p$0V v  0p@ P06 p$0( 2[   000S 0p($0 00 0$0( pMb@@2* R-$L  00 P-L @T p-@LTP 0@T@80Sܟ$0``PPҟПΟvP (Pi@;e@p -$0L@@LP`ph0P@  @0(`004$0H000D0H ᯨ 0- L<R@ P㏟00.?0 00庣PPP P} P -LpM$0@0PKDP  +0P0  P# P 0  P00K P 00p © 0 p`P 0`pH00.S, 040I0S H040. S  80S  80S,0Q00P0 00 p-LpM$P@PR`"KTPP T@ @Kp0 0R P00, 0RMPa `PP -0LS@P`#V0 P 0U`   L0\01000(pPpP㫞pp -L0M X P `|P X0SZ $ 0S X 0R  T <0 8 @ P 0iP30$D @0 P0$00 S/RL 0/  0 P 08yZH , b , phL H 4 _0PP3 $0 0.S  @P W8  00X$0D0Sv < R 03D  03 P 00,0 S00L ,@ @H0L@ 0H0 +0PP h40S  R H0Q00c 00 R,  Q00c 000S0 80HS$0 0H RS000C00 0 00@0S X H0SR H0S 0H SR,(KP0 4 00 R< X @@R  0@0 D0 0T 80 N  8 ><0SI 8 R P PA$0H00c ;< R{0@8PS B< tp P R $0 00  40 4 08 ph 00X$0J፝, P0 #$0 :, $0" ?00$00H00 03> 0S 040. S  @P P,i P0 #$0 :, $0 Pp0( 0 0HyT ,P 303 D $@ @ < $D T P 80S$$0BP> P 03$0 :, $0=,(Ko: P 00T R0,0 - PP0 P0P X0SP 03 P 0, 0,0 P0 #ꐐ -`Q00 V@@TLP 00p @$0 C T T P V$0@:$080S0 /R $0` P ݺpP P!< 0-0LSP@ Ꭷ0T@1S00 -`LVp$0*-0Q4X Q#( R> 0`VR t80Se 4S S 0$  0R/S@/00(  Hx`$0  `# 0B8S P$0 iP 303Q $@O 0 0RK 3P 103P80s 0$ `8QC$0 0`S003P$0@eP( H$  ;x/m=P XW @P ,x(P00 00 `\P  % :$00P| `e34 $0 )PX = FP6 04N 0P T 3 03 P 0  Q nI0S  0xP} $0P:$0Pt $0 ᨹP 303$0`:$0s `` @ @$0P:$0 0 #0 0 #0< -0LM@p` 00 00(K(PP0P  0P `00$@0 0$0 P aPW hPO 080@T . AT%  P5 R@PH 2 080 $  P03VY`, @, ,@ ATVX# ,P  03$0 X ߚ 00 ך՚Ӛ 0 *   P$00$0[< -PL0@S0( 00Cp0嬚 媚0Sᥚh,,`0S }  -LpMpK`P 0: S % 0P0$KP@-P PlL0@0"P  0 ( `(0@`( 0 `0`0@,``$` , pQP 0-LPp"  00R00S 0㟻p  @P  0@ 000q@0 0-LCp@P  PP 00 -L,M, P ,"pT0 0 rpP W ZD oP,@P0PC$@,P(P@Z%,`)T0PcT0P`@DQ,0, 00 ,,嗊(8 H @@ 8@ PTu*Y H,j 0lS0P`S& DQc,X 0\0 0h@dgQ!Q D\a= 0Q0 W:WF*@`d,` ,P  P0ZD0 , ) R@100*, Tg`g $ 00 `, 0R*@PT0PDP DQj 0P0 `, 0R:  0gY@(K,T0Pg`g " 00 g `0S @t:,T P0D\ DQI 0\0 DQOH0@8 H 00 HH @@ CDP,Ř 0P0 .DP @08@ 0 0 @gDQ 0Q0 0 0P0 0 0Q0  T0,3DQHł 0P0 P,1 T  `,0PL0 T P0i<0 T P T PL0i0c40 T PT PPT0PT PPT PP@0,0, 0P 0 ! 0^0 #,0, 0\ 0 T P`h0H0H 0Q 0 $P, 80)) S@10*,0Tg`g $ 00 `,0Q*@PT PD\ DP 0P0 `,0Q:  0gY@0 0P0 0 0P0 tT P\4T04PPST P(,T0,`P`T P)<T0<@P@ 4T 4PP)<T <@P@ ,T ,`P`11* M0-LM0 0 0@ PYK0 p-LM`PQ @Q ]P0fCKp000C S0 Z -L(Mğ PK<KP0 L@ Pe/h`< @ 0S0  @ 0|S :S 4 R@ :00$$<: <P#DKX00X0< ZpD0ß<(0 <QD0ß00 <JD0dß,0 <CD0Hß<l@ K40P@Tv3 D<1p3D00 ,0Ÿ  80<%2p8 40D0Ÿ<0 <pD0Ÿ:0 <pD0xŸ:+K0 4 .K0 1K, 4K(| 7K$ hb'aP`@HK<  6PK3PK0PK-PK*PKp00% D04K <0H0<1K 0p H@T<<7K p3 H0[S0F <7K@ K)P@F@0PqU``0D p 8ޑdQ0@ < *@K0pH @ 5T P(1<00a(K00F<.K PpHpF { @@xA@F`< ypD080#80;@ |qx0< WEV 0 (@-@T' :T@0@S S S 0S@ S@^ :R ^0@S :R^:^-^  0R R0:S|S S |S 0R:SS  0-LP# P! 0\ @ >.00La L Q A0LRW0LQ70LT0X\x\@@0 -Lp= @P@dBP`d 0@:SS   P0PfdⱙP `d P@f ᤙP` D`V b -Lp= E@P@dP`dP 0:SSo ^S \S0@ PUPfduPl `dP0S:SX 00@\:\O 0L0S 0/R@ 7R 0 B1/P07P0 @10@0B0L@2SD8,PD 8,PD 00U@f  P`VD`0T0 00} 00z 00w:00t00q 00n00kᯔ -8@LP [000 0$  0-@PLpPP㎔d0@@0}LP00740P (0@ @劝00 -MLM@d  ^, ` h8 l p( @0S`WP lmPm  P 0pS LH T hL(Q\(  h T80T8 X 傎KHH`YP 0 S 0Z@PY+h8YP `0 SU0U@E\S 00 HX #RR l#Pp^ 0:SP P0:S0@0p៞P@ P( = @Pr P0S :SP:0C0EK0@ @A\(h8@c`P vV v:0P E0E 4 0S :S00i c 00 4  S`D:R:0 00H0f c a0 X0;0g@ۗP H0g gg0 0H( `pPH @ eo40(o ዓHDH ;PgᷗP: 0g@pPPX(RhYH8dg S0A0:P`@^@pß, 0R(K3 Rfh(02@X8S\T 0h8 0L0SL JT(R@@WAX\K@ 00BNK@D@D"j P)*2 R% h 0ExP l^K< PE@8 PE @D 0 p& P$ D0Sh@8 0C<( 88 L WPh TT X hgYhV@h`Y@ 00TT a ⓘ0P  p000\H H8 X Ph H/X\!ƒ@ZÒ@WWX(R2 ṒZ@ 00JPp@Wn ᫒kᨒ@DQ? `P0`?SP``L0@p go艑@pb@ ᄑ {?0YP@p s?0Y@P0 -L M⼀0`P$0 ,pK  !62 b1 R<0Q0^ph ~?@ Q R $ 0R K %뜃(  0-PL@U 1  !1P\ 0h耒0<<3*(-*=)*=G$*G 0Q0   -RLMPpkܑ0SaW0 P @0P ׇ0000 R r0 11@```CNX@' ,K0 KXW@,p. Z, ,0WKX@0@p0  g00 p0S&X(K,0W`'0C0 0 00S >P` Z@假?R0S` p$` 9-  S 0S@nhh*$%%}* p-LMa0PS-@T 0S00S @ R0S)xT! 00@0SM`K pP 0S xD x( @00 L, p-LM, 0( rSwS@T 0@0Kp 㦌 0S $K0P2 RRpPB P#1@T 0O@T 1 R , 0rSU ?$P[(0!㺢d1 R6, 0rS8 , -N@$%0(a@ P0S00  0 R$ @㔆u Pq  000Q0 g d a $M@  @$T $bi L(, -0L 1 -BML Mß0P,0 T$  0S 00ß, 0R(K/ҐPP0P4 L 04  T$L00C=SX V V V V VW V V V VW V V V V V VXX V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V VXX R  1!S  b-1A L401!0T$%BNK@D@DP  ᷐p0 SP&1KH4 1D A  @d < 84 4 BXK`P 0SDa BNK@D@DPQ ; 00UBNK@D@D }(0K@/04L  t(K 04BP"0S<8w0@P@j00 c-!!R0$ 0  πBKA@@DAPT L 4H" 00꜃(LX<<(o,0 1 -0-LMP0 S  @     0S0! b-1 00   0S0 0  Q 0RK0! 00꜃4 --LM@0 S       0S0! b-1! 00   0S0   0S000 * 0RK!g 00꜃< -0-LMP0 S  @     0S0! b-1! 00   0S0 0  QL0  0RK0h! 00꜃1D0l --LM0  0 ~ K 0-LM@P?PK0 AP ?P  ?P $@ 0@P\ -LRp` @PU  PP@ -L@pPu?P `V0S p ṋVU Vp @0pP00@V00S P0S00@T TpV ᕉPP  L 0Rpl` `      P0 p-LMP` P P |P0l ֍`0 0 Kp@"4P0( @Í@$9P  -Lh -L  hNH_ 0-LM0@ K Q0!唍p@\ Pڔ!劍|K0@\` 0S-lblblbbblbDbblbDblblblblblblblblb0!hpP,؍P'"0 WpP0  Jp0 P0 R@` p01S ` 6pT0< -pTPdKU,Tt` -Lrh p-LM Pˍ|` 0 S 0K,0 ( $ 0 R r 1S0C1,KQ0@SKp  -LIM0 P$0  0SQKO_K`FNK@D "@ᐍ gl0! %$ 0R  KD! ~,0 MoKK_KQK@ <1 8! h뜃 H-0 S 0Q S0 Q(,0^ 0a(00 0Q<@\ 0-L 0Q0l0CP< (4"4!<0 @@b T 0 0 0@-Q @0S 00@  0S* n B!< 4!4"<0 0 0  0- @P  0SL 0  <4("4!<000 0P 0 0 0-@0LS@ 0, $ 0 P bp 0,0(P0 p-PQL@U  0(0PbU (,0`SPppcP0à - @LDP`Up$P  bLP"W000H$P1 H04 X0T  cP@ X0T PX> 00࠱PP L0 R0L00P ࠑ0H<,$!$ H \ QT0PR<0TPU$ᏅP $(0lH0 (0, P$8`ᩅP, 6<PᡅP$, 0 @0 X 0,`H 00`(40L P,0 D P @ T ``0 (KoN @08No 0{No4P 0- @LP 0 p 0S S 0 00b0q( ,00bc0 p-L@` Pp 0fS  0 `P0P3 5: pS0( P,0 `R$0R0` #00%( %*P 00X -(0LSP< 0S2VO0 ! P` 00/`VpP <0O`Vp0S R 00cO`p 0(p`p 0fq 00`p0  -LQڪ W00 p - L@<0 R0`000000  0-HPL0@S0`0000`00 R 0h  -LMPD \l (Q  &0SfXF X X7 `p@R, 50 S g5QR ;0NPK0@p 0P @0P ~0000 0@8 0@0S E0S0 0(KtN0  P` 0S  0bO`p0K0@0 @ @008CJKⒽP0: S0P ;L 0XoKT  P`0 0`VpS < 0O `Vp08  c0 0@P@ 60# Q0`ʜ ` 0@0@ Tmj L00cO` p  0@p 0@0P @0P }0@0@Y 00Ÿ0Sd + j00/`VpP <0 O`Vpr XKP&`K K q* Ÿ0SK D X00SG <@0@ 0 @p`p" 04# S@ 0` c00 P @0P }000 0D0 R lNq0S  Pa_ 00   a0@ P0 Bq_ 0@p`pq ADP T0 d00 S0 0t= \0/`P  0S SL E* -2MLM|$@0TP,0  <S   0/Sk @P B.K B B, + Wx X030#` V0#ScVH < VD / {P< PP#@aTQ~KpGpG (K0YC`d   Y,@B0 /S ,3X5/00,8[S XP SPP0XP /,0VbPX A0/S/0C0@0@0S_`, 0 R{(K%?00,R,  {|0<  +#rPKAA 2PPh<: S Qk®KJJ  ;pP( K`\F,<[/SD XP /P0aY 00p꜃<p 0-@P00QPLTP  p 0z@00 ㆁP @P{@*||* --LM0 0 j K 0-L M0KK 0PS܀Ԁ̀܀@ AK09"000@@@ 0$0%K\ -LM< |<0D @  Pu 0-U +U 0P8 80 D@ t 3T00S 0U RUD0 ?4 00 8 RX 4 K W4 K `ㆎV0D0@`c`f,` `p 0E Qࠑ uz \B000t W070cDPmR8Q4 YNK V0_ , ^00SD041 ,/@`p`Vp P0U8  @@RD@ 4 0 4 K 4 K , - W# 8 V0& ,@^00S0040 ` `Pp Xw"00P`q Vm"00P`q W0 W0@Q RJ< <0@ 0(KP8 ?0XSxSEP D 4 0 C -L@)T`p@P  @00#:k0cS:UV@ 0p`p -LxM`OP0 U80   0@D0 @@ 4 40 -SX갆HHHHHHT؈p@`PM  | EPeP Y|0x@0`V ptp 4 @T400t`VDK(K@0D`t` 00Spxp | /Q9Qp@`9Qʇ!000T0pCچ!000T0`C@4 /QP R 0S J0SG0 RT4 | t 0@ Q  |040|0 R" |0S  P 0BSpچ0R`|PU 0A R;ʇ!00 p0|0 04 0t0 4 0Sn 00Spxp 0XS xS 04 00S S_  x r4 @t@ |x 0 N 44 0+Q -Q,A    00@ S4 20P404 0P 10@S%40P@p p 4 /P 04 0@!00/PP9PpL*0aUS RaY T @l@ P Ē Z@PD@ @P D:H A xo@PᲒ 0mD @ YQP` 0j@T 9 DK]oD @ 07 MSp`p dp \p Xp )0@ D0 `\ 8(d(\(`(X(|"00 4 s&Pƒ~P` ẃ (tP᳃x8L d8 0%P` d \ X  X \ ` (Pd `0  ! ⭁DK, K00K)P8 W*P\ P@, TP`PPf00ࠡ࠱Rbp t B gR 6cT PbP @0"00C`T0 T @0` @T00 S 0S p pc@c`cU \a*P\ c 8)PP_ 8d(8P T8Y)P8 T XdJ*Pd L VdI)Pd D W\A)P\ < d8(PX 6 0 0\'PK X\;% 1@P7'PKYe u` l h @5 Z 0Q0jZ0S lKx%x5'P lK詏P l h Y l0K`pk6pjDKt 0Dn 0DKlD @ P@`\050Zp 8'd'\'X' 4&nl h Ylph@@PQ"P`p 4l`p@D0SH@ 46SE 3&PA44 ml h l`A0`p | ]I0@%Sft<t<S@  2r` l h0 I0P|@  |@ 04 |00P0|0 10@S 4|0@ | w\2 l h0 BCbVD@K0@1 ` m@PVD@ @P @05&C@ ! DKtmD @ @"1 R6CR0!0 5&0C@@ D0 @ @ ?4@K#P 40 (R D @ 4@KL#P 40C44 #P40\!04 @ D0 Qt80K4K< K2!0S@t 4  S S 8 RL`K L`K#8&0DK<  PP\ ~\cʄ0 DK mD @ TNP?A|&|?5?55|P9?p5&HDK@PD`K@ ` p  0l 0DK\kD @ @h0 0S56@0 0pW @0 0D0 lKye-f 0lK/kY@PD0S46S !(1p%Pu8\&dZ&\X&`V&XT&h!h1^%P|!p1D$P\l`hp0A;h@d 1 DKkD @ DBZ T30j0T0 DPK`2 @ hlP`TDP @` `V @820#:kcQ Q4Q0 AD0 0"7&@ @ DK 0P&p`p dp \p Xp 0@D0 @@ Ry|nY| @#46S TpW  Y DKD@K0 0jD @ 8%d%\%`%X%Q #0 0 K DKlD @ 3@ 0S}YD0S@ 46S30kSX 0S0SX&0PX0 \A%P@ ڌ`V L40kS7S8%d%\%`%X}%Y0ц!0М `0| |0 տD0l0 h@ D0@ 46SD0SPiP0Q; E DKkP e kD @ D0y jP0s$|DKL #jD @ DKD@K0} 0i @P0D@ @P P2 XL K6#PH0$L0&@ D0 @DT (60jS#:k0c&B# P)X6Q `60&0@ D0 2|606C#**0@ D0 )D0 1D0 p 0-P0@LS ꄜ`<0000 0100]"000 00 1 000 0  010000 00100C.0 6:0 0100 -RtL$M@K@P`p0D 0@ K,@K$0K4P @P$ 0 K T00 5CS0cC*R7S0BS c020 -LM< p ?4 00 q4 K , P` 00D S t= 0007 W070c Z1R V" U0& , \00S0040 Po P` @0T   04 0 U"00@P` V080R00S Pu`@Q RpG <2 R] 00SV0 R r 1S0C10B <000PD `0S@0PL wpP- @ |0 @p000CC000 R0@ <08 000B 0C B0S [CP, 0S0%0 0R0 R*0\SL xP 00π0;0B #A03@ #0000ht=  -`R00 F"R00LMS,  Q00 ",P0 @t 0-T@ +T@ v 3V00S=R 0T ``Z[ ~zzXfphp 00D S t> ? A10N@b@P, P0@ R?W@pG 0 _?W@P0 W(K (Kox@, x I,0!pc?WP -L(M< 1>?0@0c@ S80 D ,;8#8?C0C0V`p Vpp@P 0C P00@PP00T0#S 00@ P00T0#""S T % * 00@ T46"*C2&b& :460V0+ Vp0pS0Z0p0GT0  AT,K 1 c, ( 0 #2>;8#8`t.t>bp.p>`@ P|[\.\> b 0`@PZ 0P-\ࠃ|  >  P0L࠳|0 | 0jS SaB0Ct U U Et0 E\t t p   Q00 @  x !Ps \00S ^$-01NB0H D    ̟ ?`0`p@0 T P< HKP aH D  @H K "`X T |^ XK4< CP00Q00S ROXK; na0X T 0L0 8 4 ZX K _a; _40@S UA ;XK_ 0`pP 1 P ` \   pd \`0S d\\`h 0S00 p` p00S  0?o \00Ӏ!  \ `: a 0P ` \ p100 d Q @ B¤ Ť0@Sp< x x 0Z J∠ ӄ 删  x 0S00 0 0 x x ,00 0C Q 0A63@ a 0aCAJ Al  4 8 Dx\@` 0tS\t0tS0ct @cc Rx0S `4P` [ hyPPW h7hP P\ O pQxP R00Sp Vn46Sj70Sf t0@0t0 p\0\t00t 0 t @Tt0S|\6 R`U XY` ` @P `0  ! rP `` pd ` ` L <hP Q U00S 0S X^00S \W UbL 0`R h  pPh d`\u d  ePd `  ^P` LL \hdhH`\A@P 00`S P Q  0 cc p 9Y0 _P00C0 x\ 4@5 (Q^ 0*^@ < XKiX@Y 0XK^0@ pP`@@K 0PP< 0 ^ 0@KDPv4Q i^@ K M4 P 0jW_ @K 04~_ $4@ < w_`P-X@X 0]0@@@ K `P*P 08 ,P0@ pP0 V_@P 0]X`X 0I_ 0]000 0@PP 3 P\P  0]@P  0P  0P 8  w9R W8008  000800 hPh 40 820^  XKW`_X 0XKa] 0@P~PP 400 p\00W 1^P@W`?X 0A] 0P@^4P00 000 <1KB] 0|P K &] 0_P0w0S 8p t408`0 \0 @nT/X T   H` 0cS0Ct @4S2+  P` S d '?aCoc?`(?yPD??$@@@?0  c^Db 0@P0 pH0 p S^@P `X@ TP p@Ph  \h0`h`h0  \0Sڈ T@d hPh \P0w9S{ W p100  h\vPh  yPh UvN  \010I 0`l^,0CN@6@cSP` t @t E0SS\ MP\ \h\;Pʔ}P\ W\|P\ xzhtPh mr`lP` rjh0S0SU%`qd o9V00k90000ez0w0S p] X T p`  P` ;h5Ph U \P `:V `>9V X1``8`3 -LTp3 -LTp3 -L0MP T 0 R` BTL X 0X@P0T 00D0 nPPH , 0 ITPPAH0H 0,@p, pP0 `PU`,0D  PU `@R P 0*L@P 0 R000 CZ *0S 0SL0 B@^L :L P H(KH @ <  8 4 8 14pN$P @0`PU`@KPU`D @R @ < P*XP0 R0 0BP *0S 0SL00 A0CRL0 :LP@i 02@ U P-L@ @ 0S@iP@ 0-L@PP 0S0   0S0U 0! !"o3P񟗀$$<<<<<<<TTTTTTTllllllllllll41 01L P 1 1 1 0  10 10 104 10 10Hl0 \0 P0 @0 00  0 [ 0-@LP8"pP(000pP000 QRP000S p-`PPL . US@  0PP@ @00\ \ @UR!000p0@T00p00pU  RR@PP @T@@-@P RS 0P 0 R! Q\00000@ P-L Q T00 Q 0S0S QbP0s3 -0LS \0 0P  0  >0S@  ?0< B<R0LA0 0!88S@  ::S 0T0 0@ -L@\`0P0Q`  RP \  P p|3U 1R 0 S 0 S?0 ^^/0nP  VPPPPT00p0 P 0S 0Sp0CP 0Sp0CPp0 PXH06+@P00 R ! 3R$0P VPP [ -LPp SR 0S40S1`T000` 00R` 0SJ0S`@S @Z`0 d 0Fp> p P` P@ 0 0R @`ZWP0  d 0%p p P @`ZW0P  0 0`` -LM`P4 8  0P0(KZA 8\S00P0P 3 P S0M 80P SV#4pe00 0@SW p@40 0P00,K@p,K W:Nl 0 40 0008 RP P @Q 80@TP 4 0Q,K ZpP4 0 0-0LPM@ dK P6@Kp l 0<K <0 'i0 dK0 HKD0 @0 H0 峆~뜃 p-0LM@Pt`U@ T%$K 0K$ @ PPmp 0 S 00 0P0PKp蠃 -@L0 0 0  -LpM؀0 s`$ Q $ 0R' Kj@PK  mph K@KpK] 喙p@p@ p  Ӟ0sa뜃T0 P-RL@  ?  000 -- LM 0  M K -ML M@H,  P, PL, H$\4#0$@K$K0 S2d, 0R(KD 0KN@N0,$P Vl 4HPP,Qk`p H<VF``p  @ R@ 0#5lVF ``p0S V`FV:000C0`F RBKII ! BKII KT @D R %RP0mSL %S00T0S0 @D P R@@ L<5V 0FP `aC0S: P 0 (P`pm 0j , pPdP >2lPPKn@1AlA 8 4< <\ 0L NH^6 D 0!kPD@`P  0@,d0a0cK8< 00< @<AA 4 << O0!kVF``pY 0 S0GQ D<|k07S^KPEpPE p 00@ ~^KPEpPE<< 8L :P 0'@P07S v8뜃`[dthXL@ 0-LM@00 P>P8 -@L w -L@TP`pJ 0 T0#03/70! >\W8?XQd@@0 1T  R#*0B0L!000c00R0nT-0 0@ L 1Z \W@ <"@ 0-LMP40@ L0 @K0T -LM`p@P0PP@0  pt@TPPKT p-L@ P  BO`  0 0 p-Lpd ` <4("4!<SVJ@L@TP0? " !BP <4("4!<0cS ,  < @4( "4 ,\,.<4("4A$<U@%LPU!0? " !Bp <4("4!< 0cS<,$ 00 q 0 @ @p@ 0+Q> -Q  9 00@ S@p 0P@0@ 0P 10@S@0P@ 0@ /P 0@ 0@!00/PP9Pڌ*0aUS RaD040 @p 1 @ l 0\ P0`40  P  p3 Y ppT @@ Su W@PP@ LP 9H A R@PAu 0PP L 5RYO\0So \\NP 89R QH  HK 5@`\L9 PKQ@P L 5T@@4K 0PK@@@P 40S D0XS xS 0@ 00S S  @ @KD0K@P4 { PD @p \ 0g@T 48 PKQP L 0 PK< K80K PD W 80<@cT< <8 <  0 @n0TlT @  07  0CP| + |2 P $ |0  ! cD0% P  D  ! c8P<@ Px  \i\\ pnp  0@Pc@0 d0^0j00n`PU00S0ScPc`c\ x Px   @P  @ iQڄ P  Wڀ P  Vڀ P  Xx Px  F Pt  0St0@ p @x= P00\``V 0 03 0 4  W !0@ 40 X T 倔 <\` 8,  , K00K pP| ,QZ pPu D`R, 010 D PD e 0@S20@DT@ T D9 PD R <0C< 5 A 0 D? PD = 0 0CSv R 80@0T80   Q6` <08 @ STQu "2 IP @P2XKN 1`p P 0P[ 0@N 0XKPO40040 Q80 @cT D PD < d< 0  x | t @<0 R 00SO SI S D 00 @021T0D 40 * 00Q   0 b320PW   x t lP tx 1@P~PW 0` 0 ` p 0^0Z0S0   R 0S N?V瞯<A?&0S0 RT@   0 @ R0 0 @ Q" R  P 0BSچ0R`Ф0PU 0C R.ʈ!00 0@ D@Tj0DPD0C< @8 PD =Pcy^P` c "TPc20S60P40 Y RD0SR@ 0 SJ @DTʳ 2NW @@"2@ P G SH@P  0SMX T ^ ^ ^ 3P 0 00c 0 6H@P@@  CbVڈ3@ h d L 46 56,ʠL0 LLPKh K @N`FVP L L0# "*/B B V L pP@K0D4 ` N@PVpP@ LP XK 0$P40 040 G0P@  @ 0@ 00P00 10@S @0@  ` X T ` @@KDP 0 40 0@ 0(S@@  000 Rc 0SD40 0R  04  @040 Z"00D@@KP @0C@ |P@0@ 0 40 D0 4 9"00@`-A0=@P9U}R@d 6 PKxLP L 0D CbV6@ p l L 46 56,ʠL0 LLPKp K @M`FVP L L0t' "*/B B V L pP@K07 p` M@PVD<0 < *a P@jD2PD K <0d8 < A0@PU <ZD0P 4 "00D\  PbU,D P80D 8  \< ! 0\D0D 0@@P040 Pw XK 0PfoQl.aN* Y!ц00 `Ф Ť W!0040 W R 8D210 R*0s  R*0 s 040 @ T00\0SD0 W {PD 08@100@ @d@P80!08 40 W040 !0Z40 ʘ\00P0SttPt x"P040 ŗژPv <0Db< 8 w^\ 80C 8 ?Pi\0\K PKL\e LP L 0PK4K 0PKD00 P0< 40 RZ!040 s4  4 4 1L0HK6H0 @`y\|\PKL J 0 1SN  @ 0CD0  !08 < 40 D!040  R0S0 DdRQ8 eDIZ |040 qD08  -L0@0 0-@PL0 C@0 -LMIPU8 < @0  00SU @  00R@`0`@ `0R 0S)\ 0 \,0 0p00  70S30 R 0S0 0R@@ 0R 00s03p`00 0 00 p8`pQ  0S\P P0`10c , ,0  PR pR 4  V0G000S@Z)0g0CS  0SRP/ 0S  0S W @!`#*`P @ |0S ` Q` `00a W:`@iDA@80BP`Q @a P ,00d,0 8 p0, R80, R@I,0`cU-8  0S; S S- [P@"00F R0 0S 0S0 R@0Sc  0S@[W@FpT p2 02 p 80Pf0@,0 W 8  0S S S @@0,0< 0(K0+S- -S 04 40 ) Q! Q 4AP P\ 0>!0L0P40, Sa ,  4 0C000 0Cp,0 p,0 @000 @e P D21 0 " \  Pppp ,  , 8 0, R2 @"00 0,0 4 R 8  0S S2 R/ %P000.@r`^YPPPF ^ 7OP>W 00S `P T@ 0VP @F R 000@0b@8 0< 0N"00:1 0W 0eP %8 0,  R, @"0S@ 0bVUE P0S 8 00CS"@21 0 02@"@8  0S: S4 Sh 8 0`BPP0 0@0Pr TP0 0Q0 0U f R!10 8 @0< 00S{J R20S. 890\  0@RZR R 000A10  R*0\0Q00Q- 2R  101.Q  10 P *0 BSP*02SP: -LM@(KPp`,K0( c,0 c R0b::p  0G$K -L` B/ bR@pP00RP 0 WP0 0@ P VU  0 B_PP P 0 BV0PP0 U @980"p@-R`1Q0@  0 ^2$ Pd050 ^2$R  0fC1S00p^0^0 0fC1S00p -LM0 10R@# *P0@ @0S Q @K0 @0S" 0      $ ( ) * + , !-" . # /D0S 80 00 00 0-@P 00? b@-A d0.3Ġ Q -LM4 4@00S 0"! 000 004 APP@Q Q00S p ,  QP- 2`VM Qn,X W0#03R0ST WՕ@ `' , P@ Q0Q0XSxS0 S@QPX\ W0#03R0SgZ1* 0Y0*00Y*0S  Z QZO 0AS (K R WՕ@00' 020@ 8 _800S 0 `0320)QX00S400Q" 0R )RP  R0'O0 XSxSa0 S҅@\00 &Z*4 00890S  0 S  -4@L,    h89h -L>` -L>` -0 `R0`LP: 0P10p@ 8!#800"( (!( 0( W"H0 0b1 P 0("( #8!80 P#HT 0Q 10  @P  ! Y  0"1008#8S"("$"""!   88S00000P 00-0 S 100 0C\AP: Rࠓ -0L100`p@PC 0` P0 `6<W05#3̠10W#55 P 256U b>003<0S00S0 0-@PL  QXP0SL 10A00hO4(10 AR 0h $ -pL0PS U AT01 0S0 00 U e10SUP@ @T}0eD!<0 0c1S10@0` $  -LM@Pp`P# 46 Z(0 6(0 T$@ (K(0 0 @UC>E0C05 `0  C>@0C!0 B@`@ K$KP(0$  `!30$0 0(0 (0S@@0@ -LP`pP@ 0`PhP5 p0!1 0 P`0@ Q Q @P` XP` P *0 @0S@P`YP`00S 0pGS B p -P0 0p -0 0BPU`Lpڂ UP# T  0R010C 0@10 d 040 \2.R P0E00\00\0 -LMD PpU0D0 D 0Pp0 RD0< P@ O < 100Q80 * 0080S10000 !PD0  4 "*, 0S D ,pP`5 J$40  Sp 0 R,00,0 < R 8 0S 0 BS<00S<0 <0@ 0@(K -@Lp P00@ -LM0 0pǏ,0 ɯ0@*"P,` QPp 0, 0R ,0 10p00  0(K<PP0P  00  ! W0 0P 0-L@ODa TAPU/ ` @T P /@P/ `p0S @T 0S PP@ 00p0S |PU 0S \LgPP 00, 10 eP (q -tpLp"n0S \hnTPT@]n`00@XPC/00WUEO00t=\49D 2-C PbL SPp 0@`U0p(@J0e1P<X WV00P100C/W`VX@Z -LZL 0cP R@P $m 0@@hm4@ -0L R5 m SZ RX@J0S m00 D0 HC/aWQ<m @P $~m$ 0@@@Nt=4@ 0-H+LdM0@0 PV ECEExDCCEPD|FPDPD4EHDhD`DECCCCCCCCE`DP0S0h0h0 0-LMP@)P8P 0S 0*8|  0-LP@P0 >0h 0-LP@P0 P 0S S 00P 0h-  @ @-0S@ 0C0@ <(4"4!<0  -0S0C0 <(4"4!<0  0 c0 Q0a0  R %3 a 0 0% %  0-0LS@P*00b0 N 00 00 0-0@SLP*00b0 N 00 00 -LM0@S0C0K< 4("4 <0!  N 00 0 0-LM0@SP0C0  KN <(4"4!<0  8 -LPQFM0`,0 @] TC TR0 41 8! 0)p@S810(KOK 0< e@P! M?Kf@P8!ҽ@ѳTK?KS N/K⠃Pij8!彽@, 0R(K081 4A 0p 0ePꣳ@.00<K_K<N/K81 pp 8!+A[`O꜃ 0-L@PrP0kP fP  0h` -0LM $0 $K K 0-LM@PT :T 80K0! 80KP 0088 0-LM@PT :T 80K0! 80KP 0088 - LR *0R0 - LR *0R0 0-LM@PT :T 80K0! 80KP 0088 0-LM@PT :T 80K0! 80KP 0088 0-LM@PT :T 80K0! 80KP 1[088 0-LM@PT :T 80K0! 80KP 1[088 0-LM@PT :T 80K0! 80KP 1[088 0-LM@PT :T 80K0! 80KP 1[088 -LM0@K0!P00 -LM0@K0!P00 0-LM@PT :T 80K0S00! 80KP 00S0088 0R0-L@ P0PeS S S00P U00 P U  0, 00 0 0 -Lp@`PP \ 0S 0S \0S 0  -LMpPW *0$0 (  (KP KW0(KP 0$KP (0$@ @0P``0$K -LMpPW *0$0 (  (KP KW0(KP 0$KP (0$@ @0P``0$K -LM0@Sp`P S  KP R `V *V U _M fB00 U 00  HPP  0 -L@P`pP @T PU * iU 0SW $B00T WGPp 0 ; -L M⠠P@8K0`px ( 0+LP00P0#S  O=( 0R$K聰00뜃<$ -L`MH\,  0 \ h/00 ß, 0R(K 0|0 x0 t0 p0 l0 h0 d0 `0 /0 (K!0 0a T0c1\Tp q R |K1S q w Yp Rq w Ppw YpZKZK`,K 0S WR `V00P0#S w WV. @T*:0V0) |KPdd0IQ00 h  qG00P,T !R\  B\ yh0@@dI> ?DB> -0LMp,`K,0K@PT HPe 0!00P XZ@`PTZ .T00X0S Z  ,K G\ -LMpŸ0P,0 P@ P /00<, 0R|(K@@0:T<0 80 40 00 ' D@ >D D@ @ȗħ(,̡pa -`S00LMV00Sp@ Vg$!V00/0 (! 1$1P 0S] \4 V (!0 R 0(1 R  0>P  R$1 !0$1(! (!0R $1 0 \$1(!$Q(0U  0S (0PS(! : 0~>P (0U$Q0$1}00,1(1 8#0PS  0 P 1S 000^ P 00c0 !000 0 c -L M@  @4 < 0 D0 0 *>P8 u 0 00尀X8p 8pP` 4 0bSE `XPڲ@TT 0 >pPU 0`㲀 XP<0LS8 @ D0fPq8 00014 00 `Pv9(Kp!  P9 ,  0=pP8@00004 gP<Q#ꌧ@(8000(K  D0_ P 8 @0008 000,p8  ^ P8 0008 000 L P @ D0P 8000 0SD00 00b0 -RL@1  0hi00,1c00,1 0-LS00\00SP@ 1 \ 00hE00,10?00,1 -SL0@ h-00,1Q  0R (T0 0" 00" 00" 00" 00" 00"0Q200" 00" -LM@p`@!  0, S,0K80 4 ( 0 0 R r 1S0C18K0PS U 0`8@$KXUP  -LM0 0`SV  0S 0 0P60,0 K U& , R  Z p1p!@P00W0S W ,@PZ 0 00dS0 PdUP0,0 PU  U 1+#,PP`0 00`S0 (KPU B<B S@ p:  ' U@1 p190 0g @p0 0 00gS0 PdU PPz  0 00PUb UR:,pPG@@Up0@p` 0@T:4P3  00b0 @p@0 K90 @0g Z0 e6P, _  P0h0,0 : .9000PH 0 @00l 90 0e p@0  9000Pt p-LP `V 0@f00T`0T  ,P`@`ʼ0@00pp p-<`L0PS0@Sp  p-@PL ``0S0 P0SpIP 00ph ܯ -PLp`PS J0SX@`PUZX4 0-1L @R P Q. 0 0 0c0 0000  0 P @0P W/0 P$000 08#8("(00B< S 0 t= p-LpM0@8CP`Z0+0 KpKtnP0@: S  Q;  0  SL ( 0R  \ p-LM0@C 00   KpK K`4PP h 0 SPP P 0000C0  0lPP9 -L MpP`0S9쀟@T@0S 9P 0S$K$Km9 0@P0ep h0 F00!0C 0@000 p 90S 9 x= -LMpP!8 0H!08!X0 P 21CPU@ J 0S W 0S `D@PUZX W00C0 (K `D 4Km78 0,9P Z 4@ 8 t9Z4@S00P @8)xT 00x= -L MXP`@@0!0SG$q@T 0 0S6 0@P0ep0 FR    0000@10 0A " !B 9P@ < 0S9(K 9P @9 x= 0-LMTP@T K0 L K 0K  @@6p(l -L@Op 0PT:0q0:0 p-0L @`P 0 N0: 0phFN 0-LP=P/P00@P0T@00:00 -L0M4@0@K0  0RKI뜃 Gt,@R 0S  R@ -L` 2pP @H1B@A01 7 P d7 020 0 0 崜8q -LBMcP< , @$ D4 y8 *5iPx BNK@D@D0"=7 Pa*BnK`FBK `FA0A 04 $3 p ѯ Ci 3yj  02R Pe 0CZBNK@D@D<p`004 0 ^ 0D\1 @<@PZ@$00@_S c4R SQQC 0<8$PHp. 8\ GO00B?00, 0R:(K5P@4<`%0BTD @ F@d : :<0@JBKNN``0( K` 0T 0@@D뜃H9 -LMp`xQ@ 00 0 0C0``(KSL RK 004 0 64 P 00000 @0000 0 0C0` 004 0Sʆu P80 D0 P0D08#a`V F! D10DDAuD `P{P 1 JȘ00 -P0`@P@`H$HXpL %XJ0@@bH$HBPX%X 0b0C@0P0@ -LM`8 < @0 尀X! 0PSGpᶐYUYS<@ 04 00Q0 V*0 S80f5P7 `尀X0S7 8l@P+ 0S <@0 0 0  Ro< @08XP000808  8 8(Ko p0 S80.5P(KX pp<@0 00S<@ _+@0F@bH $H, @<0@0@cH$H@@ 00,40᷐@< 0 b c004 B  00@00088 8(81840PӞʬ <@  -LlM@ 0  P4P\ (K 04Ph \0` 00h8 #8  x0 R0Pl0 tP Xl 0@Sp pxPp| t #81@x@  |P| R @p8ڰ0SN0 00c ,0 x0K 0e8 K P8 0080 0 c4 t08#8t0 P08#8 ax0 0x 0c |0 lP txP a("( l0E0a0  P\000h0   o\h `t0 p0 \0B8h p#X d @` U*00C8Sr^  08#R0SP%0S <0 D 00SH Ps 0@KH Kp800008 #XR0 S@ b< 00H0 0 cD 尐$\0S <0 D 00SP 9 `@KH K000@KH K@KH KdP XK d0 :PT\  XX Pd d RL P@ 0 8d`p#` o\ 000h0   pP0e0CxP8#8 E `0 0d 0P0d3Pd ` 0d8#8Px0 @ `.  08# d0P`0 pP 7 P#`Q  -LM8 `p@4 \OR4 F 0, 08 DF#8, 0lR8 #X0 0$ 000 儐  bT, 0S0000T 4(1S4 0C(1000 D 0, 0004800C808   (K(Ko -PLp` Q@0@^  Q Q \2PPP0S -LM@`Q 0  P n, 0 00S02P&p(KpP&,P Z 0(10S$1 0 !$1, 8#R0 0  0 pPvp0000S 0_2P  0P$1 0$1 -L  @RPp  R 0 0 0S092@P RW 0` R. 0 S00a0 0S $10 (!$1  0 0S 0 2P  0(1 P$10$1  0S0 ᰀ `1P0f8 (#"  02p 0 S 100 0 0S01P  0`8#@ Ҕ00 -L M@`AQ 0  np, P 0 00S01PP(KP&+P  0 <P   0PP, 8#R0 0 ꁔP00 0-LMP @p108 -LM<0 @ P80K0 K p@P 0(K0,  <K` fP40@ VX 000P`08#8@ P("(000 P0@0< @0P00Q<X000 < 1P0A 8#8 @`0 0 0@<P` -LM`@@0 < L ȠT, ,Ƞl 0 4@ 0Z@0Z` 8  T @PH$HPdX%X g0PC,  ,  d d 080P0`004 0P0C8#Ƞ8 40 S 08 @8#X@eH$H 0908#8 l@0 B 080 @ <00P000 Y 4P4 0p@,T 00BZ ) \ 0 08 Zp,#X" @ @eH$HZ08#8 ` B @0 00@000 00(K@ 0Z0E8#X00 <>, P , 0`00 00C8#Ƞ -LMPႠ ` `("HQ% 0 Rp#p/`P) P 0 0`8#H0S0S 0P  dp  X0,  pP,  -LpP@` 0S"0Q00 0/W@pT? V  R 0B8S`R 00  0R0S00ڲ00000 B! 00C0C0 0 00T00 PWW800C80C800C80R B 0\R! B@-,P  00P  -LpM@.?P0S10@T.0`dY**0VXS'p0WXSpGY:0gSV P@>*00TZ! Z Z KDWP$X@000@0(K RP 0S @ H-Ap@0S 0S@@@ -L @P  - L@p0 S0 R0S 4Q R00B,R S-R+R0S0 C,S R-S+S0SS0SSP0@-P@000L S0!00 00C^00L ST0 0-LMPK@ 0P $"B20b0 :R 8: B;0P  31C 0:S0 P0 00 0-0L-S@P +SPP U00c00 -0LJS@3 MS 00C S00 [?P 0/S 00K0C0  0zP 0.S )0CpP 0.S (0Cfh~J0C0 0[ mE-@`p "2n10!0Tp 0S' S1 S  W43Cc" a*B-B ;\*-3n20!0Tpp0S0$#Bb20a  LZP3!2CP43C" cb PPT1 !/ b21C\c(1@D$"!B Ϡl   B 100/0cN!bS  \@! A!0 BA`10aR0BSB\2l 1C 01 SS Q 43Cc" a Q0*gfff$I -LP( <3aL1aa Q R 10bSP001bSP00 -LMR@0 < 1=0 \J02X 1\&0080 4 H&@v0Ca P,p ,&0CqU0K0p P,p0`0g#A@@!F@@dPGP`pPe,` U0%Ϡ2l10!0W03l20!0W00H1U43Cc"` 54ĠL l ?Bc  a$<#B0b8 0l0b"0 a`SQZjmVH4VjF4mFVX(,PK,pP4Ϡ2l10!@ 3l#20W0W1 Z/P 0@0 @(K,pd0#Ϡ2l10!0W03l20!0W001Xa^0@#Ϡ72l10!0W03l20!0W00,KAP 4 8 \20S80 040 1"0080 0L1lb P8U 4 \d2A  Q 0R=0040  0 0R 0 0RA4  R4 @ pPt@0,@PD{ND@D/0C!bb@ae0 B!a10b c@R 0D!0Ϡ0l $ "Bb 1a `34 1Cc@0, 2n10!0P3n20!0P @ 000S @c 1 S@ 0 0 < $ <-E.²ScQ(?Q-$Ių0` R 10bSP001bSP00 -PLU`p@ G'0c0h=' 0R 0R 0R 0R 0R 0c -LM0`pK0`0S\@K \@K< PXPK< P (KTK PPLP%0౨%??0cc( K2"1C0c P0 tP\oPT\*0T0P@,0 05T“_2e10!00 3e#20 0\ \ 4!0\T ʴ<P P@,|4\ )`4T“2n10!P 3n#200P P #1 0cT0 PwTP@,3_.2e10!00 3e#20 ^0 ^  21CT0!0 R b ST P0 <P@TPD` ,0;R L0 v>" 0S` 00P0SP@?0/0U40 4P T4@ 4K  KP" KP- 40S% T UP4@4P0P0 P,:P`00 ;0`0 40S0DT@40 PS4P @Ql0Q4 ? R0#S4K  0 4 P004L1XH1H1000 0 ^ 0 S J"10^=0P\ 0PE0S0 J@0S J"10^=0@0  S K0K 04 n0 PK XPl @0R @D R J@0040 ꫪ*lQ(n0 -LM@P`pJ0S 0@-H01=0\J 10S1 0- -MLMPP8 <( 0S` `,0K,0 S (K `V 08 2Q22Y PBKAA 01 R0SJK=0 0( Q(@K1$0HR1(@KA 08008 04 PZ0HTڂK `LLD 4 480H0S48 48DH! !H( 0!L 0QHL8DH @( 1"10 p 縀^8<(,0K @@`v`3d `G,0 S@0 ` 0`v3 c` 0(Zꑋ0 0n P0 0 P P0 0 I -?@P0SL?Q0SQ 1!0 0S d0 R0 R0 R, =0G'p3 -LM∪0@`x,0 a pP@ 0T00 XPP P:U /U .'P JXP, n, 0R(K:UP/U V' P*/\K(PEPE++'+&.&P@ @tXPg:p@ ()PZPUK\@ $(2Q P P\K\^2^*K\?SSTT1 !0C  K0\0, 0KH/0 g0 bR\=P*KH:K`KPH?\K:KPHK`\ KHd:KH? 7KPd  U*K d/T7Q L:K`?KSH*Kd/R 1^:KT00 S50*Kd?KTH/SK0*KT H?KHc KH0S0/%&Pd^&P Ti^:KH*KH/ 0$& ^:KH0 S5ڶKL KH.KH)*KL/KH0*KK SLH Kd*Kd/R3^-  0 KH?K^d  :K\?S0 KH0S0^^-  KH:K\d T@ KH0S0 K`A 0Rb\0S KH 0gcPKH00QXPM0 SN  K` K`P=3@PK`@T 3  P P 00*K`/R JBT3K- KP@X XPE@DJ*KX UP 10P 001K` @0 S 0*K`?Kd0 S/\K(PE PE @P0S 02S@@0 0 \0 0 @0R P;0*K`?10 Rd ^[ 0 S1K-0 Kd @*K`/KR" K`0!S:K*Khd/`?*K0`?1 KhK`:KdK`:Kd?^ͅA2@@^M@ PKdKd2 ^^K(L P @*Kd/00 Kd/꜃Hq9 + -RLLM`@0<S p@ d0Sg(K@>0 >Sp@ d$(6p@ P1!@,  pP00PUJ <Ua l@ d0S,Sl,0>C00 0q03W0Sh;Q,Qe QpWx5x%0  00@T H50D%  00Q ^ W ş^ @0^M^͆0@, 04 a$0` B0P0 P Z00 P 0 0 Sv p Z o l g;S 0KP_DKPY 0,SVXKPQ Pt Mß^ @0^M^͆0@K=`0 |30 h0 h3, btp \#0l0 BP0Pt03 p`  0 ` dp \0 0h dh@X Kd00T\0` 0B0C@0B0hpp0h h0Ϡ"2l10!0h R0 3l20!h0Q008"1$#Bb20ad Q\0\KS`00`0 \ Sh0,0h0 d 0!0Ta !0!100QP0@D0J0 >Sl@ dn\0@`00A\ 00A[Q( -L@ P  h4 -LpP`8 0S@ t8@ 0V X0(0T=H00(0(0000@P /  - @L - 3LMPU$ @ 0S" 0^( 0^N010 2 b B/#b0Ca"`0c(0 (0Sf%0S$\>^- 0 SP 0Q^M@  0$K @$ 0 !0 1( K 10 ^( 0^!0n0C?t3c Ba`1"`( 0^\  0! 0^ QA!01"1,010 Q(K ^X $0R0@0@!. B2!Nc0@0@!. B2!NQ"Y` -<1<`8!VL C 0S^͆®]P !0"100 !0S X @pP!P_0@0XZ]PpZ0^=0 @!PpDo!P00Z$000+ -tL0Sd@0 0R  Ph,0pmP/ -@L&7h#7 0-8L}@PA (Q0S!P2 h!PP+P0S. \0   B,0hE PxP 0:S  `P 0,00h, PȠ/ 0-4PL@6  @60 P0 0 p-8`LP@6 *@6p -@L6th6 0-LM KG0PK@@%A0@`TK0@@@ 40@`T0C@@D@ '0@`T0 -LM K@0` -L,M@<K K -,L@, 0E6P h -,L@, 046P h| -Lhj Q Q0!0a0PR- \1,0l00 ?\0 00R- 0bR R ?R0̑03012<000QS@-@  \0l 1<0̠ \ L ?\0 0@@\ P T  0 0-R ,0l0>-S0c012 0 00 S 200 0 3# R02 P0 0 bQ B2c0 @- @0cR#3n\0CQ0C2 d  l0p@- HXH$H%X!! a. $.ȌT2Vh`@pP1#3P1 <2PPQP3100QP3100Q#2QPP ;; ;Sq0 P0-9XpTP@ U` V( 0@0000# p-L`P@@@`@p -LPP@`p P B`B0Q40A"A`R0E0U0@ EPU0r @0P 00`04S0`P0  0   -X1L0ps3X@@`S P S `8?SPQ QU 000@U000#? 0S`Z?45VCq00ࡣ0aS S4#0C@@PUQ @T@P p-`LP@@!aph -L@P0, 7 `p P  0G`pe -L@pPe P eL -;PpLg45^@càU WN^a lAi^<.0n0ðVU, UPp V* f(\\0"?DE iW U0naS S6#0c``< 0S00O@`V`A-;P`f45^@s àU VNŒ^ 2 0N0AA A^<.0n0ðWU U ?1"C 0\ A<V U0nrS S 7#0spp\?DE pWp/R 5/R 1 -p!   PLP` &:::S@ W 0@ 460@ P S460 PXP -p!   PLP` &:::S@ ?P @ P0@ 000#460@ 460 W V  RXU -p!   PLP` &:::S@ ?S@ S 0@ 460@ 460 W V0 PXU0 ;p-@TTLUo Z~T 000p54 "d a3000V `pT00U0SpP |Vp;0 S-L@ ;0S P 0045S P [45S PP;0 S- L ;0S P P0045S -45S %R 0#03P;0 S- L ;0S P P 0045S 45S R 0#03PPPO? ` H !:0-LʠʠAL@N$^?&P@)0\^.0n04.U`U00P00S R 00000\ U0 0H0\6n "30  0000 -;L0M^P( $ 堏' ^ (P=O*1@@^ `0OO0   K\0O/ $K( K,$N$ \0O/@0 P0@00 ,@ $p4 < 8p PK4B0 ^0 ?^4@^ @T@0X0@@`" Ѝ) Z 030#0Z& ` 0 `0O PO ` P`` ЍG"04C0X0 Y ZnfQ&030#Q0516!P&030#0O/@0  Q ?Q 063UP030#&@Q `V`UP&0 A030#& -顏OLMX`p P  -顏OLMX`p P  -LXMt p p`| x0 x&Jᄪ.J`pDE媪ZoO`&l` t@|`8@ 4 , @` < 0 P d^ ^P 0 0(p(K |@K0 K<0K,Z48l p0O჏8K, K40K,8@4@<0*6々/00 E cXh 8@ 4 Šh0O⨀8@ 4 h  @ < @< @0"HXH%X$H\0 #Ƞ 88#8! Ƞᑃ.,Ƞ\d  D X c.D ᑕ,$.( 40T 2VD0gh`.8C \0C2 8\0CR0CTbP0CX`SdH ZHX \@ 0 3 #Z0#033#d` `FH d` JX H ;#;S` T<h)XX&h@%X (,8 ("( 8ᐂ.#8T Ƞ,ȠL r.L0P ᐖ$".H`LR20cWxp,8C T0C2T0CRZ0C2 aP0C X@S b`ZPT03#030# 3 #```F@ `` J `00` d`:%5ʠlhp` ^ l 0O/@0pl p 0O჏00 T030"S  pl /O p -LlM  ` 0 &J,JJJ@ 倠HD `^oOP`&@px` P`8@ 4 , @P < 0`  @cT ^ x 0O8K, K40K20^ <@ xP0O@K0 K<0K0`` 40@6|0 8<0 6*(|x("('x*D0 ,XX%X8`h0 D0l |`#Ƞd@ H Ƞh`.,Ƞl& `0 ld0!$Hខ(P` <#``X0 a&8H0 \` H` j&t p` X`P h(T` `g&T\唗)L xHp(Q2Pt.!8l@|T!LP\ 0V02PPhV0*(d`X^ 2\H@` V\`XP\xp*T3#0 Y2 Y 8 S030#p p,0Q0WC)*D@tP|`x 0<@ @P 4` (K%V! 0! 00 x  0O/0X@? ς^p x 0O/ -L,M0PPp,0 `1  9@KR0! 蠟 R0!  0ĀH 0P0 0    0@ypV@@, 0R(Kv00 <vpW00 뜃<YP -0L@H $0(P H h  Q *0S00S0 Q -LMTp,@KP` 0  "  0RKȤ뜃 -0LobfrgRBQ Alnn  `` @`Väp"d@`FT00æ?d@D`R ?V00S X W  40W  $@0iQ  -LtM` \, Pp *: 0 0 plh*d: 0 p l 0 U 00\ %\z^XTQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ`TQQQQQQQQQQQQQQQQQQQQQTTTTQTUVVQQQ4WQQQQTW`WWWUWXX4XQQQQQQXX|XXXYQU|XQ$YHYhYYYQYQZ8ZZZZZZZS, 0R(K 0So$@ T@d Ϡ0lP0 U  ^00U#3   0 P[d p-0L@0  0$RP`@) I2#8# c .@1QS P00S 0N!QR P00S\Pp80\| -L M 0`^K~`r@P x10鎠:p@PJ XT0 00 Q 1p\ ,&("(30b,>0A!0 S00Q8MP& 01C0 0 @0 0 (68#8# cN(. 0B 0S   00C 0(K  -LPM0d(0  @0P ,0 U U  UXh@K? #P$ K0DPCM0SJ @<0C>S񟗶f@f f@f@ff@f@f@f@feee@fe@f@f@fhd@f0g@f$gg@ff@f@ff@f`d@f@f@f@f@f@ff@f@f@f@ffff@ff@f@f@fhd@ff@ffxf@flf@f@f`f@fTf0$0t 0SPU$0SD3   P0 Pp 3P9P@    t *@< 00 2P9P0   R@0x0 0Z $%Z: U0 @0 ( 0R$K0000:(00 0000,00,0,00 S,01,, 1 "0$00 0~0 0{ @0( ,0 t00q00n00k00h0(0e0 00a00^0 0[0 0X0* 0( ,0P00M00J0PPUJ>PD |s00l0 R 0Sp 00 8`,弞뜃  |= > ->0>0L MS`4 0  (Ko?24, !Q, p0B0c, R,c0 S*0r 0P#R R * 0000#22Y1 (",0S* px 0t0 R!p00b b0 p0x 00h0Yp ,0S0C 0Q@t0S x0UKP t`1, R B0 A0t0SP Pt0S P00AU00, p0S(K0pS( 0S 0 0t ,xp00p0, U S(Ko04 KPh 400a0ym40 9 04 XC0    -sLP"`P *"*R@ R@  B0B Ts0STD3 R8C0 S*(3  0 ""! ttXPUV P 2@` 0 S A00C:#:30#" 01#e3! Q1(1"(@0@R!o 1S$ R000 !R 0S *l1S1100S00@@( 0b SP1:U xiR>0N@ TK: X>0N@4 0( 00b00!S 0S  |i/ic  Vii(  b R 0@@. @0N(@a A P 80  xP 0l` -L`nVp P0S0 @0T  @00S0 h0 0CR0 }np <0< @80T 0S$hU    -LMX`0 0&P,  8=>0>0S 4p(K80\>0>0Sp0(VUeB0 Ss*0帢 0p#r R k* ,0000#22P~ @ 00 1@tpW x t0R% U0QZi 0 0e6RpAC0SJ ,0 e Sp00ep0<0S 0S   0|S70S=xtp0, 0eRp000S 0S  (1@P026pp{ !000v D   h ^A 5  v Z PA h0@P05pD p000p ,0RA$r=|    - PL M8 P6(0:CZ*`>0N&@8 ppe 0 +PP6(Qx0PSb ( a R^*0S98:b0Qp 0S(K0 0(RC 0JS1p00@`V 0R 1%S@ U0 S*5 00#2 @T0N@$20!0RPp"@^@Z p 0 #2 p0p080Q$0S 80Sb (0c f058#Ƞ@^@0000!1 B("(0,R1!Q000$$00c02!0QB !R 8p00Q00Sg Ze u`p# 1lp 00Qa  PxlP3( 000/di(  bQ< p4 p4 W:370#2000,0 < 0, <0 `00V00 u Q000, +0V 0a WI< !q114 4P^  ,20 B0R ^ ,"   0 ^ @@Q@0`4@00@`0#4 0  a(0 c:37 '8#8!1q14  kp 0044*p@ 0P0N4p@  0,00 P 000S0@00P@0,@0`a4*ZQ0``w<`R|x   l  -LM@8 `kDppTPPU4 @#0SG"0S2 䒟00S0 k@k4  (K$0 T,0 p(0:CVH*`>00`  Tn`\:WZ0TP0 0/pP$Bf(Ql0 "S- ,0SV (00 c b", p 0dPP `< FP<]phFPS|!U00d0,k 00D1 0R0C0U k4 @ 80P 0S  k 00 V!1PGPwo(  b jP 00a vP`( 000H< ,    >, l -LP`jLq0S<< -L8M`PdjH 0S%@5T |0@T@V PP 8%( 0:CU*P0:#:S@ S@+ 0CC T'T: b UT $T Rs:Un0Sk4 RU@0 0CR0t Ts 0Ss tj 00l UT@ T ( RPp0VXL >.0 N. @T, D *Q#Dp,0pdS@@p <@ 8 @0 ,00@S|0<0 t@ Q0Px0640 EPt8px p080bp0x040h0TpW'  3@P TUX0 0CR0T iH(K/ `0l -L`hp0SP @0T * @00S0 $ Q0 0CRP0U hWX0 R Th 00JPPP t  > -LM PK 00%0 @# 0ST  @0S0S Q 00x= 1005*2 -lLMd 0R,0 Tq Lq0   R8,B0 0 㬀K%@ 0K K @@j0P0C `?<   c00P 0@ T0 LD@ 0 0 T0`<, 0R( (0 (KS00j 1 -0@L0S0Sh  -LC.<0 R00 R$ hy 0P 101 -L0pSP(U `@P0 000  000  eU 00CS0F0SiB@  10 -8qL0SH(!00C0p @ 00 P@0  0 0 ` @P 0  0P `0 P@0 0  Wp@@   10 P0-LP `B@T<00 - LM0, S*0 R$ p00C00 0 %P, `@0@00  Z 0`,0 ,0Ro 00@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -L@ho+a3*+I@-PP@p0`V 010P T \ 0 S  ^ 0^\0=S P0fC101 -LM0 S=S  0S=S` K@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R -- L^M⼠0Q`(0 qOoK`FppA@O?KC/MKl1 >0*NϠ80* 0 0C0S2-S0!1!@-0@0 @0!00  -LMAPTpm V R0 X 0W@ P  ~ 0xAV0KP -LMR`  PU 0SPR U< 8 % ͆0! Q0pPP(K0 13 B1 00 0<0 8 010s0380 PU4 q 1S X!0R00S,  0S X 0SRQN 1SK 0 @ T0{ 0S00S\t@TG 00B Y > 0 1P0  @0 @, @' Y$0 S ಐR 0P |t0Px  p, lPg  $1S0C1, 0R00001p0q =W0 pU 80x03 >PJXG<4 001A  0 <30 BQ 1 11  00q ͆0! q0pq5 !D00^ 0 0P QK -LRUsage: %s ..., where is one of: instbin%s: %s not compiled in mount_cd9660dfmountmount_ext2fsarchsyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigsysctlrtsolping6datelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfscksha256mknodreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shbioctlsleepmvexprdmesghostnameЍ~d@@04 $D @@(\08unknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qd%s: illegal numeric valueunknown conversion %s%s: illegal conversion combinationcbsconvfilesibsifobsofskipnoerrornotrunc%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %lld.%03ld secs (%0.0f bytes/sec) skip reached end of inputmain$ 04<H$PX`husage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsext2fsprmountmountfsmainnfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95direxecnorripgensextattprocfsversion %dlinuxstatfs %s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %sforceAadfo:rswt:uvrqnoautogetmntinfounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbinmain$ 04<H$PX`husage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinebeaglearmOpenBSDmain@@@h pp p ` @ Ⱦ $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] %s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/track/dev/%s is mounted on %s%s: block devicewarning: %s is not a character device%s: unknown standard format%s: can't figure out partition infoioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs=%#x bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u160180320360720120014402880 ܯ0 $, 4< D EHLT:  (#038#@3H2P3X3`#h@p@H@x@  @@$,4<DLT\$dlt|   $,8DPX`hp@x@@@    @@   8C$$C,C$4C<HT`lt|  @@ printmainoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sillegal option -- -%scbreakcolscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZlinkitusage: %s [-fhLnPs] source [target] %s [-fLPs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).FfhLnPscmplabelduid_parsegetasciilabeleditmpsavehas_overlapgetuint64editor_allocspaceedit_parmsedit_parmseditor_resizeeditor 9H P @X `@@ l @x(@ %-@9  `NX@_9@d9 4d$,8DLTdlt| o` [[[[[[[\[[ܪ[[[`[[ Į \s6㿂;{v&tDZI{ "UN{$8;d"@g߿9~^׺|qq^llW[Uw-kUyPy;N&o_&/w%gOa*Y]M$7eLH:YI{L_SNoer'm0 Zgjֵ5Ʌ`/O2yKerߝһx N)V[( )62Ga_*8j뭳% iA !Ro-6AL/60ΰyUFæ bZt]WZE$H XL&5+UoX*e~Ъfq% lWQu2b@1uЋo{Uw8tdٰ3pF< deۂZVgvVӽF?>0O~":7 +}BdFp'_X,2=Kdxsg? 1uUߨڠ&xc&{%Ǔ &X.q?ʵA]E ӽ7BK1ۥɖ`[270벺-yo doz4 8$3٩eB-tUQb{VTpeFӹ5͒D'fI(g1 &&M ^6_VV71\U+2ֲ2pz=f'&6Bz_t a*}lA(J#\Pުk_g QR傅o?o \c ZچOܻoYUII[LiM6 cfMaizbj&߬&z܇ĸ=b&K_syPI@M'@!#VDzGC]Gռֺ7#Z1#VP"1>h¶j>$@h WӉal0.|+662FI}ByPyN'38D:: rT EI܅Z=o}Gg#k8SYjOQͬ~SȀ>tKH(4.|d>Vnt,v";*+4f9kHߺպA禶MzvRb>@VAb{oCal0yfj-9+Ъ'%*ǍvrY q6!p,Z)l";.A+Urِו:b@%cpW]& ZeKĊBaq0ezRp`V# Yv~%lZTBg骵oϑ.&Bx!bFz X8 #  O4=ˆݛ5m0 &Fs;JJe9А eI++m>l $c#DE`ـV]|EEI՚հ0nY I I><ɼjk8=L-܀Zs37]ER6h yA+[p'`5jIj9;e*Oٗ ]G?X&glݘb5sWEsqT8`'L7*'teՋx.?R (Xb ~ LrTy,`C@ &{dC]oui jёf* V-}|`c,չj*´.'p8&-iGղny%@Sk|wV&@.c2`W[=Fޚ]v[b0ΧblXgbx5V4Qp,HpU|C`wgRjZ=99{(k8QIIŨ\]]EFgf$bh+姺vl^>iEP[\`ZպRq]%]Dag}Kؽc]kF`jQmlVP"OZ #c +LzsUP` w}aWMvەm;Zy@K\ '7 +.ܹ2NssޫEr8&"!%EIq42 Ӻ USZ'y#d0 1y,ܙa+4?.@Ņyr_14g]X7*84ξk2g(W1Ȓʷ8PɭFW( ήa}])L#~ P.Ӵ^/rdAz.va˃))a~+$N^RR$#2,kpB~2~\\S}Jb4 ]يR8 JQ`2RnYI|*Bb @b< Q}}kXy\Ey=LpqK Gm'@A]Yq !  x1rZ Y bR# Vjhr+QYr<bu?,#g;2o~8300Jbl’%oAC\.qsrN%$dbpu3t^-O/vf dhx*hĈU/LC{=!/ʪܧv(as J0H!o[~4 HYP5 HU uh!~Q˩+2 QFXnd|G R3fϵYֳT>\_ <x'!OɧHY0.$%=:X˜\CȤ`3cF잧WlISzS;u]OBIb@Q͛!(C9j(0 ]np &-@-Q=/,R7LJoBy sVLDAL. B8 MZ\ In["&Cfʮ_ebF+Z13r YUG+is3w+-X8%OīԿFq"wyW$6aֲh5mmOP]pvҗ_lt8l}pI؆pF _ ({iX[71* u[M]CAL;.A],Lf5BcLkx#٦4͛,u=vޯ\ON2~(B."I]jviB ȤPj}~efkí]8Jȓsl l hTm.[w t]+mQTvNKIG {|Ֆ=>vHLx0lf<ֵ !''Q3?S:S b* cL{(b+C]M9*u+Q]Õ¤u)AbGa81j#|DGd{mLJy(unV4"< "}^I0"hBblf֬9}z~AƔ]H?[ 9l:{ `i0.[3~*ϕd d"Fc!ZүpfFxu?hﬔ5?:0d ΜΛ㚖rw4 &9<ߞ\$ܷ%6C9 lhXn#f AVª+ rpsCh1xMG>oy`E| o7n/r%b$`t(z'A:fX' JhQԏ;38ϓ3Ayp[86SEKf4eÒ$N`hcE|4SeR0ke>jŠ.$U˸ҏYH) ]^"N CU߂D&|C%a'x0qT+]pnhߩ@dX+9 F#%FtY]ܸj\/H\|FI)Yװu$(פ򎡟jސ`Y,}del!~8o|0{~6O_O q0|֙p=rz|ZW᫐<ČIp'0(9Srrgχd+_gGOnնa=8ż&ͳ߮sJ^ooͿӝQmf<A ftujjr"{kÜ~!}rx' ᭎ꖐQ3x&S@a6)_iOO[5=wS]Ni1\5xi;Ud!\ʯ(hw'Wދ~yueã]jL}|XVT~K`1kl`B+!a\=+dF"ٳ7zi6Fon`ǎ B\vVt4PL/ϻuqs͘Z~VMs=vP~#0Ư RM {mo\թ5^%J0-6dkprc]@aJxBU9F`ij$c_3-ȸ;$B[4O#a[a=%2hZH?(m/[rDA>--/>zV;(҇TҨqiᆳ\@T0||JXH>s6,?PAM+M%%&OAajLsb~H~*׋Kwx7-/ӕi `F_Mkf&uÿhwꆚUzyO=2IMӣ@#8+IRusage: disklabel [-Acdtv] [-h | -p unit] disk (read) disklabel -w [-Acdnv] disk disktype [packid] (write) disklabel -e [-Acdnv] disk (edit) disklabel -E [-Acdnv] [-F|-f file] disk (simple editor) disklabel -R [-nv] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %lldpartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %lld offset %lld # line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi%s %s/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:Bootstrap doesn't leave room for disk labelioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFOunknown disk type: %s %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: bckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:tvwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cTreating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. OpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.Command aborted BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. noneWhere to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. can't get mem sizePossible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Invalid entry Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. A multiple of the ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu fragment sizeSize of ffs block fragments. A multiple of the disk sector-size.Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. partition to modifyThe letter of the partition to modify, a - p.No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions You need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.cannot open %sOriginal label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdrzwdFLOPPYxdhdCCDVNDsvndar_revar_drainar_nextlistextractcopyarchiveappendbcpio_wrvcpio_wrcpio_wrcpio_endwrset_crcnode_creatls_ttyls_listabcdfiklnoprstuvwxBDEGHLPTUXYZ0rep_namemod_namerep_addsig_cleanupadd_dirchk_ftimeustar_wrtar_wrCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive filecould not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot chdir to %sCan't fchdir to starting directorydirectory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot mix current archive format %s with %s%s: Reading archive to position at the end...User specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sCpio link name length is invalid: %quCpio link name read errorCpio link name is corruptCpio file name length %d is out of rangeCpio file name in header is corruptedFile is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %sFile is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %s070702070701070707TRAILER!!!File changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sAccess/modification time set failed on: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %sCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to create %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %Y%b %e %H:%M%s%s %s %s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == -> %s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: cpio -o [-AaBcjLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfjmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern ...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list usage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory These format options are not supported %s = %s Invalid block size %sbzip2compress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578-IUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPEUnknown -H format: %scpio: Known -H formats are: abcdfijklmoprstuvzABC:E:F:H:I:LO:SZ6Destination directory was not suppliedProblem while reading stdinInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cbcpiosv4cpiosv4crcustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sCPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.LC_TIMEUnable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryCannot canonicalize %sUnable to store mode and times for created directory: %sUnable to allocate memory for directory timesCannot allocate space for directory access time tableCannot allocate memory for device mapping tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableDirectory access time reset table ran out of memoryDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryHard link table out of memoryFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sInvalid extended header lengthInvalid extended header recordInvalid extended header record lengthExtended header record length %j is out of rangeMalformed extended header recordlinkpathwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %susage: ping [-DdEefLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qrs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommakeentrylinkupfileerroriblockckinodemainpass2pass2checkpass5setup$,8DLTdlt| o` catchquitNO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%d %s I=%lluBAD STATE %d TO BLKERR cannot find inode %llu bad inode number %llu to nextinode Cannot allocate space for inode buffer bad inode number %llu to ginode blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %llu, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluuDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluINODE I=%llu HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%d should be %d)UNKNOWN FILE TYPE I=%lluROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%llu ZERO LENGTHBAD/DUP%u: %2x summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device ioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead returning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %ld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld),deadlocked buffer pool %6d usage: %s [-benstuv] [file ...] benstuvxHLT\dlt|\\``Ā̀؀0tu 0,uH\ (4$<PDLXduupTxhhhhhāh́hԁh܁hhhh܊  @$,|4p@LX`Xhhi i@C4C\i ixCXF p |`4###Ȃ#̂$Ԃ$܂$$%%%%& &' ',(4(@)H)T*\*h+p+|,,,---../ȃ/ԃ0܃0001122$2,383D3L4X4d4l5x566677cc̄dЄd܄eȂe $,4<DLTX`dpx؅  ( Ѕ 0 8`@`LPX`ht |ȆGԆȆЅЅЅ $randommalformed link-level addressSIOCSIFLLADDRSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYmedia mode %smediaopt instance %d"%.*s"0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %smtu %s: %sSIOCSIFMTUbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xSIOCGETVLANSIOCSETVLANvlan tag %s: %s vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%i%i: bad prefixleninvalid vlan tag and device specificationinvalid %s %s: %s%s not allowed for the AFvltimepltimenwid chan %u bssid %s lladdr %s %u%% %udB powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restoreunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sstrdupunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %s ieee80211: nwid chan %u bssid %s %u%% %udB nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_NOPRIVACYMPLSWOL rdomain %i metric %lu mtu %lu lladdr %s status: %s %s: no media types? media: supported media: physical address inet%s %s --> %spersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupinterface name '%s' too longcreatedestroyinet6'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevgroup-groupanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacypowersavepriorityrtlabeltxpowernwflagrdomain-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downusegroupwep40tkipccmpwep104displayprintlong %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%*llu %*qd total %llu %s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufoundwarnmsgrtsol_timer_updateifconfigmake_packetmainrtsol_check_timerrtsol_inputsendpacketrtsol_inputsendpacketsockopeninterface_statusinterface_uplladdropt_fillinterface_statusinterface_upget_llflagdefrouter_probedefrouter_probesendprobeprobe_initmultiple interfaces foundreallocprobing %s<%s> %sillegal interface state(%d) on %sstop timer for %sset timer for %s to %lld:%ldfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %susage: rtsol [-DdF] [-O script-name] interface ... rtsol [-DdF] -a usage: rtsold [-1DdFfm] [-O script-name] interface ... rtsold [-1DdFfm] -a adDFO:adDfFm1O:kernel is configured not to accept RAskernel is configured not to accept redirectskernel is configured as a router, not a hostfailed to open a socketfailed to initialize interfacesfailed to initialize %sfailed to setup for probing routerstimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %lld:%08ldselect: %srecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%zd) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %dsend RS on %s, whose state is %dsendmsg on %s: %smalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %sunsupported link type(%d)ioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...socket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedlo0ioctl(SIOCGDRLST_IN6): %sdefault router list contains a non-link-local address(%s)probe a router %s on %sshutdown: %snigrouppr_iphdnsdecodesummarypr_rthdrpr_icmphpr_nodeaddrpr_packmainFusage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops ...] host ff02::2:0000:0000-%uVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->\%03o --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) NodeInfo Supported Qtypes, compressed bitmap, raw bitmap???nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: sendmsgping6: wrote %s %d chars, ret=%d IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) No Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddrunknown qtype, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply, %sBad ICMP type: %drefused truncated no address %s(TTL=infty)(TTL=%u)invalid peernamefailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luinvalid socket buffer sizeMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dEefHg:h:I:i:l:mnNp:qRS:s:tvwWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> pollrecvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefusedusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many arguments?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) .?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%tCannot allocate memoryLESSSECURE-G-L-XLESS--WARNING: terminal is not fully functionalLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_krklkukdkPkNkh@7kDLINESlicoTERMhcxndadbsgpcticdcmsomdmbvbbc|^srNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek error to 0ch_ungetchar overrunseek errorread errorESC^%c*s<%X>less %s(P)+Non-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found& [Press space to continue, 'q' to quit.]There is no %s optionCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some edit commands disabledWarning: some commands disabled"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%c%s %s %sLESSCLOSELESSOPEN...skipping... Cannot seek to that file positionDetermining length of fileDon't know length of fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbersInvalid mark letterMark not setUse "h" for help-" must be followed by 1 or 2 charsquotes %sTab stops and then every %d spacesless Copyright (C) 1984-2009 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less #Invalid column fractionInvalid column numberHorizontal shift %d columns.%06dHorizontal shift %s of screen widthjInvalid line fractionInvalid line numberPosition target at screen line %dPosition target at screen position %sValue is required after %sNumber is required after %s--%s-%c (--%s)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sThere is no %s option ("less --help" for help)LESS_IS_MOREBe less helpful in promptsBe helpful in promptsSearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file namefakeInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchmain$ 04<H$PX`hܯ @̯ȯ $@,H\htusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s: %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acmainUSER_print_diskUSER_modifygetuintask_pidask_numask_cmdMBR_pcopyunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB NTFS AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 'Win Recovery8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT XwriteXreinit[[S~UWf)_pvHv9!LRFݞV7[KRlLjc鋴7)ou89Z'/z%ߩD-tv`Pqkky/_w+b0A]Βs|et2K2]&U,\yiӕWi&2K%giYRe #`A Mr0L4]^y <&Nsӵ%Z< b5r腔MQfRqna=jr1 uE`Cn @JEgu—7w2NUhW 2ҫ4:Zu"uJ̆^DIENTzJ3Q)̶viİxz2O3/y:8h =0 TͶ`/^ UrDXp\ fB݊38 :OEfK6  zbbrJ"d4/bb\lluN >ԏnڛC"IzNx%Fyq5{0S㙧̅S:Hzg-U,![[hMmv i`mb窈.,4⠈Kuch/Nެ Jr ƪ!g`%͹h_rnT*Ѻx₝#T8ҦC` T+OpipL6l7gmQY+u|cNV] y$fKâ 7Wg`kw`T\MT˩x?גoz*^5[EAuoUӳYw)(aDq '}(ⴏ?,ڂ"725$!5; ;uq䑊! FdR[1KA5|H,aZE+FiBa_v׸SH֒Kc7 {'yG/K$ <> .< ī=% "h1k$ :ɣ̺n~ :g-%[/ sGBmE^CV*Q n]ϣ D֡W*^J{NfhXF `K+ HsLby֪H=e Yq-ya@- DoCeŸB#D ƺ\)[Xun>0.8BRŴ&yM;PrZxiD@o%d?Yņ2H3gUX9Ykw5E!fltqf=k ˗ eH`j)8XG)-0K/6MS6m? OT{c8I) dzjI WPxeֱ>5톟j/D J}/[VWx7Y ~'m4Ģ&$v,zv%ʟjvwO5;dBqF48xlhفeos!=;o6xNtG>P˷//~OB®s%;y,ݍ-?- 7Y郢J|AI 9Ga_~GHx|2wQ׷ []Z?|9vYXr8:9&9O'Cq]k*?_՛@t_&{;noillZi\(9Bgl&Khz-efeԝ%2:F0="_&GtQkfU`S zv_ŐlkW:]]?@: ̶0:DFRJ#]㱊\M᳉v=M^T}e/nLs mǤX +oʰL)uUB~GaF=}.eQҬ+D #Hfҗ)FY a>,J#Ӿ&Qٖ#L \*~Dxl/,wwDZp?3Oqp`[L8~xrs%&3훗΁i;Gv3—@sH,=W4@L-[naϨ[v)a9$2K*9G[-"Ò+GkvUߘϣ7jFYLQ,3E9]̋$^6qWot)3=u$=Pː >%_ȻNñjXk^߯7迺;9E"FMFz> Ǔd>tynzV/hcS^ˏd7`;@Tj|ts/jQ#HTpѰ^OW˱ZRolkB(e/[>Wvrn~Kgj~?? GD/4Q|29eJ0ӳdh8r#FITZ@if1249LItl8uf0>;φ%p|r20:I NN߃͢-Qh4:@.fyцRIat6[&h@L\)ݡ.'NM>/͵f2NAwK0<$iz0g rԱ<YTT޸hr' l9e pN#o;qZ蟕؝›*ٓ[m&^S~od({jMRƷᾙZ~d\ sS& vTW*w_|R8{>:YW15s2usage: %s [-eiuy] [-c cylinders -h heads -s sectors] [-f mbrfile] disk -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].ieuf:c:h:s:yPlease specify a full geometry with [-chs].Can't get disk geometry, please use [-chs] to specify.using builtin MBRUnable to read MBRerror initializing MBROffset: %lld Enter 'help' for informationfdisk:%c%d> Invalid command '%s'. Try 'help'. Aborting changes to current MBR.Do you wish to write new MBR?Do you wish to write new MBR and partition table?Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s: [%u] %s is out of range: %c%s%c %s is invalid: %c%s%c %s [n] Partition id ('0' to disable) [%X - %X]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: %s is not a character device or a regular fileDIOCGPDINFOdisk too large (%llu sectors). size truncated.Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d marked active. Partition %d flag value set to 0x%x. %s %s Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %d. error writing MBROffset: %d Partition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsPartition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorPartition offsetPartition sizeIn memory copy is initialized to:Use 'write' to update disk.invalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\((%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionCan't use small fgrep with -wbinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsets0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxyLine is too big to processBinary file %s matches umountfsusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s Bad MNT RPCafh:t:vmain$ 04<H$PX`hh@usage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %sunknown user id: %sunknown group id: %ssl9xu:g:m:o:stat %snot an MSDOS filesystemcheckfsfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't get resource limit to max data sizeCan't get resource limit for data size-b %sInvalid option stringusage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] dvpfnyb:l:T:t:%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%susage: sha256 outfile usage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:sodumpinet6_makenetandmaskgetaddrprint_rtmsgmonitorȆGԆȆЅЅЅnetname6routenamep_flagsp_rtentry0123456789abcdefUGHRBD M@dmCXLS1@2 3cPTdefaultconnectedstaticospfis-isbgpbad label: %s is %sking bula sez: set_metric with invalid keyset_metric: %s is %sinvalid table id: %slabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; 128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtable sockaddrs: locks: inits: route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8d%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8d%cso_dstso_gateso_maskso_genmaskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketmust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %snetmask missingnet: gateway %sentry in userouting table overflownot in tableroute-sysctl-estimateactual retrieval of interface tablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)got message of size %d on %sno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:vrouting table %i/dev/nulladdblackholechangecloningdstencapexpiregatewaygenmaskgethopcountifaifpjumbolinkllinfolocklockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s %-6u/esp/ah/ipcomp/ipip//use/require/acquire/deny/bypass/dontacq//in/out%-*s %-5u %-*.*s %-5u InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesspd-sysctl-estimatesysctl of spd Encap: KMGTPftp://http://file::/Can't allocate memory for URL decoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy URL.Malformed proxy URL: %serror in base64 encodingCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%s %s%s Writing HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Extra `@' characters in usernames and passwords should be encoded as %%40Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin: %slocal: %s: %s%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %s [-o output] ftp://[user:password@]host[:port]/file[/] ... %s [-o output] http://host[:port]/file ... %s [-o output] file:file ... %s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dEegik:mno:pP:r:s:tvVnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiimageebcdictenex%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. mainusage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): main$ 04<H$PX`h@h0@usage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreload5dl0"t00|000%H000'0 0) 0&,0t0#1$1T11 101 81 D1!P1X1 l5[p5|5,555555555555555556$6أ06<6H6T6`6p66666أ66 67 7أ707D7\7l777677 778 808<85H85T80p858588858588  9$989P9l9p99أ9 9 9909090::5(:<:L:5d:5p:5|:5:5:5:5:5:5::0;0;0;0(;0@;0L;0X;5d;0t;0;0;0;0;0;0;0;0;0;0;0;0<0<0<0(<04<0@<0L<0X<0d<0p<0|<0<0<0<0<0<0<0<0<0<0<0=0 =0$=00=0<=0H=0T=0`=0l=0x=0=0=0=0=0=0=0=0=0=0=0=0>0>0 >0,>@>0L>0X>0d>0p>0|>5>0>0>0>0>0>0>0>0>0?0?0?0(?04?0@?0L?0X?0d?0p?0|?0?0?0?0?0?0?0?0?0?0?0@0 @0@0$@00@0<@0H@0T@0`@0l@0x@0@0@0@0@0@0@0@0@0@0@0@0A0A0 A0,A08A0DA0PA0\A0hA0tA0A0A0A0A0A0A0A0A0A0A0A0B0B0B0(B04B0@B0LB0XB0dB0pB0|B0B0B0B0B0B0B0B0B0B0B0C0 C0C0$C00C0DHCPOFFERDHCPNACKBOOTREPLY%s from %s (%s)%s from %sno memory for info stringpretty_print_option: bad code %d%s: Excess information in format string: %s%s: no size indicator before A in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: expecting only %d bytes: got %d%s: expecting %d bytes: got %dUnexpected format code %ceof in string constantstring constant larger than internal buffernumeric token larger than internal bufferappendbackoff-cutoffbootpdenyethernetfddifixed-addresshardwareignoreinitial-intervallink-timeoutmediumprependrebindrenewrequireretryselect-timeoutsendserver-namesupersedetimeouttoken-ring%s line %d: %s%*c^ RTM_DELETE write: %sshort RTM_DELETE write (%d) DHCLIENT DHCLIENT %dcreating route label: %screating route label: label too long (%d vs %zd)default route socket: %sRTM_GET of default route: %sget default route read: %sno data from default route readdefault route read rtm: %sadd_address: imsg_compose: %sadd_route: imsg_compose: %scleanup: imsg_compose: %scleanup: imsg_flush: %sdelete_address: imsg_compose: %sdelete_address: imsg_flush: %sflush_routes: imsg_compose: %sflush_routes: imsg_flush: %ssocket open failed: %sSIOCDIFADDR failed (%s): %sdelete_addresses getifaddrs: %sRouting Socket open failed: %sfailed to add default route: %sSIOCAIFADDR failed (%s): %s127.0.0.1routes buf malloc:sysctl retrieval of routes:route cleanup failed - %s %s (msize=%zu)opening socket to flush routes: %ssysctl size of routes:%d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81relay-agent-informationoption-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120classless-static-routesoption-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143tftp-config-fileoption-145option-146option-147option-148option-149voip-configuration-serveroption-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180 08`Q<  QH`[~ [~Q`@@<@TU Qt bQttA QkAQzy(Qzy(  e`FAQf`&Qf`&Qf`&a AQ1Q~&7Q7b e@AQ1Q> Q> c CAQ1Q1Q1d >UtAQ7Q7Q7e :p)AQX8QX8Q/8f $TQf9QQ  9d!Q+G'Q+G'Q+G'!Q+G'Q+G'Q+G'!!Q+G'Q+G'QVXB3( !Q+G'Q+G'Qu4ʁ!Q+G'Q+G'Q+G'爽!Q+G'Q+G'Q+G' }sm!Q+G'Q+G'Q+G'G!Q+G'Q+G'Q+G' #!Q+G'Q+G'Q+G'/P!Q+G'Q+G'Qx5!!Q+G'Q+G'Q+G'~!Q+G'Q+G'Q+G'aQ+G'Q+G'Qy82;!Q+G'Q+G'Qy8EUaQ+G'Q+G'Qy8N g!Q+G'Q+G'Qy8ͫAaQ+G'Q+G'Qy8 i!Q+G'Q+G'Qy8)|aQ+G'Q+G'Qy8Fm!Q+G'Q+G'Qy88vaQ+G'Q+G'Qy8^,!Q+G'Q+G'Qy8X1aQ+G'Q+G'Qy8Om!Q+G'Q+G'Qy8ipaQ+G'Q+G'Qy8oǢu!Q+G'Q+G'Qy8%aQ+G'Q+G'Qy8 2!Q+G'Q+G'Qy8BvaQ+G'Q+G'Qy8!!Q+G'Q+G'Qy8p\aaQ+G'Q+G'Qy8 }1!Q+G'Q+G'Qy8 aQ+G'Q+G'Qy8 -!Q+G'Q+G'Qy8 dХbaQ+G'Q+G'Qy8 q!Q+G'Q+G'Qy8 O@saQ+G'Q+G'Qy8 t!Q+G'Q+G'Qy8 p-aQ+G'Q+G'Qy8 !Q+G'Q+G'Qy8 6aQ+G'Q+G'Qy8w!Q+G'Q+G'Qy8OaQ+G'Q+G'Qy8!Q+G'Q+G'Qy80maQ+G'Q+G'Qy8^!Q+G'Q+G'Qy8zgaQ+G'Q+G'Qy8!Q+G'Q+G'Qy8~δaQ+G'Q+G'Qy8DG !Q+G'Q+G'Qy8*aQ+G'Q+G'Qy8W!Q+G'Q+G'Qy8 AaQ͑'Q͑'Qy8p(x!Q͑'Q͑'Qy8/SaQ͑'Q͑'Qy8 !Q͑'Q͑'Qy8ghaQ͑'Q͑'Qy8J!Q͑'Q͑'Qy8x%aQ͑'Q͑'Qy8!Q͑'Q͑'Qy8&DaQ͑'Q͑'Qy802!Q͑'Q͑'Qy8(sfaQ͑'Q͑'Qy8N!Q͑'Q͑'Qy8Ш=aQ͑'Q͑'Qy8QK!Q͑'Q͑'Qy8JfSaQ͑'Q͑'Qy8W!Q͑'Q͑'Qy87aQ͑'Q͑'Qy8G!Q͑'Q͑'Qy8-aQ͑'Q͑'Qy85O!Q͑'Q͑'Qy8&aQ͑'Q͑'Qy82&!Q͑'Q͑'Qy8 =aQ͑'Q͑'Qy8DA!Q͑'Q͑'Qy8ԏaQ͑'Q͑'Qy8`0!Q͑'Q͑'Qy8$w)*aQ͑'Q͑'Qy8-kq!Q͑'Q͑'Qy8aQ͑'Q͑'Qy80!Q͑'Q͑'Qy8JaQ͑'Q͑'Qy8GT!Q͑'Q͑'Qy8=haQ͑'Q͑'Qy8!Q͑'Q͑'Qy8qaQ͑'Q͑'Qy8sﳶ!Q͑'Q͑'Qy8;HaQ͑'Q͑'Qy8$R!Q͑'Q͑'Qy8`aQ͑'Q͑'Qy8R!!Q͑'Q͑'Qy8ZaQ͑'Q͑'Qy8Ơ#(!Q͑'Q͑'Qy8;gaQ͑'Q͑'Qy8 |!Q͑'Q͑'Qy8 saQ͑'Q͑'Qy8 `!Q͑'Q͑'Qy8 _0aQ͑'Q͑'Qy8 WР!Q͑'Q͑'Qy8 [aQ͑'Q͑'Qy8 !Q͑'Q͑'Qy8  aQ͑'Q͑'Qy8 Km!Q͑'Q͑'Qy8 aQ͑'Q͑'Qy8N!Q͑'Q͑'Qy8Njx aQ͑'Q͑'Qy80?!Q͑'Q͑'Qy88!Q͑'Q͑'Q A6 ć*Bu!Q͑'Q͑'Q<6 sBuaQzy(Qzy(Qy8 ?!Qzy(Qzy(Qy8<aQzy(Qzy(Qy8m$!Qzy(Qzy(Qy8߁!Qzy(Qzy(Qzy(?_:!Qzy(Qzy(Qzy(?RJ9OaQzy(Qzy(Qy8 !Qzy(Qzy(Qy8GaQzy(Qzy(Qy8(*K~!Qzy(Qzy(Qy8(P&aQzy(Qzy(Qy8>!Qzy(Qzy(Qy8{aQzy(Qzy(Qy8w!Qzy(Qzy(Qy8tפ!Qzy(Qzy(Qzy(<!Qzy(Qzy(Qzy(=*K!Qzy(Qzy(Qzy("IW!Q-Q-Q-"Mp7m!Q-Q-Q-4n!Q-Q-Qy8f6p̪ OnҦ 6|O^[ĉ/}BW|*wiI9Ø'lo@ . ..GMAKEDEVHconsoleI ttyJ memKkmem MLnull MMzero MNstdinMOstdoutPstderrQksymsMRklog MSbpf0 MTwd0a MUrwd0aMVwd0b MWrwd0bMXwd0c!MYrwd0cMZwd0d!M[rwd0dM\wd0e!M]rwd0eM^wd0f!M_rwd0fM`wd0g!Marwd0gMbwd0h!Mcrwd0hMdwd0i!Merwd0iMA ...B . ..C binDmdec[sbin[share[C .B .. ftpgrep8fgrepegrepgzip8gunzipgzcatless8more8\sedD .B..E ...F ...option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251autoproxy-scriptoption-253option-254option-endtime string too longinvalid time string%w %Y/%m/%d %T UTC%w %Y/%m/%d %T%u %Y/%m/%d %Tunparseable time stringtime could not be representedBogus number: %s.Bogus number: %s: digit %d not in base %dvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dExpecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.expecting a network hardware typefilename must be a stringno memory for string %s.dispatch_imsg: imsg_get failure: %sbad IMSG_DELETE_ADDRESSbad IMSG_ADD_ADDRESSbad IMSG_FLUSH_ROUTESbad IMSG_ADD_ROUTEbad IMSG_HUPshort IMSG_WRITE_FILEbad IMSG_WRITE_FILE (%zu)received unknown message, code %dcannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp fileline too longcannot seek temp filecannot write temp filecannot read temp fileunexpected end-of-file& no previous commandinvalid pattern delimiter\  \abfnrtv\cannot read stdincannot write filecannot open output filecannot close output filecannot read input filenewline inserted newline appended cannot open input filecannot close input fileshell access restrictedinvalid mark charactered.hup/ed.hupno current filenameinvalid filenamefilename too longno matchnumber out of rangeinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableHOMEcrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s usage: %s [-] [-sx] [-p string] [file] unbalanced brackets ([])trailing backslash (\)no previous patterninfinite substitution loopnothing to undocopy_link%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory lchown: %sutimes: %schown: %schmod: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %soverwrite %s? [[[1/D,0[[[\Y`Y[[[      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs[\[ \\(\4\H\X\[usage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfhlNnqrtVv] [-o filename] [file ...] usage: %s [-fghqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimes: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gzZgzz123456789ab:cdfghLlNnOo:qrS:tVvcfhlNno:qrtVvfghqr1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... group is %s: %suser is %s: %sHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %smakeentrylinkupfileerrordirscaniblockckinodecheckfilesyspass2pass2checkpass5setup$,8DLTdlt| o`  @ catchinfocatchquit?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%llubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %llu to nextinode %llu cannot alloc %lu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing %lld,conversion levelcannot do level %d conversion usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:EXCESSIVE DUP BLKS I=%llucannot alloc %u bytes for inoinfobad direct addr: %ld bad indirect addr: %ld INCORRECT BLOCK COUNT I=%llu (%ld should be %d)too many inodes %llu cannot realloc %zu bytes to %zu for inoinfo phase 1, inode %llu/%lluphase 1b, inode %llu/%llu%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %llu/%lluDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %u bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %llu out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK %lld (%lld),   delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcannot disable lid suspendcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %lld sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %llu out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d sectorsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemwarning: fsck_ffs will need %lluMB; min(MAXDSIZ,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d checkrm_overwriteusage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %llu): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:p\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s' ..."usage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] Eae:f:nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtvȕ Е( ԕL P    |   P    , 8 @ D (N HPc_umask *  ,:   , 8# @ H P X d l, t( |`" ) 8$ ,:  p>    l-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$tx  t f0cDdTsdlxmnpx_modex_search_histkb_addx_bindx_emacs|[ dn  ̛ P | { | ,{ @v Tl `n hd 0 Hx| x>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():hist_initj_printP`lxdoppromptyylexIFS= ${PS2=> } ${PS3=#? } ${PS4=+ } l(Xgmatchgetoptionsac ̬eԬܬiklXtmCnf$,tb4u<HPprGs\hhvpxxdo_phys_pathshf_vfprintfdlt|  0   бE{}P ]]<>!let||&&()str_val| (9@    $08@HP@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'ls:usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directoryCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tainvalid file modeusage: mknod [-m mode] name b|c major minorusage: mknod [-m mode] name ptime: -%s unknown optiontime: -%s requires an argument:p%s%*lld.%02ld%s%s%*lldm%lld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numberugorwx%#3.3o augo=+-rwxugoXsbad masktrap -- bad signal %sprsu,nothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unsetmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited unlimitedinvalid limit: %sexceeds allowable limitbad limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS"#$&'()*:;<=>?[\]`{|};|&()`+@!fileglob: substitute errorFPATH nothing to yank yank something first I-search: duplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return codebeginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $(<) input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlcheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id\%c%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextracealnumalphablankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s unexpectedtoo many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --derive_key_pkcsbio_diskinqbio_createflagsbio_parse_devliststr2locatorbio_changepassbio_deleteraidbio_createraidbio_blinkbio_setblinkbio_getvolbynamebio_setstatebio_alarmbio_inqmainInvalid keyInvalid saltToo few rounds: %dcan't specify passphrase file during initial creation of crypto volumeinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: invalid AOE dev list: use nic,dsteaddr,shelf,slottarget not specifiedunknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKTarget %s: %sBIOCINQBIOCVOLBIOCDISKDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEinvalid alarm function: %sBIOCALARMalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuild%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s FailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial%11s %-10s %14s %-7s %-6s <%s> %7s %-10s %14s %-7s %-6s '%s' usage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:svu:need deviceneed -c parameterneed -l parametermust use bio deviceusage: %s seconds do_movemainusage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longeval5syntax error|&=<>+-*/%:()non-numeric argumentdivision by zerousage: %s [-M core] [-N system] M:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFmainusage: %s [-s] [name-of-host] sethostnamegethostname/etc/networks/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[0.0.0.0::::1/etc/group/etc/spwd.db/etc/pwd.db/etc/ethers%02x:%02x:%02x:%02x:%02x:%02x  0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad base HOSTALIASES/etc/hosts;#nameserverlookupypsearchinet4ndots:RES_OPTIONSoptions LOCALDOMAINsearch lookup bind filenameserver 127.0.0.1ASR_CONFIGlookup file %d.%d.%d.%d.in-addr.arpa.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.ip6.arpa.no spacebad domain namedomain name too longbad dlenlogout/var/run/utmpimsg_readmsgbuf_writereadlabelfs[[[[[[[\[[ܪ[[[`[[/dev/diskmap%sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in label%s%s%s%c%s%s%slogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%o%s: bad entry: %s@BKMGTPE0B%lld%c%lld.%1lld%clogwtmp/var/log/wtmphmac_sha1pkcs5_pbkdf2\\#tgetentTERMCAP/usr/share/misc/termcapTERMPATH.termcap /usr/share/misc/termcapOOPS5MS7) longjmp botch. inet6_rth_reverseargument buffer overflowunknown/invalid errorno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failureinvalid value for hintsresolved protocol is unknownfstabscanxxswinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d %u.%u.%u.%uSHA256EndSHA256DataSHA256FileChunk0123456789abcdef<  (08<DLT\$dltSignal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2THR[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL@LX`lt ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaqueBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocks P$(,0P%m/%d/%y%Y-%m-%d%H:%M%I:%M:%S %p%H:%M:%SESTCSTMSTPSTEDTCDTMDTPDTABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/regerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***/etc/ttyssecurertsctssoftcarwindowttyname_r/var/run/dev.dbPOSIX_V6_ILP32_OFFBIGPOSIX_V7_ILP32_OFFBIG-lpthreadreadpassphrasetcsetattrglob2authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problemauthunix_create: out of memory t| ,8D\p|4H\tt| ,8D\p|4H\tHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread ASTunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s/etc/services,/asprintf%h %e %T clnttcp_create: out of memory Hb0b1ncdtscsbpxbxfxoxtxdxgetentcgetnext%s.dbtc|:/etc/protocolsSHA1TransformSHA1Padexecvpeexeclpexecleexeclexecvp: : path too long xdr_array: out of memory  @\x$@`x,RPC: (unknown error code)%s: %s - %s ; errno = %s; low version = %u, high version = %u; why = (unknown authentication error - %d); s1 = %u, s2 = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)perrorxdrrec_create: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathؗҜ<3#I9=D2[%Cod(hinityanMD5Pad0123456789abcdefInfinityNaN\^[Yy]^[Nn]yes646NONEUTF8$(,048<@DHLPT\hp4xSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y__stack_smash_handlerstack overflow in function %sconnectlog_r__vsyslog_r/dev/log_rsyslog%s: unknown facility/priority: %x<%d>[%ld]Error %dlibcUnknown signal: Unknown error: _catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%l.%c/%N.cat:/usr/share/nls/%l/%N.catLC_ALLLC_MESSAGESLANG 4H`x 4Xhx(@ Pt(<\t(HXp $Hl(<Tx<Th(DUndefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supportedt| ,8D\p|4H\tvsnprintf !#&(*-/14[[[[[[[<[[ABCDEF7yACnF?O8M20HwZ?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ inet_pton01234567890123456789ABCDEF0123456789abcdef""too small ((((( AAAAAABBBBBB   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%$sniglet^&isatty__put_page%s/_hash.XXXXXXHASH: Out of overflow pages. Increase page size tzloadmnGMT/etc/localtime/usr/share/zoneinfoposixrules,M4.1.0,M10.5.0abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual pageasctime3JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat??? ??? ?? ??:??:?? ???? %.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s _conv_fmt$(,048<@DHLPT\hp4x-0%2d%03d%e-%b-%Y%04d%a %b %e %T %Ywrterrormalloc_initmalloc() warning: unknown char in MALLOC_OPTIONS recursive callregions_total not 2^xinternal struct corruptmunmap/etc/malloc.confMALLOC_OPTIONSmalloc init mmap failedmunmap roundmalloc cache underflowmalloc free slot lostmalloc cache overflowbogus pointer (double free?)bogus pointerguard sizemprotectchunk info corruptedmodified chunk-pointerchunk is already free in free():free() called before allocationmap roundmalloc cachepp & bits in posix_memalign():mapalign bad alignmentmapalign round in calloc(): in realloc(): in malloc():arc4_stirsnprintf[0,`ȣxأ  0n4(w,8X@H-Ph{Xx`xhjt,||\\\OȤФܤ`Y YYbX3 (lN 0Д 4 8 @|  H  L P Xܳ ` d ll t unblock and -DNO_CONV?@Xhp[[[[IJ[(7[زز[ [ @ [4@@[[LH1м|^t0 Non-system disk Press any key to reboot NB:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:qr:s:t:u:d`ltt|8hTd8P /tmp/EdDk.aXXXXXXXXXX $,8DLTdlt| o`  5 !   &'LTL$!$  l&'LT5n> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is not a regular file (use -f to see it) is a directoryaĬb@p( B,TcxdAԭeT$8fXpF\gܮ(hX\xiP(ԯj+ J!h<KT|Lm԰n"t,pH *P )LqLXr"s!`H`S!u"ę̲VD(w"$Xx(&XAгy|z,D"%d~!lp?%#`*ȴAԴd Dh... (interrupt to abort) (press RETURN)|С 444 Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUH8Lt|<h@(dآ  0dxl  Q@P`hxABx;CDEFGHUsV ab~cefhiLl,n8q@qHrTs`vpw|xuLHtP L    tбh (08tDL !"|#X$`%|&l',u()p*x+,-./01234567[,Dp$Lx priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHMPLSUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC SRCMASK LABEL<NOOP 9 dF t[&( 0(EHC P E(  0(EHDHC |DhJH[R ... ...^^^_I $ 04<H$PX`h@h@@@%s: can't read disk label; disk type must be specified...... ~$~(~0~  4~8~<~D~L~4T~`~h~~{}abcdDgGhHilnNpPqrs tw xy !:#=2 28 P l( 4X(I @ @8DLdȪت 0DTdpd(P |`0 H++,ĭ,̭@,ԭh,ܭ, ,,w-0-X-] _ xx:xx:xx:xx:xx:xx0000000000000000 ̬[[[ĭ[̭[ԭ4[ܭ[ [[w4[<[X[[ptx|`.   P        x $(,04w 8!L"\#h$t%&'()*+,--..//p0123 4(50647<8D9P:L;X<h=t>?@[\\]^^__(`8{D{X|h}t}~GMT 0LXpJ|  $ @L d> p|[$++,ĭ,̭@,ԭh,ܭ, ,,w-0-X-DHTXt?[` $,8DLTdlt| o` mfl?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ĭ̭ԭܭ  w@|x\Pt,T\8:T\L; T\`<D,D\LHxHHLLHRQ R(R0RVTYXTXXWWXVVk17[( ^}5 am+}Q,f>Zb^ "qc فCa? ))F "_Ae'ï'ڙJ.Є,ya[/I E c iC/<ODEڪܵ`zNIi7!3-vf&yS 9\g/2D+& +z#ӴDžO'd} LP]${iCD ;njj˔2: <R Vn [)ؽmvL10 S>xHqcF)ٌ^=k . .. pppfirmware0group( protocols(d<passwdtmpspwd.db services(asswd.origpwd.db fstab  resolv.conf( hosts  ...ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP  .B.. .B ..misc[Ekeymaps . ..termcap . .. bsd base54.tgz comp54.tgz etc54.tgz) man54.tgz) game54.tgzroot:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin  . ..chowndhclient.( disklabel(dmesgfdiskfsck8 fsck_ext2fsfsck_ffs.(ifconfig.(init8mknodmount mount_cd9660-( mount_ext2fs-( mount_ffs( mount_msdos mount_nfs(newfs newfs_msdosping8ping6reboothalt8routertsolumountsysctlbioctlwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _btd:*:94: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: _iscsid:*:102: dialer:*:117: nogroup:*:32766: nobody:*:32767: ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs $user (cd /mnt/etc/skel; cp -pR . /mnt/home/$user) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 /mnt/home/$user /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | ed /mnt/etc/group 2>/dev/null fi if [[ -n "$_rootpass" ]]; then _encr=$(/mnt/usr/bin/encrypt -b 8 -- "$_rootpass") echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd if grep -qs '^rtsol' /mnt/etc/hostname.*; then sed -e "/^#\(net\.inet6\.ip6\.accept_rtadv\)/s//\1/" \ -e "/^#\(net\.inet6\.icmp6\.rediraccept\)/s//\1/" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi finish_up 31a930546c87ed08996333685abd824802de64b2c8852e6487fe7c563d7ab093 bin*Binaries Commands and Source//sbin/nologin1bintrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3]Xdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody vm,'> >operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootQLbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpTFTuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpn`n_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3MPBPnobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binrrootdaemonCharlie &/root/bin/kshn2rootdaemonCharlie &/root/bin/kshn3]Xdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody ul+&~==operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootQLbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpTFTuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpn`n_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3MPBPnobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n} dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E)0:ec=\E[%dX:ei=\E[4l:\ :ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:\ :kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:nw=\EE:\ :pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: he root password must be set." done questions user_setup set_timezone /var/tzlist echo fi diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;H;d;}' \ -e '/.*# total bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs);; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk";; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b f3a7af2b8609561147449feca01873f51a898728cb3b4788a5190681bcbd74f6 3d935c817830c87da99cf528112d7e04e3f2a85372481ddc6c466eb068629c17 #!/bin/ksh MODE=install . install.sub DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) _fsent= rm -f /tmp/fstab.shadow /tmp/fstab /tmp/fstab.* ask_yn "Use DUIDs rather than device names in fstab?" yes [[ $resp == y ]] && FSTABFLAG=-F while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK AUTOROOT=n md_prep_disklabel $DISK || { DISK= ; continue ; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || { DISK= ; echo "'/' must be configured!" ; continue ; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == none ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || { _rest=$DISK ; DISK= ; break ; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent="$_fsent $_mp!$_pp" done >/tmp/fstab munge_fstab mount_fs "-o async" install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF $(tar cvf /dev/null [A-Za-y]*) >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(ftp_time) && _now=$(date +%s) && (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(ftp_time)")'?" yes if [[ $resp == y ]]; then date $(date -r "$(ftp_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $SERVERLISTALL ]]; then _i= [[ -n $installedfrom ]] && _i="install=$installedfrom" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $method ]] && _i="$_i&method=$method" [[ -n $_i ]] && ftp -Vao - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed -e "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed)/" \ /mnt/etc/ttys >/tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; [[ -f dhclient.leases ]] && mv dhclient.leases /mnt/var/db/. ) hostname >/tmp/myname if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f ; rm /tmp/$_f ; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) (dmesg; cat $SERVERLISTALL; sysctl; route -n show; df; ifconfig -A; hostname) >/mnt/dev/arandom 2>&1 echo -n "done.\nGenerating initial host.random file..." dd if=/mnt/dev/arandom of=/mnt/var/db/host.random \ bs=65536 count=1 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 echo "done." apply if [[ -n $user ]]; then _encr="*" [[ -n "$userpass" ]] && _encr=$(/mnt/usr/bin/encrypt -b 8 -- "$userpass") uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:/home/${user}:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group echo ${user} > /mnt/root/.forward mkdir -p /mnt/home/ . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts" ;; default) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done fi } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local IFS=, bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -ne "$1") } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { ifconfig "$@" 2>/dev/null | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun)[[:digit:]]+:' | sed -ne 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts (($# == 0)) && { echo "No filesystems found on $_dev." ; return 1 ; } if isin "c" $_parts; then resp=c elif (($# == 1)); then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | grep "^ [a-p]: " | egrep -v "swap|unused" | sed '\''s/^ \(.\): .*/\1/'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { stty -echo IFS= read -r resp?"$1 " stty echo echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $cppid 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap _ask() { local _q=$1 _def=$2 _int _redo=0 _pid trap "_int=1" INT trap "_redo=1" TERM lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" read resp lock; rm /tmp/update; unlock if ((_redo)); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap ((_int)) && kill -INT $$ : ${resp:=$_def} return $_redo } ask() { while ! _ask "$1" "$2"; do done } askpassword() { while :; do askpass "Password for $1 account? (will not echo)" _password=$resp askpass "Password for $1 account? (again)" [[ $resp == "$_password" ]] && break echo "Passwords do not match, try again." done } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return ;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue ;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) ((${#resp} <= 31)) && break ;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full user name for $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed." ;; *) ((${#resp} <= 100)) && break echo "Too long." ;; esac done username=$resp askpassword $user userpass=$_password if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } function ask_until { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (($# < 1)) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." echo -n "Which one $_query? (or 'done') " [[ -n $_dyndef ]] && echo -n "[$_dyndef] " _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b (($# > 0)) || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [ "$_l" ] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } makedev() { [[ -z $(cd /dev && sh MAKEDEV "$@" 2>&1) ]] } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2 ;; done) break 2 ;; -*) _action=rmel ;; *) _action=addel ;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(vlan$_vl: flags=0<>*) ]] && break ((_vl++)) done _vd= ifconfig lo0 inet 127.0.0.1/8 while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (ifconfig netboot 2>/dev/null | sed -n '\''1s/:.*//p'\''; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan[0-9]* ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while ((++_vi < 4096)); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan[0-9]* ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan[0-9]* ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if ((_vi < 1 || _vi > 4095)) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || echo "up" >>/tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && ((_vl++)) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn ((nifs++)) : ${_first:=$_ifs} _p=done fi done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down -group dhcp 2>/dev/null rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' > $WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | less -XEN ;; *) _nwid=$resp ;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" ((_haswpa == 1)) && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep -q 'groups:.* dhcp'; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then echo "dhcp" >>$_hn makedev bpf$(ls /dev | grep -c "^bpf[0-9]") fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up if rtsol -F $_ifs; then echo "up\nrtsol" >>$_hn fi return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -ne '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $nifs == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _resp _routers route -n show -inet6 | egrep -q '^default[[:space:]]' && return _routers=$(bsort $(ping6 -n -c 2 ff02::2%$_if 2>/dev/null | sed -ne '/bytes from/{s/^.*from //;s/,.*$//;p;}' | sed -ne 'G;s/\n/&&/;/^\(.*\n\).*\n\1/d;h;P')) local PS3="IPv6 default router? (${_routers:+list #, }IPv6 address or 'none'): " select _resp in $_routers; do [[ ${_resp:=$REPLY} == *:* ]] && break [[ $_resp == none ]] && return done route -n add -inet6 -host default "$_resp" && echo "$_resp" >>/tmp/mygate } enable_network() { local _f _gw for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do ((nifs++)) if=${hn#/mnt/etc/hostname.} (ifconfig $if||ifconfig $if create)> /dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1 while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case "$af" in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" if [[ -x /sbin/dhclient ]]; then cmd="$cmd; dhclient $if" else cmd="$cmd; echo /sbin/dhclient missing - skipping dhcp request." fi makedev bpf$(ls /dev | grep -c "^bpf[0-9]") ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case "$dt" in dest) cmd="$cmd $dtaddr" ;; *) cmd2="$dt $dtaddr" ;; esac case $af in inet) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet alone is invalid" return fi [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a X"$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd=";route -qn add -host $name 127.0.0.1" ;; inet6) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet6 alone is invalid" return fi [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) if [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]]; then isin ${_f%${VERSION}.tgz} xbase xetc xshare xfont xserv && continue fi isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at " echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/' echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col echo return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp [[ $resp = n ]] && return shacmd="cat" [[ -x /bin/sha256 ]] && shacmd="sha256 /tmp/h" for _f in $THESETS ; do isin $_f $_get_sets || continue echo -n "Getting $_f ..." rm -f /tmp/h case $_f in *.tgz) ftp -Vmo - "$_src/$_f" | $shacmd | tar zxphf - -C /mnt ;; *) ftp -Vmo - "$_src/$_f" | $shacmd > "/mnt/$_f" ;; esac if (($? != 0)); then echo "'$_f' did not install correctly." elif [ -f /tmp/h -a -f "/var/hash/$_f" ]; then if [ "$(/dev/null 2>&1 && SM_ARGS="-s /tmp/etc$VERSION.tgz" [[ $_f == xbase$VERSION.tgz ]] && ftp -Vmo /mnt/tmp/xetc$VERSION.tgz \ "$_src/xetc$VERSION.tgz" >/dev/null 2>&1 && SM_ARGSX="-x /tmp/xetc$VERSION.tgz" done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } startftplist() { ((nifs < 1)) && return set -m ( ftp -Vao - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$FTPSETDIR" \ 2>/tmp/ftplisterr > $SERVERLISTALL echo -n $SECONDS >$SERVERLISTSEC ) & ftppid=$! set +m (sleep 12; kill -INT -$ftppid >/dev/null 2>&1) & } waitftplist() { wait "$ftppid" 2>/dev/null } ftp_time() { local _ftplist_sec=$(cat $SERVERLISTSEC 2>/dev/null) local _time=$(sed '/^TIME=\([0-9]*\)$/!d;s//\1/;q' $SERVERLISTALL 2>/dev/null) [[ -n $_ftplist_sec && -n $_time ]] && echo $((_time + SECONDS - _ftplist_sec)) } install_url() { local _url_type=$1 _file_list _url_base _prompt _passwd _mirror eval local _server_ip=\$_${_url_type}_server_ip \ _server_dir=\$_${_url_type}_server_dir waitftplist ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp if [[ -s $SERVERLISTALL ]]; then _prompt="Server? (hostname, list#, 'done' or '?')" sed -n "s,^${_url_type}://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $SERVERLISTALL > $SERVERLIST set -- $(sed q $SERVERLIST) _server_ip=${1%%/*} else echo "(Was not able to get ftplist from ftp.openbsd.org, but that is OK)" _prompt="Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$_server_ip" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue less -XEN < $SERVERLIST ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -n "${resp}p" $SERVERLIST) (($# < 1)) && { echo "There is no line $resp." ; continue ; } _server_ip=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) _server_ip=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done eval _${_url_type}_server_ip=$_server_ip set -- $(sed "/^$_server_ip/x;\$!d;x" $SERVERLIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (($# > 1)); then resp=$resp/$FTPSETDIR _mirror=yes fi ask_until "Server directory?" "${resp:-pub/OpenBSD/$FTPSETDIR}" _server_dir=$resp eval _${_url_type}_server_dir=$_server_dir if [[ $_url_type == ftp ]]; then IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi _url_base=$_url_base$_server_ip/$_server_dir if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp -V "$_url_base/") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -Vo - "$_url_base/index.txt" | sed -e 's/^.* //' | sed -e 's/ //') fi install_files "$_url_base" "$_file_list" installedfrom=$_url_type://$_server_ip/$_server_dir if [[ -n $_mirror ]]; then PACKAGE_PATH=$(print -r -- "$installedfrom" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") else PACKAGE_PATH= fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" '$MTDEVS' || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitftplist if [[ -s $SERVERLISTALL ]]; then _tz=$(sed -ne '/^TZ=/s/TZ=//p' <$SERVERLISTALL) [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue ;; "?") grep -v /. $_zonefile | showcols continue ;; esac while isin "$_zonepath/" $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols ;; *) _zonepath=$_zonepath/$resp ;; esac done if isin "$_zonepath" $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue resp=n [[ -z $_q ]] && ask_yn "Are you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d _locs="disk ftp http" echo [[ -s $SERVERLISTALL ]] && _d=$(sed -ne '/^method=/s/method=//p' $SERVERLISTALL) ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs" ; : ${_d:=cd} ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" : ${_d:=http} if ! isin "$_d" $_locs; then for a in http ftp cd nfs tape disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -n $method ]] && _d=$method sane_install quiet && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin cd $_locs && install_cdrom && method=cd ;; d*|D*) install_disk && method=disk ;; f*|F*) isin ftp $_locs && install_url ftp && method=ftp ;; h*|H*) isin http $_locs && install_url http && method=http ;; n*|N*) isin nfs $_locs && install_nfs && method=nfs ;; t*|T*) isin tape $_locs && install_tape && method=tape ;; esac done } run_sysmerge() { echo "After rebooting, run sysmerge(8) to update your /etc configuration." #if [[ -n "$SM_ARGS" || -n "$SM_ARGSX" ]]; then #fi } update_firmware() { echo "/usr/sbin/fw_update -v" >> /mnt/etc/rc.firsttime } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || $_fstype == nfs || ! -f /sbin/mount_$_fstype || $_opt == *noauto* || $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed -e 's/ro/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _msg _fail while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) || _fail="$_fail\n$_mp ($_dev)" echo $_msg | sed -e 's/, ctime=[^,)]*//' done 0)) || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $sshd_disableroot == y ]]; then sed -e "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config > /tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $ntpd_server != default ]]; then set -- $ntpd_server sed -e "s/^servers /#&/;/#server /a\\ servers $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf cp /tmp/ntpd.conf /mnt/etc/ntpd.conf fi fi if [[ $x11 == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi if [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]]; then echo "xdm_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d _xdmask=y _def ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi def=no [[ -n $DISPLAY ]] && def=yes if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" $def x11=$resp _xdmask=$resp fi if [[ -n $MDXDM && $_xdmask == y ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n ;; *) CSPEED=$resp ;; esac fi fi } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done $/\1/p') md_installboot $ROOTDISK if [[ -f /mnt/bsd.mp ]] && ((NCPU > 1)); then echo "Multiprocessor machine; using bsd.mp instead of bsd." mv /mnt/bsd /mnt/bsd.sp 2>/dev/null mv /mnt/bsd.mp /mnt/bsd fi [[ "$MODE" == upgrade ]] && run_sysmerge update_firmware cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats } ROOTDISK= ROOTDEV= PACKAGE_PATH= SM_ARGS= SM_ARGSX= SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" SERVERLISTALL=/tmp/serverlistall SERVERLISTSEC=/tmp/serverlistsec SERVERLIST=/tmp/serverlist WLANLIST=/tmp/wlanlist FSTABFLAG=-f for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot FTPSETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && FTPSETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") nifs=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed) md_consoleinfo THESETS="bsd bsd.rd bsd.mp $MDSETS" : ${DEFAULTSETS:="bsd bsd.rd"} for _set in base etc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="${SANESETS:-bsd} base${VERSION}.tgz etc${VERSION}.tgz" COLUMNS=$(stty -a | sed -n '/columns/{s/^.* \([0-9]*\) columns.*$/\1/;p;}') ((COLUMNS == 0)) && COLUMNS=80 : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR COLUMNS cd / umount -af 1>/dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig ((nifs != 0)) && startftplist echo while :; do askpassword root _rootpass="$_password" [[ -n "$_password" ]] && break echo "T8d0c59cd11f3cbd36c08dab354a30052392224e47423f9eb9924a1059b285ef8 1e6f3260ad0e670f1c24c98258637a0cc7e7dff163339b65e6e15108f168fd18 5a1ed8c930dd85befc3451ecf8bce1e140750abb6bf2063839c6c3bedd564115 xu0{0{0dB00oФA1ؤA܋2A3A80A0Aċ0AkA$0 A`0B0Al0A0 $B0(A0ķA0$A0,A04A02222222T552222221<112222222/5,E1 h7;T112 :2T5@'55$^2 ::28,512 Q32222222222222222222222l2l2222222 2222222222 ,:2 DW31 l541 :222222x3\<522x55p1n1D: :22222222 1 1 \1 12 :Y1122X15F105p;5222a21Dh2hc2ܑ1 1xo52 22225454525|$5("5(15$75 5 t85:5hD5h/55 55 T45\-5+5211\1\1\1c1d[1_18b1[1[1s1\1hm1<[1(r1q1L\10k0k0k kk@k kAAAAAA AAA$A0AķA4A8?8XL8hkp777P7hkLu777P7 j7Tj7hk}877P7q8hk)}877P7hk'777P7"7t%7#7#7hkp777P7`7Bkhk6 dXkkkkk<8Q @X,@kLkTk`k|kkkklkkD> >,>> >m= >> >,>0n=\>>>n=d>>>o=8>D>P>`n=> >8>n=>><>\o=lo=|o=o=o=h>>>o=o=>p=p=>D> >,>> >m= >@>H>T>0n=x>>n=n=n=n= o=o=\>d>p>`n=>>n=n=,o=:>B>,;>`=>H=>0=>x=><>؝==X=D====`==@=L===BBBBBBBBBBBB ABBB$B$BBB A,BBBBBBBBBBBBB A4BBBBBBBBBB AA0E>@T>L>S>HBԏ>@>H>P>X>L>><>>B`x>>į>>>B>,BT>B8<>B>>B0>B0d>B>B`?$B>$B8$?4B8,?B8l ?H???<?8?DB<@?X?V?X?>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy,C @ @@ @B-C-C-C-C-C$7CDv@q@dm@C*@@t@CCx2.symtab.strtab.shstrtab.text.start.data.sbss.bss.arm.atpcs0C !0T;(C`T|(.TkT;4TkT;9T;T;D(;pH  &=00CTkTk @3; 3pDl2P,4450@k0W<&Ao0wL>,x=>`F=D 5`y2 7pTk ,;,:|\I3(9XD= A&64A?::L4kaklw=v1Xg30a>k3,:48V3CT2T5DI,@0Y,Z1\87@6<w;$ 8h41?<@R>L\]5dx[4o<|kN@Xܤq\'7H4=tW971?h>p;@k<>$@3?dB08RH}0dk=z614<>(150 >D;24k>`|k [0 Lk&6&Q46T}p??`Qpp]l4o؍p$3P̱k2hk?Ll9l\\1K30@e5pl57;#C27?GkQ(1eD?z,0`X:l9,kTn>4L5L$5=8j=\0p<\$tp2ȹ0F>Z=ha0h?(wtk|>Hk$9 khCrt5t,8 4x=0k#0@9>hN9XeO8 pp~l?g4p34$rr @3p<<d5p2p(k h1>P h=L p@- 28 0<H :X 9=` 46pk &Cv |:< 1X @| H> k (< 6 48 43 `@  5D p3 $J;PB s1R PW9h \1Lx hc2 >x ,> k l2d ȀC0 `r l2H 0T 0h @P 7% 2t4 ?\= 7LH 1[ 41Pc 3x k ~7 @ \5$ *? 9@t p0 A 42 ^1P =2 (1HD `J:[ k4g @r <~ = DX5D 3X p 2 d?, J3 f0( :D H5 02 (+?& $|75 tkE =[ ,*:l |=lx 8 @@X P9 ;6D 1< 7H 0 @` \"4 >,a:d5"1/pk@;Qpa<: x:(@$|=  5 Įkl5T|5Է0$q1< pk0M=P'g: 7)@@L):D]H3td?0z0 L<\ AErx?4 3\83=dK6(L22u=61S=$x?  47p,,?9D@LP9$^3tf6s<}$1hru5hhr e@< kT26tY@>i3!1p13 ?<@8LO@ aTkk@}7tS>i1xp07^>@]>T9\ܽ2`1@8H?dx< #:3V@@>A|R(U6\e 6$oY1l}`5CkL2?LpkH*A>,=Xq `7d|S5@!X0/0rr>p=PQ6xX@/pc00v$C@kP?c>|*@erq$HW9s2PLp ;>/p%X101k<,%pC4O\n2 aHop<;20 }1h!@(1L-> Լq0`kk1\6?$*>@(k-4p<tpPJȈpS 3<dkn\?LZ>$0k`kX=:/p3<ȭ?0r Ԑ>|Ի9X&95Tj7`AT5`KpV`5 c6rN3~8^?@*:?@Wrx k@$,:dL]pئ>Dh2,6$64.%0<48C=kH4e2[ؓ1Dgn1Xrv1{`0D2"2Dg2O2`k8d7||$50n=3p<7p ;1 t%7@)1+=<>xZ0|U$= i@y0<46^@@r 1(>0\4>C8T2($?%`):600C6@tchrqn=q>lH>Pko` ؼq;l@B80}=5$ :0'p7H8<[1(H`kO1Z=pn0n=8D=9p,?hrk,>z@A@P<20+D7` 5/6>2HJkY>f(.3ptJ;~$:l26l"3T3 4tF2(%p4$2l\; J>Pp k10`) er=kMd0XCfn=xY9 =l5>h=tLȱk6z;$d7ȶ:D73 pP\:$f4t T*:/C2kH=<8M4X1cX3mk~P>hr;$xqd6Կ4P=TԶ60 >` ?  84(, pN=,= <3pH 1`T d1_ 0j ov 5A } 1( 9 ,k 1 $C6 ȏ4L ԣ= 8 @!30!}@#!1`/!T:d=!.?N!6X\!5k!|ps!=!L>!k!<!؞1X!|AH!7P!#>!J6l!y5H"6X"0#"G02"9xA"`.@Q"fr ]"нki"O6X"L< ":|" k"`1<":1"1@"k":p"er"5"$? #_?#:<6#DkF#5$P#D9e# 0Tp#hr#W9#h?#Tpr#p#,C#X5#@9x#k#D4#@,#М8#@$):T$DD>&$,r57$4J$pt2PS$f9a$?@p$5{$>1@$Y;$l: $\}p$@$l6$X1d$:>0$k%p %0%=40%D=@E%T@[% ;Hq%`1(%4%05%$4 %:<%8%Q3%k%/0(%n;H& 5 &<>4&1,%&k4&?H&hkQ&0`&\?h&w4&@1t&K<&h4&+=&3H&Ў=\&$;&87x&k '|k'(:l.'k7'h5J'V0(d'>xv'o=' 6x'd1' >'4:'$4L'k'lr'\0'$>(0\(hX?`$(@1(HS54>(p1I(X9W(T@Df(s;t(z4|(ܑ1x( 0p(n=( j5(8k($6T(Dk(<(@(n=)3H  )89=P)l2')TA 4)p4<)T0tN)<;d_)$00@n)Ay)8?d)̽k)C)?)k)n9 )3)q9)i5)*@h *TM>*d4l3*؈7A*>J*38a*7l*Z5Tu*P7*x]5|*2*x=4*<%?$*vr*@h*%4*4rr*t9 +4,@!+p++D4@9+>,J+z=(a+pl+Cv+pA+=X+9d+<1+Ԡ6 +5+بk+H`;d+T4 , :$,9",0.,><,l]pQ,x4 [,T&34d,ĀCn,I?4,Q>, 7$,8,= ,k,@;4,3,@(,@6P,Hp5`--6`-[1D!-k,-0$:-(kJ-pT- 2a-250o-=-$3 -m6P-54t-$3- :-4@-kp-o=-R:,.h< .,5.hr/.HA}7.`=tH.;|\.pg.tt1xs.`:4.`;d.&7\.p0.o=.pp.0p.V5<.2X.3.e4/ [9|/pk/0:2/`0@/A@E/H;0$U/ԨkZ/t= f/80hz/m=/,@/4r/?1/p/ 0l/Lq/d>/~=/̩k/`@p 0L< 0k502G0kV09,c0t57p0O3v0xo50k0Lk0k0P=,0/@ 0k01t08I:0?P1>01T01 >010$>1d>I1|?4P15\1Hd1h1`(@{1k1481Էk1mAx10010?1I>P15H102|1/@D1؏kH2\-5x2V12X><"2xk 12<0D23xO2 0HZ2Lkc2̓A u2܃r`2i92(0L22502<;P2 22P72t42\A2T=222k232P; 30<3Lk13k>31xN3A X38rg3@y3H<`3h\<3013 33X}23tT7,34`38D3130D4@?@4>%45L:44<E4|pN4097Y4l4=^4$:<k43lz4LH24`Z3414t3p4}p4ئ@4p34t004ܩk4*>414̇04,2 50o5_6d(5>?5kK5P3V5̾3[5,S=j50y5TP65`o58Cr 5=D5H^p55e96L4x6M560*600>606M6|2\V6P0d6D3dk6?=y6dm@6 '96hk46g0L60=>6,>61X6/?p656D2@6k7P77):0#7Xk$375x>7TkL7l>Z7LD7g7:14r7ط@7fr7ĩ?7o7P_<$7܋1X7L> 7M<07H87u07@7p70q8K9@ 8@@8<9d(8k48}=A8<$U8̱3\85pb8<3j81y84@8H>D80882 8p?8l=8><8̈=8L9hk:\ >L :<:X,J:HpS: 9@l:=z:܌4:x2 :hr:l&A:,O4<:`>:|z<:LwA:k;hZ9x;$@<&;k4; J5>;kE;hI>];@p;r;;;;0;;tA;e2X;H1d;Pj0;4X<h2<$k<=,<`69<ؽ0`L<$drY<XZ1xe<xE:x< 2p<1<t>P<4,<L0?h<Y:<\D8<t6<P><k=09H=I3$=pk#=>x1=\dr8:=cr0E=qN=P0<U=k[=HR>$m=@'5z=D==lr= 2=D>=1 =4=c1=Xo?=,o=9<>I3P>40%>H@p.>;<>m9\G><P>$<\>l<p>i>d>|5>\0>ċ0,>$6D>К4<>er>0x ?X~=?83%??6?6D?8@ArA+= AHx3x)Ak;A5HAؙ< SAH7paA A5HjA@f5rA>4Ak6xAx&1A9A}=A|1`A,9AT7(A\1A>Ak  B_1HBl4D%B$+A0Bx5;B4oxIB$?WB 2_B@4kB`n3uB`5 ~B@@$BW5@BLu7BkB4BԽkBP9BXCBu;B0%pB6pCkC1(%C?x4Chr@C0@0RC$>xkC01,xCI6lCkCkC45Cl0DCs=C1XC*1@CCC7xC@DD?l"D7<-D04?DG9PJD@5YD50fDApD ?yD1|D(A8xDf@$DFEZ0,`Et8>|qE;:E7t E'7LET1PE|1EPkEkE|E7pE5LEĞ3FkFH:8Fh[>3F'A;F3 IFxG3tSFhrdFX7nF@d:F91 F5Fl*;Fؘ6lF(@pF:,F04F1,FkG7lGЍp&Gd>5G,[1;GxcrPDGvrPG=]G X?\oG|4pwG3GpG@\GX2tG6G;Gl0G`@ HH~6HhrHIU5DI>I0dIoI3XI=I kI kJ:t JT.7)JD7p3J4j0JJP]pZJ9dJt'1XvJLz?J>J37pJ1JV>hJ04<J1JqJpJer K6K7:%KP046K?DDK`kLKP0ZK ;HiK`3rK o~K00TK>xK&pKp 5Kp4K1`KT]pK4M ;MP9MkMP6LMq8Mp3N\r NpW5@N+>!N;x0N>HCN\;SNF2@bN`8rN2PNU6<N kN@N@rr N6LNkN:@N@t7 NkOF1OhrOo(Oh@8O8HDOpUOd@thOk=wOX*AO1`O<~=O2@Ox: O0?O6OP/?OL5OkOkPdt;dPD4D"P4)PgP0x{P0P=P06tPd@P;P:P>P(k6P@k0lQ1lQ#6<Q:*Q0 ;QHkEQ`}pMQA8QH{7QkQJ6Qb>`Rk!Rį> -RY?4R0dBRB>|SRp=WRH(@hRO8xwRu:|R:RTCR8>`R\<R pRH7pR 7 R,2RqTRDrS*1 Slo0PS(1d%S|A9\2S5,;SF1PESPf2YS>gSAqSL%3~S3SȥkS@SPkSkS0spX SO3 Sp]pSlS>PS9 TkTN=8&Tx4L6TkFT4DMTP: cTT5DmTTqlqT?T<TcrTԴkTw@HT0kTH8pTh?0T5?T;T$91 Uk%U0@.UC 9U=PUl :D^UV?HmU|4=rU(3XU,E1U@kU'AU|3U'pU0U-?`Uķ>U(CU13\UkUZ;pVx^p  VHk*Vu09VerOVl16WVk`V04jV:lVpV<>VT:LV8K:V\pVT5HV4xVl=V:W,Y,pxYerY):Y@pYkY$5p Z4W?lZ:.Z98Z<00FZCQZ7aZtkrZ,>Z; Z4=0Z6Z1Zܕ?ZLkZpZP>Z\?4Z$&A [=D[ 7,+[kD[l1`N[kY[[@x[lk[3[H;[4x[d[14[X24[kp\\@\Dr+\9=7\@kE\:xQ\p Y\7e\po\|<z\ԏ>\5\`p\/9h\t3H\ 3t\G?\\%p\h3\\`Q7\@3H]l3d]Hw=$]\5=*]t@;]H,;H]lb9PR](w]:<]kp]F?]w;]6L])> ]H;<]da>X]t]@]Tp^vr^9)^|3H3^hrE^\:Xa^*Aj^:6w^D,_ж9`7_\Z5@@_4\_8e_`?4q_4%py_hr_*>D_0_44t_H1_{0_'A_hr_y@`_P @_\54_*1@_45 `@b6b̲1Db\o=bDrb8=xbxct;Dc5cp<4ckc>4c84c9ct0c\75<c9cL^pc0dL:4 dD9<-e: >e|m3 Ie:<fexe9el18e@f5f6D)f`k5f\?BfZ74Mf@d]fpeff8,pfkyfJ>fhrfd2pf8=Df1fO:df0f<':lg!6 gPb6g{2)gX6|6g=@RgЋ9ag6Dqg3zg|g Crgu04gogj3gs1g?$g@=dgx6Hg8>ht6D hP^ph0$hY? +h0hkhkhOi)pZig@doi@?pi*>i@ioi,i9`i{0i4<i5i5ih`jkjd00Tj@8jK6jC:kDCr  khk!k=9k9LDk@5dMk[9H[k(3pik|*prk=|k=kdCrk|P=4k|I2kAkY=$k1k(0k<;xl`l3hlx*4lи0%l:.l@;l<8?LlhW9Yl45 el:sl#A$zla;DltH64l)@lLrl4=0l?l(5l,3l=m9 m16Pm414mT9.m0h9mCAmH?(KmH @@Wm0P3|`mܳ1hm8@Lsm("58mt6Lm6mk mP:> m9(m4mU6PmLrr mermh4m3n3n?n,=0)n3=n,8Jn8 Vn5dan|@8nnȄ0n4nD>nZ?n|f>n5=<n5Tnԓ6nD < n>np o\>XoXrr$o5-o0=oT*4$Go8kWo;do5uop}oppo@oT>o6|o5oh/50o:<o6DoH$4pE;(p4<-pg>;p<FpL1<Lp?Up 5op.@0p(k=pkpp}ppXkpb>Lp5p0p8kp8Q0 q03q"q {?<*q=\9q /@0Tq<4_q8pq>,xqkqL6qh=PqkqP5q^@q8Y60qO=xqԸ9$q|8|q=@r|?prPk>p)rl@88r9Irk4DQr5arX5@kr\^6wrȗ2hr0Pr`@rO3r3rhm14rO>r8 r3sps0s:l.s@@sX<, tk!tte6x'tt0\tt\58t&1t 6t3ltX5tH<> tktD5,t+@hu ?8upk4u8=x5u06dKuh1Tu|:euX?wu@g>upkutkPuL9tu6uP@Xu =?u0uV=uovL6 vk$v|p.v$97v|L>Lv46 \v3Lhvp5Tvv(38vqvXB>hv@0v6Xvhkvh4Dvkvkvkv3vk$wM:8wpw >L'wxkBwJ<Twt6_wc@HkwtI8uwkwTq6hwx?Pw4h?wĬkw,:Pw'?w;wQ:wx6|w2px,2x<x̬k/x15(;xXq3,Fx9Tx5bx|pox5H}xtC xx5=Hx0@x8TA xB9px|<0x0x0lx=>x3Py4yiry=0yĹk,/z5>zD]pDz,m3PNz;@[zh6liz;@}zHpz6z=9zX7lzd0z6\z@z0oz?z5 {o{|p'{4@5{?@{n6\I{ȬkY{p0b{?Pi{ @pz{l;0{L8p{$q={>{0{/0P{,>4{6{o={q|>9|d9!|p(*|98L|2Y|kn|9=t| 4$}|vA|y:|3 |pP|pH3x|`8p|3| k|<9l|t><|@|t:, }@}]>`)}9P3} kB}w=Q}k^}wr4i}h2}-1}L{>}|o=}o;} 5<}6}3`}$N~kY~Ж3a~X23p~4X~ȇp~tl0~!p~\5D~(Y9@~&p~0~3~lr~S5D~D1O6, 4k&\rr7L67lA5LK7]:50i<'ApY5<|hL024 5hI48XBr :hirqkH@8h[6u2(8,54$?CX%2ST?d:uk>W7X5L8409@ǀ@?Ԁ_5$݀f9܋2`s3l;#k5 0`@kI4{2lSHra>,o7tq9<,dr:4ā0΁`-8pہ61P>8H ~=&01,53b6E@CMx> Z(9o.:~L0hس;|~=;?<؂t85(p1p?Pqq?4k ԩk&в2X4t3lCk@N :hqwir8do9=8kh4pȃkԃ@X4+@T 643(4?<0$? 8`"54B:,O(z;|]:i}08wL9PW3 q8o=_51HƄL3Єn@݄>Tql5?|=( H3*05043<A3J=Y>Lok~;hk(5pAk…,5$Ѕ@8D0::t>9htk&Y81hD50<3Fn=Y (A bx@o؄0D@k`A d@erȆPkՆa2!p?<?<?L3, @((R:|6ȹkICCOg6P]4=0dirxP"2T,k?$|km3XL@ɇt1pӇp8$އj3|?0@l=kP@$3Tk?0CL+=TXlrdu<v\0},2@pqT14o0H<;>DЈ4Lވ/5,H>Pm=k0C?&4/T6@7\58D2<TCWke0p~Ԡ@\Pr938|xT6É0Ӊ`?܉@Xq?4&1 h>r5 $W0;@GHD4hRk`جkp]1{>,dr;x\k W>H%pTd;LΊ\]p֊xp71 D A0 o*@4$9@$kH >Pkbhplkv00kt^:̶8Xqˋp֋{5N4Dg7@> ky:! >@40W9@5K(??Y6@gX2x00,[?D0,#?tdT?xq406̌2 Ԍg?\{? l+16lFr V@"2 *,r?6C?8F؁4M74WE?g>Tudq~)>;H:8`5P#7ɍL6Ӎ[<`414843@tp,*;@*ir9~=JW98S>^L>\kXL8vTU5D@м=2@pZ>85TɎ0D@َdqr\1@h6 4o"9038k;kELkO)>0Yhd5f@prhr~Xk84@̓<k=p͏,2p؏Hz,>p182,|3`@;o=Ր=ݐ9D;@ hot@!,5p.X=6U>0F"6 Q@0Z5dckoZ9@~/1`ĵ43@Xv54_;p̑5ّ7kHX6$k\1k"1,k;9N44X@fkp,3 b1`2H2x#@4h9\̒t;ے9p&9\LT@ xr X@Hٓk8?Dl2th>3 (6lhr!p/8`??Rp;(aP}8xlC(u@ >~;kT2O35=<d5p͔2֔2Pp;481t9$-Ƚ?@?S0:<jirwG=,=8t)A:<ɕ4hЕЪ3ؕ~=;;4<87,%7=h- 9Ch0,V԰>L`CyS@H(@^1@(@C0ӖK6<Xkt;x0L8=D xjr5#`64H+p==T7O]6^k<i$40xx2:@k4kX?dq—4= ȗ@oחfrx6k %@kh\3{3":2p>kJa14\kd?nĩkuka2 rL=h?8xG6U4]kiıkt4z|jr08X1|0$,K@pΙ$?֙De9X<,90 '7x*pL4x*ܨk >jrMkẎpeP5Hrt.4X3<@k8=d==ʚ?4њTb3ݚ5|,4` 92 44@k,H]p9?@`O(>`6hpܥk|p=9=45pk;7HÛ5Л1pޛD5@PC xk  <#>(; gr*er@t3IH2dT'6](2k2wlD2H@L~@@@34>pkʜG@lܜd[5(@lx2LQ3P8o C?-L>h9\4lD94 S4@aFrtD~=oxxhp l;9`͝4؝}=hY5@4ؓA k >L-H";X:t5KD(pSh``@6o6p|>=h\p$oD>hş}=۟L3=~= @<= 5&Q3.H86:\$?G9Z+=$iW44v?>P)5Xpk2k=П1lԠ 0ޠXpw1`kx>8>8kr,d]pB>,L84<b̝6@nk~,04khX<5lp]585pʡ$3ס G(6Vkbp 0 l0}>0l=4<,=TL;LǣԌ>%== > F@18Q`9i 7lvx}p~949|3 3=@k54PͦX>|ݦ1 >@ pU5D#Y9-8:m;xQ\p[02c1n1{4@@`X"@ @W9(A44ǧxZ8@ҧ(1>ة4Pk@|@:-/0BD7<Q?[;ld?x@2tClkx0\8,?xT=,p9Ĩ1d֨k\>:52H;1 7T10);H8$6DP;T1 a>m(F9{Z=P@@82h`~t0@C4@`2` )?l00 1׫x7ޫt2X>kH@L0(&<8?H <Z3aPkkv70P@HkpĬ=@7xĬ54ˬ=$߬tX9L%2XY?$R=$L07X0?DpQ5[U5De 2s!pS6`<\c6X,0ɭ<>ޭt]p0XK6<F5@ 6Xu?%p1dkEDdrU:idkv%< d1 ?4=0Hp,1ˮW5T֮v?ޮD50>S6!pd 0p)p#33hm>JܐpT,@p^=$r]5z4k<شk4k@k00 :į,X=ޯ`pp\p @<qAP\q(t53U9@^čpk\"3$u9~e>Px4`L?Ѝ=(:c3Ű&:\۰o6\lo@T>$6 d?l8v {;li7г(<> ڳ;h3Ȯ1(11L!6L7z2@C:> U9@j?`tА7}>Dj:P=s7DǴx0Ҵlo=%;(kh@|(4T&1$,840 @@6tMH?^vAll3@rD<~0\= |2?p*pȵ4lܵ9`.1h`rr>@@5p&k609ID4XHkhh5Hzܱ4h'A 0,p>t95|3`ն1ܶ|45,܌0@ K=6 k|=+95#5@H2K4kVx:c8b1pHkr_;$7=|J2Tn=n:ɷp?۷?P2=903 ؝=H83?>DG?<O H@[3li#ppow9, z:LE@6838>Ը:X9TE5`= h<> 3642T'A@@SC; aki0\1DhO4Dl2Dk'3ɹ,1 ֹ;l4:XI:d2+u042T)>,; =R9=Xt2g@=x7T0d?xl?>TLkrɺ55(׺|1ߺ,?'A H1D 806D02p `<':01k:;8JT0Y5(ef>|u?<05`10q@L6p2λT@Pٻ;?k\M=t';`=&dr/ n=AHkN`@`Y7DmA4|11TD>3<\0<μ|):Xro<>=,26D@4;XM0^fred&;8u@,7`2Tz0p6|]p4;ɽG5սo=3k8p\1$"p:\761<Tn=N5|\d=h;xhx54m:l7@.?H>@8̾1dھ$758kk=hg< 00|W9% 10%1,FlrNk[79iX$ArDr=`@$$;8W9οȍpݿx18kJ>P ,W5D9 k2p?@tM\9]v5hV:x>x$:P;4x04j0l|o2Do9Th3v@l2\3,4x#"2P30><\kFT @Rh2[8'4|k@\yx>M=,k9G=,d730k4*@ X>@k%00,:@@;W?g 7xtk>(<>k@d \9(?+<,e9M@53 1, 0<%;J@4Ww0_H>m0̦:q2n=@|`>А>k4`wA@[>&@`920E:,XM3d 5o@@X0&0(1 \C4@]56=005@``r>< 9 +8h5kCP>U4= [,i;jlpq:P2lH.6h 8H=<l@;;Hq4~0hLJ="2.$0T=h; K 1W9Hb2j@m@$ter6!?%A<98><7p0\ 3404'q7H3B4CR\=0\o9f4= jPkr~@< 2hp Ad\@`q &:@X2dkDW3 P_:hG9/U@T?4x:P3xY6hfxpvdp`4lxu9@1 85$Ē9<̆08;`v;4H6d ?\4=&5($l;0^1$7<> =x?Epk ^.xr:6`1A xkkԏk=:8h9T"7 >"5<8erWĜ4a@~8Hiku=\d%A4ܨ1 fr>T;\ ;4:Der k't545<1|ML@t\(1r&1@C? X?<, 04}; mAd>0?P#?p>l:L6X*!?0<,o=OP8p]N0Dgtktp?@dx?D<7H1<4?k109q;lhz@8kF> )p8)@Td30dk k=1%#08.$@`>?lK9a|i6qt2XD>D0H2k:dt48O<190LT3$k7i?D=Q42L=D?<+R86xo?T?R>:|h94x<]8l6(6(8>4(A:5P|oW683H3?5\=)|92LZ0,L|5T]ԏ0mІ5P{C1L%p 3=0 5{00*30@21b5 H=><`?<&Lp2D:DET>Sh9^P84l(>|y86P3=@to:`< o9o2( 2t$p$\5L`0<0; Xkr,k<P8K$kS)88^,3@gu:<uqX9D>}=T%;h0[54:1Q4HY>kTs? >`x4(04D5<470D!@Op\B><j0x@@d<@(?0p0k2 42pkD:` 9d$?\/(::*pI1=@O0[=Lmȸ28v$5<pl6842@0>h:0/7<@8P6>7d=<D7L*?|]klL:k4b8X{20=:l2lk\?\@? &=-8<@HFHR6V\6^P(?<jkPz܍p &AL=P%p/<84td2Pk=Ĵk ]p@ 5#D$700X6@Ck|aTkh L>pw3|lAp@kT9XH5p(2 4@01$r?HN<`$@&>4$@tLpY >h\=ydq6 xk=64@`4@??P8>p=ph;,3x1| 0H"H4*T02(o@E>Lk[pkd 5Tu>t;'ApT8pH3/@0D:@6$1Xf6 $9@k0't1$10ML<]lki3tvA|07<(6L:0L=8:kk1hCL1?h!4`31LA01P6b0o/:,} ;,kD2h3d|@,>kk2kA<,0p!:x/h=D<>4Sܝ>D\?,gx=$6Hl4T%p̣?1kp2TD0>=$= _?N=<^:n=0|7k3Ј0tM; pA?>ko|k\=k=(&1'x4/0?S?R<=0ppb2yH4q4P9=@D>l(oD)1<k< `n=*> E4@0l8K5(;')p:hrMkf0xer38\1?H=l:k4CDr 7?+t<5t0,B`qO4n6P]3c`0t;X*>@APm=`4<k@p;5?Ԝ3 ?N61 k2p,k%l0AT5K`'?\U50\j\=`{k@82L(4kt@P~=,f8 l>4tktq6P=>l2@,,i98<1<B8C<Ett5PP=,gP5,t`(1Ho=0U>Xk p$5L0p3t?0Dl7|`4AkMl:^|@lp@~Dr:</44#A$k8-1$n=p0, k >  ="H281h2@J|0STkZp3e3r1t~7L\1.@DH51P5pm2xdr=43ħ2$8)+?x4D:8Q:=Zpe8pu~=hq(\: D>,`5p9\1< : 3 lr6 3(x@8tw:Bxu0KH0^@:@XlR3u3084<kH>cr$L@;XF@$4 : 0d Hg?@0t49:> I9=O2f*pm\1zlI5k0O39 7HpĎp3'Adrr 3=DPpt4=iA&Y5<3\>`C0>lU\krd:\tԧq ,=$D33p@pprr N=P4180P\280T3d&p83@H+p730@l'ALt1T]h7;@i}=vp}pAmA|n=Y<V7k  >$P<,h2dM;\64 ^4?Dйk-548>NFr[khX6Dv?TW?l_=, L?9<p: P=8)4X0,"?h Pkk#2(2k?a5GpTu4[1`e?npsr~=ܽk :Lr/0l_>H4!Ap (O6\h78, :=؎pJd0(\B@Dq4Tx>1`d:l|6:l6,?Pk08?<د5'=9x@KT45(Xl3Lc6m$a2t}@z1x I11d?$<5P,K2w243<@0LLk=̹k#@p-`0H5:|B,=0Y8&1ikx{f;3e74120[1$k1`q3DD:q6  -5ďk"8@02<B`7KL4TL@d2k9w@K3~̙2p`krܼk1$%Avr43T&A75k k0k \\?2"lK>6d7xGP8TL3b0?4mk{<>dkr<kkHC:d?d0,f0,X8phkr}="=X4kC Y=`ZC_Ai>0y Z5<T?td<4> Aq|$p@K=`Hk_9L j74lkr D;t4d86&ȈC?6LN?Xc7l4j?<? Pk1)\<54\5?@?`Op\)1i:\"5m:\50vA<>]3h 4"00(\p4(j@Ad?lS 4]b3hv=w`482p@=>)A3<65L2Hq \ur̍p.H2<0kF@lX4g@Hx><2T[39@0+20p@l7Q3T0, P20 ^4, <D23$t@P>k 9 x?7P>7  V=*A% >.]p9R? It=<[$5epkru|0l;hHp+5p510?HD9p?8p[? =h58&`#445;>08Lp:5Y@$g1w74(k0O0pk0PA?t0*8d76@Ԭkd1`>4 (:<$.11R@@N=4MkWCd43j>w8 `@DX>@k303hl@4$;AP@(h2|d5` @p;(k72@G$(@ W)9 ad4Lj83y<k1$(lr,5|\0|\6$L:plp0 =(d#>}=>4$T">-̏kHwAR\ke0p)Avr$h4`urjA$p\6XkXa65toHk#h<81k$<0J4Q<2p[ Afȓ?`r,:2p}=7Lk@4 3HD9 `3Pl= =< L=-$8=(4>=<D1tU5c20rd3 @w=X5pԱkkx3<@Per$7\8p0p8(=/(45,91Ed>Su54_t04n1wl@$,lrw?l|6$9,h10XW90\4ld6d@4 qer*f94>Sx9<d5mc@H{X150@pE7d}0D k@$5,55$0;xP=3p<2xk!)@(DX1NP0@\l/0\hl ?v|9 X_1 p<> M30]6`0LХ:XJ:8[8t;,l23Pv=%9pk10?:lf2 10pk5`2p 3(`\6d!p5l/k8Ķ:G@TO@@Zz3c?\qk{*:3p23=4@0)1`90X1?$r$k :0 :: h0D Hk@O J2\` عk4l \p| ,)5  C  100 k H"4 0h  :0( Hk$ ؑ? ? k J; k=3 ~8 @ ܏<K ,m=a ,=x : ԍp H7 7 54 C wr D6 (r1 C: Pr Fr$ <0 3  k=B ?O Tr] 0O3h 1z G7 $6 Z5@ =| 1 /0 7 <_; k 89 k( po= ^7K tV5@T  V5T^ Xrf <>u k}  @ > > Pu< 9 `k T5D 98 LZ7t W; M=@ `>T, 17 %AK HkW X4P` _:Do +8{ Њ24 ,6X ? T5@ 8 7| 0 0G=\ @x .5  kT]?tvr 2 8\$a81m@hz3,k:Ш@d0lrkp10 Cx<4ĒA01"d?83>p<p9MY5TY}pa8hjDH>|K=,$^2x8?@d=;=P2$l0p06@ة;hq( o=;kI)@d@<w$k|pkPx<@( 5H hq52ХkkAD(5p d0(r&07`?HĈpSk`P/@0t+4,=8<P3 X^p2Ĵ9r5?@?8p$?8 |:,6P)B@T7;$E(4X:g6ttto 6(5k1t 58plk:d3 54A4M7 3k%,k478@<E$20,]L9hp;hwL4dL7\@L3040o=(<<=#5@24lrDLo=WDpa6pxk`1X,rq}8xP7L$h6289,;> kk7p7'< 2XkDp+@\a>lG> xa8]>x3<704lk0k;Lk1<`2Xj02| 9`;\C(I|b:XX=dl0t^9~01h/0)3`C?h`>d4pR3ؙ621txe?:> X1DV=X,p3@7@60lB?JLkV0<g=w=8=@66T0Dk3?T`58lr$@;,:51I=e\1s10|ؕ9l 645*@}32;@,g7)p #7(*A,o2h&~=8r2$@?hP.=@f9Hxk@k`2 x0D/4h0d?9| 'A d?8`?4kHk<3$$2`,p>7W;hG>S1ckvo02D:5,4=@1 @m9>,4@7Xxa1tн43Dh>+1005;<8$I0;(Tk0`>8v8M?44lCL1@04D>=G94@tm=$3:+h>;q<GHkO̾;T[$=tp;,Xp%l4X1 |P:swap_onpfslowtimonanouptimebuf_rb_bufs_RB_REMOVErandomreadehci_device_ctrl_closeuaddr_bestfit_functionslongjmpommmc_bus_clockarm_dflt_intrkdb_trapvfs_allocate_syncvnodetc_setclockarpresolvechrtoblktblsw_reg_strategysys_minheritputcharuvmfault_unlockmapschild_returnsmsc_cartlabel_unrefsmsc_startuvm_map_initipsec_soft_first_usenkmempagescopyinstrsys_getgiddofilewritevsdmmc_intr_establishdumpmagttyflushsys_setsockoptsys_ppollcomdefaultrateclock_gettimedefrouter_lookupinetswwdog_periodffs_fifovopsip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksip6_get_prevhdrscheduler_startdb_logpmap_alias_bitsintc_imaskuvm_maxkaddrumass_io_putomap_caipmforwardingmainbusprintarmv7_bs_w_1sys_closeusbd_do_request_flagsrtflushclone1in6_purgemkludgeffs_inode_allocsys_setsidusbd_intr_transfer__ashldi3vn_statunp_detachnd6_nud_hintether_ip6multicast_minusbd_submatchtcp_secretrti_find__mainufs_quota_deletehardclocksd_vpd_thinprcm_v4_hsusbhost_set_sourcein6_domifdetachvtagsmtx_enter_trysmsc_sethwcsumwskbd_cndetachdb_get_variablehotplug_get_eventgeneric_armv4_bs_wm_2if_group_routechangerw_assert_rdlockarmv7_bs_wr_4sys_fstatatdmtimer_waitdest6_inputgsignalomehci_camii_mediachgipport_firstautoehci_stripsendredirectsbpf_setifunp_internalizetk_rawccscsi_xs_sync_donefc_lfcemptyvfs_export_lookupif_cloners_countm_freemifnetyielduhid_seltrue_filtopssc_print_addruaddr_free_rbtree_RB_NEXTfilt_seltruelogcomspeedsmsc_tick_taskvn_writechkin_ifscrubuvm_pmr_freepageqpdevnames_sizescsi_mode_select_bigroute_dstsingle_thread_clearch_usergetelemstatusinit_execuvm_pmr_size_RB_NEXTuvm_addr_alignwskbd_cdsdmmc_mem_enablenamecache_rb_cache_RB_FINDsys_getdirentriesbcmpgeneric_bs_r_1db_set_breakpointsnd6_dad_startexec_maxhdrszdb_force_whitespaceintc_intr_establishmmmmapsetjmpsd_read_cap_16prefetch_abort_handler_addressprcm_enablemoduleuvm_deviceopsuvm_addr_align_backlogread_filtopsvndxfer_poolfilt_fifowritetcp6_mtudisc_callbackcopyoutstrsitaracm_cdusb_transfer_completeprcm_v4_enablemoduleuaddr_stack_brk_selecttcp_attachla_hold_totalwskbd_cngetcbuf_dirtysoo_writesystempagem_zerond6_llinfo_timervn_fsizechkunp_gcingreaddoslabelbdevswcalctsrusitara_cm_reg_read_4pmap_get_l2_bucketbaddynamicportsworkq_initX_db_line_at_pcuvm_mk_pclusterbswap16domainnameehci_endpduvm_pmr_addr_RB_REMOVElockinitwsmouse_detachsitara_cm_padconf_set_gpiomodettywrite_filtopsnd6_ns_outputbpfkqfiltersorwakeupttyunblockhidms_disableremovedeigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetachsys___thrwakeup__divdi3armv7_bs_allocallowpowerdownsys_clock_settimelocnameshidkbd_bell_fndisk_busyrandom_hostseeddb_breakpoint_allochidkbd_belltcp_pulloutofbandevcount_sysctlsddetacharprequesttfork_child_returnsiginitpool_set_constraintsusb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigusbd_clear_endpoint_stalldb_vnode_print_cmdums_casetdisklabelknote_removepmap_bootstrap_pv_page_allocbufq_nscan_createuvm_mapent_addr_insertroutedomainhid_locateicmp6_errorarmv7_dcache_index_maxVOP_MKDIRpool_large_freeip_protoxsys_settimeofdaysdstrategyaddlogehci_sync_hcuvm_page_physgetmsdosfs_synccheckdisklabelscsi_mode_senseip_savecontrolstackgap_randompmap_pte_init_genericvm_map_unlock_lnarmv7_setupffs_clrblockusbd_set_hub_featureuvm_addr_linsearchbpf_filterchgproccntip_draindb_map_print_cmdumass_init_shuttlesoqremque__adddi3uvm_map_inheritfifo_printinfosys_getthridarmv7_a4x_bs_tagin6_ifawithscopebuf_page_offsetuvm_pmemrange_addr_cmpkm_freeusbd_is_dyingarmv7_idcache_wbinv_allsync_printvnopssys_lchownmsdosfs_removedb_read_tokenfilt_timerdetachzeroin_addrehci_device_bulk_closeampintc_intr_enableuvm_map_protectusbd_get_xfer_statusuvm_map_setup_mdprintfehci_alloc_sqtd_chainrandomwriteprelist_updatesmsc_miibus_readregip6_protoxsys_recvfromttrstrtrandomif_getsysctl_doprockcopyrtfreesingle_thread_checkampintc_spllowerukattachhostnamelenomdog_attachusb_needs_reattachuaddr_hint_selectttyopenraw_ctlinputnd6_ioctlsched_chooseprocphyslockspec_setattrpte_l1_s_protousbd_get_stringfill_prlistipsec_exp_allocationsbpfcloseusbd_probe_and_attachomgpio_v4_set_dirsys_writevsys_setprioritym_tag_prependumass_detachusbd_free_iface_dataip_defttlusb_schedsoftintrarpintrsdmmc_activatekqueue_registercred0in_delmultisdmmc_io_rw_directsdmmc_io_write_2uvm_forkdisk_lookupuid_findumass_activateomehci_detachnd6_rtrequestuvm_km_suballocusb_delay_msti_padconf_devmapif_getgroupattribsbpfdetachsys_closefromfifo_ioctlehci_devdttydefcharssigexitscsi_link_openhidirtypagesuk_cdin6mask128armv7_bs_wr_2bus_space_read_raw_multi_4uvm_amap_poolin_pcballocVOP_LOOKUPdb_shift_exprphysical_startbs_notimpl_bs_c_8ifa_delpcred_poolenqueue_randomnessusbd_set_idleemul_nativewskbd_inputsdmmc_printusbd_pipe2device_handlecpu_do_powersaveuvm_km_pagesufs_quota_alloc_inode2microuptimesocket_poolarm_init_smaskpgrphashsys_setpgidgptimer_caprofhzcache_enterntp_update_seconddb_watch_tablesysctl_file2exec_elf32_makecmdsusb_rem_wait_tasksys_setlogininitarmamap_listdb_trapip6_maxifprefixestcp_do_rfc3390sys_setresuidrn_deletesd_get_parmsiskmemdevstat_rush_requestsipsec_def_compfc_lmdistancench_poolphtree_RB_REMOVEsomaxconnscsi_xs_get_donesdmmc_card_intripsec_exp_timeoutip_directedbcast_bus_dmamap_loaduvm_pmr_pg_to_memtypeuihashtblpoison_memsd_buf_doneticks_per_secondommmc_wait_stateamap_initffs_flushfilesicmp_sysctlsys_lseekllinfo_arpmsdosfs_pollmsdosfs_accessaddupc_intrdvd_read_bcavm_map_lock_read_lnwsevent_finiip6stathotplugread_filtopshidms_enableuvm_pageboot_allocconfig_pendingmii_phy_updatesys___thrsleepether_crc32_lern_searchugenread_isoc_filtopsipipstatsecureleveldb_consolearpt_keepsavectxdb_printsymums_disablepte_l2_l_cache_mode_ptbinuptimesys_seteuidhidms_attachwskbdpollmax_protohdruvm_map_checkprotdb_access_irq_spumass_scsi_attachsdmmc_alloc_ccbsrandomkqfilterbufpagesusbrev_strsleep_setup_signalprocess_newsys_keventcopyargsarc4_reinitmi_switchsysctl_sensorstsleepkern_sysctlnd6_delayin_pcbinitsys_fchmodatbs_notimpl_bs_rm_4nmbclust_updatehw_prodfdremoveigmp_fasttimobufq_disksort_queueatomic_setbits_intehci_device_ctrl_startpmap_pte_init_armv7umass_bbb_statedb_print_loc_and_instrt_mpath_matchgateusbd_port_disown_to_1_1uvm_map_entry_poolcrgetdmtimer_setstatclockrateunp_bindintc_calc_masktcp_delackcsignalreaddisklabelvm_map_unbusy_lndb_print_cmdusbd_clear_endpoint_stall_asyncvirtual_availbs_notimpl_bs_rr_2tcpstatgptimer_intra4x_bs_r_2dma_constraintdb_break_tableuvm_anon_poolicmp6_mtudisc_timeoutfillmapentrytcp_timer_persistcpufunc_ifarsys_umaskpow2dividesyn_cache_reaperfilt_fileattachsysentcpuset_addpmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistufs_ihashlookupscsi_inquire_vpdpmap_kernel_l2ptp_kvaicmp_rediracceptmemmoveugen_set_interfaceusbd_get_hub_statusworkq_create_threaddb_boot_halt_cmdip_outputbpf_mtapfindblknamenkmempages_maxarmv7_bs_mappool_inituvn_referenceuvm_pmr_addr_RB_PREVbpfreadpool_putm_copym2buf_alloc_pagessysctl_structbufqs_stopsysctl_rdstringuvn_attachsdmmc_send_if_condlasttimefiforead_filtopsehci_freexarm_dcache_l2_assocsysctl_disklockcnkqfilterdesiredvnodesbs_notimpl_bs_r_2ufs_pollpmap_map_sectionmsdosfs_readlinkprcm_setup_dpll5pmap_devmap_bootstrapusbd_get_device_statusukmatchsdmmc_verbosenchinitexec_mapdb_qualifysnprintfcomcngetcether_ioctlumass_bbb_transferip6_forwardingarp_allocated_bus_dmamap_load_mbufsdmmc_io_write_1ifindex2ifnetrt_mpath_conflictin6_savemkludgein_pcbnotifyalluvm_pglistallocsyn_cache_addpool_large_free_nibuf_kva_enduvm_map_splitentryincorevm_map_lock_lnhzomap3_devsdefrouter_resetcheckaliassched_exitttyretypestartuphook_listsdmmc_card_detachpte_l1_s_cache_modeuvm_pmr_remove_addruaddr_pivot_poolrt_timer_queue_changelf_initcpu_attachrn_mpath_countmii_phy_matchsdclosevop_generic_kqfilterampintc_splraisepffasttimoinitsiginfosys_getuiddb_set_cmdcomconsunitcpuidsexec_setup_stackuao_createdb_free_watchpointssensor_detachifaddr_items_RB_INSERT_COLORbuf_mapidentify_arm_cpuffs_realloccgwskbd_load_keymapm_clpoolugenintrgroupmemberuvmspace_initscsi_plug_detachether_sprintfmsdosfs_unlockselwaitpmap_init_l1cpsw_mii_writeregicmp6_mtudisc_callbacksnd6_slowtimosys_forkbufq_implsip_setmoptions__qdivremifaddr_items_RB_PREVspec_openfilt_bpfreaddb_watchpoint_freeehci_alloc_sqhuvm_fault_wireusbd_abort_pipekernelstackvm_nphyssegifaddr_items_RB_NFINDip6_randomiduvm_pseg_initproc_filtopself32_os_pt_notefiledescopensys_vforkcomcnspeeduvm_pager_initcpufuncswinChkNamest_decide_modedvd_read_copyrightuvm_pmr_addr_RB_MINMAXdb_history_prevsys_mkdiruao_reference_lockedcom_resumepmap_devmap_tableufs_fhtovpwskbd_translatedumppcbrttrashmblowatgetnewvnodeufs_inactivend6_mmaxtriessys_socketugenopenffs_cgreadugenioctlvm_map_lock_try_lnomap_set_devsspec_close_clonevop_generic_bwritenanotimeufsspec_writesd_read_cap_10fifo_badopfdfreeuvn_detachuvm_km_valloc_trytty_counthidkbd_detachraw_disconnectsensor_task_registerarm_dflt_spllowerip6_neighborgcthreshbufkvmKERNEL_BASE_virtremove_coproc_handleratomic_clearbits_intumass_polled_transferuvm_pmr_extract_rangesensor_attachbrelvpmsdosfs_mountfsvfs_relookupuvm_map_addr_augment_getffs_checkblksys_utracencpusfoundehci_root_intr_startip6_sprintfsync_fsyncsetstatclockraterrw_initpmap_cachevivtwskbd_deliver_eventdb_eregscom_fifo_probest_loadbread_cluster_callbackfdcopyin6_proto_cksum_outbuf_acquire_nomapemul_findb_to_qbus_space_read_raw_multi_2uvm_pmr_size_RB_INSERTin_len2maskusb_blk_freelistudp_sendspaceuvm_objtree_RB_PREVifg_headvfs_rootmountallocehci_device_isoc_transferomgpio_v4_get_bitbs_notimpl_bs_sr_2netintrrw_initarmv7_bs_r_2vm_map_busy_lnbuf_rb_bufs_RB_FINDcmask_bss_end__db_pool_print_cmdprcm_v4_hsusbhost_activatedb_delete_linescsi_activateuhidkqfilterVOP_ISLOCKEDsys_kqueueuao_referenceusbd_kill_pipein6_addrscopebuf_getsys___threxitdb_searchbs_notimpl_bs_wm_4vfs_getcwd_scandirmaxlockdepthraw_usrreqnblkdevinitiduhidev_detachbs_notimpl_bs_wm_2ttyinputscanc__stack_smash_handlerukbd_consopsbiodonedb_set_breakpointicmp6_rip6_inputehci_free_sqtdsmsc_encapukopenmaxslpehci_device_intr_methodsst_read_block_limitsufsread_filtopsufs_symlinkm_dup_pkthdrufs_mkdirvfs_getcwd_getcacheusbd_get_no_altssdmmc_initnamecache_rb_cache_RB_PREVin_iawithaddr__anddi3phtree_RB_REMOVE_COLORrt_missmsgVOP_BMAPip_dooptionsvn_locktimeout_add_tsrip6_ctlinputscsi_link_shutdownprcm_fmask_maskumass_cbi_adscsbdropmsgbufphysuaddr_free_rbtree_RB_INSERT_COLORusbd_desc_iter_nexttcp_debugusbd_transfercpsw_mediachangearmv7_dcache_wbinv_allinpcb_poolnextralocsmsc_miibus_writeregbus_space_write_raw_multi_4uvm_addr_fitspacesys_setegidrn_matchfifo_readautoconf_verbosein6_setpeeraddrunp_externalizesys_munlockalluvm_faultrandomioctlarmv7_bs_sr_4softraid_disk_attachsoreceivepool_getuextralocscsibus_printlinksdmmc_discover_taskdb_show_radix_nodeffs_dirprefrip6_outputscsibus_cdin6_get_rand_ifidndflushcompose_tab_cmprn_insertspec_pollbpf_wakeupfilt_kqdetachgptimer_cddb_flush_lineipsec_exp_bytesbufqueuesconfig_defersys_faccessat_bus_dmamem_allocm_tag_initif_attachsys_setrtablem_reclaimuvm_map_addr_RB_REMOVE_COLORnameiovero_devsbs_notimpl_bs_sr_4uvm_map_setup_entriesip6_ctloutputdead_pollpte_l2_l_coherentversion_bus_dmamap_syncuvm_pmr_remove_sizebuf_needvakqueue_inituvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getcbs_notimpl_bs_rr_8mountlistcomsoftVOP_REVOKEconfig_deactivateclallocbiowaitfilt_ufsreadunixswuvm_objtree_RB_INSERT_COLORdb_stop_at_pcsccsehci_check_intrccpupmap_updateehci_device_setintrgeneric_bs_sr_1hidkbd_inputnexttickeventfdinitboothowtoarc4randomtcp_delack_ticksarmv7_bs_rr_1armv7_tlb_flushDttopenukbd_apple_iso_mungeip6_randomid_initether_ipmulticast_minconfig_rootsearchrip6_sendspaceuao_dropswapin_addprefixenxiosys___getcwdusb_cdrnd_event_headin6_maxmtupmap_enterusbd_ratecheckundefined_handler_addresssys_setreuiduvm_map_findspacewsevent_initdmtimer_intrcomcnattacharmv7_bs_subregiondb_var_rw_inta4x_bs_w_2sdsizesys_pwritevkqueue_scanusbd_iface_claimedomap_devstcp_closeicmpsrcsd_patternsX_db_search_symbolscsi_initsdmmc_disablemsdosfs_advlockwdog_registerusbd_free_xferdb_varssys_utimensatfallocintc_splxdeadproc_mutexdb_breakpoint_freepfctlinputcomcnprobephys_mapumass_bbb_methodssoft_intrqufs_lockcomintrsys_accessuvm_swap_iokillpg1arpproxyvputonfreelistregyearpage0setrunnabledmtimer_capool_do_putuvm_pmr_getpagesnd6_prefix_onlinkugen_seltrue_filtopsffs_specvopself32_read_fromosversionticks_per_intrhid_is_collectionfind_pfxlist_reachable_routerip6_pcboptstvtohzphtree_RB_NFINDratecheckin_rtchangevfs_syncwaitffs1_reallocblkscansignalhotplugpollomdog_wpendingcpsw_get_mac_addrmsdosfs_check_exportlf_setlocknbigpipein_controllmaxuvm_pagecopyphtree_RB_NEXTsysctl_quadsys_readexec_process_vmcmdsm_cldropmbstatuhidev_intrttyinfodb_flush_lexttyingetnulldevispidtakendb_dmesg_cmdextent_destroydb_lpif_group_egress_builddmtimer_cpu_initclocksloop_clonerttsetwatergetcampintc_attachomap4_smc_callifaddr_items_RB_INSERTdb_last_addruvm_pseg_lckpmap_enter_pvmsgbufenableduvm_mapent_mkfreeunp_disconnectarmv7_bs_rr_2ufsfifo_writesys_listensys_mounthotplug_put_eventehci_root_ctrl_donebpf_mtap_etherpgsignalehci_waitintrfirstcdb_read_bytesuhub_detachffs_fsyncinetdomainehci_abort_xferarm_dflt_intr_stringmemcpykthread_exitscsi_req_detachvfs_unbusydisk_constructip_nhopsrip_usrreqvm_map_upgrade_lnommmc_functionsspec_writekq_timeoutmaxsdmmc_inquiryin_broadcastfd_getfilehidkbd_set_ledsmsgbufaddrsdioctlutsnameip6_setmoptionsexit2intc_intr_stringip6_mloopbacktcp_update_rcvspacerddumpcpu_setperfuaddr_rnd_poolufs_lookupugen_attachufs_bmapdoasyncfreecpufunc_dfarip6_randomflowlabelttpolldegetlogpollkthread_createugen_set_configsdmmc_mmc_commanddb_elf_sym_initlogclosesd_vpd_block_limitsgeneric_bs_wr_4prcm_v3_bitinstall_coproc_handlernd6_dad_findufs_strategyam335x_devsphysical_freeendcopy_statfs_infobounds_check_with_labelarc4_timeoutsd_ioctl_cachesocantrcvmoreprocess_poolip6_setpktoptfile_filtopsst_cdch_cdbuf_unmapmsdosfs_renamesysctl_proc_argssdmmc_mem_initpipe_wfiltops__lshldi3purge_detachedpfxrtr_addcd_load_unloadgptimer_cpu_initclocksipq_pooluaddr_kbootstrap_destroypmap_activatebuf_dealloc_memconfig_make_softcpte_l2_s_prot_kruaddr_stack_brk_functionsunp_discardsitara_cm_padconf_getip6_outputuhid_caswap_syscall_lockufs_kqfilterums_enablescsi_autoconfcheckdirsexecswsdmmc_set_relative_addrumass_atapi_attachin6_are_prefix_equalin6_controluvm_pmr_rootupdateleapyearsleep_finish_timeoutsys_sigsuspendehci_device_bulk_abortnamecache_rb_cache_RB_NFINDtrapsignalrushjobpmap_devmap_registerrn_inithead0db_single_step_cmdnd_defrouterfdcloseexecuvm_map_sel_limitsevcount_attachlimcopycpsw_watchdogbio_doreadscsi_req_probeuvm_mapent_forkcopytcp_timer_rexmtrt_timer_initcpsw_txintrnd6_useloopbackuaddr_rnd_createputsintc_caomgpio_attachrip6statip6_id_ctxtcp_debxcnpollcd_casdmmc_task_threadsys_truncateesigcodescsi_xfer_poolsysctl_wdogarmv7_bs_w_2sched_choosecpu_forksoacceptkqueue_pollcdgetdisklabeldb_call_depthuaddr_pivot_randomdb_printfehci_device_isoc_doneuhidreadin6_ifaddloopufs_creatend6_freend6_optionsnd6_llinfo_settimersdmmc_mem_write_blockmsdosfs_unmountelf32_load_psectiondb_show_all_bufsrn_mpath_nextnamecache_rb_cache_RB_MINMAXarm_pcache_unifieddb_add_symbol_tablearmv7_setttbm_tag_nextch_getelemstatusmsdosfs_writebs_notimpl_bs_w_1exec_script_makecmdsehci_rem_free_itd_chainfilt_pipedetachentropy_add_ptrdb_unarydisk_attach_callbackselrecordffs_validatecomstopffs1_compat_readrip_outputrrw_exitmld6_fasttimeouaddr_rnd_insertkthread_qimaxwsmouse_matchchioctlstioctluvm_object_printitmbpoolclock_secs_to_ymdhmsst_write_filemarkstcp_canceltimersrip_recvspaceroute_initswap_prioritylink_rtrequesttc_setrealtimeclockomgpio_set_diruvm_vmspace_poolstackgap_initpipe_createfifowrite_filtopssysctl_vnodend6_sysctlsyn_cache_putdoopenatvn_openomgpio_clear_bitif_clone_createbufq_fifo_requeueuao_detachcpufunc_controlmallocamap_pp_adjrefin_pcbrtentryknote_dequeue__udivsi3tcp_outflagskqueue_statbuf_fix_mappingip6_v6onlysys_preadvdb_tok_stringomapid_attachuserretsys_recvmsgpipe_statvn_writehidkbd_hookup_bellVOP_LINKicmp_inputumass_cdvcountvm_page_zero_enableuvm_vsunlock_devicerd_root_sizein6_delmultistathzroute_ctloutputwdog_ctl_cbsched_idlewskbd_cnattachvirtual_enduhidev_get_reportprcm_am335x_enablemodulesys_getloginifaddr_items_RB_NEXTbuckstring_initicmp6_rediracceptdetruncdb_elf_symbol_valuescopyoutpfindbufq_peekcomconsaddrip_ctloutputuhidev_set_report_asyncwsevent_readarp_ifinitdb_write_variableufs_dirbadvfs_unmountallsys_renameatcopyrightsdattachsched_peg_curproctcp_timer_keepusbd_devinfo_vpgptimer_ioh1sbsynctcp_mss_updategptimer_ioh0free_pagesffsfifo_reclaimehci_root_ctrl_startdb_proc_print_cmdrw_enter_readdb_show_all_procsvunmapbufehci_device_ctrl_transferbootstrap_bs_mapuvm_map_pageable_wireroute_outputrti_deletefreepidsys_geteuiddb_output_positionicmpmaskreplin6_pcblookup_listenmsdosfs_mknodttkqfluship6_defmcasthlimsys_munmapsdmmc_io_write_multi_1kp_nonefilt_solistenvsnprintfpte_l2_s_prot_urarplookupuvm_map_pageableproftimer_trampolinechainallocsw_reg_startifmedia_baudrateusbd_setup_default_xferuvm_pagelookupsoshutdownproc_cansugiddb_command_tableip_mloopbackbpf_iflistgptimer_attachKQREFip6intrqtodr_handlend6_rs_inputscsi_activate_bussoabortm_free_unlockedunp_inohidkbd_attach_wskbdlogkqfilterbpf_mtap_pflogni6_dnsmatchdb_extent_print_cmdip6_init2uprintfsensordev_installdb_clear_single_steprandomiduvm_page_printitmainbus_cacoredump_elf32softdep_flushworklistsys_issetugidinitclocksomusbtll_cdsdmmc_decode_cidif_detachpmap_kernel_l2dtable_kvand6_cache_lladdrcatqsession_poolunp_connectuvm_pagermapinif_detached_startpool_serialscsi_probe_lunampintc_calc_maskirq_entryni6_inputvfs_mountedondb_expressioncputypert_lookupfc_lookup__bss_start__if_downndqbprcm_attachVOP_GETATTRa4x_bs_wm_1elf32_check_headerdb_historyttytstamppmap_unwireipaddrip6_auto_linklocaluvm_pageunwirerti_fillhw_serialehci_device_intr_abortautoconf_attdetufs_chmodbufq_nscan_resortcdattachommmc_wait_intrin_localaddrsys_sigaltstacksdmmc_cisptrsoisdisconnectingsched_steal_procsyn_hash2rttimer_queue_headarm_pdcache_sizertredirectuvm_map_printitdb_read_variablesoftintr_initdb_regsdb_stack_dumpuvm_pmr_pnaddrttymodemdb_lbuf_endehci_free_itdmtx_enterkqueue_poolvntblinitbuf_rb_bufs_RB_INSERTcpuset_intersectionallcftablesuhub_activatesleep_queue_initampintc_capmap_preferin6_ifattach_linklocalVOP_REALLOCBLKSugenwritesys_setresgiduvm_pmr_freepagesmsdosfs_sync_vnodesplassert_failarm_picache_waystty_inituvm_km_freesys_killrn_mpath_reprioperflevelcomconsiohpmap_set_pcb_pagediruvm_pmr_addr_RB_NFINDrt_setmetricssys_getegiddb_set_single_stepst_spaceuvm_objtree_RB_FINDsw_reg_iodone_internalhidms_detachumass_init_insystemst_quirk_patternscpsw_rxthintrfrag6_deletefraghdruaddr_destroydirchkifaddr_items_RB_FINDipip_outputpipeclosedmtimer_ioh0VOP_REMOVEconsinituvm_pmr_isfreesdmmc_scsi_minphysuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachifaof_ifpforaddrsensordev_listhidms_ioctlminidatacleanrt_timer_queue_destroysd_cduvm_pseg_geticmp_mtudiscipport_hifirstautosys_fstatpte_l2_s_prot_uwdb_endlpumass_bbb_resetffs_alloccgbuf_object_storesmsc_wait_for_bitsgeneric_bs_w_1sa6_anysys_getpriorityarmv7_cpu_sleepsysctl_diskinituvm_km_vallocscsi_xsh_delrt_mpath_nextscsi_plug_probesys_unmountbootdvelf32_probesin6ifa_ifpwithaddrvgonelsofreend6_dad_timeruaddr_rnd_destroycpuset_unionommmc_soft_resetdb_del_symbol_tabledb_add_exprpmap_removebpf_mtap_afhidkbd_parse_descicmp6_fasttimouvm_pmr_addr_RB_INSERTmtx_initif_clone_destroyehci_close_pipevmcmd_randomizebpf_setfuvm_page_unbusyfilt_hotplugreadomgpio_catk_noutusbpalockpmap_collectukbd_enableuvm_map_addr_RB_PREVdb_symformat_elfgeneric_bs_rr_4cpu_sysctlhotplugkqfilterti_padstate_devmapip_randomidintc_attachednettxintrsdmmc_io_function_disablenosuidcoredumpukphyattachcddumpdb_search_cmdparse_uboot_tagsastusbd_claim_ifacetcp_disconnectuvmspace_execsys_mmapehci_bus_methodsbootnd6_is_addr_neighborunp_rightshostnamedb_print_llinfodisk_closepartuvmexpnextstateventbufq_doneehci_detachsensordev_getufs_diremptyreinsertfinishdupsleep_setup_timeoutukphy_servicesmsc_stoppool_destroylogwakeupshutdownhook_listhidkbd_attachip_dosourceroutesoread_filtopsdmapoolsbdevsw_lookupdisk_changesdmmc_create_threadamap_lookupsdoreallocblksampintc_eoicache_revlookupbpfread_filtopssoinituvm_mapent_isjoinableVOP_MKNODuvmomusbtll_attachnd6_ifdetachin6_ifaddrroute_protofilt_ugenread_isocsync_vopshw_uuidcd_play_tracksscsi_do_mode_senseuvm_pmr_allocpmrvirttimer_trampolineip6_maxfragpacketsdb_errorehci_confdprefetch_abort_handleruvm_km_threadscsi_probe_buslminm_leadingspacesys_fpathconfarpt_prunekp_zerosoconnect2knote_poolcnopenscsi_test_unit_readycpsw_startnmbclustdma_freesominconnuvm_vnp_syncpool_allocator_large_niarpt_downrdgetdisklabelarm_pdcache_line_sizebpf_tapnthreadsdb_lookupuvm_pmr_addr_RB_NEXTnumnegmii_phy_autouvm_pmr_addr_RB_FINDuvm_mapent_free_removemax_datalenmsdosfs_initlf_clearlockgeneric_armv4_bs_wr_2uvmpd_scan_inactivech_exchangedb_lastsymip_srcrouteuhidioctlip6_accept_rtadvpte_l1_s_cache_masksys_setregidusbd_device2interface_handleallowaperturecpuset_infosusbd_dopollvinvalbufsys_ftruncatem_splitsoftintr_disestablishentropylockfifo_polltcp_timer_initdb_tab_stop_widthdb_putncharstuagg_unlockedscsi_sem_enternd6_maxnudhinttcp6_inputsosetoptkp_dirtyehci_set_qh_qtdtcp_mssifa_addcache_purgebpf_mcopycomconsrateuaddr_pivot_insertfork1curpcbdb_activevfs_hang_addrlistst_cach_cadead_writeufs_dirrewriteinsmntquettreadtk_canccdb_write_bytesudp_outputfind_last_setsys_chmodprelist_removeuvm_objtree_RB_NFINDffs_vgetinitprocip6_getpmtu__umoddi3bcstatsarm_dcache_alignvm_map_downgrade_lnugencloseip6_log_intervalsched_idle_cpusscsi_activate_lunuvm_page_physdumpuvm_atopgX_db_sym_initmaxprocesssyn_cache_timersolisten_filtopsprocess_kernel_argsin6_update_ifaehci_alloc_itdrt_msg2suser_ucredsd_shutdownmem_nobufbackpagesommmc_card_detectstwriteuaddr_kernel_functionspmap_free_l2_bucketrevarprequestmsdosfsreadwrite_filtopsrrw_enterkernel_mapdumpdevwsmouseioctlusbd_ref_incrprcm_am335x_setclockugen_do_readdb_not_taken_bkptm_printuvm_pmr_splitvfs_mount_foreach_vnodekqueue_kqfiltertimeout_add_usecbeagleboard_devsuhid_do_ioctlzeroin6_addrstrncasecmptimer_filtopsuvm_objwire__guardtcp_mss_advin_ifaddrnd6_optionommmc_host_resetwin2unixfnmax_hdrffs_readm_freephtree_RB_FINDscsi_inqmatchfdesc_poolpool_page_allocin_pcblookupm_tag_delete_chainfilt_pipewritebadaddr_read_4bzeroumass_scsi_probeswapdrum_addufs_closedefrouter_delreqfixjobcsdmmc_matchuvm_pmr_size_RB_REMOVEdb_show_all_cmdsscsi_devidin6_addmultirn_newpair__udivdi3sys_obreaksdmmc_intr_enableusbd_set_config_nolastddateprcm_imask_addruvmfault_unlockallm_inithdrpmap_curmaxkvaddruvm_pmemrange_addr_RB_NFINDin6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotsys___thrsigdivertsys_getdtablecountmbinittcp_secret_ctxusbd_get_reportabortwskbd_default_bell_datascsi_readsafe_cmdgptimer_waitamap_allocVOP_LOCKbuf_rb_bufs_RB_INSERT_COLORMD5Finalwskbd_matchcp_timel1_listplatform_smc_writedb_page_print_cmdvgetrw_casrd_attachkd_nowaitcdstpugenpollwsmouseopenwinChksumbufq_requeuefreeclusterchainmld6_initscsi_get_linkswapmapdisk_initrip6_ctloutputdisk_readlabelusbd_getnewaddrnd6_na_outputcpsw_cdumass_cbi_transferusbd_bulk_transfer_cbuvm_map_teardownpipe_pollpool_reclaim_allsysctl_dopoolcpsw_cauhub_matchpmtu_expireuvm_mapent_clonetcp_respondsys_readvamap_cow_nowroundrobinbadaddr_readuvm_map_createissignalfilt_uhidrdetachin6_selectroutecdevvpmsdosfs_kqfilterch_get_quirksigmp_joingroupuiomoveboard_devsmsdosfs_startlf_alloccpu_idle_leavedb_loop_countbpf_reset_dnd6_dad_stopdiskmapioctlhid_start_parseuseloopbackuvm_waitnexecsststartmclpoolspmap_referencesys_bindsdmmc_done_xsloioctlrw_exit_writebs_notimpl_bs_wr_8usb_abort_taskspmap_bootstrapbs_notimpl_bs_wr_2sys_mqueryarm_picache_line_sizekmeminit_nkmempagesusbd_new_devicescsi_io_putscsi_iopool_inituvm_pmr_size_RB_REMOVE_COLORmcllivelocksarmv7_bs_wm_2uvm_pmemrange_findfillinusemaprecvitums_cddmtimer_get_timecountfilt_sowriteuvm_kernacccnpollcsys_linkuvm_addr_initlog_openfilt_randomdetachuvm_pmr_size_cmpuaddr_free_rbtree_RB_MINMAXfragtbl124rt_tablesrt_ifmsgrandomread_filtopsrealitexpireipstatunix2dostimedounlinkatscsibus_causbd_delay_mscrfreecnputcuhid_do_writeip6_lasthdruhub_uhub_caugen_matchtcp_reaperpool_sethiwatmicrotimearm_dflt_intr_establishuvm_pmr_addr_cmppipeunlockuvm_pmemrange_addr_RB_MINMAXuvm_swap_getelf32_copyargsampintc_intr_establish_extuvm_km_alloc1cdopentcp_usrclosedphysmemuvn_flushsdmmc_del_taskuvmfault_relockinferiorukbd_attachclusterallocrt_if_remove_rtdeleteamptimer_cdwskbd_attachin_pcbbindumass_cbi_statelopagesudp_notifyomdog_cdsdmmc_app_commandpmap_l2dtable_poolendtsleepstrnlensigactsshareuvm_map_freelist_update_refilldb_set_watchpointuvm_map_addr_RB_NEXTbpfattachif_detach_queuesitimerdecrether_outputpmap_bootstrap_pv_page_freeuvm_addr_printbpfilter_lookupm_copym0sdmmc_io_detachvm_physmemrdwriternd_timeoutpipe_ioctlfilt_timerexpirewskbd_enablepmap_devmap_find_vabpf_allocbufsset_stackptrrt_gettablemsgbufmappedcomprobe1cdsizedb_symbol_valuesumass_lookupdb_evarssmsc_attachufsfifo_closewakeupgetnanotimea4x_bs_wm_2dmtimer_irqtcprexmtthreshkprintf_mutexrt_getifadb_malloc_print_cmdenosyslockmgrrtlabel_name2idhidkbd_is_consoleuvm_vnodeopsdb_bcstats_print_cmdvfsconfVOP_OPENcompwroffcpsw_new_rxbufbuckstringusbd_fill_deviceinfoscsi_interpret_sensebeagle_powerdownugen_do_ioctlcomconsattachedufs_readlinkrdopenin6_ifadddoscheckpathpcbmapnd6_option_initbufq_quiesceomgpio_cd__guard_localin6_init_prefix_ltimesnchstatsmsgbufpsys_setgidfilt_ufswritert6_flushehci_timeout_taskgeneric_bs_r_4mmrwffs_bufatoffomapid_cddohooksprcm_am335x_clkctrlnprocessesehci_free_sqtd_chainukbd_activateif_detached_ioctllocnamppsegsip_mtudisc_timeout_qaddress_exception_entryffs_fhtovpgetvnodefilt_ufsvnodepool_setlowatkmembaseswi_entryrip6_inituvm_aiobuf_poolampintc_intr_stringsysctl_emulseltrue_filtopsamptimer_cpu_initclockssys_sigprocmaskdb_commandin6_if_upfilt_pipereadsoreservedb_formatuvm_mmapusb_activatescsi_report_lunsufs_quotactldosymlinkatuvm_map_uaddraroundin6_pcbnotifyifaddr_items_RB_REMOVEusbd_clear_endpoint_toggleexplore_pendingstrrchrst_check_eodgetdevvpm_clgetdefrouter_selectamap_unrefbpf_mtap_hdrcrdupamap_wiperangedb_strlcpycfrootsscsiprintwsmousepollchrtoblkminphysukbd_matchsys_fchownatrtalloc_nocloneether_addmultitimeout_mutexarm_intrffs_vptofhvfs_isbusyifunitirqstackarm_dcache_l2_nsetsbawritetputcharpoison_valuewskbd_detachpmap_postinitpool_print_pagelistffs_fragacctffs1_ballocsys_fchownums_activatedb_breakpoint_cmdvwaitforiomii_phy_tickcd_read_subchannelsdmmc_io_function_enableflsextendfilelortrequesticmp6_inputintc_intr_bootstrapbuf_valistsdmmc_io_write_4board_idcreatedefilt_randomreadsbreleasedb_history_sizein6_selectifmsdosfs_islockedhipagesmax_linkhdrumass_attachget_stackptrsysctl_rtablemsdosfs_reclaimsys_readlinkatuvm_objtree_RB_REMOVErtlabel_id2namesbdroprecorduvm_coredumpnamecache_rb_cache_RB_REMOVEsdmmc_io_scanip6_sysctlsuserdiskconfvn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1memalltk_ninsysfilt_opssdmmc_io_function_readyclusterfreefilt_randomwriterootdevehci_device_isoc_startm_tag_firstomap_matchcdmatchpmap_map_entryusbd_get_config_descriptorpfxrtr_delffs_checkoverlapdumpsysicmptstampreplif_detached_watchdogrip6_sysctldoforcesys_fsyncusbd_reset_portifconfampintc_routeamap_wipeouttcp_output_bus_dmamem_mmapupdate_ledssdmmc_mem_read_blocktcp_timer_2mslffs_reload_vnodebuf_putmsdosfs_setattrVOP_RMDIRif_addgroupwdog_tickledb_delete_breakpointuhid_matcheopnotsupppool_allocator_freefilt_procsdmmc_enableffs_reallocblksphtree_RB_INSERT_COLORrootvprandomcloseuvm_pmemrange_addr_RB_NEXTugen_do_writepool_reclaiminitdisklabelusb_quirksbpf_sysctlvflushehci_opencddetachpmap_clear_modifytcpctl_varsarptimerbufq_dequeuetcp_reass_limitm_copymruaddsys___set_tcbrdstrategybcopy_pageip6_freepcboptsdb_free_breakpointsif_upcoredump_notes_elf32timeout_add_nsecehci_intr1uvmfault_lookupm_extfreesdmmc_set_bus_powerVOP_BWRITEbufq_fifo_peekrt_timer_queue_createm_cluncountmsdosfs_ioctlspllowerno_constraintsys_openusbd_match_devicescsi_sem_leaveinet6domain_bus_dmamem_alloc_rangeether_crc32_be_updatepgdeleteuvm_pageidlezerowskbd_do_ioctl_scsdmmc_io_initdead_vopsdb_symtabsuaddr_hint_createraw_attachhidkbd_cngetcscsi_ioc_cmddb_boot_sync_cmdamptimer_readcnt64astpendingifnewlladdrether_ip6multicast_maxpipe_pooluao_initsdmmc_needs_discoverifa_ifwithroutem_clinitifpspec_kqfiltertcp_notifyffs_dinode1_poolarm_setsoftintrdb_print_positionrtflushclonedb_radixgetblkintc_cdmaxsmapip6_mcast_pmtusoconnectvtypesuvm_map_fix_spacenobuffers__lshrdi3data_abort_handler_addressin6_delayed_cksumrtrequest1usbd_errstrtcp_identtcp_rst_ppslimifinitsd_cmd_rw10cd_load_tocunpst_recvspaceuvm_map_mqueryscsi_io_getget_ifiduvm_map_kmem_growraw_inputfilt_logrdetachtimeout_add_btnd6_ifattachunpdg_recvspacedofaccessatpipe_closesoftdep_mountmsdosfs_rmdirdb_is_activemsdosfs_fsynccfdataffsusbd_do_request_async_cbsitara_cm_devufs_checkpathpfxlist_onlink_checkdiskmapreaddb_elf_lookupinittodrm_tag_findvputpte_l1_s_cache_mode_ptvector_page_setprottcbhashsizeworkq_syswqfilt_hotplugrdetachusbd_get_configuaddr_kbootstrapufs_quota_initallocpidkqread_filtopscoredump_writeusbd_setup_pipebuf_acquiredolinkatbioopscpu_classesbpf_setdlttcp_flush_queueipprintfspool_setiplarm_intr_establishmsdosfs_statfslboltpipe_inituvm_wait_plarn_mpath_priousbd_open_pipe_intrsyncerprocifa_print_rbufs_ihashinsin_setpeeraddrdb_readlineether_ifdetachuhidev_get_report_descrndstatsst_touch_tapemsdosfs_inactivecurrent_intr_depthpanicstrumass_scsi_cbscsi_delayif_startunpdg_sendspacesession0viscpywsmouse_do_ioctlehci_abort_isoc_xferhw_vercopyin__umodsi3comparamehci_reverse_bitsomgpio_get_bitrtalloc1bs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetuaddr_pivot_selectsigacts0uaddr_free_rbtree_RB_REMOVE_COLORfindblkmajormsdosfsvnode_filtopsntohlsorflushugen_cauvm_mapent_tryjointtioctlarpintrqvprintfslpquettycharssyncdelayuvm_vslock_devicecpsw_mediastatusugenreaduvm_pagealloc_multihidkbd_enablesdmmc_io_read_2ffs_mounticmp6errppslimbadaddr_read_2msdosfs_vopsintc_smaskconfig_process_deferred_childrenbufq_waitsdmmc_decode_csdbs_notimpl_bs_sm_2in6_setmaxmtumsdosfs_rootbpf_getdltlistm_tag_getuvm_map_freelist_updateuaddr_bestfit_insertsb_lockuaddr_bestfit_removert_labelsintc_spllowersuid_clearttwritedma_alloc_initbuf_rb_bufs_RB_NFINDbuflowpagesehci_activateswapdev_vpdead_readufs_pathconffile_pooldb_boot_reboot_cmdunputcendVOP_CREATEcpuset_firstifai_cmpnd6_recalc_reachtm_intervalpagetables_startin_ifinitfifo_closein_pcbhashlookupsys_mknodatkp_dmaVOP_ABORTOPehci_pcdcoredump_traddofchownatsys_acceptuvm_map_entry_kmem_pooluvm_pagerealloc_multicwbpuaddr_bestfit_pooltcp_rst_ppslim_countukbd_detachif_clone_listtc_windupsys_futimessdgetdisklabelsysctl_proc_cwdinternal_commanduvm_map_boundarymalloc_errintvlprcm_v3_setclockin_losingVOP_SYMLINKgeteblkusbd_set_interfacescsibusmatchvn_ioctlufsspec_readdb_show_calloutpipespacefiqvectorget_last_resort_ifidip6_sendredirectsddb_sysctlukphy_caitimerfixticks_err_sumintc_splraiseip_stripoptionssyn_cache_countuaddr_stack_brk_creatend6_timer_chuvm_pseg_releasecpu_resettcp_ctlinputether_multiaddrstart_cleanerarmv7_bs_w_4ffs_blkfreearmv7_tlb_flushI_SEexit1bdevvpifa_ifwithdstaddrehci_cdommmc_attachuaddr_bestfit_selectuvmspace_duseddb_watchpoint_allocselectroutearmv7_tlb_flushID_SEin6_nigroupscsi_mode_sense_big_pagesys_mkfifoatuihashscsi_ioh_deltcp_keepintvlcdwriteufswrite_filtopsttybgconfig_searchphtree_RB_PREVusbd_printuvm_km_valloc_prefer_waitsyn_cache_poolpmap_kernel_l2ptp_physffs_allocdb_prevbswap32ipsec_exp_first_useplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingrn_walktreepool_prime_pagechclosestclosesys_chownuvm_pagewirein6_joingroupsys_munlockhotplugattachuvm_anfreedofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfilerw_exit_readtablefulluhub_explorearmv7_bs_r_1tcp_maxidlevfs_getcwd_commonststrategyset_cpufuncscttyioctlsys_lstatcttykqfiltercttyopenpmap_link_l2ptsitara_cm_reg_write_4inet6ctlerrmapicmp6_redirect_diagdisknamessched_queued_cpusumass_quirksdumplomsdosfs_mountffs_clusterallocnullcnpollcuvm_km_inituvm_objinitbzero_pageffs_sbupdateomdog_caudp_sysctlsys_openatm_clcountbs_notimpl_bs_wm_1vmmapbsyusb_add_taskdb_list_breakpointsusbd_set_protocolnkmempages_minukbd_accessopsusbclosevector_pagekq_ntimeoutssys_sched_yieldvmspace0stmatchchmatchscsi_decode_sensettywaitwsmousedevprintuvm_map_setuptcp_syn_cache_sizeetextifa_ifwithnetmemchrpte_l2_s_cache_masksysctl_cptime2sdmmc_cascsi_mode_sense_pageboot_argspipelockumass_scsi_setupproc_pooludp6_inputsys_writeomehci_initdb_get_valuegeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immedemul_flags_translate__bss_end__ip6_insertfraghdrcnstopextent_print_allihashtblsys_dup2db_inst_countdb_read_linearm_set_intr_handlerbread_clustersys_readlink__ashrdi3bs_notimpl_bs_mmapip6_auto_flowlabeldevid_copylf_splitifafreeVOP_STRATEGYtimeout_add_sectzrip_sendspacecoredump_writenote_elf32uhidev_writeusb_generic_tasksamap_addtcp_freeqif_setgroupattribscom_attach_subrdvd_authumass_scsi_cmdcdreadbufq_disksort_requeuearmv7_bs_sr_1spec_inactiveehci_device_intr_starthidms_setupsys_sendtoicmperrppslimgeneric_filtopsknote_dropintc_attachampintcin6_selectsrcrd_casdmmc_read_cissoftclock_siin6_pcbsetportalldevsicmp_do_errorvmcmd_map_readvnsmsc_initrandom_startcomconsfrequsbd_get_interface_altindexamap_extendsigpropvmapbufumass_scsi_switchdehashtblsocketopsX_db_sym_numargsnd6_maxndoptuvm_map_clip_startffs_fragextendtcp_always_keepaliverawcbtablespec_readunp_markicmp_mtudisc_timeouta4x_bs_r_1ttyread_filtopsuvm_mapusbd_bulk_transfergetinoquotafifo_ebadfscsi_do_ioctlrtable_existsdisk_lock_nointrehci_free_sqhcd_resetX_db_forallscsi_ioh_addscsi_detach_busudpstatroute_inputsetrootcd_read_toccdioctlbufq_switchifmedia_addfrag6_queueusbd_set_config_indexlogopencd_buf_donescsi_devid_pg80breadntcp_hdrszscsi_devid_pg83prcm_setclocktcbtable__xordi3frag6_drainuvm_objtree_RB_REMOVE_COLORdosdiremptyigmp_slowtimoifpromiscip6_setpktoptsfork_returnsys_getsocknameusbd_alloc_buffermask_rnheadsw_reg_iodonepte_l2_s_protoarmv7_tlb_flushIufs_rootcpsw_ioctlsdmmc_detachtcp_sysctlVOP_SETATTRsmsc_chip_initpmap_kremovesigactsinitsdmmc_io_rw_extendeddomknodatusbd_set_reportcpu_kcore_hdrexec_elf32_fixuprt_newaddrmsgvop_generic_lockcomconsiotuvmfault_anongetconsttyusermountomapid_ca__ucmpdi2vn_closefileumass_discoomusbtll_scip_mtudiscvfs_free_netcredmld6_start_listeningcpu_mainbus_capmap_kenter_papidhashtblusbd_get_protocolpmap_l2dtable_ctoruvm_mapent_forksharedm_pullupenterpgrpm_copydatacnbellbufq_nscan_requeuegetdirentries_internalcd_setchanomgpio_matchmtx_leavefilt_signalsigactsfreettymallocums_intricmp6_notify_errorbs_notimpl_bs_sm_4mmioctluaddr_free_rbtree_RB_NFINDuvm_coredump_walkmapdb_nextumass_matchsched_choosesendsigsdmmc_print_cisbpf_ifnamesmsc_iffvfs_busytimecounterfilt_ufsdetachbufq_initlf_getlocksolistenwskbd_compose_valuespec_getattrip_ecn_ingressmsdosfs_bmaprip_ctloutputffs_vtblif_getgrouppool_debugkqueue_ioctlmax_processessys_wait4rip6_recvspaceamap_share_protectfs_sysctlukbd_cnattachboot_filefilt_sordetachknote_activatepsignalconfig_pending_incrusb_task_threadamap_pp_establishuvm_pmr_nextszuvm_anon_initffs_reclaimusb_free_deviceintc_handlerusb_exploreifaddr_items_RB_REMOVE_COLORbufq_nscan_queueif_link_state_changepmap_virtual_spaceusb_disconnect_portpage0_endbpfpolluvm_pmr_nfindszupdateprisched_kthreads_createommmc_host_ocruhid_cdwskbd_cnbellbintimeommmc_intrfilt_soreadrtable_addzeropageipsec_def_encffs_nodealloccgsoftintr_establishuvm_pmr_removeip4_input6pdevinit__iordi3uvm_pmr_findnextsegmentinetctlerrmapresetpriorityenoioctlflslsigacts_poolexecsigsconfig_initicmp6_redirect_inputbuf_rb_bufs_RB_REMOVE_COLORrw_enteruvm_addr_destroyst_interpret_sensech_interpret_senseuvm_pmr_size_RB_MINMAXpmap_pv_pooldb_access_abt_spnd6_ra_inputffs1_blkprefin6addr_loopbackuvm_objtree_RB_MINMAXvprintttypendarmv7_icache_sync_rangeuvm_swap_freepagesnd6_dad_starttimerin_revarpinputstrlcpyuaddr_bestfit_destroyX_db_symbol_valuescpsw_tickehci_device_isoc_methodsusbd_reload_device_descsmsc_read_regknote_fdcloseusbd_get_devcntehci_device_intr_doneif_clone_detachpipe_rfiltopsin6_cksumcomcninitstrncmpcsrc_ptevfs_shutdowngetsockbs_notimpl_bs_c_4syn_cache_respondif_creategroupllinfo_nd6sbcheckreservepreemptuvm_iounixdomaindb_next_free_breakpointscsibusattachsyn_hash1ulmindb_last_symtabproc0paddrrn_addmaskifaddr_itemsusb_attachbpf_bufsizeselscansoo_polluvm_map_uaddr_ertafidx_maxsig_filtopsknote_processexitukbd_cdwskbdopenttclosipsec_soft_allocationssleep_setupintc_iot_bus_dmamem_mapst_mount_tapeip6_fragmentnet_sysctlcom_cdtimeout_adjust_tickswskbd_do_ioctluvm_pmr_size_RB_FINDudv_listdead_ioctlusb_matchsdmmc_complete_xssysctl_iflistvwakeupgptimer_irqif_clonersvgonepmap_initializedtcp6_ctlinputsched_init_runqueuesdb_stack_trace_cmdusb_allocmemsd_sizeufsspec_closend6_prefix_offlinkuvm_anon_dropswapigmp_inputkmemusagelf_getblockautoconf_attdet_mtxpmap_pmap_pooltcp_rttdfltcleanerprocfifo_reclaimsbappendstreamm_tag_copy_chainusbd_intr_transfer_cbsowrite_filtopsstrncpydb_disasmsdreadsys_pselectupdatefatsvfs_getvfsffs_sync_vnodeproc_stopvfs_vnode_printdb_history_lastrrticks_initusbd_set_port_featurecpsw_mii_readregbpfilter_createsysctl_locklockfpoolcpu_switchtohtonlsched_all_cpusin6_mask2lentcp_dooptionsdos2unixtimesys_sigactiondeupdatusb_fill_di_taskehci_ifcdrndlock__negdi2in6_purgeaddrcpu_modelarm_dcache_align_maskcttyreadschedclockbpfioctlconfig_attachdisk_unbusysysctl_fileusb_syncmemugen_detachsoisconnectedsdmmc_ccb_allocamap_clean_worksusb_block_freememVOP_PATHCONFumass_fixup_sonydk_mountrootassertwaitokdb_run_modescsi_minphyssdmmc_delayvattr_nullsys_getsockoptuhidev_attachfrag6_nfragpacketsarmv7_drain_writebufdb_linepool_allocator_largein6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlcpu_get_controlVOP_READLINKbuf_mem_initumass_cbi_methodsdb_ed_stylemii_submatchuvmexp_printmsdosfs_pathconfoldpidstimeout_wheelbpf_m_xhalfumass_io_getaverunnablettyfreettysleepehci_root_intr_doneunp_disposechquirksscsi_inquireufs_getattrvfs_exportuvm_km_pgremoveex_region_plfscalesmsc_matchffs_alloccgblkip_optcopyvfs_registerm_livelocksys_dupmcllowatmii_printbpfilterattachproc_stop_toarmv7_bs_rm_2armv7_dcache_wbinv_rangetimeout_tododb_lcarmv7_bs_unmapcpu_read_cache_configpanicarmv7_idcache_wbinv_rangeget_pc_str_offsetL_cksumdatamsdosfs_lockseltruebpf_m_xwordscsi_xs_syncsoftdep_initializestackgap_allocunp_shutdownarm_do_pending_intrdovutimensdummy_get_timecountgeneric_bs_wm_4kthread_run_deferred_queuearc4_initlastdaycheck_execdb_max_linetcp_initsdmmc_start_xspte_l2_s_cache_mode_ptdeferred_config_queuecpsw_stopbuf_rb_bufs_RB_MINMAXnetisr_initipport_lastautocom_raisedtrdb_last_commandip6_pcboptwinSlotCntvn_kqfiltersched_stolenpoison_checkpte_l2_s_prot_maskcache_purgevfspostsigsys_pathconfcom_omap_cain_addmultigetmicrotimebs_notimpl_bs_rm_8maxumass_clear_endpoint_stallscsi_probedevtcp_templatemsdosfs_readdb_object_print_cmdcomopenusbd_setup_xfermtagpoolbcopywsmouseclosewdog_autousbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_optuaddr_rnd_removetcp_reasssys_getfhomap4_initrt_timer_timerrtbl_id_maxcomcnputcKERNEL_BASE_physehci_alloc_sqtdgeneric_bs_rr_1ni6_addrsdefrouter_addreqin6_clearscopend6_dad_ns_inputuvmpd_tuneusbd_set_addressffs_setblockipsec_expire_acquireicmp6_mtudisc_clonememcmpwskbd_init_keymapnamecache_rb_cache_RB_REMOVE_COLORip6_dad_pendingmsdosfs_createdb_output_linecomstartdb_examinecfroots_sizecwb_ptearmv7_dcache_sets_incdb_end_linetickadjpool_alloc_item_headerip6_splithdruvm_map_addr_augmenttcp_secret_initsbreserveundefined_initvrecyclein_pcbnotifymissextent_printcrcopydb_symformatomap_bus_dma_tagundefined_handlerscortexmatchsys_revokesysctl_stringsys_rebootuvm_unmap_kill_entrybufpoolproc_finish_waitarmv7_bs_rm_4ommmc_write_data_bus_dmamap_load_buffercpu_forksigonstackuaddr_kbootstrap_selectdb_print_ifattylistuvm_vslockuvmfault_update_statsttyoutputexplicit_bzerowskbd_cacopyaddroutommmc_read_datacpuset_add_allsitara_cm_padconf_get_gpioflagsrn_mkfreelistVOP_READufs_ioctlffs_freefilein6ifa_ifpforlinklocallastdtimegetdisksys_setuidstart_updateusbd_clear_port_featureusb_abort_task_threadufs_quota_free_blocks2senditudp_detachbufq_fifo_destroyarmv7_bs_freecluster_writernd_event_tailhidkbd_decodeuvm_setpagesizeehci_root_intr_closetcp_xmit_timerst_rewindin6_recoverscopech_positiontimeout_add_tvtickmclpool_warnmsgdb_termscsi_preventmmcloseffs_statfscpuset_complementudp_recvspacea4x_bs_w_1km_allocfill_file2fdropsyn_cache_unreachsys_getrlimiticmp6_errcountbpf_attachdicmp6_ctloutputcpuset_issetcpsw_rxintrufs_dirremoveamptimer_intrif_attachsetuppipe_writem_clsetwmsuvm_map_addr_RB_FINDin_pcblookup_listensbappendm_copybackscsi_remove_linknd6_rtmsguvm_swap_puticmpbmcastechofifo_advlockextent_print1db_continue_cmdehci_timeoutbufheadconfig_scankp_pageablepmap_copy_page_funcripsrcugenkqfilterether_ifattachnlineswdb_restart_at_pcdb_sstep_printsdmmc_function_freeumass_adjust_transfersignal_initfill_drlistffs_updatedb_print_formatunix2dosfnspec_advlockfragtblraw_sendspacenullopsdmmc_intr_disablecomdiagextralocvop_generic_bmapunsleepscsi_xs_getX_db_lookupsched_proc_to_cpu_costipintrgetnanouptimesdmmc_scsi_detachmaxdmapusb_block_allocmemdb_skip_to_eolip6_savecontroldevice_registernd6_dad_stoptimerq_to_bmountrootsdmmc_scansyn_cache_resetdb_inputcharuhidev_opendb_boot_cmdsundefined_entryip_initreaddeprocess_read_fpregsufs_check_exportsysctl_rdintcd_interpret_senseampintc_irq_handlerin_mask2lenscsi_iopool_destroylodirtypagesfindwin95VOP_WRITEsys_nanosleepstart_init_execifa_update_broadaddrnd6_addr_addifa_ifwithaddrclock_ymdhms_to_secsommmc_card_intr_maskrootduiddb_write_cmdif_clone_attachsys_getfsstatbpfopencdstrategynetisr_intrrandomwrite_filtopsnd6_slowtimo_chuvm_km_valloc_aligndb_max_widthip6_pullexthdrmalloc_printitstreadcpu_idle_entercomwritebuf_kva_starttuagg_subVOP_RENAMEcdclosesys_fchdirsdmmc_scsi_cmdsysctl_ifqprocess0m_cltick_tmorandompidfilt_ttyrdetachsdmmc_mem_send_op_condarp_inuseuhidwrite_bus_dmamap_destroyvn_pollinet6swrouteswdosdirtemplatemainbus_cddb_uvmexp_print_cmdsys_mincoreamptimer_setstatclockratelastsecondswdog_timeoutwsmousedoopenusbd_error_strstcp_maxpersistidlespec_ioctlufs_initproc_reparenta4x_bs_r_4uvm_exitfc_bmapcallspr_rmpageffs_initsdmmc_submatchcluster_wbuildscsi_ioh_setbootsyncuvm_initsys_ioctluvm_map_addr_RB_NFINDif_free_sadldb_dotsdmmc_attachfilt_bpfrdetachst_loadquirksicmp6_initbs_notimpl_bs_rm_1disassembleuvm_mapent_free_insertfilt_ttywritepool_update_curpagehid_end_parsein_setsockaddrpool_set_ctordtorbpf_moveinostypevndbuf_pooluvm_page_physloadreset_entryuvm_pmr_remove_1strangeomgpio_v3_get_bitip6_insert_jumbooptipintrqtuaggusb_frag_freelistip_slowtimordsizeip6_nexthdrrtdeletemsg__bss_startrt_tab2domVOP_KQFILTERukphy_funcssys_msyncwskbdreadsbappendrecordevcount_detachsd_casoftdep_fsync_mountdevinitmsgbufehci_device_bulk_startwsmouse_attachmemsetpipe_free_kmemufs_getlbnsphysioin6_selecthlimdb_show_all_vnodesdb_symbol_is_ambiguoususbd_set_report_asyncmii_phy_delete_mediain6_unlink_ifaicmp_mtudisc_clone_splloweruvm_pmr_insert_sizesodisconnectrw_assert_unlockedsys_setgroupsmainether_crc32_le_updatetimespecfixarm_dflt_splraiseuaddr_bestfit_createstminphysip_flushsitara_cm_padconf_set_gpioflagsuvm_unmap_removepmap_alloc_l1icmp_errordb_hangmanbs_notimpl_bs_sm_1uvm_swap_markbadkqueueopssmsc_miibus_statchgvholdbufq_fifo_dequeueidgen32db_help_cmdrt_if_removescsi_default_getusbd_no_quirkm_adjmld6_stop_listeninghotplugioctlpmap_map_chunkppsratecheckdmtimer_attachkmemlimitbuf_rb_bufs_RB_PREVamap_copybufq_drainphysical_endintc_irq_handleruhidpollsched_wasidlesysctl_kmemlockuaddr_hint_destroylf_findoverlappandaboard_devsfilt_msdosfsvnodelf_wakelockkv_anydb_sym_numargsdumpconfuaddr_lin_selectdead_badoppool_large_alloc_nicalcrusys_unlinkdb_cmd_listmainbusmatchrt_setgatetcp_ack_on_pushpmap_growkernelufs_chowndofchmodatsysctl_intampintc_cduvm_shutdownkqueue_closepte_l2_s_cache_modeuvn_initstrlcatsysctl_int_arrbs_notimpl_bs_wm_8uvm_map_set_uaddrsoftintr_dispatchomusbtll_initdisk_unlockufs_ihashremcttywrite_bus_dmamap_createtcp_update_sndspacearm_splassert_checksdmatchusb_freemempool_chk_pageproc0ufs_renameuvm_map_entrybyaddrusbd_get_hid_descriptorrt_ifannouncemsgsoo_readommmc_start_commanduvm_km_doputpageufs_opencopyout_statfspmap_modify_pvsplxm_catrtinitcluster_collectbufskp_dma_contigumass_scsi_minphysuvm_swap_inittcp_nowdb_trace_until_matching_cmdproc_printitunp_gcsys_clock_gettimeip6_hdrnestlimitpool_catchupcpuset_clearfrag6_initbuf_replacevnodeuvm_pmr_size_RB_NFINDuvm_mapent_addr_removetimeout_setrdread__subdi3armv7_dcache_inv_rangentohsmsgbuf_putchar_bus_dmamem_freeinet_ntoadb_boot_poweroff_cmdsd_flushcd_setvolmii_pollstatpte_l2_s_coherentsys_symlinkatrw_exitst_erasekv_pagedupfdopenidgen32_initifmedia_list_addpidhashrtprefuvm_totalencdebugicmp6_ratelimitdb_unread_charsys_mkdiratsdmmc_io_attachomehci_soft_phy_resetdofstatatstart_inituhub_attachether_fakeaddrsysctl_tc_hardwaresmsc_rxeofscsi_ioc_ata_cmdtcp_mssdfltampintc_setipluvm_swap_freedata_abort_handleromdog_scbs_notimpl_bs_r_1db_look_charuhidev_set_reportin_pcbdetachmsdosfs_vfsopststohzomap_find_devttycheckoutqicmp6_mtudisc_callback_registerdb_set_variablevm_map_unlock_read_lnusb_explore_tasksrnd_event_spaceintc_intr_disestablishpmap_clear_referencert_getmetricsin6_ifdetachdb_search_symbolcn_tabswaplist_insertsmsc_lock_miiip_forwardextent_createrdclosebpf_freeddisklistin6_lifaddr_ioctlsys_fstatfsbs_notimpl_bs_sr_8m_injectip6_mforwardingffs_isfreeblockseltrue_kqfilteruvm_map_lookup_entryhztobs_notimpl_bs_w_4dead_strategyswi_handlerni6_store_addrsspec_fsyncuvm_map_deallocateicmp_reflectscsi_xsh_iohmii_phy_activateffs_ballocsys_getgroupssys_linkatuhub_cdgeneric_bs_wm_1ip6_raw_ctloutputkernel_textufs_startsigstkinitbufq_disksort_dequeue__end__kinfo_vdebugufs_bmaparrayfragtbl8uvn_sync_lockarmv7_dcache_sets_maxusb_needs_exploreswaplist_findufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachwsmouse_cdsdmmc_go_idle_stateVOP_FSYNCffs_sysctlipport_hilastautoarpinit_doneusb_wait_taskuvm_anon_pageinspec_closeuvm_map_mkentryommmc_exec_commanduvm_map_addr_RB_REMOVEsys_shutdowncngetcehci_rem_qhtc_adjfreqrnd_statesuaddr_pivot_createm_gethdrugen_activateconfig_rootfoundputcbufbackoffsysctl_rdstruct__divsi3uhidev_cdwsmousereadschedcpusbappendcontrolukbd_set_ledsa4x_bs_rm_1ampintc_matchugenread_intr_filtopssoftdep_flushfilesdb_access_und_spipv4_inputm_getclrpool_headusbd_interface2device_handleommmc_bus_poweripforwardingdb_lexusbd_open_pipe_ivalicmp6_redirect_timeoutomapuart_attachsyn_cache_lookuparc4random_statecpsw_attacharm_clock_registerprtactiveksym_upcaseufs_makeinodescsi_xs_ioip6_process_hopoptsufsfifo_readusbd_find_edescfifo_writefilt_ttyreadsys_getpgidcom_common_putcswaplist_trimcache_lookuprdioctlgptimer_delaydb_boot_crash_cmduvm_objtree_RB_INSERTsysctl_tcbs_notimpl_bs_rr_1umass_scsi_sense_cbsdmmc_intr_disestablishommmc_shutdowndumpsizesowwakeupukbd_keydesctabsdmmc_io_read_multi_1smsc_setmacaddressextent_freeuvm_aiodone_daemonaddupc_tasksched_syncusbd_clear_hub_featuredb_mount_print_cmdcomclosesetsigvecsys_sendmsguhidopenvn_marktextstrcmpsys_quotactluhidev_matchomapid_scommmc_card_intr_ackuaddr_pivot_destroytcp_mtudisc_increasearm_intr_funcsdmmc_card_attachulmaxin6_pcbconnectdehashuvm_pmemrange_addr_RB_INSERThook_disestablishbpf_catchpacketffs_isblockdb_stack_trace_printusbd_find_quirkuvm_swap_allocpagesuvm_aobj_poolhotplugclosedb_show_frame_cmdsys_adjfreqdb_examine_cmdicmp6_reflectsetrunqueueudv_attachsettimeuhub_intrarm_pcache_typertable_initscsi_ioh_runqueueuaddr_lin_functionsuvm_addr_entrybyspacemii_phy_auto_timeoutsyn_cache_getnetisrdb_clear_breakpointsttyrubvop_generic_islockeduaddr_hint_poolm_pulldownbufcachepercentpmap_initufs_rmdirminpmap_zero_page_funcip6_initconfig_detach_childrenrawcbsmsc_detachukbd_cngetctcpcb_pooluvm_map_addr_RB_INSERTuhidclosetimeout_add_msecipip_allowsys_polluvm_map_clip_endufs_makedirentryusbd_set_configuvm_mapent_mergem_defragrtable_l2setvnode_hold_listlastdosdatebuf_rb_bufs_RB_NEXTufs_linksched_choosecpusys_mkfifouaddr_free_rbtree_RB_REMOVEdb_cmd_searchin6_ifinitin6_leavegrouprtlabel_id2sasddumpiminsys_chflagsget_hw_ifidKQRELEdelaysdstartdb_machine_command_tableip6_hopopts_inputch_get_paramsampintc_splxddb_regsselfalsescsi_default_putcom_enable_debugportpage0_datavn_isunderusbd_get_port_statusuvm_pageoutpffindtypepdevnamesamptimer_get_timecountqsyncehci_resetuvn_clusterifaddr_items_RB_MINMAXfifo_openusb_camii_phy_downuvmspace_forkraw_initknote_enqueueums_accessopsudpcksumtcp_sendspacedb_maxoffpmap_zero_page_genericuvm_pmemrange_addr_RB_REMOVE_COLORffs_oldfscompatmaxlocksperuidfilt_ugenrdetachin6_matchlensys_madviseehci_device_ctrl_methodsscsibusdetachdisk_attachwskbd_displayioctlip6_clearpktoptsncpusdb_cmd_loop_donearptfreefilt_ugenread_intrdb_show_arptabbufadjustcom_detachbs_notimpl_bs_w_2dead_printmii_media_tablettyprintfreaperprocsigcodedb_elf_search_symbolipip_inputdb_delete_watchpointcomttybuf_undirtysysctl_tstringdb_watchpoints_insertedusbd_start_nextfilt_ttywdetachamap_swap_offpool_allocator_nointrsys_sysarchigmp_initmii_phy_add_mediafilt_msdosfsreadwritecpu_reset_needs_v4_MMU_disablecache_zapMD5Initomusbtll_cabus_space_write_raw_multi_2ffs_vfsopssysctl_malloccpu_info_storeprcm_v3_enablemodulefrag6_slowtimouvm_pmr_insert_addruvm_map_hintwant_reschedpmap_bootstrap_pv_allocatormsdosfs_mkdirkthread_create_deferreduhidevsubmatchbufq_disksort_destroybufq_simple_nscandevid_freescsibusactivatend6_timercomcnpollcin6_ifloop_requestcd_patterns__cmpdi2sd_ioctl_inquiryscsi_xsh_addcpsw_inituvm_pmemrange_addr_RB_FINDraw_detachscsi_xsh_runqueuebs_notimpl_bs_wr_1domainnamelenehci_polligmpctl_varsusbd_get_report_descriptorsd_thin_paramsip_rtaddrfiledesc_initvrelescsi_xs_errorprtrealloccheck_consoleamap_freein6_domifattachugen_get_alt_indexusb_blk_nfreeomap3_initnd6_prefix_lookuptc_getfrequencysync_inactivespec_printmsdosfs_openehci_hubdvop_generic_revokefifo_printfilt_sigdetachfilt_seltruedetacharmv7_bs_rm_1ipsec_def_authusbd_setup_isoc_xferttywflushwskbd_default_keyrepeat_datacomcnmodeclosefcomioctlumass_cbi_resetscsi_ioh_deqsoftdep_sync_metadataif_clone_lookupgetmicrouptimemii_tickrandom_initdisk_openpartip6_dad_countuvm_pager_dropclusterfilt_generic_detachip6_getmoptionssensor_task_unregisterehci_intrlist_timeoutpool_print1db_breakpoint_listcd_get_parmspmap_extractnd6_ifptomacwsmousedoioctlamap_unadduvm_pmr_insertif_congestionnfilesin6if_do_dadpipe_kqfilterpmap_devmap_find_papmap_kenter_cacheusb_insert_transferukbd_keymapdatast_mode_sensestopprofclockbufq_nscan_destroydb_hangnullioctluaddr_pivot_printpte_l2_l_cache_modemclsizesparsediskbcstats_printbreadamap_lookupipctl_varspmap_page_removert_timer_remove_allwskbddevprintuhid_intromgpio_v4_clear_bitproc_stop_sweeppmap_set_pt_cache_modescsi_xs_exectcp_usrreqdb_playssd_interpret_senseuvm_map_pageable_pgonuvm_addr_invokeudp_usrreqifmedia_initrtable_l2omgpio_v3_set_bituvm_mapent_freedead_bmapdb_guessesif_getgroupmembersdb_show_all_poolssoo_kqfilteromdog_resetfifo_pathconfcpu_startupamap_refehci_device_bulk_transferfilt_fifordetachdb_command_loopfilt_fiforeadfdexpandtickssrandomcoredump_countsegs_elf32msdosfs_closerd_detachpool_do_gethotplugreadsysctl_clockratevn_rdwrarm_dflt_intr_disestablishnd6_need_cacheip6intrsyncer_maskuvm_pagedeactivateprcm_v3_setupufs_unlocktcp_ctloutputukphy_statusMD5Updateifmedia_setblktochrpmap_createuvm_map_extractnd6_prelist_addufs_removesysctl_tc_choiceptsignalboottimeVOP_ADVLOCKdb_watchpoint_cmdfrag6_inputpmap_alias_distunpst_sendspaceffs_indirtruncsmsc_cdtcp_rscalettwakeupuvmspace_freeffs_ino_pooluaddr_rnd_printmii_phy_statusmsgcpufunc_domainsswapdrum_getsdpVOP_PRINTfdshareuipc_setaddrsdmmc_intr_taskicmpv6ctl_varscdstartsdmmc_stimeoutfilt_generic_readwritevrefin_scrubprefixusb_detachipforward_rtarm_dflt_splxdb_elf_foralluhidev_activatend6_dad_na_inputsd_cmd_rw16db_set_temp_breakpointdb_buf_print_cmdinpcb_pool_initializedsys_nosysallproccdevswsys_mlockalluaddr_free_rbtree_RB_FINDwskbdcloseuvm_sysctlmalloc_lasterrgetsndiskmapopen_bus_dmamem_unmapdisksortsys_fchflagsnamei_poolrt_timer_countvfs_buf_printworkq_destroysmsc_ifmedia_stsukphymatchuvm_pager_putdiskmapclosein_canforwardsmsc_unlock_miiifa_item_removegptimer_setstatclockratepmap_destroyip_oursscsi_mode_selectkernel_pt_listuvm_map_freelist_update_clearetherbroadcastaddrvfs_getnewfsidudp6_ctlinputitimerroundarm32_vector_inituvm_pmr_size_RB_PREVwdog_shutdownuk_cascsi_print_sensewskbd_update_layoutmmopenffs_inode_freeukbd_intrifa_item_insertrtioctlscsi_xs_putbeaglebone_devsifaddr_item_pluaddr_hint_functionsarmv7_dcache_wb_rangeprofprocsip6_inputbuf_free_pagessleep_finish_signalgeneric_armv4_bs_rm_2route_srcbootduidspeedup_syncerigmp_sendpktloop_clone_destroyifmedia_baudrate_descriptionsv_putcsdmmc_add_taskm_getptrukbd_cauhid_activateufsvnode_filtopsuvm_fault_unwiresched_noidlesys_getitimerhid_get_datadoniceintc_nirqcpu_configureip6_freemoptionshidkbd_delayed_decodearmv7_bs_wr_1usb_create_task_threadsbufhighpagesarmv7_bs_vaddrpmap_fault_fixupuaddr_poolrn_refinesgeneric_bs_rm_4sockargshidkbd_ioctlvop_generic_abortopstattachchattacharmv7_bs_wm_4setregsni6_nametodnssobindvmcmd_map_zerodb_read_charvfsinitcnclosedb_tok_numberomap_attachtcp_do_rfc1323ip_fragsfilt_fifowdetachmii_phy_setmediain6_ifpprefixkd_trylocklo0ifphostidpool_chkusbd_free_bufferuvm_pagermapoutrt_if_linkstate_changerw_assert_wrlockif_downalluaddr_pivot_newpivotnam2blkrw_statuscoredump_writeseghdrs_elf32rt6_deleterouteip_maxqueuesysctl_ttyuhub_cain_socktrimrtallocsys_mprotectdequeue_randomnesscortexattachuvm_km_kmemalloc_plasyncer_maxdelaydeadprocstart_reaperehci_root_ctrl_methodssys_fcntlukioctlvfs_free_addrlistsys_setrlimitsys_sigpendingloop_clone_creatediskmapwriteuvm_map_cleanuvm_pmr_get1pageicmp_redirtimeoutworkq_add_taskttycloseugen_isoc_rintrarmv7_bs_r_4icmp6_nodeinfomaxvfsconftimeout_addcpu_cdip6_forwarddb_fncallnumcacheuvm_pagecountarmv7_context_switchcpu_initclocksmii_downwskbdioctlarm_get_cachetype_cp15v7rn_mpath_hashbrelsepsratiosdminphyscpuset_delttyoutdevice_lookupehci_device_requestDebuggercdminphysschedhzrip6_inputtcp_totbackoffvdroplooutputsoisdisconnectedcpu_coredumpdvd_read_disckeypmap_clean_pageuvm_aio_aiodonepmap_clearbitsyn_cache_rmfifo_vopsclrbitsdb_boot_dump_cmduvn_putscsi_add_linkmii_phy_statussitaracm_cacommajorommmc_cdamptimer_attachgeneric_armv4_bs_r_2bufq_disksort_peeksoclosebootstrap_startscsi_detach_targetinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemonskpcsdmmc_scsi_attachdb_lebufq_fifo_createipv6ctl_varsroute6_inputbs_notimpl_bs_w_8board_startupsys_socketpaircnreaddounmountuvm_swap_allockthread_create_nowhidkbd_bell_fn_argtcp_ackdrop_ppslim_countdb_elf_line_at_pcarm_picache_sizettspeedtabkqueue_readst_mode_selectarmv7_dcache_index_incuvm_pmemrange_addr_RB_INSERT_COLORfork_tfmratepv_sizeuvn_sync_qin_proto_cksum_outwskbd_activatend6_purgedb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmduvm_wakeup_plaiszerodevumass_cageneric_bs_sr_4lf_freecortex_bus_dma_tagsys_fhstatst_unmountnullmodemstdetachif_attachdomain1sys___get_tcbraw_recvspacediskerrcd_cddb_machine_commands_installsys_preadscsi_moveehci_root_intr_abortkernel_pt_lookupkmem_mapukbd_translateconfig_pending_decrsoqinsquediskstatsums_detacharmv7_periphbaseudp_inputomgpio_v3_clear_bitnchrtoblktblihashrn_search_mresettodrusbd_ref_decrufs_readdirsys_flockpvspec_badopampintc_intr_establishmsdosfs_linkbufq_nscan_dequeuebs_notimpl_bs_c_1sdmmc_check_cis_quirksicmpctl_varsigmpstatvn_initialize_syncerdpipeselwakeupomehci_activateicmp_sendadjtimedeltasmsc_newbufdb_mbuf_print_cmdomgpio_v4_set_bittime_uptimeuvm_pagealloc_pgsmsc_rx_list_initfilt_uhidreaduvn_wlistuvm_pmemrange_addr_RB_REMOVEsowakeupinsidetcp_autorcvbuf_incbufq_queuebs_notimpl_bs_r_4db_putstringcortex_cdarmv7_bs_barrierprefetch_abort_entrysigactsunsharetimeout_hardclock_updaterdattach_edatattkqfilterm_tag_deletesensor_findip_fragmentfilt_timerusbd_endpoint_countsys_statfssensordev_deinstallsched_nomigrationsinittimecounterrawin6pcbtablepmap_protectkprintfdevice_unrefrc4_keysetupscsi_startuvm_pmr_addr_RB_REMOVE_COLORin_cksumvnode_poolvnode_free_listarmv7_tlb_flushD_SEtcp_savetiuvm_pagereallocomap_submatchsensordev_countuvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadpool_printit_endrt_senddesyncsogetopthid_report_sizeuvm_unmaprd_matchdb_deletewatch_cmdusbd_ref_waitpollscandomaininitvflushbuftime_secondommmc_host_maxblklenip6_forward_rtwskbd_get_mapentryuvm_pmr_initusbd_read_report_descsbcreatecontrolsys_mlockhotplug_device_detachdvd_read_structvdevgonearm_intr_stringhtonsdb_show_callout_bucketbucketkqueue_writesys_syncprcm_cdcominitenodevffs_mountfsin_delayed_cksumm_clticksrtstatttvtimeoutkd_waitokabtstacktimingsafe_bcmpspeclisthbdwritecpu_idle_cycleversion_to_spcVOP_INACTIVEsdmmc_io_read_4omgpio_v4_get_dirpte_l1_c_protouvm_mapent_biastcp_syn_cachehaltkputcharums_ioctlbootargsampintc_intr_disablesys_getsiddb_trace_until_call_cmddisk_gonedb_show_all_mountsm_trailingspacefileheadrc4_cryptusbd_alloc_xfernextvnodeidcttypollkp_dma_zerosensor_task_ticksys_swapctlcpufunc_dfsrbd_reqst_patternsch_patternsbs_notimpl_bs_rm_2copypktoptsin_selectsrcmsgscpu_exitip6_initpktoptsworkq_threaduvn_getbpfilter_destroyunp_attachch_movetcp_syn_bucket_limitsys_renamesitara_cm_padconf_setfrag6_nfragsip6_log_timertalloc_mpathst_buf_donescsi_activate_targetdisasmufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnsbflushehci_device_intr_transferscsi_link_closeswapdevipsec_require_pfssysctl_intrcntarmv7_bs_tagvn_readnclrunegheadbwriteleavepgrpukdetachkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initstatminehci_root_ctrl_closesdmmc_io_xchgnamecache_rb_cache_RB_INSERTtcp_timer_funcsipqent_poolif_attachdomainicmp_ratelimituvm_km_page_initrttimer_pooladd_entropy_wordsusbd_get_config_descsosendcpsw_miscintrdosetrlimituvm_pmemrange_addr_RB_PREVrn_inituvm_objtree_RB_NEXTloopattachukcloseusb_abort_task_thread_procdb_listwatch_cmdscsi_cmd_rw_decodechainlengthprocess_read_regsusb_fill_udc_tasksys_unlinkatttwakeupwrrn_lookupthrsleep_unlocksmsc_write_regsys_execvefdallocprfindscsi_donechkvnlockhw_sysctltc_ticktockphtree_RB_MINMAXdb_siftingdb_look_tokenpmap_alloc_l2_buckettcp_syn_cache_limitnumvnodescomreaduvm_pagefreeehci_device_isoc_abortbufq_fifo_queuedb_examine_formatin6_pcbbindpool_large_allocicmp_do_exthdrreapercoredumpfilt_kqueueugen_cdmalloc_rounduppipe_readuvm_map_addr_RB_INSERT_COLORifioctlsys_utimesdb_symformatsusbd_do_requestnd6_storelladdrrip_initsocreateusbd_find_idescureadcufs_setattrlogpriworkq_queue_taskmemhookdoclusterreadsys_exitsbtryarm_smaskm_applyuaddr_pivot_functionsdomkfifoatudv_lockbufqsdb_watchpoint_listcd_playsys_clock_getressdmmc_set_bus_widthsyn_cache_insertrc4_getbytesttystats_initstactivatend6_umaxtriesommmc_powerpte_l2_s_prot_kwnd6_setmtu0nd6_debugip6_maxdynroutesuvm_map_piestdumpdb_delete_temp_breakpointehci_root_ctrl_transfercpu_cpuspeedcsrcpcpufunc_iddefrtrlist_updatearm_clock_funcamptimer_set_clockrateesymosreleasesdmmc_free_ccbsVOP_RECLAIMscsi_probe_targetip6_getpcboptbuf_release__modsi3smsc_txeoftcpqe_poolpgrp0mainbussearchdb_panicufs_advlockicmp_initcdst_pteuvm_growvfinddevrt_msg1ehci_device_bulk_methodsether_delmultiomehci_v4_early_initsave_rtedb_history_currprcm_camainbusattachrn_mpath_initheadexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutcpsw_mii_statchgvcleancd_getvolomapuart_activatesplassert_ctlsys_getresuidsys_fhopendos2unixfnscsibussubmatchrtentry_poolbufq_restartuvm_km_pgremove_intrsafein6_init_address_ltimesdefrtrlist_delsdmmc_mem_set_blocklensys_fchmoduvm_unmap_detachehci_add_qhusb_dev_quirkssitara_cm_attachdopselectvfs_mount_printstartwdog_cookieusbd_devinfost_identify_drivevn_isdisksys_selectbadaddr_read_1vop_generic_lookupzombprocdb_branch_takenarmv7_bs_sr_2in6addr_intfacelocal_allnodeslogreadrn_mpath_capabledead_lockworkq_next_tasktcp_issphysical_freestartfc_largedistancesys_setitimernd_prefixsmsc_tx_list_initvfs_unregistersmsc_ifmedia_updmii_phy_flowstatusdisk_mapselwakeupffs_reloaddb_set_watchpointsfill_kproccnwriteumass_bbb_get_max_lunin_ouraddrpolloutdb_show_panic_cmdehci_device_bulk_doneuipc_usrreqnd6_na_inputdb_next_free_watchpointvflush_vnodewsmouse_activaterip6_usrreqin6mask96colddb_clear_watchpointsunp_scansbappendaddrbufqs_mtxbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountfifo_inactiveffs_vopsdofutimenssys_pwriteuvmspace_allocrevarpinputbufq_nscan_peekcd_pausesdmmc_function_allochashinitttstartumass_setup_transferommmc_transfer_dataipsec_keep_invaliduao_detach_lockedsdopentcp_tracemii_phy_resetip_getmoptionsamptimer_matchin6mask32__moddi3disk_countscsi_detach_lunpmap_page_protectdead_openpmap_l2ptp_pooldb_list_watchpointsicmp6_redirect_outputroute_cbsys_futimensreadepcpuset_init_cpuscsi_init_inquiryuaddr_pivot_removetcp_slowtimocd_play_msfpmap_remove_pvtcp_newtcpcbsbchecklowmemswapmountffs_mapsearchsys_fhstatfssmsc_activateelf32_load_filesys_getpeernameehci_device_intr_closeehci_intrdb_taken_bkptdb_eqnamescsi_strvistcp_set_iss_tsmbpfwritedoingcachesys_getrusageomgpio_set_bituvm_map_addr_RB_MINMAXbufq_destroyusbd_get_cdescampintc_iacknd6_prunecomconscflagm_getarmv7_bs_c_2ffs_truncateuhidevprintmii_attachsdmmc_cdttylclosepool_allocator_allochidms_inputin6_ifremloopchar_typeusbctlprintworkq_createvn_closeuhid_do_readin6_createmkludgedoclusterwriteusbd_close_pipeusbd_deactivateffs_writebremfreefilt_sowdetachnd6_initip6_maxfragslimfreenl1doutimensatdb_show_regsifmedia_ioctluvm_km_free_wakeuprootvnodeehci_initpmap_pmap_ctor__one_cmpldi2cpufunc_nullopmii_phy_detach__muldi3db_qualify_ambiguous_namesuhidev_caip_mtudisc_timeoutrandomopenin6addr_linklocal_allnodesprcm_imask_maskbufinitbootconfigscsi_quirk_patternslimit0rt_if_trackuvm_md_constraintsif_attach_commonuniqdosnamedb_recoveramptimer_frequencypfxrtr_lookupvttoif_tabdb_delete_cmdbgetvppgrp_poolsmsc_ioctlsd_cmd_rw12uvm_pmr_addr_RB_INSERT_COLORucred_poolcpufunc_ifsrip_insertoptionsarp_maxtriesukbd_cnbellphtree_RB_INSERTufs_dirbadentrylogioctlgeneric_bs_wr_1_bus_dmamap_load_uiocortexsearchstrlendb_machine_initsensor_task_workfifo_kqfilterconfig_suspendpool_page_freewsmouse_inputcopystrsched_nmigrationsiftxlistwdog_ctl_cb_argsys_pipeusb_detach_waitarm_pdcache_waysarp_rtrequesthw_vendorelf32_check_brandudp_initproc_trampolinesys_rmdircpuset_copydmtimer_delayspec_accesssocantsendmoreproc_zapusb_rem_taskpte_l2_l_cache_maskcdactivateether_inputuvm_vsunlocklockstatusquotaoffcoredump_note_elf32fs_posix_sysctlif_slowtimosmsc_tickudbtablearm_dcache_l2_linesizeufs_printsitara_cm_padconf_get_gpiomodeuaddr_lin_createfatentryusbd_printBCDsys_statukbd_apple_mungein_baddynamichotplugopenlineswmsdosfs_symlinksys_symlinkicmp6_sysctlampintc_intr_disestablishclfreeconfig_found_smuhidread_filtopsusbd_interface2endpoint_descriptorfdreleasedb_line_at_pcehci_disownomehci_attachuvm_swapout_threadsknote_attachmax_keylensplraise__assertif_congestion_cleardb_put_valuend6_dad_ns_outputin6_prefixlen2maskuvm_pmemrange_use_insertudp6_outputcn_devvpcom_activatemaxfilesuvm_pagecmpuvm_pageactivatein6_addr2scopeiddma_alloc_bus_dmamap_load_rawffs_mountrootrd_cdrrw_statusuvm_map_pageable_allsleep_finishehci_device_isoc_closeipqomap_cdmsdosfs_strategytimeout_delm_cltickif_delgroupspec_strategyommmc_cauvm_pglistfreeusbopenums_attachsoo_statwskbd_cnpollccortex_cauvm_map_isavailrusage_pooldisk_detachstrchrhid_clear_localbufq_disksort_createehci_check_itd_intrscsi_sizescsi_plug_poolomap4_devsuvm_pmemrange_use_cmpuvm_pmr_size_RB_INSERT_COLORdb_deleteiftovt_tabsysctl_int_lowertcp_backoffworkq_task_poolsys_chrootehci_odevdehci_device_clear_toggleicmp6_redirtimeoutsoisconnectingarc4random_bufehci_check_qh_intraobj_pagerchopenstopenarmv7_cpufuncsuvn_iogeneric_armv4_bs_w_2MD5Transformmld6_inputgeneric_armv4_bs_sr_2pmap_copy_page_genericuvm_objunwirebpf_d_listsyn_cache_cleanupip_pcboptsfc_purge__data_startprcm_fmask_addrifmedia_delete_instancefilt_timerattachuvm_mapent_allocgptimer_ioticmp6statdb_single_stepgeneric_bs_w_4wsevent_pollticks_err_cntsys_profilvmcmd_map_pagedvnin6_pcbhashlookupbpf_detachdVOP_UNLOCKpmap_uncache_pagesingle_thread_setehci_root_ctrl_abortsyn_cache_initip_ecn_egressether_ipmulticast_maxuvm_init_limitsukphy_cdentropy_input_rotatein_pcbconnectVOP_POLLVOP_IOCTLstatvararm_dflt_delaysafepriuhidev_ioctlarmv7_bs_rr_4omgpio_v3_set_dirip6_copyexthdruao_swap_offmachineVOP_CLOSEuvm_anallocin_pcbdisconnectuvm_vnp_terminateampintc_set_prioritysdmmc_io_read_1sys_getpiduaddr_rnd_functionsipmultipathunp_dropuvm_map_advicetcp_mtudisctimeout_startuprn_addroutesdactivatefilt_msdosfsdetachdb_print_sadb_elf_sym_numargsdb_trapperukbd_cnpollcdoreadlinkatdmtimer_cddvd_read_manufactundstackconfig_activate_childrenip6_check_rh0hdrdomkdiratarmv7_bs_wm_1remrunqueueusb_fill_udf_tasksoo_closetcp_recvspaceuvm_meteruhidev_maxrepidpmap_needs_pte_synctcp_ackdrop_ppslimehci_device_ctrl_donemaxthreadnd6_lookupukbd_countrylayoutsys_getppidscsi_ioh_pendingmii_anaruaddr_rnd_selectVOP_READDIRdomainsrc4_skipsdmmc_select_cardcortexprintsys___sysctlsd_cmd_rw6arm32_dma_range_intersectin4_cksumextent_alloc_subregiondb_putcharneedbufferusbd_do_request_asyncin6_ifattachtcp_rst_ppslim_lastbs_notimpl_bs_rr_4ip6_multipathusbd_get_device_descriptorumass_fixup_yedataipsec_soft_bytesnselcollemul_elf32usbd_open_pipemsdosfs_lookupspec_pathconfhook_establishmountroothook_listtcptv_keep_initaddrmasksys_chdirdb_unread_tokenintc_iohdb_find_variablescsi_io_get_donebuf_objectip6_rr_pruneusbd_desc_iter_initsbcompresspmap_free_l1nd6_outputcdevsw_lookuplogsoftcsys_adjtimeamap_splitrefspec_open_clonewskbd_do_opensd_thin_pagesnclruheadscsi_move_doneuvm_aio_biodonern_initheadusbd_get_descuvm_pmr_printvop_generic_unlockuvmspace_sharert_timer_addentropy_poolroute_usrreqdeextendspec_vopssched_init_cputcp_dropicmpstatudpctl_varsuvmpd_scanm_prependsys_getrtablesmsc_resetin_pcbrehashpool_walkarm_intr_dispatchsyncer_delaynoin_arpinputpmodehci_root_intr_transferufs_accessin6_embedscopeif_alloc_sadlphpoolunix2winfnmsleepsdmmc_io_resetreassignbufip_freemoptionsums_matchsohasoutofbandddb_initbs_notimpl_bs_c_2nd6_dad_duplicated_bus_dmamap_unloadmsdosfs_fhtovppte_l1_s_coherentbs_notimpl_bs_wr_4maxvnodesether_crc32_becpu_reset_addresspgfindsoftint_pendingtcp_ackdrop_ppslim_lastip4_inputtcp_inputsysctl_dumpentrydkcksumuaddr_free_rbtree_RB_INSERTarm_dflt_setiplnd6_gctimeriptimerip_inputnd6_setmtudb_last_non_spaceusbd_get_endpoint_descriptormii_detacham335x_initudp_ctlinputsdmmc_io_send_op_condpool_sethardlimitip_freefvfs_lookupdb_show_cmdsudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnd6_ns_inputdevice_refehci_device_ctrl_abortffs_syncrd_root_imageuvm_map_submapamptimer_startclockcnioctlufs_vinitsys___tforkehci_nooppool_primedevid_allocsdmmc_mem_scanpgrphashtbldoppollifmedia_matchstatclockdvd_read_physicalarm_intr_disestablishrw_enter_writeamptimer_delaym_tag_copyehci_idonest_readamptimer_cadb_value_of_namepmap_l2ptp_ctordata_abort_entryarmv7_icache_sync_allhid_get_itemrt_xaddrsmsdosfs_getattrdb_find_breakpointip6_maxifdefroutersm_devgetwritedisklabelmsdosfs_printkernel_pmap_storein6_ifattach_loopbackstartprofclockundefinedinstruction_bouncesys_getresgidprocinituaddr_free_rbtree_RB_PREVmsdosfs_readdirdead_ebadfusbd_interface_countsoo_ioctlswap_officmp_redirect_timeoutforkstatigmp_sysctlin6mask64db_lbuf_startsoftclockarmv7_tlb_flushIDtc_initupdate_modifierreaddir_with_callbackffs1_compat_writedb_breakpoints_insertedswdevtdisk_lockarc4random_uniformsbwaithotplug_device_attachufs_reclaimkv_intrsafescsi_xsh_setsdwritememnamewsmouse_cafilt_logreadsysctl_rdquada4x_bs_w_4uvm_vnp_setsizea4x_bs_rm_2vmcmdset_extendip6_use_deprecatedehci_softintrextent_alloc_regionsys_mknodpmap_proc_iflushkill_vmcmdsuhid_attachufs_mknodintc_setiplsbinsertoobin_lifaddr_ioctlknotelf_advlockpffinddomainsdmmc_ccb_freefreedorenameatffs_hashallocswstrategyehci_allocxgptimer_get_timecountscsibusprintnamecache_rb_cache_RB_NEXTehci_root_intr_methodssys_getpgrpukbd_ioctlsonewconndb_fetch_regufs_direnteruhid_detachgeneric_armv4_bs_c_2pffindprotouvm_pageallocsdmmc_io_enabletcp_saveti6nchrdevfrag6_freefundefinedinstructionuvm_pmr_use_incaf2rtafidxnamecache_rb_cache_RB_INSERT_COLORcoredump_unmapuvm_map_vmspace_update