bF _\ 00ھ0X|5 ``@! ` # `` g!" $@` ``d@ g @ ga@2`"` H*/+ e g"aԈ 0 "#@h㿐' f@٠ X- f`B f`E` ?c/?+*`@..`@0  `   @@"`@@ ׀?@`@ e e"`@c e e"H@c e e"x@c e e"0@c㿐@ g x x@r  e e"@c  @ e耠` ga@@ g? `  @?`°` g`@"? g`@㿘 @]㿘@'    㿘# gaԔ` `"` a`@ '@``",06 @ * '@. @ …`㿘 ga `ట@ (@ 㿐 ga/` @ T@㿘  㿘 gat㿘# gad`2 `` 4 "$adp & 4$ad㿘   ?$  g`$`(㿘' gd`$ ?` ) g!`$ $ $ %!$ $ $ $ $ $$ ($ ,$ 0$ 4$ $ $ $   e @\""< ec) + Y`T e cL E e@ ( e(c@  ec< ;@c"  Ġ@ @ ` ec @$ 0  ` @! `  e@ "$ 4@$ @B"%`d`$d   e @6"㿘@ % e` ga`!# g`@aЀ  $ $  g` g`$$ I# g  a e@Ő#`$@a• 㿘 ec耠 ' g`; g g@ Ё?``````` ``(`$`,``\` g`X `p `P `d `l a ` `t$ `H ` `L `T `` `X  g a`H,  e c e c e `8 g g`H (`"))(`8``) )㿘 `)   `@  4 $` $`$$`(@ 뀢 '@ '@` (@`@ 2(@@   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" 5|5545454545454545545455p54545454554545㿈 ec @,@  ? * :  ?㿘 g`4 g!h ec@* : !!h x d e`؀ @(`8` %` @`(`` 8 % h@(` 0  x @Ĕ  ` + ,3`3  ? * : *?~ @w @(`8`  (`8`  @ @ U @ L @ l0  -  a daĐ!<㿐 aH'H'L'P'T'X'`!< g`8`8 ?@* @ @:`? ``  g  `<   #`  D>4 vɎ~(:':8Ǜ/74\ew%@)›Y#xB!LW*nl xUw&1*Mp8<EN(h} o(Y ÍN@cb9ĭ'{ . .. bsdbootg< @ Udb   Ud @@<@TELF@444 (@@x`` H&e44H4H$$<P xHP rHP nHP jHlHHP ^HP RHP XHP RHP NHP JHP FHP BHP >HP :H  H H H  H H  H  H H H H H H H HP EHP HP !HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP )֡HP *ҡHP +ΡHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~H <P HP  rHP  nHP  jH lH HP  ^HP  RHP HP  RHP  NHP  JHP  FHP  BHP  >HP  :H   H  H  H   H  H   H  H  H  H  H  H  H  H  HP  vHP HP !HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP )֡HP *ҡHP +ΡHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~H <P  HP rHP nHP jHlHHP ^HP RHP HP RHP NHP JHP FHP BHP >HP :H H H  H  H H H H H H H H H H HP HP HP HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP mHP ҡHP +eHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~H >8;8;;;;; ;(;0H )@`  >8!  >8;8!5 >8,0+0;"+*+0΁`#@ 0΁1 !>&;8>0)@09`")@)@0΁`# 0΁1"; >8 9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/> P->8 %)>8 %"+/> ->8+cP>",`"",#t@>ː x;x ;"`;" @Q@FҊ@@2 @ 0P -@ @ @"P/> P->8 %)>8 %"+/> ->8+cP>",`"",#t@;x҂@ ;Ԃ@`;"k  ւ@ ؂@ " +?P `* -` @Qt x ``-`ぅ @Q tx ځ )>"@"P -@ @ @"P/> P->8 %)>8 %"+/> ->8+cP>",`"",#t@;x;;>"" ;`#h#l;;;;@q``htx ;`#h#l;;;;@``htxy )>( H@)>( ā P -@ @ @"P/> P->8 %)>8 %"+/> ->8+cP ;`@;h#t;x;;;;;`@;`htx3 />(->8+cPۜP -@ @ @"P/> P->8 %)>8 %"+/> ->8+cP ;`@;h#t;x;;;`;;@~-;`htx쁌 -?P @c-@-P -@ @ @"/>(/> />(6PP->8 %)>8 %"/>(/> />(P;x>"<`""<@;,/,;@ ;`,;h)>̨!#p 8% 8H  p@ @ `E < 0x  +?P`-- -?P%-?P0P -@ @ @"/>(/> />(6PP->8 %)>8 %"/>(/> />(P;x>"4`""4@;,/,;@ ;`,;h)> 7 #pH  p@  "`@  0@@Zѐ`x0 `E <P -@ @ @"/>(/> />(6PP->8 %)>8 %"/>(/> />(P>"4`""4?P *`* ;`@;h09P -@ @ @"/>(/> />(6PP->8 %)>8 %"/>(/> />(P>"4`""4?P *`* ;`@҂@ Ԃ@;h ւ@ ؂@@O}`h ?P `*  P -@ @ @"/>(/> />(6PP->8 %)>8 %"/>(/> />(P>"4`""4?p " ?P "  / ;`@;h@Yۚ`h ?p " m @/>  @̀->8 $)>8 %->8+cP->8 VP @ H ,@`#>8`$` (08 @̀;)>8 ,0+0;"+0+0 `# @ 05-! % >&t 8 >0-@0=`"-@-@0 `# @ 05-"Y  ->8%- +cP ;`@;h #t;x;`;;;;@~&;`htx ->8& 0Ʀ! H,@` !`hpxX (08@HP @̀H,@`%>8 $!>8 `8 (0 @̀@ @̀  H ,@`#>8`$` (08@̀22?@ @̀;'>8,0/0?"/0/0 `# @ 05-!$>& 8>0-@0=`"-@-@0 `# @ 05-" ?  H,@`#>8` $`!>8 `8 (0@̀ ->8  @wP->8"/> 84  ! H,@` !X (08@HP @̀>8 `?* `"" * `@">8೒  * `@&* *  ֊@* "``@!>% $3  >8`"@%>8$   c d  mt@ >  >8 4"|@t@ >  @@   >  @@ D#>%>Ѥ  '`@`@ 06  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>%c@>8"  *>8" (!`>8" ,H(  /  >0 ==>7PH >8" 0> A!H>ђ`@8D"@!>5$!(H``>5"a !>%#!>&#$ $ >&  *> " > " > "!> "!<>#"">#"# >#"#t>#"#>$""P>$""x>$"">$""0@Ig@Rd#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP    "%>8> >8"  ">8>@ >8  >&b|#  >&b# J@*@ ` `*@ ?"@ 2"# @ `*@ @ `*@  "  ?J*@`8  ?"@ 2"> * >8 >@ *>8 >&#d@8" >8" >8"   >84``6 >8>:H"(o  ()X`!4"j j ` *@  ( !>5!$` (08 2㿠@^>8`` Ъ@@>€"Т@: H" H*/  dh>8>'a" `2 `2`2" " ?" ?@>'a" Њ@" "@ 6 :@ 6 `6: >8`>( ` #` 6 J *@`#`  `"<" " J *@`#`  "J *@"`" "R 2@`8"R 2@"`" " "@`" "@"`  :@ ` " "@` R 2@J *`#`  2J#`  *@#`  #`  H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$@% #@%"$@% #@%&؃%"@ւ"%ւ"&؃"@  >(| "2 J "2 J   "2 J  J  @ @: `  : `z Z@  r R@  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@ > c@ @: " longjmp botch `&"`㿠>)@5"6 0l(h؈ٌ00hԴH<<<PdP(p 8Ho$(@eHp@㿘  @@ . @@ %, ` .  @@ .  @@  . `$`" ԟ@ Ԁ` ! Մ`&$㿘%$9@~> * * "@~6* & 㿘` `@  `%0``  2 %,`` `%,`2%0`"%0` ``@  `@  ` @ ` `   (`(0`0 (` ((@ (`@a2(@ a@ 2@ "2@ 2 `M(  `M`"` `N(`@ `"`  (` ` @"` ` " @` @㿘  `@ %,`  ` @  㿘 `@ >@6!  ` @ 㿐``  (`0`,`@` .$```2%,`Ђb@!>8@}h#_ [ @}`#@.`%,`   @  ``    `@,`` ` `"O`M%0`/`B`D &% &%'` %% @ `@  `2 @  ̀`@2 %,`  `@ %,`   ` @ %,`  ` @  ` } P `  A ` %0`   ,`@``-   0` `D`M.`,`,*``N *` `.` .`.%0`Q O  &% &%'`%% @ `@  `2 @  ̀`@2 %,`  `@ %,`  ` @  ` @   $!`@6$.$    Ÿ@ `@͐  `  C  $!`@6$.$  F  B@㿘 ` @ $`` 㿐$`@$􀠠"!%  ` @ 6%&% > ` @ $%%`@.$6% !8@͔'.% `2%,%%  @&% @(6$6%(`0``Z6%``@`"%``$m%`2$%1`@`` ~$s%a2x$G$ %``` (% (%((`0 %@(%(`$ b&% `` (Z% %``` (% (% (`0` @(a%(`  $`> !h@Z'S %``` 5`> !h@L'\ %M(%N(` %&% `.$ ( ``` (`0` @`(`( `.$  %  %.$ (%&%%,` 2% %%  ` @ %88 '` %% @ `@  `2 @  ̀`@2 %,`  `@ %,`  ` @  ` @  ` @  `@㿘 ` @ ` @  ` @ @!%,` 8=>(`>)@  ѐ @   `@ %0 ` &%0@ %0 ` &%0 %0?` &%0 . .  @  . `  @  @s!  `@   `@  ` @   `@ %,`  `@ 㿘`` >%%$%%@! @@ %, ` - .`@@ ,@`@& ׀` ""%  `@  @@ .  @@` %@@ ,@`@& %@$%㿘%,` $%( (*?@ >@! ` @ $%`@v.$?` ` *`@ (`@a 2 *`@a   @2  @"   2A ` `    H.$.@` `- *`.$& `˒ ` ``@ ` @ $%`@.$"`@ ` @ $%`@ .$6%`@ &$`H&$  >@{" ` @ $%`@ .$6% 㿘%`2$ 1>"h"$$  >@Y"$&%.$$`"% ` @ %%1>@"@D($ ` @ $%`A.$(6%`%`(!$(``6 $2` ` $  `2 `" $ ` @ ``&%``>i% %`` (`0`,` "*$쀠-`@z$ $`o%`6 ` @hc$> @Ȑ"&$` a $` `&`H` `$ U.$(`0``@```2L%> Ia2F% >@" ` @ '  ) ``` (`0`4 !,`@(`@a2`M!  @ 2@ "`M2`M`".`N`N(`@ `".`N (.`N.`M  ( >@_# $.$(> @R#H(` $ .$` a&` $&`@$&`H&$`H&$쀠``y_`2 .`%``.`.`%4` "$ ``|$` ,`(( `'  ?-(%$* * "@xP* .`$` %4 @&.```(` .``.`  `@ $%`@.$6%.`$.$q%> @А#p%`` `@(,`(,``X(@gP>#@gK>#@ ` @ $%`@@.$% >$(`0``2#  `*`` > `6$ ` #% ` (@   @} h ` @ $%`@ .$` @ $%`@ .$6%%(`` ` @  ` @ $&%.$㿘$`>@&  /> `  (`0`- @`(`  0`@ ` `   - @(`@a +- @a  @2  @  2$ - `"   !`" - @(`@ a؀<  `"$   ` `  .,`M `2 F@ (``  ` $2  `"  `, , (@ ` ,`N ` `"@ , "@@` $@` ` $` $j`2P` @gL 2|:0㿘` `@&` '&` 䀦@$>8 ` @ $%`@ .$6%>8`'@v#`@㿘``/  (`(0`0 @-  .`/  (`,`,`` 0`&`  &`D &`H#&`- &`@@` - @(`@a 2   @2  @"   2 `2, z $ ,  䀦@2 `&@  `& & `  ܂`&`&` $`㿘``  (`(0 0`,@(`@a ,@a  @ 2  @   2@``L`(2 `( > 4 *@˕2`(``L,`B` `@` "`L  $`(`>``H$`$T$`$  䀦@ ,$`&  U.$,` @d㿘$   4   @fP '> a؃, 0`,`<0` V<. `$ !`  $ . `@(`@ aE > A>c!p㿘> A !p@^   >3@.a `$ 㿐%>=0`   !> A P!p#\>@`!p@  > A>2!H>2@j{☂ $0 d`2``$`$`$`` @,Z$ Ć`Ā@03 4d`,d( `  (`^ $ , ` (W `& `  ( ,   2  @`Ā&#!$d$d `Ȗ 8 8`(`e4` @ (e4`(((@`Ā@`` ` ,d` @ e,``1a"1I#=,da h '`` `4@d77  @  H L $ @ ` $$$%$@> a>b#x`-#`0-0`#l#p #t#\#d#h>@r!@ `@ >@i! 0'>@b#  (Ԓ 䀦(0` @``$`@c>@H!`  ȃ(` 0``($ h `@ z >b>bX>b>)cX>)c4>b>b@>a>a>)c  ԃ(`$ @@  " $ ` @  $`  >@!  䀠` > @Ր!؀  Հ`@"<$ Հ`@@ @@  " $ ` @ g $``2 `  ("$$(`6$ .$$$ >@! @@  "А3  `.$ @ "8  `@?2 > "8` @   Հ2# $`" $`2 $$`  % #\`2 Հ`  ?`H#\ @x  Հ` "  Ԑ@q $`   @ $%`@ .$ @ $%`@.$6% Ԁ` "R$ 6$@@   ` @  ` @ D$``88$(`@`, $"$``` .$(0 ($`2`> @#` `">>@#0*@#@@`O   ( & $``(`@ >@#X: $` >> #@ + @#$$`"   @@  > @Ґ#> c @@? @ǐ 4 ڐ Ԁ`d $6%6$6%`.$@` ܀`$@  `& & `  ܂`$`$` & $ .$M   $%%,`"%   $#\ >@#@.$  $ .$ @ $%0`" $%,`2$$.$$``q  Ԓ >@^ Ht ``̀`2`>' x ` (@@ `  *0`, @`2 $ `M`2$>5 `"(>/ `,  ` @ $%`@@.$6%, @ `! %4**$ `.$ `M`  @ $%`@.$ @ $%`@ .$ ` @ $%`@.$ 6%X&$%0`" % `@@  K!  @  @   ՘ #`#\ , ,`4 4`>@ǐ  ` @  ` @ $%`@ .$6% `  @!%0`!% "&$  #\ **>22#`!@ !&$`@&$`H &$X.$  >  @!P ` @   $`"D$ Ԃ.$  > @m! %8%@c %%@,`L%%@` a $` `$`H` `$ .$@G  &%` @ 0L >@;"} $`>`2$>"(@  "$  "%,4O " > !^ >$X&$ Ԁ%,` 2  ׃(``& $ ` @ $ ` .$ @   " $` 2$  ֐@ $$$߂@.$`?t  ֐@ؒ  &$@@  " %0 ` @ %0`/`C`D &% &%'` %% @ `@  `2 @  ̀`@2 %,`  `@ %,`  ` @  ` @  ` @  `@  , ` @  &$` @ $%88 '`$$ @&$`2 $ ` @ $%88 '`$$ @&$` ~$`  `@  `2 @  ̀`@2 %,`  `@ %,`  ` @  ` @  ` `  `@S  `.$ @ &$" @  .$: @]%$@pB 2Ђb@'"'@? `@ @C @ 耠      2 @   2  㿘#`@ " `~q`` q$`Mt"#耦2  㿘  4`   0 @& ?. 0 . 2 . < & (@^p ((` 0`0   (` ((@ (`@a`2 t(@ a@ 2@ " t2 t&  &  & D`& H &   @& / & D & @ & H. L&`& ` @$` `& d` o  z f q㿐%`2%  @_̔ &%%`2%  @_Ô &%%`>%`2%,>@" * >@">=%$`@>@# %$ @o6 . Ґ 2%$ . %$ ҅(( @ (`*` "@o#* %, . Ӏ` .   &  ` & q.$%( 6 P><c& ` 6 >> AaH&  06 R& d'>@ 㿘  ((` 40`o0 . .` ..@(`@a 2 .@ a@2  @"   2 "      .`@(`@ aB @^ 㿐 d(`0`d@`@nc>c!hc(b,@ (``6 ! dd6 dc@Bc!` @J  2 L$c   (`@ ah al$ !&!"2$c L @G  c0,@ 6 b?7/ 07b@ b̐ @ Hc c$c`   dd6 d$c㿐>#`>c)0>'cآ %#`f, #(" (`Z {@;6 (``0`@@(`0`@h@"؀`&"@@(`0`@d ؆@> ؀d"  ؆@>  І@> Ѐ" "  ؆@>  Ȇ@> ##  &#`  &# 0#`"6 㿀>`@#Ĕ >#`P>`0> ` #$",`@ (`>`@"``2 `@E` ` @: @> #,,`*2@ @?"/:77 #`@" #$&# 0@W㿘"Ȑ@ "6"* 4` O "̐ ?@ "̐ @ @`  І@> Ѐ( @> (  >@ݐ p  >@Ր  @ > 2  >@ɐ  А@> @%  $&"M" ʐ h (`0`a"7?7"`2"Ȃ`7"".#8#4#6#8#5#7#9(`(@ ( 777@Ԑ 0#$##@&#0`7&#&#U&##(?# (` 77K0# "?* 7ސ @ #,#@#$0"/?/:, 77 7@ #,  #0#@#("0/0, /77 7@ # , 㿘>;al&#<>9b@ &#@## (`` (&#(@&#   &#$#, @#( #0 @# (Ho&(@gHp@㿘 "̟@ 㿘"܀` @㿘 d(`0`` &`"`"" &`"`@"@>_` " >^a ">^a 㿘 d(0`a%"``!6`6`6`6@"X  @Xh 2 (@2   (@@6@   d}6 d6 d?6@6`6`6`㿐(P !`@?e8G  @  "A  $ `$ '2   @ធ  2 @- @ @( (`0`` @`( '`$ @$  " & @ @$ 2   @> "``"`` @! @@(``@t 㿘  2b@@@ ;bĔ <"@ <㿘"̐ @  d"Ѐ`""@""̒ *@2#<@"##  , 2"̕4  @_ d"̐ @ ab"Ȑ@ * 2 !"Ƞ?@ * 2 !">"̐ @ B #@`@{6 6  0"Ԓ @ "Ԁ`@ 㿘㿘 a@(@80a @?  da5@20 a6@25- `6 d(`0``@2v``25 `0@xz0  d(`0`` `@`2 da# `"  \  d6 d @[b@X%`0 4  d(`0``@"  7㿘 > @` @< 㿘   h@!#@ &!>=a&!>=ch&%&!?`"& 06 > " ><><t@Zr" 0`   !"`@ @[' "耤@,`" @[  !@[-#@8&##    ! &# @  &#&#  &# &#   @&# &# @j& @j$&# &#@V)">@!#>@!  @Un&!@Wڐ#  @Zޖ &#,#   @Zؖ �,4@ Ho&(@gHp@"" c"@#@>`88D#@?`88H#@0`@88P#@`<@` aT#@>@`88X#@?`88\#@<`88`#@`"  ``d#@ "` "(`@(`c(`@(`@c0#@#@#@#@?`88@#@`00b#@ !88`@ࠂ @#@#@#@#@#@#@  c"#@#@#@ #@#@#@#@#@ #@$#@(#@`<c`#@# #'@` 1 ) ?c (`@? 0@@#` "` "(?(c((`@`#@ "` "(?(c((`@`#@ "` "`(?(c(`(`@`#@"$` "`"b@?(c(`@?00@@b@"#`(`? (? 0`? 0`b#@`"+"(*>>@0$ ` $$`$``?(0c(`@?0@@ 㿐 d(`0`d@`@ n!h` @ 2 a acH /`@cH @ `" , 2R!`@ݐ  I @  2B! ,D@c( ! @ dd6 d`@  (`@ ah al&!&!2 L @@c  `2 (ɲ  @ 0`G/`?? @  @   #l? @  `?3` + (@  *   ?  @?0 `, 2 5 +`( @(,4`4 44@    ; cl  8`4  c`    @ ,@  @`D/` l? @ ? @? @  `?3` ( *+ @    ?( @0@ (? , * 4 `+`2`  2 0 4`4 @  ; cl 8@ `/`@ @ `d`` @ ,@*= DD) %#HH D(`@ cH H@`/`??c@ (@ 0`7`! cH% 6 b'H(`@cD`"!!`!h@ k 0   (`@ ah al" !&!2@ۙ @> 㿘L6`!DcD` " ` cH @`(" @cH@ycD$cD Ȇ@> $&` , ߢ@cDcL& {6 `"6  0  㿘cP# cP` " `  @`(" @ @=$ 2cd&ch&X"`"`4?(0c(`@?0@@`4 DŽ}(0`a6 "`  6 (`0`a@`>` @``@2 @" 2  ` ??c@R[ 2 (2  8 (@@  `6   0 ((` @0@@#@  @`` `) 1 ?c (`@? 0@@`4$㿘@K"""&`"&`㿘"` "@M 0 @J"㿘""`0 $Ő#"@@ @? ?) 1 ?c (`@? 0@@$"Ȅ@ `@? `a`@`) 1 ?c (`@? 0@@<$@`8?(0c(`@?0@@"Ȁ" $2 `) 1 ?c (`@? 0@@`8$㿘 #?c?c@` 0((`@0@@@ d@@ =??2" 㿘`""$`$$  3$ $` $`$` @`.6?(?0`&@$$  $@@?@`88T$@?`88@$"@ "`0@?(0c(`@?0@@`0@ `(`?(?0`?0` 0 #@ >C` "@ "`4@?(0c(`@?0@@`4@ `(`?(?0`?0` 4 #@ >C` 㿘"".`.`@@b ?@ # @.`6`#@(?@0`#@ # #?3@R ` 0((`@0@@@ d 1>@!X㿘"".``.@@b 6`?@0`@ ? c'?3@ ` 0((`@0@@?cd`> @p!p㿘@>> !@cᘁ 㿘"- bh`@' `@`` >  a>  hd > @  @>  @1!㿘""# $ N 2>`@" 䡐#?`88@&    4 `> @"@㿘""#$   2>`@"`p#?`88&     `> @ΐ"㿘#M"ʐ?@`88$`   > @"<㿘(  @\ 7 (" " .`@cP$@@  @! " >@">@e" `  `(@  @`  .`clG0? `( @  * ? @0   (@,  ` ? @ + 3`? 4` @(0(+` 4 ? ?   @3 2 0 @    ` ;0 `9  P`N.`(  @  @  ` ?( @  * ? @0  (@,  ` ? @ + 3`? 4` @(0(+` 4 ? ?   @3 2 0 @    ;(        9 .`@ @   d ``$㿘  |#d#P@B   ? 2 T @&㿀"'">'aH@  h 0T5/  P@#@/   # `E/  #l ?@?  @   @??  @ `(*`  ?+  @ 3` 2*@   ? `4  ,- 5  *@+`@ 4@ @4@5`5 @ @@ cl    @28! " ` ``(@ " @`@'@ @  &@@b>   ` @ ! 0(@! @!  ``2l"! #h<&@`#d?(0c(`@?0@@a @K 㿘  cl(@""  " ` #@@   (@""  @ `  cl    | #P@Aq 㿘@" d6 b{`)6 d@Fe"Z"#cD` " ` cH@`(" @cH@cD&cD`@2cDcD$cL$cH$g#߰㿘"" Đ c`@zl`  (0?c(`@?0@@` $@`#@0?(0c(`@?0@@0`$@`  (0?c(`@?0@@$@`#@0?(0c(`@?0@@0@`$@`#7`?7c$`>`88@`$$@`??c` `($@$@r$#`` @@@`) 1 ? (? 0`$@$@Q ``(0?c(`@?0@@$@` c8`(`080`@8`8?( ?0c((`0@@@c8`(`0880`( @8`` $@``a"$@@E``4@?(0c(`@?0@@`4@``) 1 ?c (`@? 0@@`4% $@`"@`d?(0c(`@?0@@a $@@" d`@{6 d 㿘 @G@ 0 @@F  da5@00 a6@2<+  d`6 d(`0``@2``2; `0@l6 (`0`` `@`2& dp* `"' 3 "  @Oyb  P(@?@ @L`0 4  d(`0``@" ̐ 4㿘 >@P` @> 5㿘 (`"0``@E"`(`` @@a45?@) 1 ?  (`1 @@@/ 7 66`/`(7 .@@ @ `` @@a4@@@  @@ 0㿘"`"` ?(0c(`@?0@@` ? ݐ`@   0ܒ 0v ``@?(0c(`@?0@@`@`  0 R``@?(0c(`@?0@@`@`: @> `` @?(0c(`@?0@@` @ c&``@?(0c(`@?0@@`@ cc&@ !㿘" "a a@@1 ?) ?c @  (`1 @@3` @ (3 @ +`   a a@@  aa@@1 ?) ?c @  (`1 @@3` @ (3 @ +`   aa@@ И@@ > ИD > `3 a@a(a a$@?@) @1 ?  (`1 @@+`3`@ @ @ (`3`@@ @* 22 2 + ( 2*   aa(@a a$@@@@E > a&@a&@a&@a &@a&@a &@a$a(&@&@x @B"}"@~z㿘  0 N%cH` " @ cT@` " @$"#@ @"" @#@" cl 0@"#< (@#(??@B@MF?@J@Fʁ㿐&`0"> $a#<#`#(#\   "" 1>@##< , cl  " " >@{#8b#@ #\    " " >@h#hb #@ @  cP  `>@U#ubb. @`(#\ (   @>`@=#o @ b. c@@`(#\ (   " $#D`>  @5@ @Hb>@ Hb@`ba ?(0c(`@?0@@a (` c`&@ @`h?`"6`>@`&a>I`&a>Ia&a#&a܂ &a>Da&b>D`&b>Bc,&`0&bԢ`0b&b >B>B@L8c`$b`P c"$bb&c@b`) 1 ? (? 0`b#@c`` ??@AҚ!b`26bc!2bc`8-bb ?&c@b` (`?(?0`?0`b#@c` ``? ??@A!b`28bc`3$bb@?`88P!bb@?@`88T!bb@?`88@>?!c&b>Ca&bВ???@Ab!b`   ! @LS  !@Ldb``` ``2c`&c2@Fݐ@IIbؔ>JaĴ@z1 #@3>I@z֓acH` b @&@cH@@` b @$@b @c@b @c@b cl@ 0@bc< (@ ܴcT  ?? >>N >a | >>N >a |㿘 @ޔ!" &(&0>=``&40` &,&8` d&8 `>@r``  6``>@k`p`, &`< aW6`r&`&@6`p@ 4 1? (6 ?6 c.  (`6` 3>N@(̓`|㿘? 0`@> 4  |@o  ner@"/  `s@e@2^ )`Ђ`h@"*` V c@`+0N  @J! `В@! @J ; z 5 @~!0 &`Ѕ(&% `0@Y ``@.  e`g@4`Ђ`(`,  ?c>N `|* @'@1@㿘 D? `> @ |2`@@2` 8`@C?9` G(`(`@`` (`0`   @@X*B  |>=``+` @ 8  8"8 0>=h @ H @  8 @ & < 0 8d& <& 0 & @Ho$(@e@Hp@`@㿘? 6 >  |4@   `0@ @b@@~ 㿘? 0`@> 4 |@t   0@  `  А  @  @@S㿘 >N@"t 0@ ` "`L>؁``0㿘> A1> >  |`hH H$      @Jm   & | ؒ @Iܔ  > & &(&& > @ (&,> @ |>G @&& @ @~۴ 㿘>@ΐ 㿘>@ɐ 㿘>@Đ 㿘> `` > 7`` `2 `(`(` > 0a@㿘> ```p> 7`` `2 `(`(` > 0a @ 㿘> ```p> 7`` `2 `(`(` > 0a,`" @㿘> 7`` ``@㿘!> 7 `  `` @  `` @ 㿘> 7` !> >   ` @  `$ 㿘> 7````> ` > 7 p`  @s@ 㿘 `b@1>  ` @M  "& > ``"> 7`p`` `2 `(`(` > 0a@㿐> 7``$!>6"0 `@5$"0 @ J 6 @ 6 `(`(` > 0a@ 㿘> 7`` `? >6b0b0@6 `(`(` > 0a@@    H'0`w@   @H[$$ 2 @$  $ w @ 2q  `,@I?''''`*` @%:` M (`0`` (&` @#!@`*`@!ړ:`@ 0` > `  `( ` `$ `0 `4 `8 `< `@ `D `H `L `P@" `T ` @.’@IV @G    `" @.@IC @G TU\U4UHUUUUUTP(P(QRVVRRHo$(@eHp@㿘 D`8(( @@ D!(a(&!(`2D 㿘 &`Ց㿘 Ă?!(B (@ (@ ̂ ( 1a@"5㿘%؀` @ Đ ``('%؂@&%؁㿘> ` А @` ?  Р 㿘> ` А @` ?  Р 㿘 ! ( ``(%Ԁ%%䀠 %%܂@&%ئ  &%ܦ  %%܄ (@&%&%܀3&% &> -!H22># )  )> >!! 8@`@?`@?@   .% .% @  .% %6&%!x@`@"7  22  @0```2+ Ģ2 %%؀`2 % Ă ? (y% &% ( Đ(@M ? 2 Ā(@2  Ā`4 %؀`  Ă ?( "㿘 Ģ@&`@`@"%&; 2 & @0``@ @.@ Ġ (@ ? (@ 2&`4 а&㿐 @'> ` @ `> ! @  @  @  `> !@r (@@    @ >@^! Ą (@> ` Р?@   >@K"   Đ(@ (@ @ " > @5"8J!>@0`` "P (@ @/`(``>"h@ 4! ,@ (`@dԀ&>!&!`&!!&! &%&!$&%܂ &%&%Ԁ@ Ȃ $( `  ` @  )"@ ! Ă`&!  (n   &%i&% (@ (@  @?(!&!㿘 Ģ``('@`@"& 9 2!  @0``@ ( ( Ġ (@ ? (@ 2 Ģ`4  Ă ?&(㿘!` `@ @!`(` $((`2/&!`   2```"#&! ```>@k"$($`&!&!``(`@(`@ dԁ > @V" $(&!``` (`@(`@@uT d$@!(&!(@C7&!㿐!!@`Ǥ >`>Q)> `< >c` @`@  >@)# ' ( ` ?  !`>@#80՛ d 0``,@!`><# ̖0(@ + u !`" ,> > #@ g&%>0` ``#!$4#    В  Ф @0``@2G&%>#@ !` &!: `"  !&  @ .&%Ԁ(@!$!    @ ! !$@ &! &!$! ̂ (`"  /  ` (`/////      4  $ ( ̂ !(    $ >@\ ݤ ٤! ̂ ( %@`%%  ! &!% &% @`@ 2&% @0```2&% @` " !} !`&!!`2`$  q !`)&!%@(``&%%`,` (``6 %%`%` ` $  %`2 %`@"% Ġ (@R 2 Ą ?(@a Ѐ` .>(`>Q@6%(%`20 (!`&(`0``&! % !$!%  &!  &!$%` >` > P@   @`` &! Ġ (@ 2 Ą ?(@N&%Ԓ@!` &!R Ф &%Ԁ" ``{  @``" !`&! @ !@" Ԑ  @`   >@X  >! `&!``>@F !$6 !$`` > @5 &!$!$' $0> ` @`@? $`Ӭ  ` >@!\ Ā(@ (@ ̂ ( (@  @?(  &%&!&!&! &!$&%&%&%ԁ㿘!`"!@!``&!F !`@㿘!`"@a>;>8a` >a8$) )  ,`"$0- @(`@dԀ`2 $(`&$ !  ` ) !`@ &!!`  (@ (@ (@Hof4 (@g ?(@ Ƞ (@ Đ @`@ " ?    ` 2  Ă  ( @` "  Đ(@ Ȣ (@~͐M!(@ Р(@s  (@( Ă  ( Ă  ( А @`@ ?  Đ ( Є @`@2  ̂ ( Ģ (@ (@ (@  @?(!  Ą(@!@   $( !`"&!`c@!%؂`&!Z&%؃- @(`@ d&!   &%&!$&%&%Ԁ`&%؀`2$ (@3$ (Y&%&! &!$&%&%&%``! $`&%,&!* b !#&%"   耠"  !&  `"  `"@` ` @Q#@qՐ q!`"$㿘 `4a`   a` ```>@!a`" t>@h! t  @ ` (`0`  ` (`0`     ? a(`$a("aa, 8((@(`@@(`@(`@ $da`xm㿘^`>@L!0 ` `4 > @C" `& !@2 @ ! (`@(`@ d!`K@㿘!` `!`@!` נ !`.㿘>W b, ,   ($@o   2, , (`@ dԆ' $>Q>Q@E*  & &!  &%6 >( (@ (@ (@  @?(!` @  Љ( @ ` ` `(((`@@@"  ` ` ` `(((`@@@"  ` ` ` ` (((`@@@"  ` ` ` `(`((@@@" >b>`b @ ` ` `(((`@@@" ` ` ` `(((`@@@" $ ` ` ` ` (((`@@@" ( ` ` ` `(((`@@@" , ` ` @ `(`) (8`8(@8@@" ` ` ` `(`) (8`8(@8@@"  ` ` ` ` (`) (8`8(@8@@"  ` ` ` ` (`(8`8(@) 8@@" " 0" 4 @ ` ` `(((`@@@" 8 ` ` ` `(`((@@@" <'P'D'H'p 't 'x '| ' ' ' ' ' $' (' ,' 0' 4' 8' <''P? H(P ''H'dptx|'h'l 'l@ (`0`' (` 0` (0d(0@ @/ 7  @(` 0`) 1 @(0h.6@@@(` 0`/`7`@@@(0+@3(` 0` . 6 @@(`0`@. 6@@ (0@@@(`0`@ (+ 03 'l /` 7`@@/ 7 (`0`@ *2 ) 1 @@ @+`3`(0(`0` 'd@ 'h*` 2`@ @@+3@(`0`@`Vptx|@@@0- 0- 1 - 7`- 7 - 6- 6- 6`- 0- 0- 1 - 7`-- - - - - - - - 00- - 1 - - 7 7`- - 6- 6- 6`7 - - 66- - 6`- hd@@` l'2  @2 001 7`7 66- !- $0- (- ,- 0- #- '- +- /- 3- 7- ;- ?- 4- %0- )1 - -7`- 17 0- 56- 8- <- 9- &06- *- =2 1 - "- .7`7 - 2- 666- :- >P`@'?(   )  'P@D `4 `0P @?w'P㿘>6bP>8`> 9aH>0bfg(`ςg(`3g(`ᛂg(`+g(`0 ( (`0@&@?``@ ` ` ??͒ @ >6 bP>8(`㿘! 1> I"lJ` "l  `(`8`   >  `Ё"`H>  `"`H (: (  : ( a@`` ? 㿘>`> @ot`1>6"X@nb"8㿘> I!> 8"l!H$ `(8 (!H  @( 2!> 8 (!H!H @ (#> I b㿘ڒ> I b> 8$@֐!H> Ib 㿐!> @' >6bT ` >6@m >6"p`( Ć@%>88`(>7`0 ''@'" @'ې"p@="p`(@$> @' ā㿈>6bT``>8@d>8. `0  (8` <   $ @ 8`8!@$;` @48? 8 ?c`8 `8 `8`82 ` ` ` `[> @'n  `>8>8``0( %` 8 %>6bp`8@B8`8% % >8`@" >6`(`>7`0 >6bp`0@-8`0.  >6"p ,`@`@@@B$`;9 C `8`@B . ;@@%`%` , @ %`>6bT ``2> @lݒ > @'  ā> 㿈 `@d:> ;  > I b㾈%#> Abh> 9@aH@~@l@k (@ݐ (  @@ @`ِ@cϐ @( "> @&  (>6bp`@ 8`> @& @Ғ (>\bd 㿘``8   @; ' @Y @*```8`2`@ɓ:``` @pe``ဢ@ ʐ @ @;㿘 >8 0   @! !>!  @2 (>8#>H``a   2` > I F bh  >6>["8@j`Đ 1>63>[ "T@ja㿘#> Ibh` !> I> 8 (!H$" $bh"@ @G $"㿐#> @&` 1> I"`8" ْ " !> 9!H@$ "  <$"@͐">6bp`?@&"8`@%`㿘   @L  @L㿘> @%ِ > 9aH%> I`$@@ $"@ @$@$``  `>6bp`1> @8`@% 㾘`a Đ`@ @!&㿈@bƐ Ð  > I b> 9!H0` O  @:Ӕ (3 В (! Fߒ (@ !'@ `v@XV ```" `@o+`'``ސ `@Y @@V @:I㿘 `d     ``@ @GLE<   X@G"@ @&8@&&& 㿐 `@G@ ` @ @2'`H@&'H   @' ?c%  ' ''#  d@`  ' (`$` ` ܐ@# 6 `'؀`  @(`8``=2 `'  ``'`0"$`8`X@* $`8@2 <`8`\@:<`8$`8$`<  'Ԡ >8 y >8``8 @'8`8`?`X'6 `' '8? ?`@ '̶ ?'  @ "`8@`8 C  H  `8`  @8`@ <`8 ` 7`!`䀠`C 0``@"i`8؀`@(`8``.   !(`8`@`@s$`@2J`8`ؐ@{ !  `@^`|(` `<2'"1`8B`8"|@L(`   $`@@9& @ (`0` @i  @8Δ jВ  @8ȶ `8 @C<`8`8Q8L "1`8$`@̭;` @ H`@F!̡8@< @̀ @̒ x ԂH<`8#@  `0$`8$`<' " @ ܐ@@ڔ ?Ѐ >8``0@8`0Ȁ @ ```8<`0=@s @x @% `@ (@@ @  @ T? cO% 쀤@  " @h?c% , ``@@ 2  (@3@S @@ @V@% Ȁ  @   @% #@ "ܐ@@I `2   @㿘 gl     &`&@&` ` @G` ?Aa9, , @ @(` @,`,`""*  @G{, 80`@8` d$@Gp0` `d* 80`@8` $, ,  @@(`(` `  (( @ @ -8`(`(` ( @ 8&`&@&`  (Ѕ( @< 㿐 ? /  /  /  /  /ܐ  //z㿘 dg@> " d@$  d :@71 & d 㿘 `d$  @X (``@ h>8'D'H@xaD  @ H  @  @ >8a( 㿘  >8a,*   2  2 2 2! && $ D  @5Ȱ 㿘>`0`'>8,* @2 2   @ , 2  㿘>8`  9>8@S(>8  a, >8! ``` `((`* * 㿐'``9  `5 (@ 8c􀦠' H`" `h=    ` `h`p>`>``x ``>`x>`  ```>`x>`>`h>`p @p㿐 `'?6` 6```"Q`  "M`. 8  􀦠">`H`29` ``@`a6` `@2``@6``2`` 6``2``6``2``6``@2``6`(`@&`(`@&``&`am&`6` @ ` @((* 㿘@ 4 @ $ @ $ @ 4 `&` 㿘ݐ `` `* `&`(`8``C`   `( x0@"`㿘Đ  @2 ? (0`?@`@(`#` ?(` ?0(#``&` 㿘 : &` &` 8 &`&`$&`㿐 `'` !`?@@` `p `܀"```  ?)c-&``  ((`88`@2 ((`88`@2 2``"  `(` @: ``9` 6 ``8`4 `2+@ ((` 9 @ <` 4 28 @A @˜  ``H`@@ " @ 2 `$7 ' ''6''Ē> NP ` ''ܐ'Ē> A 㿐`(`,`$(`0`*>2b@ @  !(`8``"`(``(` ` `$#\ ! `@_  0 2@>acܔ 㿘 (``) 2 @`x  "`"`"`x"`| `@`h  `x`:`h:`p `.@r`.`2 @`xϠ  "`"`"`x"`| `@`h  `x`:`h:`p `@```x`:`:``&` 㿘>@"@• `!>&` ""@   " "&``1 @ "'ܐ'Ē> " ?X 6  7 x !'''''Ԓ @#`>  a0'> ae㿘 `& `  `  > @?b >b@8 " `>c@0 `}&`" 㿘 (`8``"> `` `2>  ` 2> >> b> bb`>>bp   @#`,>(`0`` `(@0@`,((`00``$``(&`(`0` @"@&`$0 @`$`@&`$ ` &`㿘`( @`$(``00`>b>c8 >>;>>_bp2 @`,(`0`6 @ /-  @`  ``$  " `" ( ` `%   `%` ` @8b`   ` `@p`, (`0```,(`0``( `$&`&`0(`0` &`$0 @  ``@@ ``(&`$0@&`0 ` ` &` `@"``@!`( x0@"`㿘. ` "  ?.> b * .㿐P;,` ;  ?.`` Ђ`` OЃ.`@2  . . Є@&@  `8Ű  @ ?`` @ `.`;   y`;" ? 㿐`\  = .a  `;2 ` `. G`.6 ` @((*   -  d 2@ "`d"`㿘"h` @  4 0&& 㿐 ``9 @ "& d`(``2&@ F&㿈> b>cXhǐ&`  @4 :  &@1   @0 D `d$${$  @: h2K'6@@@ F>"#h@ ! $ @ F>#,@8@8 @@m>#@`H @@ " @W  > #@ F$ @k$ 6@ <` "@;    "_`H : $T$P  P (`0`(` `:2+$X2& -@> c$ @ה `d$ d `d> ` @W@'$@P8`  T@ ` &㿘` ę >@Ȑ 㿘"h 0@&`&`&`8&`&`&`&` &`$&`(&`,&`0&`4 `@ Z!`@ Z!Ȓa@ p 㿘"h  ``?㿘@@ *@  bh `T `@    @ +?@h  9@0 `$?&bhc&`$㿈 T' `$'耈`` @ [@Z >8a<R  @ Ȑ@   @ @ ? ?@  8h`"'l`&'$'0c ?@ ' 2'>(8(@ܨ >`H`0 @G  2ߠ ` `@`5`3 '- +h'`$ X>`8@'   '> @`@  '@  2  ' `' @ؙ'd @؏'􀤠 (`@?~b8 2  9 @/  @ PX$  "$  @O$ L $ $ @$ $ ?$ @Y` &`&bh``$&`&`(&`$$ $ $ h`%` `   (8@ :`H$ 耢 h`@&&h'h``$` $  $  䀠`쀠  "@4$ $ $ " T@ T/ `    @ " @ @  ?@ː@   9@.  &bh> `H  '   $`3 (Ԕ p -@$ (` h` @J, ( Zj  @&, &?&&(&0&@ n`@4 T> 0` 0``@&@' @3i "$ @ *!@!@k @ @ y$@2 ` 0( 2  @@ Z@ݒ @F Z  Z@Ԑ Z@<l Z @ʐ Z@3Ȕ p@\(0 > 6bh>`0>8`@Kb  >> 8a,!>8@C!< >@s P>> x`@ !<'Ԗ `  @) @-Ӕ  @>Px `  0_ @ @ 㿘@(?ߪb0 ` >" D`0 0@@$ 0 0D@$ 0(< x$ 8@@̐ ` H @.  2Z `U`"  DހP܀`2K   (`@?b@@2>  ( @Ր 8@є  0` `0` `` p<..) &1 @  &  @  6@ 6r  aW@ 6&6&&&66&&@fʰ 6  0h$ 0@bHo$(@eHp@ d2 2/ 2+ 82' H2# 2 `2  2 $"   8  (@`  `"`        E   "!    "     @`d``䀠`   %"    沐 b `d>b0 D㿘> @* 㿘` ` d>@ `x`p@2%`|`t@2!`| `x@ʚ "`|`0$`@d$`0M@'S2`|`H`8@) $`<`|2  8 @> T` $`D`@ `d` D>aؔ  `d >aؐ D㿘 @J@ 㿘 @@@ 㿐 `d 䀠`   0 ( @    H  @@@; `` >P@ c(>P @z F ``2>P@`c8>P@|F @ @``@c8`*`@IÓ2`>P@|+ (`0` $`(`0` @(`0`  㿘`@` (6`#`(`0` &#p?>`@I#` ">#h` d`$ ` < `(`0`o$ `(`8`$ `$ `$ `h< 0`p< 8`x< @`< H`< P`< X`$ h`X< `X`\- `)   @+$  '܂ ''Ă''$'''''''' 䀢 Є& <  @+I  $ d$ ```$ (`X< p$ 㿘"C "H"H(`8``=2 "I   ` !+!1`!@2!+@ ""C!+`"  #P\!  .!+ `" "C#HP . "C ` 6"@#X(`"0>#P!>#H@D0` d ```*`2`>\a op'`d    @+#x @! !@!"0 @! ,"B,!*, $#`$#p<#X@  <#h    " Xǐ  X8  ??"H  @ "#X@#X {  `H  #X  @8`@ p<#X $ 4  ` ,"C`!&z  ```ʒ'`|(` '#X @ <#X䀠`z <"0`:,"C4#X ><"0b@g! "C `2 `!(`8```#X,"C2#X ,"C`#\`?`! ` ` ,"C䀠`2#X_ #Xj @8e   䀠` ,"CĐ   "#h@#h>` #p  @) x '`` d``w   '` ' ` X膠  `` `2c (` &'>48@6  `B 2:䀤27䢂` B  !@)  8袄`D %``  @6 X@/`@2 \@ 88#\#`@C  @)v ? @\?   <@ґ&   H@GH@ҁ  ``뀤 x` 㿘    d@:  @:!`?㿘'(`  0`!n`@@ݐ   `d?> `   ((  @@(`(` 0(8+`(@ @ 3`+ @f @ F h 0>@Β` T@63တ  T@6nတ  '@: .`!n@6$ 6 '̆  Ƞ$ ...@8..@:v <@8 <.@:o.*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~  "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjl> c>8a0 >  c` @8 &>8 a0S`F@ a2  (`0``2   `2   ,(`0``    `       㿘\> a  @&`+@ @  ` ( @@ &` @&>a` (@0``>a`'@ @'@8`(`@'@ C @ * @r  & (( >va$  $ `$ @L$ @$ $ @@> * @R  & ($( >v`$  $ `$ @*@$  * @4  & (( >va$  $ `$ @ $ @$ $ >a`8@@@@ * @  & (( >v`p&    @  @'x!@#d #\#l#` #h@ `2 㿘,   * @(72 ,a(`0` ט 8,(` 0` )@`2&  $8" *  @' a   2 2 @2 @칐 2   *   @'( @'$ 㿀` '`3|` x (`0``qa``l ,   * @'Α2 ,a(`0` o O?&a&a  >P ` 1 `` 2*` c8 @uba  M '  @(``"`  `  `"`" ` ,(`0`@&(`0``  " `" @F`> c&a4?' ` $`> (%  ">  c@  `2`π   -@`'@`"ð ``2x Rh怠@2pN` ?@2`'  `  @' 'a#\耤 '耈``a &aa:&a @ @8&a"7a  &aa:&a @ @#&a !`8e ``*`@l```&`(`(` @>u @`@ ``% ` ` ` ` `` ,(`0`&{'a "&a a2 &a@>aa`a &a@@(@&a&a@ &a$(`0``  @& " *(`0`" ,(`0`" " "&a8&aD @%@va@,  >P@v @% @Đ`   D''p'T'' 'x?p@'t'P D``5 !@@ .l`(`$`' !@!@ 2  ߘ 4 2 ̐  ȃ(`0``    * @&2 ԃ(`0` 'l >a`8 (`0`  ``  @ه-  @  x  |  @ 2 T  @C>T @@&D   C7 >x>@8 '`>|@@@ @@@ @@@*' @  ` @Pw`   T&D @   @ > , @@T @&D.`@@  '@['`h怠@2Q/ 2 T '  @'#\;     @ P&$ `@!'@8- *@ސ`&(`(` @>u @ @ ` $@ ` ` ` ` ` (`0`&'@  !@@c l l@$N T@ PaDa8'  a@` " @$/ >P@t @I`@a & ' a<' ' ' '>a 'Ђ '̂ '' ''؂ '܂ ' @''?' @# `>P@tP 㿘@ !8`&!< @㿐`a(`8`8a` `4> @a0 -`   (`8`` 2(* ` @(`8`` ` ` , (8``%@` ` 2((` (` @(`8`` ` `   @ (``2`*@   a??l`  @J@!@ @ `",` @$ ,a0@ @% , a(`&a( 0 > `  `(0`, , ` @ \`? `  @`  a( ` ?&a(@#  ? @#h@F$ ` ? @#\$@9 ?$@#S $a(` @$    4a(a0> 8@zT$$&` @K 2$`a(``&a(@@7 >P@sB a(a` &a,&a(l@ a ` 7a ` `8a(``&a(&a(@$_ ,a0@ @$w ,`@@ `>P`8@s 0  ?@"    ?@" @Ő` 㿘`, @( !>! @"Ӕ ` !@琒`   @">@WD!>a@"q 㿐`  `>a``8 &`  Ac#\`#` ?@K?㿀`8 >`a`(&` @*c#\#`` ?@Kf?  !@`` ``#d  #\#h#l @9#`     @8@@F[ 㿐`) >a``2" `  ` @) A`` ``c #\` #`@K  `@ 㿘   ` `@   @  &  ?@!˔  & &㿘    `@ ` @$ @@` `` Đ`㿘 ,  ? @"e& , ,  @@q  @! ?& 㿘=&a>&a 1> aP>4a @(&a  `"`B  aa(@ !&a&a``*`````&`(`(` @>vp @ aa a  @ `a ` ` ` ` ```*`````&`(`(` @ @a @ `a a  ` ` `   ` ` H`@"@Ǟ@>`0`@ޞ@>`0`@끞@P @'܂ '?'>aH'''@݇  >@xz!X>@xu!@ā`!>8>'a#( @Fܖ #(`А !>`0 a ! > @' ! @ ! c#\#` ?@I?  > `|3>8 @I>O!a -a8/   s$/'/ܨ '@ڐ $'Ґ ?''ʔ  ?” ? '''Ԑ@x  >@w!ت`@>>@w!>"@x㿈>9>`0$`|@O `@U!>8@K> > H@wђcH@1@Z@@ @@@SP@$y@ڗ@ r@@@&' $a@2 @͐#0>=ਠ#0$ ਂ  $  D@>=$!h$`ଂ` >=` $` >9"$!T`$`0`0 4` >= @`#@$`4`#" `#@ @#@$  >8@ `   @`$"$  ,`) ,!l> `, $!Xa">@b`L>@O4c @<>8ap@5}$ 0@>9b$`$!P$ 8``?8`@28>8`  @;` d$`@& @8`#>a``!>9( "< X< h  P< < p @, ` 8 $   < `#>8 b>>і @A`>8`>8c0 b!>9 `<  $!X@#$ @1@D>@2 0 |Bc  @Rl$ax@@j@/@@0@b><b  @`2 Ho&(@g@ G@@Hp@@it@Tw#\#`>9    >w @n"| >'"!>G`>9 bp>; @ `P>#b( @E #`2 > @<!@> 8aD`>@ >"0@wc >P"x$'>P@ $"x ` @ᘀ >"H!>9  #>9 ` %>9`@2xᘒ @  ` bp`8 `bp`8@#`bp`8@F ` >=``۔ !l>@` ">w>"p !>9>t@y  ">w>" ! >@m☀ ">w>" !ܔ >@aⰀ ">>"   >@UȀ ">>z"ؒ   >@I耢  >n"> @;^!>8 ( (@C|@oy >9`>c @DW "`X `X @"   X` `"`X`X" "@  `x`2|`|`X2x` `X`"`X`X" #`X"`X`X" "㿘   ` `X `& &  2  @& 㿘 ``""`X`x`x 2"`X`|`|@( "`X & "`X `X @& 㿘`  X`$$  `"`X`X" " ` @  >b$  >b$ 㿘   @  "" " " 㿘   @ٰ "" 㿘> @q >  `@l $@B& $@Z  >9c8 c8@B1> @N 㿘 @V  $& `2 @B{  `   @Bp @1&`\㿘 @7 ,`@ @#㿘 @* , `@@㿘 @ ,` @ @ 㿘 @ (@6 >.```.`%@ +@(, ,  @@` @@ 2 %@$@$($,@Ґ, ,  >``@ 㿘!> @ϐ >9  @ c8> `>`@Ð  $ $ @C  `@  㿘 @> $` @C  $`&`\  ,` & @@㿘 `@Ѡ @>  ` `@Ck&  &     @d㿘00 d @ 0Ho$(@e@!Hp@6 㿘 , `@!>  & @D!>9>#8`  @C& #8`>  @2 1> @ 㿘`>O>@t (aH`h; 80  0@ (8 @ ``` @   4  @ .`& & & (.` >``& , & >@th H> @ !>9>#8`X @Bɘ #8`> &@  Ho-(@nHp@H`@"㿘T  N,>8>8c&>8>8`4,,@@0((@ < D @3`c+`+  @` @0 ((@@ :@(ސD$``@+d#:   >8`c`@)]< `?@+ c㿈 #?@+:#@-' `Ђb? '`?/F a?'㿀>9c@>8`>8`>8`ܒ>9c<'''''@:x 㿘 Da& DH`~ >9L` L!>9#@`(> I#@  b> I@b b)㿘 Da D(!>9L`` L>9c@`>9cP>9c<> I b> I@@ b㿘>`0> Ib\@  X \>9c@>9c<@'`@#  `Da> @sd>`0 X`_! X p`& p al(`8``$ ( 0@;9 0@79 ( > `Da>!\@s@`>`0 X`;! X >(` " @ x`& x @@9 @> ` > t`& t 8@9 8`0`H@8`H> Ib>`0  X D`& D>9cT` $`` $@N)㿘>`0``5`$b1>9`@`! >8!(`"!@>8`@E^! 2 !@`$d  > 8 `!@>8!H`>9>8`@EI!0  >9`$O  > 8 `>9c@`>:>`0 T`& T@MaȀ` @C@J >9cD@㿘 >ǔ @Tc>9  cD>@rV > I  b> I@ b>9c@`>9>8`<`" <@)<>8>9 cP @B(h|H`@" : (@6 `(`@ &* ? ` :`+` + @  @2   3`(+ @  @4"  `" 㿘 $@>`& $ +`@ 2   3`( (@ (   (@ (# @2 &  &  @:  *`  ,`2 㿘   (`8`` *` @ 8*`0* 8 ? 2 "8 㿘>`0``D`0 ++ 8)   (`8`  c .`  `( ` T!   `"㿘 ` `@"     @ >:>:  0@i 㿀@ h` = ` (`8`7 -` `(`&` 7'''而  ' 7`, &`,   7 7`, `&`,    0@` `&` 㿀 *  `& ``" `D`"  (`8``2  ( 7''''7 @՘ @  `& p㿘 `*6`*(``F@ `   ` $ `6& ```@ '@, ``8``8``  '`@! ` '@ ` "` @` "`8@`8  @  `@  @ 1>9@h]#X㿘 >9@f#X>`@ , 4 * 4 ( H$ $  $  $  $ $$ $ ?$ 4㿘 8,@s >9@f\#X@ݲ H  " @  @  ,6 *>@` `4  H & & (`@8` c4   '@t , &&  8``<`  &   &  ' @` &  ' @Z & , @g&  @c @_,`  @Z*@/@ c   (`8```2 +` `  @ 4?& 8& @& <& 4@㿘  `1 2(`   '@  , @- $@@  @ %@@  ` '@#  `88``<`8`$?&   ' @ݐ    '@֐   <  < , @ޔ ,@ݱ"   <   ?, @ϔ,`$@@ݢ  `8``8``  ' @   '@ݔ & & & && 㿘@%` >`.` ? 0@@`0``.` `@&? 8.`??㿘 ->8 aP`8``$@`<`:?!` ,  @? ڳ(`, @6``$@$$`$&`(@ `@  㿐   J >:>8`  Ӱ >@n!h>:  0@dȒ   " ,@" >:`" `"   `" ` "  `@(` !@ " " ` &@& `" 㿘 @ . ` ` `(8$` $` -` " &`( @Ő`@H @` `$`  @ !   `$ x@ `$   @˒ 2'` 㿘 .`  `& ) 4@@ߐ" 㿘 @`,@,`  @D  ؐ` @8 㿘   ,@  @`"`` @$ @㿘 @    ,@@ 㿘`  "  @.@ " @ `$ @ @`( ``Q`" ' 2''   `4@^ 㿐 @`,   `@$  W  `$  @ޒ @`,x @>~ b/>8, 2  `$ `` 8 (`@@۴ @ aP``t (r @m @I  `$ ’ T@QŐB  `` `(@<,@q`@,```(@(,+  (`(8`8`W@ (`8` (`"&&&  34 `̂@4 (`0``' # `b~@ 2  (`0``@' b}`@ "  b~4 ' `@  (`8``2  ( `<``w@ & (`8`` ` ( <!@` @!@` D  @İ  " !T`&` `` @`v P (`8`` ` (  2 (`8``2؀ 2   6  ` ? ` @ ?(`8``` `t  (`0`` (`0``i  D @# @_ڒ  @EP7'''' @ @ C7 (`8``= ` (  26 (`8``2؀ 2   6  ` ? ` @ ?(`8````` ؔ @̘ @ 2 `  `$ `㿐 />8`, SaP`8 `J@FC@2 ' `@$ `!h  `$ & !@ɐ">@kY z   @``.@`, @`  `?c>a0  `@>a0 㿐 X   #\>:> 0@d`>9#\#X!0   >@d`>: a H/` /Hp@ `" 㿘 D `@`D`((`8`  > `<"`H "`  D`( @2   D `(`8`: (`  8` D@ @@2   , (@  " (" , `(`8``` > a"`H   㿘  `  ` $`   8$ 8`$`t?` `" 82   2 8㿘 H@` 8)  @<@1 @@(`@2&@2  8`" H H@`"  D `  D1>:@b.!㿘 @`@ @ 2 H *``8>b  `" >:>c!㿘 ( @_   &``8&`T&`P&@ 㿘 H@`2`4`<`2   @  @.ٖ`<&`@ `@`<0@@(`'@ 8!`8!(!   @D`4`8@R*`4 *$ @@#*`8  @g &`4&`8`8 (`@&"& 8㿘 ``@6g&  `" & @v? @ 㿘 &   &   @$  8`& 8 `$ ׁ㿘` @ "   8``& 8ܐ  2 H㿘 `@ ? 8``" 8Ğ@㿘 (`>: !a,@@@ H`@ D `  D@aA%@ 2 4&8<` >: a,@@@ @`H`@@a %`2`<`*@& (` `Y$`  㿘 (`A  `@u{   `$ 'X`X D#?@ `@' ;?@;  C耠`4 >8`Ta >8`܅(` (` ( @(` @8i@C?Ђb?'`?/C a?''''    (xQ쀐`"K @8@耣 @       2     ?@c?Ȃ ` 'ІC??Є@@'Ȁ` >8`T@ >8܅(` (` ( @(` ,Ȧ ` > `  # `!& >@5֔3耤# "   '' @& s`  ` &   @tp 8`"(`0``H` @  8&8 F& @s (`0`` 8&8 & H`@ xв` " &8&(&,& &8 &  &   @&  ` !  `2` ` &  @  X (}- X% 㿘`(`8`    ܄8> (`@`&@Ȱ ` `$` @4Š 8(2  `((`88`@"*` 2 `< ` @@0@@ (`2  2  (`8`  2  `(`0``F` 2'`>: !@]Q n " D" " H`" <`$ @ &`&`@Ԛ&`@   $ <`$ @`$ 0 H` @   8``$ 8S`   H`@*``(`0``" ` 8`2 ` 8`$ 8`(`0``` 8`` 8``$ 8`` `$` r `(`0`` o`x <<@  @&  # 8 D `& 8?`6 ax(0& , > ( @2 ! @ @2   2"  <"  0    'c@''؆ `7?7ޒŔ  `&  @ 㿘 L@>x @  > | |㿈> > |`*  |@#@8#'@'(( @@(`'`  4 @  >@=ct@>X $L㿈 ( 8`@& 8`> (` (`0``# @@o8#''@N(( @@(`'@>- L㿘 @H "5  D 0>`0` "` !@` " ` @s `$`D` (0`@ 4``@ $` 8$`,$`(?c4` @$`$ @  㿐!(#\   >:>!@_0`>:#\!> Pa  @_& 㿐 `,@Ð@ڐ* 0` 0` > ` >: !@[ ""  `( `&" `4`&$`4" , , ` 㿀 @ "r ` (`8``2l ` `$` `    2b` &``( (9;4 `' * Q  . o4 . :  ``@`$ 84 .$ <` ` `` &` &` - `(ޒ`` @&`(&``ǀ`" & `$ ` `$` ``` ɐ&` `$` H`@"H`(@ "㿈`8`4`@) @ @T@&`@>a`%> `@h*c#\#` @5g "`4`@@ @ `h (@ @3 &!d@`@>a` <`@*c!d#\#`  @5B `@@ 㿈`''` A  O!4` &@((``@' , :֖ 3@'`'  2$ &`     @'?    x`(D% (% ,@0 2 &a` a!@@ 2 8`(`$` `"!@as !@ @@埖 2{ 8a``Iu !@ @x 2n 8 @棐!@``#d#\#`#l#h  @u L`  @ &` +> > c`@  a4`<``" 2a(a(`" 2< c̀ 2a$a$>8 a 8  aP `a $@* 5`!@@\  8>P@[g   8>P@[` @QP !@ @! 'L  D @!>8!0''? ? ''''@ %'!0'''Ȃ '̂'Ԃ'> `,''''''! >>ǒad>@e` ,(` ,@` ?@  @2 ?@  '``I`2`%@'Ȕ  7` `h %2`& `" %'  ``F`  ?  > `` (>a` ( ? ` `@@`(`؄ ' 'ؒ  @ @1>>a <($`|  Ĭ8@@ @0@$`l ($`  $`t8@@ @0@$`p  (@0$`xВ$`2$` $``"@$\ `@ *@@.+  ''`$` ' \  I@&!\!" `,$$$ @r ̀`8 Ȕ'@ϑ44@ $4@nD 3D`@" ; @  7 D@. D  "  lD@ |D 0D@z&!@h " d" $  @  ,>  ` '쀢 M'쀠` ``-` E@@ь4    4 @3貒  4  @% ``  0`0`  ` `(, , ` &2  @  ,`2  " @&!@  " " "D`$@$D`  Ho)(@j@9\ (@ a a ` ` ` aHp@& & & & & & & & & >>ǔ@d>P@Y  @@r`,`@ `(L@9 Db ?@#N  ?@} X" L쀠?. +耠`$. +`D`@D$X @  r`  ,@ ' @  ,`>P@X  " @6 @} >P@X >>ǐd@Z @" ?D @K@a=`>P@Xk  "Ē @  >P@X`  @L>>ǐd@- ?@  @ڔ D H`@"H`(@ " @  $ ( ( $ ( @`," $ $ (`," "`," (㿘@ !@><@X #>  㿘@  $" $ ( ( $ (?  @ ` 4 $ 4@W d  *@  h>=@W"h@!P@ ] ><@Wِ">  Ł㿘` \ @ 7  D"$ \ @  @,u`@`@@`$8 $$`@6ax` h@=  "     @`,㿘` aT`  /- +   `,@z @`,@" D!T`@2o $ D@`,'@ax(`0`& " h@ Xn fb2 `) H" `))(`8``2 `)$@2 `)@Q D$`,3'@ Hax(`8`` D`$@ D$`,'@ax(`0``" $`$@" $`$ `,'@?c&  @l X  $ 2 D  "  '@! > @,( l  8``@ ` `` G ```   "` ` ` X㿘#> @M`> ఠఀ`& 0ం 0 4 ఐ`& 4@2@+m㿘> %> `>)b'@1 @-   0 4 4 4 0@ @@ $@$ |0 @ D@  D;  @@ @+2 0t0̝㿘, $ `@ ` @  @2% @   @`,``D6`>` @^S!0 @0ax`D`@"    @`   D@*`  `  `$`    $ >`h 2@+Ɩ a`aPa``Da"`hꎐ`h2 $!>= @T9"h`h`$`h@V"h`h $7&!W@6/aaT`  @2!aT `"$   @2  |  @! @u   " $ @   $ @F$ aT@ ` `0a `"& `D& aX`L`" 0@ 0 . ) 4 4 4 0  "      $2>`"` ` ` ` `D >=ఈఀ`$`ం` $` @ ,`, >9bp@*Dp $` Dbb2` DI" H    @`p@ @ $& h @А`p@``D>9bp` -@* @!x $ >a`$a@)`>a`@" `>@]?!`㿘@*`  㿐@` '   @    H`@"㿘#> Ib d@ɐ * >:$bb @㿘>: b#2@L @q >=``,@T`"`@2  㿘>;`P`> Iİ` ācb Ő ""  " "` `"`  @"  "!a@"`" >Â` " ,c>ǁc!>`0`\ `,>` 㿘 `Db@ @ 㿘 ><@R" !@ސ @ DaP@!P’!P$ ` `4 $ 4@b`DaT`0 $ D `` @$ D֐$ 8!$ 8@$ 0@ $ 0@=`D@0`Da$ <@ D`Db$ D  D@$ D D@@$ D D@$ D>=ਈ਀$   $ ਁ㿐\`h b0b2# bb > !@` >8`@  > I> I> "ؒ`@. # >@[!x=! >8 > `  > I> I> "@.m` "> >@[Ր!> 2 #! @  :  aP`p 8  @?>  >   !  #@  > @~?>  >    ><@QÐ#Ȃ * )" $  @ 8! <@aa@`L>`c @2 `$f$``$` 8$` <$`  D@``$P"`"  @ DJ @DG  @$`@@'aD!X`H`@ $aX>` `@= ` <>;TT` T `x`p@@!! `>;>;T` `x`p@@ a`T ` !   `! `x`p@@!  Db    *@ 7 >= $`,$` ` `,>=`>= ! @$` (``$`0`0 4``, @(` @` `,@(`@4$`4`$   ,$$ $$  $ ( D,$,.$ ( `, $ \#$ dd  @ d @d`,  d`, $` `$`  @ H`$ L`$`$L`,b@'w  @ `@*D!  D4!H`?c!`Ho-4 (@n ,`)@$`|@Hp@ $`|  *@  >@a`,@ >a`` ` `` 2%>`a d @'̖ D`d Db@ * Ѐ`,b@ @%%  㿐 #\#`    㿐 `` `#\@?#`  |>dԘ!8㿀``    @>@  >#\#`+!㿘 >;#>  `t `Ѐ`$`$ @  @d `Ѐ 2㿘>;`t`  @ 2" >@Y!" "> `` `㿘  >`0`>`,!a"@X>`0`.  0㿈"#\#`>9  b    @>!"&㿘```(``@2`2`@@@ 㿘@  !!   㿘 @ǡ @Ho&(@gHp@    (@8   8 (@@@> `܀` >  `"! > 䀠` >>a`8@ >a80`@8`@8 @*#`܁㿘>(`(@ (@X`" ``F @ -, > 耠`2  >;  x @#> a @  "@*@W@ǟ  @`@(>;@ǖxz*  @>;a @$'''@ @㿈v#> ch!>  , >a`> Ib( '  @#\>  `ch>; `>;*` a @ >; `>;a,  @$$`@㿘 =>;'>`>;``ᨂ&8@ (`@((8 (@`(`0`(@ ᨃ(` ``> `ؒ*2@m*0>;a, & @ @@ 㿈!>!( @ !} >@X!ې>;* a²!(` (@(@`@O@> ->clcl`> `؂@(@8 #\#`#d#h, 6  @  >;>@Wؐ" < `>;`$8@(`0@@*`@ 00 "@" ` @&``&@@`@ @&@@&`h  @ 㿘?c@ ?@:  >@W~"HY " "`>`0`@` ` @ (`@`  "@#@>`0`@ `" ܞ@㿈`(`(`@>h@@` >`0`` ?`@%` `1 `@#I ``@$6a@  &@$}```@# ` #`@ڐ@@& ` @# 㿘>`0`@ `    `  & `>`0``">b  @`">b  @"H@ @"9@㿘 @ & &Ho$(@eHp@ 8@@4" 8㿐 'D'P>`0 ` ٴ >O@L|!!Pc!$` " D" @" ," $`0Ӑ@?` ` >-@bt- l@`0 z$`0`0 @@$`08 '0 $`x($`| @($`8$`8P@`8@ S`"$`H$`H@ D@ @# `0a`0`$`0`2@ 8@A`0d" `@ "  `<`8! $ $  @9  @C'  ?   `  &C``@rF>O@M! `,`8  2 >=>=` (`@ 0 2 ,>=>=` (` @2 0$ 2, ><>=b@ (`@ 2 㿘 `)(`8``2  @ @     2㿘 aT@` ` @2 ,``&``&`ΐ ,#" $ @2 $ D@2 $ `" `"  $ 2!T㿘 ` "|@" |"      `  ><@L"1>=@L 㿘      @!T `2&!T&!T㿘d 2E!T &&& &!T`  @R` DH` & !T` & ` && >=><#@@(`&#@@(`@ `#@@(` @#@@&(`@& ><@L">=@L  ><@L">=@L  3!T/       @!T `2&!TV&!T `&    $  &  㿘><b ><c(`@@@" 2   )- @ ) 2 " ߔ `" `$" 㿘ϐ @ " >@T("㿐>8` )8`2 >= `>= `>=  `: >=@!>8 #>= )$` 8`><2 @:   )!>= $#@><8`2 @: `>< b #@` 2#\>@S"ؒ!   ><>#@Mvb!#\   ><>"@Mlb X#\   >=>"h@Mbc `#\   >=>!@MXc #\   >=> @MNc ><#\"> 0c(  @MD H`@"  @`," ,А b@"  ` @`,"  aT`"!@ `"!@ `" `D` "" " !@ `"!@ `"`@` `(`8`` @@ *  !@``  ` `0 @  `Db  `*(`0``  `!\@  ,!\ `,"㿘 aT `   @  ?"  `aT `  "``@>&c  㿘@!@```  ٔ `  є   ɔ  `"㿘@!@```   `       `"㿘!@@(` 8`&(`8`  ` ,  "&㿘`(`0``   @ `` ` 0`*@ : `>^a \`">=>c! a@ "a@` @㿘 >=@H! "㿘@ڔ ` $㿘` @˔ `Ɛ $㿘 @!@`@ @ @ߒ $ $  v D 㿘 @@ !@@2@. @@ @ l`@" $  2$ $ $ $ $  8 D^ 㿘 @!@`@ @  @y \8$ $   D6 㿘@ `?!@2`?@?Y 2`2`K `` `2 8`@`@ `@ %ޒ?2$2$?"$`2 $``@"$$$   DȐ 㿘@ `!@` 2 @ X T    ˒ @ @ @  @ ,      c2&`2&`2&`%   3 DY X   !@ `, X`4@9 4 %`  D.㿘 @@ !@@2 @; @ @ @@ *#`@ 0 2$ $ $  $ $  ʐ D `@>?;  㿘@ `?!@2`?@?e 2` 2`W `` `  D`@`@ ` @͒ 1?2$`2$`?"$2 $`  @"$$` $  P D? Ē? j 㿘@ `!@` @2  d ` @ @  @m L    Y 8    F %) 2&`2&`2&` %   Ր D  @I?F  㿘@  `,"T "  TaT `   T` ``" @`,& 㿘@  `,"T  `TaT `  T `&㿘`  @G >= @EI `@`,@ "2 _ "- !TaT` &  D`" !T!T` `@ `,`,u   aT ` 2>=  >=@Fߐ 㿘  )><`,@D"'>= @D!T`@N  @FÒ"@F ٖ& Ho-(@nHp@aa @C" 沂a :1M@b:" `p  @C : `t B: `x@C : 㿘 pڒ`ג&`x&a&a&a&`p&`t㿘㿘   @ E@>9&@&`&`&&&&&&c@2`>8`܃2`*`* @ 3`8+`+  @0` ((@@ c@ 3`C+`+ @@3`C+`+ @@3`+`C@+ @3`C+` + @@  @{ >沐@x5`-`- @ 3`+ +`@ 0` ((@@ c@3`C+`+ @@3`C+`+ @@3`+`C@+ @3`C&+ +` @@H  @A >@沐@>&`5--@ 3`+ +`@ 0` ((@@ c@3`C+`+ @@3`C+`+ @@3`+`C@+ @3`C+` + @@   @ >沐@&hȖ '#@>@&`>@#耦&>@#&@` @C" Жb?  :?/@a:"  ` `@C"   : ?/@a: " `  @&"  $`$ @@"`  `" >=>c#H㿐!> I#D` #\>= #H   >@Fc8 $#D >=@CB#H@  $ 㿘`  ` ( ( h`@ X   @U X ``` p  X@j ؔ` P   X@^ @@Ŕ ` X@  `aP(>&c   㿘` @ 2 @  .`aP@ * @ 2   @ :  M q aP `.` a$aPR aP`> ``2 > ` ?  ` `>8`>8`8`@8 >@2 @(>@8 >@`@`>`2% @   2  @ (  #@  "  >a`  8  @  << 㿈`  @`㿘!@` ` ``" &?쀦4 al(`8`  ?.al`@',``> 㿘@``.`J ` `@ ? ``  aTH "/    `  ``>=!@`&`>=`  ``@2 ` 2 " 㿘@``0`O `  D  !l(`8` (8 )0<`  aT "1   )(`8`4  2!l )``2>=!@`&`>=` )``@2 l(`8`42 )?&  H`@" N"!<"!8"!4aJ `a  *```V`?`?> 㿘!8`? `"!8 !Ȓ`!8`3 ! `D`   D ᄀ`?  Dᄀ` @   Dᄀ` @   D ᄀa`0``?@`  D ᄃ0``` `D$`?c@"`" `!8  @( a    @( `"   Dᄀ` *`050``?@` 㿘(`8``/ @:e  >@I9H  2)(`8``/`.2 )(`8``/) +`8``瀠`/)@>@cP(`8``/2 @  * $@@󀦀(`8``/2?$@$@۴$@` .㿘  Dg @(@{ }@~|@6V  ]`r@2! @g`h@{@2!  (`8``2!`T!R0 a@"=  a@* `@<> bo@a@2>  (`8``2 `>tb (`8``2 0``` (`8``2 ``?"  (`8``@  @H|#X  㿈 D|w ᄃ0``<```` ` ``X```2`2 `2`2 d":  `` /2,```%` #`!```02 ,``" , #\#`#d#h"> @G#h 㿈 ,!4>!"@G# a   @ @' @   ax D_ ᄀbQ @ `''쀦  @2@``@`@`@@ `?@c`2`6 >0``> )cֽ    *`@G:` (`8``" ( ` @G{  `" #`@& x `Dc  @ `''쀦  @2@``" @`@`@G `?@c`2`= ab.>@0``> ,cU    *`@G":` (`8``" ( ` >@G  `" >@G #ؐ #`@& 㻘!8` ِ$} 2̐ a`@"!8!4`` !8``2!8> @c 2 !8>c@   !8 ````@  ` `` `  #`  !4`!`&` hw`:k>>@ cj `>@` z >@` s >@` k`>@`0 W`>@`H [ >@ݒ`X S>@Ԓ`h @`> @)` B>`@!  ; >@c 4 > @` 2%@>`@? " @`Ѐ 2 `>@`0 2`&!8  &!<  6 Ho-(@nHp@H`@"> 0> 0  @` `0` * *@>` 㿘> I#L` `(>>` @@` `3`(H` (@ )  | !  d0! d`  `+`@ `p+` @`l` \ (@ ( \\` |>>>` (@` `0(` * 㿘 |! d1 ` d&) p& p>> @ p\ (@@ \ | ( |> `$  80`@8``  @  & > `$  80`@8``  @  & > `$  80`@8``  (  & 㿘> `$ 80`@8`` "  }, >>@ (`@,  @"> I>`cL"㿘>`0` !!,!  , )$ | $n а`@!x$ ځ㿈@0>@  @` '  ?膀沄@b?'!!@C&!沂a >!1M@b>!&!!``& 0!` 0 4$!`& 4 P  {()>@E"㿘#>`0`!>> $ $,)$|@!" $Đ 0r @!,)w `4 440 `20!l`{0{\`{0㿐 `#\#`>9"   >! !> I>@E."( `#H!" >@D8#H`$#H㿘 ( l`h` p & `>S"&!pN1>>= 8㿘>`@!\`" P!\|?*  \c>>`P@8`P   Ho@} 0. )H/` /Hp@㿘>>`l`> & &   @`4 2&` & `>> `l֑㿘ʠ l`2 p T `&`H p&@$ p`@2  @2`@H H @`4@ @`@2&`HH`&`H&@ `@`H(`@@2 l`  l`$ l㿘>>l > ! l!!@2 㿘t l p& l@& p@2@ `@`H(`@ @"& b>  a"@ $@ `2` 㿐  `p@2H@2&2@ 㿘 8?& Z㿘 87 `@ L` 둕 @@  $>>`h@@㿘!>> h`> "@ @^ $ h>`$ h @  뱰 >"" "  @c $>@c 8>HbHΐ((LL8Ho-(@nH/` /Hp@H`@"H`(@ "!@ ` 2`@ /@-2 `DaTaT` @$`D`"` 0( b2  `@    `?  0$` $ "" " 㿘 `0 (@.`$`@&?@` `!  >9 >9bp`0@! ` `n y `!($!`@!($!`! ($! `!($! .`> `"!2!!I`"!!@$!! (@8@$!`!$! 0>  a) @ `"   ?a (@#a  !)  #a 㿘!&@`?b    ! ! &! ! "㿘! $&!d &!>`0`L` HD!@@  >`0`` " D` 2 @  @ D@ @@2  @ = c @2 , (@: ( , (@  㿘  $ H D "%"   $@"  $p )(`8`` $@  H` @0, )o  ߀㿘> LbP 2@  L`㿘 @`0?bp >bX!(@  㿘 `H`,@*)'`L`" `L`D@@?"`L `$`L@y`D@  F  @e. )`H`݀` 㿘  \``2DD  >&H&L`);'> 8"9  $@ `23  )(`8`` $ )``(`@@ $`" L` , )` @L`&LL`&L $  ƀ`J㿘 $ `0.`> a@` &!h`@ `  ⶕ 㿐>`0`?  (@0!!h.`@   !p!l`Ǒj $` $ !d!.``k!!@`!(@ &!> a@`.`!@&!.`&N !h`$ $!l$!h$!p$!tX` '@㿘 @$ && & `  (@m& & 㿈!\C`H` @!D@+ `'v %`  vr  ` $LcD @ 㿈@ `?`0 Z`` U Q `@, @'`'' ) 2' 2`'"`' `@' ```' ` ` '+@`'+@'v  `   u  㿘  $. ) Dx  $u>>aH ``@H >9@˯cD`@㿘 $ 0```??c> !a>b`!!`D@(@  } wԪ ?-@S`0a`Db"!`Db@b2,`06!x    `Db"!!x(`0` "!!?-@@ `0,@24!(  ,``Db2!aT``2!6!xg "!ې!2! !2!`Db2!@>!ђ @ `@ `  + u,  w沂a  >8`(`(`"@@@*`>8`ܢ: @8`@ D 4 #  `6#c ?b *@> I cP>bp `Db"'`'`'` ? (@@@"!@"!t `&```0    !(@ ǰtÔ ?``2 㿘 `D 4(@ >  `0`H`2.!`0`"`@2 `$2`@2` 2 @2 2$`@" `D`@"`D `D,b> a@! % `0@!@ @    al(`8``  ,al aT``!В  !  $! $ $`q     )(`8`` )(`8``+```k  $`g`Db_`?  ```!0WM `"K! `D`@O!6!x G `DbC   $y2 ` $ bnh! H  H`   !. )" H!X `  $`@ %  > 8 `! `2 2.! @D0 % ` @ p㿘  ܰ N㿘>=`# @"  D!  0a ` Ɣ @ P   2 D>`H 㿘 $` `  $  $`" ! $  !N! `Db!" $t  $`" $ $ڒ !d&!0! `Db!" $V  $"!!a !! |.! (P㿐 Db (@.0!@"+&!p!@ 2'&!p ̥.``& X` @'`!!@`!(@ $!> a@`.`!@$!.`$&!p&!t&!l&!hDb.`> ` !@!@ 㿘   " D`"    􀦠㿘  K  㿘&>=` 1@,`$D@2`5 " ` ʔ 2, aT  #  1@,`$D@2  " `  2@?`㿘 ( (  @ " `"` " `2 p   倦 " `"` " `M 㿘`@ >  +Ђb@i" 2  @ + ] %$"      ?        0a$`"a$" 0>>>c p㿘 >>@1 p 0@E!( $!$㿘 0a$`ܐ& 0㿐 >>>!H@`>>#\ p>!(bx  @57 㿘 ݦ! `0> as ?(@,$a* `  a$a,$@a  &!D!D  a `P$a $`P㿘` `    @ `  `&   @ @ `"   2@` " `@  >b$ 㿘     " ` " " "   @ & `" `& &" 㿘  >@;"*, u    @(?&㿐``"0 ``+@ ` >@``"/` (@ p   `$$ ``@&`>`  㿘> F`0``@`&<&``2%@ `"@ `@p} pr @`q7 @`@ $@$` @@&@>&``2`@ (@XpDPLD (D4`xxx$@<Xt0@`lx<\$<TH0 `> ''!Ò  >GcԀ` >Gc  "@  2 #> a   t !> !Ā  m >Gc$a p  0$!Ē $!Ĕ ᡐ>G$a*c>b>bز> bȨ Q@  @ʐ @ "  C @ A B#\ D #` E#d F#h G@8#l %@@8@e@ aĔ @@A@ ,$  0 p<  8<  @< ( H< 0 P< 8 X< @ `< H h< P p< X x< ` @< h    `>G> a@(>G0 c/> >Gc %'>  Ġ@@ǐ ,$  0p<  8<  @< ( H< 0 P< 8 X< @ `< H h< P p< X x< ` @˟< h  ۢ > t!   @@    "@  >&c `  @>`0??"  ``2?   `( >c8 (㿘@ɐ  @@    &@ n㿐' '@`     &@` n 㿘 'P@`     &@` Pn 㿘`@@  @ ` `  &@no `na㿘@c   \@@2`1 @ `)   @@n@ 2&@>" n3  &@`n$/ 㿐 #\㿐#\㿘`@` @ `  &@` m   m 㿘`@` @ `  &@` mҔ   mĕ   \ @` (`  >c| -㿐'  @(' 㿐` \` `8 -(`>@> kH>ʐe> `$> `(>a>a`v( >a>a`` "l*>ha r> a9>6s  2e> a>Gc+ + A @ >GEc>>c`O -@ 2K9>> c>> bh>>ct>>bl>>cp6L>a>a` (>a>a``  ( J>>bd` > !ȐS!ȁ -㽀`*\`B`G`=6$`,"!`3``'0`7`1`G4`I` `I`( `R(`>T@ ->8>@Đ&>H>>Q D>8 >8 >:a>LbH>Q`@>La\!>>"d'o  "d6@ `@`,`>> >> bd>>!"p  >> b`>>!!`  >> cx!>>#|')$#|0>9bxbx`#@?' >L|"0jĐXiS N >8 0Q> ?`> "> ">  >6pǘ!b7w |k m@r"> Ř!  &>H>H```a  O `0>H>H```a v #\ ܙ0ؠ @Ҕ >ݚ`0 ,@  ``҈  3> @`$$  2H >PHA `>;T:  @Lv0>8a> a> ` @*0!>  '$찒 쀠@c~$ > ">8! q@dC @0U> # 0F!>8! ݘ! ! `U> 7>$! @r!! z ; @W  @4 d@C >8a>O c(> 7``"?`' >Qa\0 !> "L"L K"L@ @-   $ X`'`= `` V @*j\ N``, Đ 몔 ` (`>@ ->]a>bH> c> `>`>b>Yc` j'  D``" #>  a >a` ``H2 @a݉ `@즖  ~a````#\ȟ``@W> h!  ` `ڐi Ho-(@nHp@H`@"H`(@ ">>cd @ ``@2 @㿘>`0` & & & >>&c$ H$ l$,! $ d>``.`@`$ ` @&` H`8` >>`(`@ `  " H㿐  `> if   `' !̔ i^㿘@ 㿘p> >>(c@" H  $ $`  )(`8``2@ `2 HT>a̒?㿘@`  ?2 > I#T   `@2   < `@& <  2 <@?`& 㿘 H` )(`8``@ $c $$㿘 ` >`0)`  #` 2 !  `Db!   $`  ` `0a  (@@@?`㿘>a`0``&&  $ے  H`2 H! Db!"& Ő& &   H`  , )& `& & 㿘>`0` $d$ $ # L@  `>`0`>Ɂ` L㿘 `>`0 ``   Ђ`. )@%& 0`Đ |!! (Pp $㿈>8`Ԓ`>K`؀`H/` /> 7Xa(V o 5 2㿀@ `` ` ` `] `@ఒ @   `耠     @   o ` #`蚢 b $`  <@沄C?b<@$`>8`@>8`܃(($8@h``B , @S@ : D4 '2%`<6%`<'%`<3 !?`  g  2`"`< `<`?> I?cT`<>!2E?%`< 㿈`   gt 2&&``& 㿈>8`Ԓ`>K`؀`> 7a(`@&`@&`| ߐd`&`@ސ ސV@ސ&`[  2  B@ : @@: `B: 2 @(@@:@ @ : `b :  2 @ (@@:@ ` : :@  0(@ 3`+ +`@ ` 0((@ @c@ C 3`+ @+`@C3`+ @+`@C3`+ @+`@C3`+ @"` :@  0(@ 3`+ +`@ ` 0((@ @c@ C 3`+ @"`> Ic\  c\㿘@  " 㿘)> ! P>(> @(  SP㿈ߐ㿈֐㿘3> ICc`㿈i㿈㿘%>  PW ` P@㿘%>  Pu ` P@> a`@`P:`H : `P> a`0`P:`8 : `P> a@`㿘>8`܀#!> I!@畒#$#t $#t!> !@!@>?c  2 c(   2 ?`x: ??x >?` 8c*(@@ +`>  :a`( @ : > a`(:`> @a8`( x> a  `2`$ כ > *a>b>c> b@. @F $  7x> aР` @PN `@  > a@ 2 $@@>  aЁ2 `  # @ "   > Ict "  - >`  > I>c|#p >aX >` 㿈> a P`TP$P@ r> a@"@$@$@䝐   ǔ ?(> I?Вc``4 @ 4   ?0@> a@"$$; `8 0 @ (0 @4`,`8 , @0((@ @c@c3`+ +`@@ C3` + +`@@b@@$B*`* $2``$ 0$P> 8a > 8a>  a> IX> It`@ X>b X` 8` ?@ ?j!> IO#`ؐ<#`#`>9< tbx < A> Icp`h >#`#\c@.B 㿈> Ic`c` 2   ? 8`@Ԗ ?)> aa8`  8`(㿘  `  @坔  (`(` "@S">8`܀   80>& @-J#@>@-F#h> & $   > a2 2  @@ >  aЁtLX`8 `2   }xa8    沂a  2 }xa  Ђb?   >8`"       >8`&" 㿈  ` @@"      > > &@  @@`  @`4&@㿈  ` @ @Є@b@   `6  2 @  `> >  㿘> @Ɛ! 6   &@ Іb@@> &     @& ` >  @! 2  `"&  >  >  @  & ЄC?b@> & >  @{!x %   􀐀  `2&!&!&!b??/a!!  @C&!@>!@@&!>!!耠    !         !!?@ c '  ?؆ЄC?b@?؂'ؒ?`$  D`@!h@`T   @!> @! ,`@a``a?'?'@!`2:`&؀ `"0`耣  @         '''@ c '  ?؆ЄC?b@?؂'`b% `@ `b```b Y  '' N`K дG D B >`-@CԀ؀`"@Nؚ@C?ЈЂb? '؆`?/C a?Ђ'ؐ@m  2!> @m!,` @` @X!  㿈@`ݰ  R`$>?c 'А@@௒  ?@@` 'ЄDb@?'a  . + S %ay  *`2`8`3`+`*   + @0` ((@@ c@ 3`C+`+ @>?B8c㿐` @  aM  `    a7 㿈@ `''''a$   `>8 a H@`a   b?@⢒#'M     ! > I>#x? # 2 9К@c'؈ '''?Ȁ  'І沄C?b?Ȃ'К@c?؈   '沄C?b?؂'؀`'''ܐ`  2㿈@''''   (@`= />8`܂ /`! c: ?/a    >8`''@"`'` `z 㿈`o.`>„@ψ Ր>?c`@c ? 2  膀@?>?c0@ c >?( @ 3`+ +`@ ` 0((@ @ c@ C 3`+ @+`@C3`+ @+`@C3`+ @+` @C3`+ @& >`@@`@"c& >沄@b>& `p@C> `x沈a /&`'C >`@@`@"c& >沄@b>&  @C&沖a  >@1M>b&!!@@C& $>1M@b>&o` c>` ?/a"    @  ؈ > > 㿈@'''' `_ 㿈>? c c > ?`)#>>bd`&         @   @ >c #ؒ@( ɰ @Zp ` @ -`_.   _%  `) )  @ @(`?'Ѐ   >8 `` `㿈 ֐  `^ @` s>?>Gc ` 2  " " " 㿘> !@>E;>Gcc>?->9c+@)@80  @H `m@ @a48(`@`(` @408`(`@(`@` H @ @a48(`@`(` @408`(`@(`@ H @ @a48(`@`(` @408`(`@(`@` @H @ @a48(`@`(` @408`(`@(`@ ` `@ @@c2}1> @!㿘> @!>9#H>?c(`@ @ ##H >G#  #K(`@ ` #K(`@ ` @ #K(`@  @ !  #H`bh8``(`@ @  >G#  #H8``(`@ `#H8``(`@ ` @#H8``(`@  @ !  #H8`<h8`(`@ @  >G#  #I(`@ ` #I(`@ ` @ #I(`@  @ !  #H8`h0(`@ @  >G#  #H(`@ ` #H(`@ ` @ #H(`@  @ !  >Gcc> @ @O!㿘> @V! `       @ &  > !& @5㿘> @<! >9cH @& & !&@@  ! >G c` & `& ` & >Gc`&& `  ` > @!㿘>8`(`(`"@@@*`ē㿘>8`@㿘>8`.`8`6`>`* @ 3`+ +`@ ` @0((@F@ 4 `c 㿘>8`ܒ>`@˕8` 4 `c 㿘`>8`0( @ 3`+ +`@ 0` ( @(@ c@ C 3`+ @@ޔ@>8`ܢ: @ܙ8`@ D4O㿘>8``(`(`"@@@s*`@>8`ܢ: @x8`@ D4.㿘>8`@W`@>8`ܢ: @\8`@ D4H`@"H`(@ "" " " 㿘>`0`  $  ΰ㿘`` `@``@&`` $`$@`  @@㿘 @>`@`@  ƀ ` ` `$`$  @ ` @  Β 㿘``  @`` `&@&` $ &` $ @& $@` 㿀 `>ah>`0` Q $> a @ `" @z>`0  @ @r&  ` >`0` 7 $  u I 㿘 @i 2  @R (x  &>c>@%ѐ `@C& 9@H ">@$ߐ 0 &` ; 0*@"㿘 @) 2 &@&> `x>@% XD  ` @ (㿘  ([   " " " "" @  >& & $ ˪㿘1>>  aˡ3>  ˞a "" " " " 㿘 @ &   H`` !@㿘@Ґ㿘 ː @Ho-(@nHp@H`@"㿘>Gc $ D `"  T  `   T`>5  ,> 8  |`>`0 |`P `@>5  ,> 8   @al (`8` (!>́`D㿘> lb((@ @& @(& l]@Œ l`& l& @ҁ㿘 @``$ $& @Ő! `1!!.! z㿘 )(`8```>@$x  `Db !x(`0`` !f*@ ݐ, )$ | l`( !  ! $ l}㿈!> 0` @@/` >@ `@ @  `@@      2*>`@@`@ @c'  ?膀沄@b?'aa@C$a沂a 2  "> 8  X >T   8   > P@<>PH` @ >`Y >5 ,`)>5 a,`|  㿘> `0`>@#  !!,!  , )$ |< Ԃ`G$ 㿘>`0|` !!,!  ), ) Ђ`4$ z㿘>b>9c@`(>9c<>=`+> E``a`l`&`la[`h`l2 `4&`hM`d`h `D* * * @v`@&`D&`h[@n&`@a 1`)(`8``a!00`" a!ܦa!.a 0.a (``2`)@ >Gސ#ف㿘1> I>͐#|a>8`@ڑ >G c#|>G>G c cĄ ` >G` > /@`` @@  ,H``"㿘` @.`   (`  ,H` ` @@>b$ 㿘 < @29 `  ` @4@E "' ``>@! ` `>a@2 ``@!@ ``@`瀦@2`$ 2 $㿘 y@ `@㿘 (   ?& (  2& (>Gcc cc`@㿘>Gcc`$@` $`$  @ @  ̔  2 㿘> @"!>G>#a"  #`"@$# `@  ` `r@>8 *c`"\> > @!!(2   (`8``2    (`8`@"4  (`8``2    (8`@2 4   `ހ@ `  `>Gc `    @(`` > @ ِ!X` (@`&@2 > @ A $`$@4 > @ ">G`` G>  -> @"㿘>Gc` @2 Y  `@ 2 $㿘@@ /`> !h E 2`>!@!^$ $ $ (` (`8``2``(` 8``(@@`$  `(`8`&``(`8`$ `   >@ ' ($ $>͐! `@&%@  . $* $`  Ʉ  >a>a>!" $@@. @@ Ȥ $@@ (@` >" @ $ ,㿘` ` `` @ >8c$(8``(`0``(` `` (`@2 a(`8`` ` ``2` 㿘 ` I> b`"`>`@ϐ"@` (`8``2`>@Ɛ"X>*`#@:``2  @``2 `>`@ "` @> b``>`"@  " &     & &   㿀''''䀦` ` `` @ ''>8c(8``(`0``(   ` (`@2(`8``  `2 > b`耠` >`@F">@@"㿘> @"!>G>a#" y #``"@x$#` ` `` `  `(`  (`8``   `(8`2&`6 6 &`>Gc``&``  ```>@" >8>`@" >8c2 `(`8`@2  (``2  0  (`8``2 `0 `䀠@@%`@Q!> @">G` ="@㿘 _  ƀ> * b@>@# 㿀><''bp'>8'''c (`0`` @` 2 (`8`(``㿘 Դ   > @S#㿘 $>` #     2" >#X@" ">G>G"  @ ` 㴁㿘> /@`` @@`8  (@ `L `0   "  } " yH/` /Hp@  (`0` `` *(2  (a8 p"" ( p <(`0` @ 2 8c2 p?" < 8`5 "   ) 2 1 " 2 " 2 " 2 "  @  2  p <(`0` @" 2  p <(`0` 2 r " @@2 " 2 L" P" T2 N"  㿘`8`D D x @ 8`<`(5  @Ӑ 1@ , (`@``(`0`  @@ӐB `@ `" 8@=`b =`  @ *` 0 *`   & 8 0 d& @& 0 8?& <>G cc `>G c>G c`&  (`0`@*`@``2    (@ "  (@ "    @" 2    (@ ("  (@ ("   @" > /bT@ 2㿘 >Gc@ 2  㿐 /@w 2e?@   c?2Y? (`8``.2S?"  c``8J?''  1 @8`Є``  ``8 (` +>Gc `"   @@  2  2 ( "?  >b>bH,`;`> @H?㿐@'? 2  2 (?2 c*    (`@  >@ >`0 @? ">e `e@ ? " >@>`0` @?@` 㿈  @ ?0 (,  Ѓ(``> / bT @f 2, `, ` ?㽘> 8a,{ d  >@#(`@ @ ` (`0` @ 2>@ @@~>}` a>j` b>@Ð `>}a@㿘`K(`8``` 4>G7c`!` @g ,`(``2(  (  ((?c(&2  @F  `(``2 ?&  2 㿘 >@c >Gc>`>cP`` @V`2  @O  2>@H#?'L' >%>G`#>8 " (`` 2 $  飔   2'>@! >Gc> cP"  (`2 @ 2 $>@ #''>G#@  >G>Gc@"(2  >G` >G>G @c@ >G!>G# @#> 8D>8>88` 8>8a8`D>`>a>`> b``a>h`>@Ɛ" @`@@@zH  @ǐzB @  ]`   @:@U`p(`8``*(p "H ">@`b>b>a>a>b`>``?)?c>@d @`@\@ZNy  @ly K@ `L@``*?'' 0`@1 0`(`(`@`(@@'@  ">`?'􀠀>> 8 4> 8 a,> 8 a04? >=c` > 6? bh> 8 a0> 8 a, 2^!> 8> 8a,2Y!> 8`20''#ؒ@  "'>Gc#؀`"   @@ה  " 2(>Gc؂c```````>#\#`#d@!     (`) @?`@(`@@> 8 , (``@`('?'> 8 0> 8* 4!,0`` H!,?  4 4 h  a>@Vh@=   >@Q!p  `   "`2  @b ">@a` `>>=c` > 8 D> a@> 8a/> 8``a>Ԃ`x> D! @>2 > 8@7!@> 8>Gc؂c```````>#\#`#d#h@!!> 8a,?`0`@0`@0`> 8a4`2  0`@0`@2 > 8a4 a4!0? > 80!> 8> 8a4 0!> 8!4?2  !4?  >2"2 @ޖa!> 8!0?">ɑ2 ؐ !0?  >2"2 @ɖa>@Ɛ#>` >`  >b 㿘 @ ,``& , h@㿈 @ ,& , >@"( h p `  xИC?b@ @ & Ђb? > x?/@a> x& > p`> h >` H 0B`> HC > 0 P 8B`> PC > 8 @@> @@ 㿘> /.`b '> 0 `@`@  ᜀ&@> 0 a'> 6 `@`0@  `&@㿘>GcЀ`@?  !` >Gc ` >G @>G   c>@"H㽘  ~  (`2  $ d 2  ( *`2` (`& ( ( `& (x㿘> Hbh @,  (`$ ( 㿘`(`!!  &`>@"p`X>G&@>G&` @ `  >G c&` ?'&`$   ((?c(&`$`$  U x$ >ؔ`>`'>GcЀ`@ 㿐 D?`@0`>@0` 0`>>c@#>a 0 @>c>b a>*":ŀ 8b  x>ŀ"`  ? >F"Вŀ 8 x80`@8` 8` @  > "ŀ`R ,  8`(K, @```((`0`4    @@}B `8FPd @ِ #\>ŀ"`8`(4 PO @ `,PE @̸ @ >ŀ#㿐`8`" `(`a2 @ @(! aW2 `@2 ǐ |  (@@"2   (`0`) 1   @ @ C 2c @2`   (`0`) 1   @ @ C 8M 2 @8G  ` ` ࠀ`"  , 4  `''`@@p  26`#>G  c  @@`  2 6`@T  "6`T6`!@ >G cԁ  㿈? aW? @  (`0``  8`  (`  +  \`p ?(0c (`@?0@@ aW@  0(`0(@@@@  (`0``0`(@`(`` `*(`w   ( ,(0aW ?*`#8 ? 03`&6  @+`(` @@3`@ @ 4+ 3 & (  (`3 @@ @ 8*2& ,  (`2@@ @ <*2& 0  (`2@@ @ H+3& 4  (`3@@@ X,` 4`& 8 @ @(`4`@@@4,& <  (`4@@@4(& H0,,  8)  6 4 & X`\?(0(`@?0@@#`\  ` p r(`0``0`(@(6 p0?c) 0 6 r'?`t 0((`@0@@#`t `    ) 1   (`1 @@@3   22`+ *(& 0 (`*@ 3 @ @+`0@  @ & @?6 & c ?``0 ( 0(`@@) @ 1 $` (`1 @@@ $` r*(```0 ((` @0@@#```(`(0`0`() 0`0@4`4``(`0``@ (8`@4``6 ΐ6 `p`<(`0` @@@!`r(``# `6`p6`r  M   Mv?Mr, ,` 4`4` ``(`0`&&`P&`<6`L- 0`&`6` &`6`p@ 6` 2&`T@ (&`T  &`T6`6`Nz 6` 88'H'T`NTL (`H (0`? @c?  ?  '   '?'?'2((((2  @ʗ 0?ކ@!@ @ Haa(`8`@@ ] 0((`@0@@"  ``"  `8`? `2` /`2@ /`@ (00(`@@) @ 1 @ D (` @1 @@ @E  ?(2  @ >0`2, `&0,`28 `?&,8` ,L0&8    p(<0) (`@01 @@  @ 2 v0(0(`@@ @@ fc"6 "1 , 2& $ `8  2     2  /  + )'- +` 0((`@0@@" @D #`3` (00(`@@@ 3` m`'   6852H` `+(`8`%  (8(`0`n(0`a (`0`   6@ &. &6 'T (2  @  >p<(`0`&P @6L2&T@(&T&T6NT` (4  @`@ՐB @0?ނb b `   @㿘 @u > & ( ` (& & & >  &  @  ? "  㿘 `,`'# `$  '  @?`a`> c  "     `>G`?#@`  & 㿘`0 `)"&``>G &` `&@ `$  "`@ #   `&@ `$  "` `  $ N 1>G@ #㿘 `@  \?`*<@`;@2`2`@"`` `@ 5`2#@@@ ("`(@!"` :@` @&  &&"` @ `&"@`2` !>>#p@_#(>#p@9#Hk`` $`㿘 ` ? @?8 ?@&`&`  `&@  `'  &``2( @  & ``@""`` @& ` `@ "?&`@&@&`  `&`&㿀`'T'X @?a' ` ' @'L ''  d͐   @`@`2`` ` *'TX ' J LJ@ 988` \$$` \s`??@ @@ @8` \@@b  _ $ w @`ud "'@:` '` TXE  F@`2`@ = L9 \$ \(`? @@ L@ \@@   쀧 + @`)d "'@ ' 耥 耠> `&  ޒ > d'  #dh @d   @㿈`ђ   \#`#\d#d#h㿘 @ d @8b  \ @? a>c  C D`  ;  `& / " $  0 ݴ @@"`` `@      @Ĵ@ #@`2`6   㿘  & 2 ` ݕ 㿐'> I㔀@ `\!>G #   #\>@ c`#@   $㔀`@~s  0' (' $'    ` `'  쀢8    `? " && & & & `&  &  `&  2 " `2  } "  `"  `&  " H/` /Hp@`a   `@" (`" & "    @" " >HЀ`   Ё㿘`(`8` > b,&`H>H`ܰ &`L>H``&` `㿘>H` @2   L @" ,8`" (@@ p>H`آ # 9  `$ `@'''''''''' ( Ж  @J  `$ 㿘>H؀  ` >H `>H `>H ` 㿐 }@",  b@`w@>H7``@7 `v@$~@  +3>H```. @ 6&`` & `>H `  >H !@   `& v @P >H؀"  ` s>H `؁㿘>H`Ѐ`>H@< !>H 䀈` 2  䀈`>HL` $ 㿘`A >H```@>H @`㿘>H`>c %>H #`$䰒 "   ! >H    @@ @@   `$  @&`$ `㿘   >H  `a"c 㿘`1>H ``a @ ` @  `@ `@|R & `a& ` @`(`8`` >H`0  >H `ԁHo&(@gHp@ (`(@ ?@ |` <` `"` "; ` @ 2 ``  `` "`2  " #`    ! !  `  2  "! = " ` 2 ` ! 2@ 2 ``  `` "`2  " #`    ! !  `  2  "!  `" `" ` ڀ 2j ` 2 "` `"` ``` `@2  ""` `" ` `"`` `"``` `2` 2      ` ! 2  " ! ``  "` ``"` ``` `@2  ""`h 2 "` `"` ``` `@2  ""` `" `2-` `"E`` `"A`" `2` `2 `      ` ! 2  " ! ``  "` ``"` ``` `@2  ""`   " `2 " 2 `2" 㿘``8 6 `"   $`"&`@2$`$` @" `@y `"&@2  `` ` `````` $`"&`@2$`$`ɔ㿘  0     &`&`&`&` 6  $㿘      㿘        " ` "      " ` "     6   `" " " 㿘 (`& ("@ "`  @ x`& V l H   < @ ̚`@ & H& & Ā@ & <& ́㿘  <  H @ x @?& H& & < & А lݒ@`` `& `@ @ $`@`& ( `@& ( $`@`" ( `@" (㿘`   @?@+Cx@'& 8 L@  :" P" " |" " " "  " ԝ㿘 `@@㿘 ``@㿈>Ǡ`Ȕ @xY x` X'  X@ĥ㿈>Ǣ`Ԕ @xF x` X'  X@Ďߐ ``X>>bx>Ǡ`Ȕ @x$ x??'//倠`? X'  X`'/@Ֆ؁x>Ǣ`Ԕ @x x??'//倠`? X'`'/ Ԡ X@ķذ㿈  X??'/`?/>@Ĥ`>`> >ʁbbX`"`` ` -d>Haы [> "D> b< @"` `2`TG   2B  `d> 9 @xx @`h"`,@`,'`X'`@'`<'`4'`8'`P'`L'`H'`'`'`'`'`'`'`'`h"@n ՘ @> P"D 㿘@j& @Y ip'@_ L P `  @ `2:`@?` ` * %``h (`>` ''''''@'ذ@+0`d  `@``,@w ` @$`㿘 ; x`>H!   v  & (&  @&  t@" A p & $& ,v 0 @ 0& &  @ @ @&  ,??㿈 @'?'@\A@W '?  ""  @'  @쀠`` `'`@ 쀢`2@@ 㿘@& 0`   @?@!An@ H& 4@ &@@m 㿐 L (`& L@]Y@c L _& Lh (@2 d>>#@ɒ`0@"  ( d>#\>#`#`@  @ $`` $ &   $  $ @ & $& $ @2  & $     @ $& `@`& ( `@& ( `&  㿈 '``i&  ' & ` `&   ! 2쀠`3'@ɐ@Ԑ  L P 'Z $  @쀠` `' @@ 쀠`2@ `& "    @& 쀠2`@ x "' \@@ l- 2 ( d> # X@@8  0 d> >@` 0@&@ &` 2 $`@"   $@"  @" $  &   " $"  $ @& $ $`2" L Ђ`& >9cH" 4  & $  " "   @ $& `@`& ( @& ( L   8& L&  `>9cH> `4b>8`?$$ :0 @ @  @ @㿐```0"   d`(>>#\ (`@^  2`(n x`1>HK!㿘> "Dd)>9> b<'> *%>8`4(&` @Ӑ "!` ``4 ` #H 4?$$ ܒ0 @ ` `2`<> "Du1>  "t㿐''@  < 4 H @ 0 @@ $$  @' @c` `` `'`@m `2@ 㿘> "D> b< 1> '"D㿘 @C&@ &`   @& ?@*㿘> "D>H > "< "< `!"<#`2  ` ` > b< ` > ߐ"D  @ ;@  㿘& h@ @㿐>a\ `( @>Β@8.`> @ bP>   bh> b\`2@d>&@ 8 Ȁ`p Ȓ@V @t ؂ &  &  & $ & d& `& 8? & & & & (& <& 0& 4& ,& X& x& @& H& L& |& & & & & & & l& \ & P>w'@@$& p  & t& h& & & & & & @j& А @g >Ha , & &  8#\   >v`pj >ǂ`!> & "D>H` & T`> >> x@͒`<<`&  >H <` "D   (@   ?㿘? * *  (1>H!㿘ߐ? * *  @(`@1>H!@ 㿐> Ic>Ha> `>Ǩa  ,@s   #\~  `؁H/` /Hp@ D`T` `` T`   `"><>c"㿘>K`؀`> `` ` `> `````@x  `> " @ ```   >H`Ԁ``>H`ܓ. =:`` > ``> b@06`@ `'L@'H/'L'`H ' ''` `K"D.;>.'(8` %    '?  (`8`'d~d2p9U1T +" + .# * 2|`#0@-tۨ ʀU bDXOiz 6b4IX`>ptl"3 nh,i2P= ]o2J\ 3t xq#s?~zu27 >'  @q”  2" @   (` 0` @ (`8```> ` `>  '> @  `" .2.2 HL (8` 瀦`Q /`` $ @   @ :@?`` ,`" .2.2! HL " .2.2 H~L (8` 瀦`  (`8`` 4 (`8```"`"  >2 >2.Ŷ >HOL"ͪ ɨ  `' ' (`8` *  ` ? (`8`*@@Ѐ *&?d Ѓ(`) 8`) @Ѐ`   @(`8``l2   " / 'τ    @p  2" @   (` 8` 8`   -`H   @p  2" @    (` 0`    s >    x  g' ->` @o "'' '@q '   @p8  2" @    (` 0`    + a'  @p  2" @    (` 0`    2   `6 ?``Oπ` ` π`9->'0 Q'#ς ``0-, 4`4  "2π`0"/Ϭ 0*-@`0 , @   `0` , `-4`, 4 @' @/ ' '' '@&` `2` 2 `/ `"  2 2 ?.HL ? 耦``/ `8"1.)+.0`  02. `.HL 0``" .2. HsL `"  02 02 ?.HLW 0? 耦`   02.2 ?.HL9 0? 耦`` `" .2.2 HL* : '  @?  2.2 ?.HL ? 耦`d?`L 㿐'`' ()`(@㿐'P'T'X'`'P ('`(@㿘!> @u"   >K`؀`6@Y"㿐'X'H'L'P'T;> @[bH '  >K`؀`@>b㿘> 㿘>  Hڰ 㿐 L'L'P'T'X' 㿐>'H'L'P'T'X`0``D`T` `` H'T `  ` 㿐'X'H'L'P'TH   '>H`Ѐ`'    㿀 < 1  >TP % (`8`   >  㿐 'L'P'T'X   `   @!     L 'F㿐'X'L'P'TL   '1>H`Ѐ`'  $ ]> >caP㿐#>K'H`'L'P'T'X> H b'􀠠 !!> J  "Д$`ؠ!> !hH'>#ڹ㿘>!p> b`>͐!㿘>Ð!㿘 ap`@ %&@` `  @6 * 2`@ @ $!T&!P`&!TH` @! > 8 `㿐  Da*(!x@ $&@!|  @ !t* 2`@ !p5N   75K  ؐ㿘`  @ ʰ Ho-4`(@n` x` |@ p` tHp@ ʐʨʴʐʴ>8 c> >8> a>   ă(`"@ &(`8`"Ț` `>8+`c `` >  b> b> b>  ؂ >Ka0(@> > b܀ >Ka0  ؄ (@>  bԁ㿘(`8``-   (`8``0   (`8``x`X    `  ````%ɠ4"?7&``( (8``  `2߆Є  2 &@ ?㿘 ``( 8``*    ( @  .(`88л(``  (`8``  ` ` " `?&@33@ 㿘>8c. >  >`v# (`0``81>(`>@ 1>³.`>`d P1>!1>!![ `> b``  >’>"> P>Ґ#A@㿘> b. 8`@> b1>@"#> bĀ@(@><b@"@&@!><"((><bx@:>@ "("bĂ&@(`@`41>> "81>"H(1>X"`>88 c>"x>" (`8`">> `"> * _:  | `|(`8` (`8```$  >`"8>" >8 aЅ(>8a>b@^`(` 8`(` 1>"㿐>b>b>La0>bȒA@@i (  (`8`` ` ` " `{ &@zݒ㿘>r"> b>´c>b>`>aH>`>`>a>`>`8>O``Y@l@S $ `@(`8``f8`f`q>`b1#h`b4 >>`L*#`a2'">`d"#>`d#>`q `t`h`l2 `v `s2#@#`>#@ @(``㿘 (`8``  ` ` `> bȃ(?8` >8a@k2 `@l "`@,`- 8`?&@ 㿘!> "̀ > bЀ > >Ɛ!h[;$"̰>!x > "̅. 8q!"̄Q`?`?㿘>  b>8 a#> >  `H  , @ bȀ?>  b́㿘>  b%>< #>   ?,  F: bĂ@?>  b́㿘!>K (!>F@k-!> #> bb؂@ >K!a0@j0 @k!b؂@$b؁㿘> b+!> . >8@ (`8`` `` >`2> 0 0 9! >4". : `%>0)"Ā><1>+!b4%1>&><(bx>!"><&(`@`> ! 1>  ݐ e1>!"`㿘> b(!> . >8@ (`8``"  `` >  >0 ڐ! >Ր". S: >`'!0)"Ā><1>+!b4%1>&><(bx>!"><&(`@` >"1>0 } d)1>!"`㿘>  b>8c>8. .aб> >>b <-> (`@,.8`2+``2@@2 `e sd0 m "\?` (`8`Ѐ@ $ ?>  b́㿐 (`8``  `  ` `2    (`8`` ` ` " `>"0  >.`.: :"㿐 ` @(`8``  `  ` ` @` @-`8`` ` ` "`> bȃ(?8` >8a@i2 @i ",->8`?"P-``  Ē >- s"㿘> b> . 8`u> bh> cY , 8``y `Y`n`N, 8``y`Yk c. >8c` ``   "@"  `2 - - >8Т@>8%a>8 a`(`8`    2` 1>X"x ,`@h ރ- Ԡ @(``8`(``>"`` @g7 "&`  >+">&"bĀ><1>Q"b@4K1>. 8`Ր> bh> c X, 8``y `Y`n`N, 8``y`Y*ː cw#> b!><& "*`>"@=`bĂ&(`@eb><&x(`@>Ґ""`ˁ㿘/ 8``c> .8`>8c.8`/  8`>`b b`@ho2W @hǔ 2P   (`8```02B (`8`@2<  (`8```24  `d.8`><bx/  8`%><>#> ^b`d`e`c0 `f2-     l  !:  [  `2σ.@@hk 2/ 2, d"bec2!b f2bĐ { bĐ ֐  4   * :    ʃ, / 8``c?>  b́㿐?'>b>La0>b>8c>.`c>`>b`%>  (@e   (`8`` ` ` " `3ߒ 2  $, ܐޒ@``@g "'`a2'(`8``? `q   fÒ`Qp @f > b> b>##.8``>8 c>#8 @gV2 @g "   `2>#h> a#k>8c .@e̒@>77ޠ# iW; a.: ,: >> b>8, c@ @e ,>8Ԑ# @e@>8b̈ >8 bЃ(8` @&0 &><bt >< bp(8` @&0 & > ? >8c`@fǐ2 @g 2  (`8``"`2  (`8`@& `2`?`@f2 @f 2  (`8``"`2  (`8`@& `2``@f2 @fה 2  (`8```2   (`8`@4 4  `2 ,c: 㿈 -`8`` `  (`8`` ` ` `2 >  b?@f:2 `@f "`,`@ (`` ) 8`   "  '-`>8`` w#> (b@@(`8``f"р`q`b"G `d`L`a2]>(>o`dL) ꀠ`q `t`hۀ`lL>ۀ`v6`sD>>?  %> 8 bЀ3 S >**:L:#'>  >>  b  (`s>ے "' 2>**::u c)> ) d ' 2>**::N d> X  eP' 1'͖ 2>**::# e> @i * +: ' p>**:: fy'u']>o'! q.?h'b')^'쀠" + ?>(``1>8 `(``` 8 2  (`8`` ` `  >8` `ސ t!>8   >8```> x'>"> `? `>b>`> ' '㿘>Ӑ Ti >`>K`ː@a ( &  TV1>     N - 2  * *  @> /"@2  * *  @> 0!@> 6b`2 `> 7`\(> 6bl@ `?( 0`@?`@(`@@?> 0a2 `> 7`\ > 6bl@ 2 ?( 0`@?`@(`@@(?H/` /Hp@H`@"H`(@ " `E  㿘 *٠   `  `  㿘  * @`"6`,  `6`  `" `*`@:`6` `$ `(`@`א&P aP>8`@'Xٰ      Ш.'*u ?c 0 02    @@ 沂a@ `1MD b@ ?b@  $>L @\DXtX`dC耠 @      2 @   F@%@d'` ?؆@?沄@'؀` >8`T@ >8܅(` (` ( @(` Oئ$`@>L\@ @>L!>L>!XӐ >L @ #"? "  " v  㿀`   ) А `    ) `@㿈`?  #@*`(@@ +`*+` : (?蚣@蚃@ +`'`@И 㿘 ,@ "&@  >L HaX2&@``6`&@㿘 "ڒ `: (`0`` >L\>L` \ !X 6 & %Ho-4H(@nH>LaX2$)(`8``ε0 0`@$ @㿐  ''H'L>a'X  H @L4@(`%] 2   `$ @4` (`@ (@'@ `$  (@,*`@Ԓ ̓4 ìX @ X'D'P'T`\ D`@4`0`,   + , , ' ' @a ЄԠĢȮ''({ DP`(q DT(g D   @C沂a `1MD b D?b@ D `$>L\B @D`5 h``dC耠 @      2 @   G@%d'` ?؆@?沄@'؀` >8`T@ >8܅(` (` ( @(` ~JتD$`@>L\@ @>L!>L>!X͐ >LD @ݐ`$? #$  !' P P' 2T`' 2,, @ _ x`   ' ü `    '}  ` @``#\#`p`  ؔ 'f í ؛) ) ? @ @(`'` @``#`#\8 `/   $X  B O  '/ ?`''''''  `@'``.` , @\@؀ 耠@ ?  #" 0 0H膀`@&>0@9 C>H @ `   `& ƒ㿐@  Z  ` `` #`#\ 㿈@  B  ``'' ` #`#\ c  @` %   $ 7a`>`,`b@  `*  a4c@  ``$ p  m ` `&Z 2  $ `  @^Ɣ  `$ |"/ }b{2^ G "~2U '` `4   `/b~'` `@4   `!b}' (`8``  ( <!@` @!@`2 D   "9 !T`'  ``v(`8``2  (`<$``w@  $`@ 2   `2` %ʔ `$ ~`@| 8 `/   $a   X  % H` ''''''  `@'``6` 4 `\@؀ 耠@?  #  2    8 8P膀`@&>8@9 C>P @ `   `& ~%㿐@  }  ` `` #`#\v 㿈@  }  ``'' ` #`#\ Z  b}@ (@ b~b@c @ P@  c@" `X X  " P "`D`((`8` T > c`"`H "`   > cp"`H "`  D ((`8` T 2 ! @2   @2   D`(@`T : (`X`2   "  X`" ?@2  @  D`(`T" X`"  ?@" (2 " ,    : (`?㿐>L#\!h> `a    X" X" X@㿘>a& X   Xb!a a & X㿘   @> J>L` `> J >ǂ @  >@d& 㿘  ( @\&@ &``8` @>`P@ B?>`X  (>` &`( 0 8>`0&`8 @ H>`@&`H `&```&` 㿘 (`A  T` X`  X`2 `" `X`"`   ` @ @a8   `[  X`@$ X`S``X`@$`X㿘 X`@  _& X X" X7  X`  Pc 㿘 * X`& X> a^ X`  & X<  \` T  Ɛ X`G$ X$ T@1>L冑!h㿘 (& & (ΰ 㿘 ( |  \`$ \>Ja"$ X  @@@8  9  @@ $ $  @`$$ $ %`&`$ XА(`0``?! X`$ XΖ 2 \ʐ 2 \2 2 \א  \`$ \ X` " aT8   X`" $ X  @a.ݰ #㿘>ǐ`>>ǔd@2ᘠ  > J& && & &   @ 㿘 (`T ר X` \`$ \@(#>La``4 @8`2[ 2 \@ a``$a`B> ta X` א[$ X n  @@`A `> . 2^ \  @ X@8  @  6   $@    @@ $ $@$ @$ ""' \"  ?$ X (`0`` #y X`!$ Xݖ 2 \ X`2  `2 X \  \`$ \ X` " `"  X`"$ XҐ` `   2Ð 0` 5 `S$ \㿘  & @ZL & X& T& \   @ @ H> 0c> 8> > (& P㿈  %>Lhܨ p hը i`,| \` 0`0`  `(> c| ` B0`@0`  `( ```(``($ T% T, , ` zJ, , ` z=!Y  }c}`Őy֐z `?c>`,@ @>`, 㿘 (  @%$ (㿘 ( @Y 0&@ (`0``  P`" $&@ (`0``2 @`&@ А&` ؔ&`  `  @ 㿘 (Ho``A(@a`A"   L`" P@`2  P h (`0`` 2  2(``2   8(``2   (`0`h`$ #`    ! 4  ``2  ` (`0``"  `2  8(``` `  H`2`@  ` `) x `$ `!  `$ Hp@㿘 @C (@8  b@"< T@2A28 ~@  c@#}@242 ` 2   `  Ă2 2  2 2 ?2 " <@`" @@`" D  <  (`0``"``i`r  @ 2   @  `@  (   >,a 㿐 (#\   @!      ,-,,,--Ho%(@fHp@㿘6 `(`(` > 0a@`(`8`  >  c>  `&`H&`L &`$㿘 L?2 `(`(` > 0a@ $ @2  㿘 L?2 `(`(` > 0a@ $ @2  㿘 L?2  ? @6 `(`(` > 0a@ p H L @& ,8`& ( H (`8`4 l㿘 Ѐ`@ 㿘S t& tV@2``@@?㿘 @ "! ? 2 @8` L86 耢 d d6     (`8```2h h2)"@>L bhbh `>L bH    x   x@>aܐ!㿘>LbH ( b >L&bh"" (" H" 2 2 2 t" " |`"" `" l* $ (2p㿐`1 @`, -(`>0@>L b`>LbP>Lb@>LbX>LbH+ +  ? 㿘! >y pb$$ h h @4  h (@0  h H@, >L$h>L$  @H ` H>lb㿘 ꀢ  /  (`88`@2?㿘H > c' " H@ H`2 t t`"+ t2  @# Ѐ`& t!ɘ  H` t``2  @ Ѐ`㿘  (`8``>`0`a H`Ȁ>#`a@   t`& t H H`0'>8>b H@߰ P Ő >b d, , , $4 @G d@)>b >`b | 2  >c6  >c({!'u " 􀠀 @8 @*   D@2 '  ߒ`D􀈀 `<@`4`p c@@ 沚a  '1Mb@?'؈@  '1Mb@?'`  ) h(`8```'`?`?* h(`8````?'`?` " : h 2 h8  h*   $@ 2  h'  2 ) )>(`8`` H`>cPd 2@>c`@`,!&%@|"#`ؒ"#d@u#h-`#l-`"*  d* $@h2 "#p>#t#\ch36 㿘u  t`  |  㿘  H(`8`  t` H|& tZ >bx 㿘 t`@% d"  "  @ H 2  t:& t @ ؀` @  t& t㿘``2 >LbP@8bP`d``&`d 2?`H@ ? / `"R``2N`` (`0``   T`H>@%">LbP$@@ <`@ 8bP`d@L&`d`@6`? `"#`? `"`>LbP@8bP`d``&`d  @@`H 6`2``2 `` "?`?`8`8?@"5` | ! } ` { \ ( ~ \ ^  ) '?? ?`>L"`>LbP \@8bP`d`H`@ &`d D``@ >L bP`(``6>LbP@8bP`d``&`d @ ܒ`H &`>(`?8`(>D@46```2   6` 6`??㿘`t`  ` `  ? } 㿘`t2``?c&```h` h`@  ` `   ^ `  ^Ȓ ` ?`@㿐 ̒ 5 ( @ ; @   @ * @   t?@& t 6 6 㿘 ~  {` 㿐``3?cq&``(`8`&>` >a@ `?\> (@ `n @`2``Q "b` \`†```t``6`  &`t&`@  :@  ``t?c?c&`&`t`,(88` 6` ? `㳐#`   `t@2 @ \&`t``6`㽐 `(`'8`     /  HV t  @ "T р> N #`! E>`0` `T @9>LD "` | "` @2`0a@2`a@2` `  ; >G!c>  ¤@" H&`@`qb " t&>H`> 7`Z` pV` (``ߢ @ @(8`` `` >H`@˦`> ?@RȠ@6 2 B @= H@!`076 @ y $6 "P9  @ ?"P d @& d#$@ @  H@`4 (```2| `4y `@&`"9@P-m H@r0" tl`@&`@P`@` #> `! & tP`>  c>^a 㿘3` (`" @  ( `" t@   t?c6 6 o& tI` t p0`& t`(`(` > 0a@ H`@ r HŐ H 㿘` t& t  & t   "        㿘 t"` `i& t 2,  p0`& t`(`(` > 0a@   & t  2  "    ֔  d & t  㿘@ P 㿘`H   㿘#?`2 `@0?y L@&㿘>LH H` >Lbh `   Ӑ @ ڐ @ ؐ ( H@ ղ > 㿘> @"    `& | 6 `  ><0"& t&  㿘`p *`L `h" `@@a >L>LbX@8bX`D` &`Db@@8b@`$`&`$>Lb` ?@8b`;`?c0` 2  `| `( 2`t` !@  ! "!@ ڒ!  (``2``@"E`t``h `(l `t&`t`h0`8& `(`t`@2`(`a"``(`$&`t`d"`` " `@ `H 2``t`@&`t`@"`t`؀` @  "`t`t`@&`t`t h 2?h2`d?!c&`t=``2` `"`t`  ^ `t̒`tł@`` ! @?`c&` `(`@`"`ڐ`@`6`2`  ``2` `&̒ ``|   ` ` x`|  `t* `2` "``t2``p0`&`t`(`(` > 0a@  2 }`t 2`t  2q`t2  `2`@2 `h2`(`"`(@@,"0``th \w (&`t ( ) ! '2 `  ` ^2` ~ }` |`  {2?h1&`t?`( `2` " ```"!`t@`g`t22` .```(`8`` ``@lN```t͒`"` ǒ``"6`@`6``t?c&`t`2G` Cd b`?`$@=  "?"`t@0?Ɔ  2> a@@@?    `@@`@`t`2 ` d"``t`2`( d"`(``|  @2`t|`t`(``h@@``H(`8`6k`t% f`to b`t`@ Z` Ɛ%R`t` ` `2`‌d" `…  `(@6` `t``6`(`8``2`t`6``t" `?c /&`tޒ``2`t `"`t`, (`88` @`8  Ò 4?`ta" `t2`t``2  `t`&`t?@&`ϑx  t7c & & t @L & & & @ ? tc& t㿐>`0`  'H'  ( ΐT  @'D# |0a@2 @@  `  >G!c>  q਒ ΀`0B>8 `?  @C   @&8 tq `0@j`   > `@$   `O`  `G'``"  tB (`= t    @  ~ `> v #``> ؒ! g`" ``2 # ` # g "N #c`I  L D 2 2  | _ `:>G!c>  ͖਒ *0. H `&2 !H``        @ 6  h@y  @@` `"   g j`㿘  a  (   ` 㿘 L? 2 `(`(` > 0a@֐8& ,& (` 2  (`t`2 ( ?@ 6 `  ` ,` 㿘6 `(`(` > 0a@{`A 4      t`   ` t`2`     H(`8`$  ``ْ `Ԓ QP @8 @ {@ ]z@:->G^ `r`g@%>G @e@2<>Gc@`85>G` >! !T>G#c> c!T  @  D| @  0a@!@"`[@; o@8^@ a @{@a0@n@Z0łc@"!T wb@]@K l@`h@s@?Hb@"]  }@4  `@ ]`r@'!@@=@`~@ Z@. ge@v@ 0@ !#@`?h`t$ti 03[&T td` ` `2> ` @" @`t`(`(%  @'܂ '?'>aH'''@@f Ē @_!@Ė@]!Ĕ@_ @JĀ > `2  Đ ,@I 5   >>!T` @ D`2 | | c &`  D` @`,&ʰ t{$t #@`r " `@2} `B $`(`6Ԑ ` @ "tt2( @" (@2(߂b$t($$($ऀ` $      2 `@") ਄a!" $(@ @Hߐ @Hې@Hה 7c$$$ࠀ hw&  @@ @H$͐> aXp  l   l> (`@`@.@ " ,l l(`@  t "ਂ$t?c$``!T` @Ȱ  D` l(`> @`@ tp0`$t`(`(` > 0a@ Y!T` @``"@}" !T` ><Ҧ"!T D` ` !T` $!T$|!T` ` H``   !T` I D`E Z  @Ae$| @G  "I @G |   Rx??@$x`@` @$x` "x@$x`@"x@$x` x@$x  㿘&`t` &`p` &`&`t&`6``t }#&`t?Ho%(@fHp@㿘?`& @(@    @8` ` 8@`2! (@)(   `@&  & `&& & Ͱ㿘 8 `   @ 0 - @ a @   #`8 @  @ 8@`" 0    #`@㿘|@`& #&   @  @@  @ & @& & &@`$4 `& & \ :`:`  `*(*0`@ 8` `@ ?? 80`@8`` 2 #@ (@(@(*  (@@ *  (@ ` (@  (@*  @ > J b$> J$` `` $ `"  "   "8``8a"> J b$  "@ "   8``8" a"@ 㿘Ơ?`)  2 &  &( "  @8` ` 8@`2! (@)( `& & 㿘( @  @   @  @F&  @F    + @    @& & & @&`4 `2$@& & $@h㿘  "  @E     >  "&  8`2`@:`@E`   >8`2:& & 㿘 >5  &  >8` 2 : ) & &  & @&& & & 㿘`D ;6`2&$͔ &'&  @  @E   @  @& &&@& `& ܐ㿘@`а?2` ``2&`$ `&`&` ` (@`` ` !`8`  (@ @  (@ ()@` ``&` &@`&`  x`@` `ܔ @E @E@E |z0}?>`0``D` T` ` @Y@ D` T` ``2 d@>rc̒  D`%T`   a@q@  @DH`  >rc?  㿘``D`T` ` @Z @Y? @Y 㿘``D`T` ` @Z} @X? @Yѐ 㿘D`T` ` @Z` ?@X @Y >Lbp@2㿘>Lbp ` 4 @ ` ``2`㿘>L bp``4@ @*`$  2 6 㿘>L bp``4@ @*`(  2 "!㿘 >L"p> bd>  `$>   > b `!"p``" `@`` 4@`* ``2`>N``  ``>Lbx>M!> J ap"@>V`1> J>"(aP"@ "( >Lbp@"2  (`8``" 4@  4* 㿘`0- >L @d bp@`2 *  (`8`@2 40`4 @* *  "/ >Lbp@"   2   (`8` (`8`@ 2 4(`8``2  42 4" 4* >Max , ؀  N `  8 "@ @  `4  (`0``2!   @ `   (`0``   @ " ! (`0``88`"  @*"   2" `@ (" "@` "`6   (`0`` `` T@  D  @  D    (`0``" ` T@  D P @  !  " " " `2 `" "" "` `" `` `@"  ` ``@" " "`"`"@   ` "  " " "㿈>at@BQ @ "$`$  2 @`"$`` @$`㿘@g5Ӑ @g 㿘@g( @g㿘 T@> @g! T  X  X X `T> @g! 2  H D P@ L 6 㿘 ` T` @@ 6`> @f! T&`X&`T& T`T  `X1> @fّ!㿘 ` 6 ` 0 @A6 & @:   (`0`` D&  (`0``` P D"  D  @@ٞ@㿘 D&  &6 &   @Bz 0 . @㿘'H`>#Ȁ>#H >#H>  @  @A'H&ꀦ 㿘 3 !> @fk!\ >Lb|(8!\@fS0 #(`0`@  "  @4  (`0``" @W (`0``">M#>M˳ 㿘`%`(`0`` `" & T@2&n` & ` @A@`  @& `2 㿘 㿘@f  :` n 0 @& @e  0w 㿘@e  :  B 0 `& @eǐ >c 㿘 >M@  _` !> @e!\>Lb|.`!\`@e06  㿘a   ݒ  `@ 8` 2   & ` & D6  ,& L& P& X>& Tb& H㿘` `*` 7:` C`(  (`0``2`  `@$ L$ `(`0``$@3 (`0```D D@@A  ``D` $`@$`X4`$`T$` @@3   $`4 $`  㿘 >M@  `Ű !> @e !\>Lb|.`!\`@e 0 6 && 6 & 㿘$@  @ 8(`0``2"*`1:` / "    @& (0+$ & ̔ &d$ @& 2 $*`:`    @&  (`0``"    D@? D @&  @ @?& &$ $㿐`'H`> 0  (`0``H > P'bc2  沂b"`> p*`C:`$@ V"   M &` H  (`0``$&` ( H D@ &`@?A`DG&` &`  H 8&`  H`@?%@ ` &` H'H 'H4  >cL 㿘_` "@ 6  @8@ `"  "& ` `@(0&` `@$` @ ̖    2 ``%(`0``& `@$` ` @$ `" `" $ >cL 㿘`> ̐&    @& 3& *`c:` 2 } (`0``" 6   0@>q6 & 6 (`0``2D&& & @& (`0`` @& 㿘'   @? 㿘>M!>8ax#>  %aŻaaŧ ؐ <!1>MŞ 㿐   !>M! #\>7` +  #>Ūa>8aǎ !>N <#h   #\>"`#h > aah> JbX>M+>8ax` >`t2    #\ |a` آ` @㿘  $`&@`*`:` ]@   (`0``D  @>$@$ @` @4@@`2` ` $( ` &8$` ` @8`@@>@(@`2@`*`d:` ($@ޔ (`0``2$@ 7$ @ 4@  7  (`0`` @&% 㿘`> `> 2 >!@ &@`4 2 >! Ͽ @8 @  & 뀦  㿐V' a  O$  F'>N    2  ` 0` [( (`0``2(` `@ @$ `$@@ $@@ $ @  $ &@ @<פ %` 㿘 (`0```! @@ ` @&@R`  @`@ @  D P@@ @ @h&@5@`  *`l:` W`"    (`0``F (`0``$    4    0@` @0``" $ 2 `"$Ր1 㿘@a9 @<. & & & @a#㿘@a& & & & 㿘@a! $ $ $ @a "@"  `@2  (`0`@ 2 (`0`@  2 "  @㿘>Nch@c&  `6 㿘 @& @ 2@ >NK#h  (`0`26 㿘``4>:!>N@ #hW` " 2 2  㿘  * *`2 2`ߔ   * @;2㿘`    72 "& "$  @6 @` 㿘 'H>!H 2 Z(`0`    T@@ H@ `?@  @8 `̀ @8D@`  *`r:` Q      *`:`  s(`0``swm& `2H & &'H 2 @Z &;H`2`  @  C @& bH`@@` @*@@"  H@;)@  @& >'H *`:` ` `(`0```32  &` `H@:@   @& ``  @ ` @J&` &@&'HH&Ho (@aHo&(@gHp@㿘 `   @㿘 (`0``* - `>`0`     `` `6 > bȀ@> > b> b̀@&6 4㿘 `>`0`    㿘 `>`0`   㿘| (`0`` 9` % `>`0`    z㿘 (`0``$ -X (`0`` ` (`0`` 8̐ 2 8 `>`0`   N `""  ` 2" $" `"" $㿘`D`(`8`( (`0``"> > bb&`HP> b&`H ,&` 8& ,`6 8 㿘 D`( |$ |@2   |` 4  D `(P: ((`0`` " 8 ?@2 8 (`0`" (``  <`"h @8` 2 @ ( 㿘 D`( $ @2   ` Ă4  D`(2(`8`8`" (" ,2(`@ 㿘 < @ D  x㿈?c@  `Ւ``А *   " W4% "R "M 4FH @ @; +" 52 A"; X&9 40 h"!&$ 8!E"x[   (`0``   (`8`n  `(`8`f @ (`8`a  (`0` [6 8 `W @2  ƃ(`0` &` >8`'@]: ''@=>8M`'`,  `: *`"7"3``.*:@ `(`8`` ` `   `$&`  @8+& 9  - *&  *㿈'P?c@  `"  *`` # >`0`w* 0A?`"K@5300 0 ``D#!2Ӱ *`!2ʰ * "ð  `2İ `c4 6   ` @`(4  `@` -   `@` "%2s  -2k /X(`0``u @ o 7@> i 7U$(`0`` b \@ \ 7P@+ V 7B$\;$5$h@  `A @7<U !7`2! 44 `"& *`"" *" *``!*: @P `  ``  @P  * >1` 㿘@  P Ȁ` ̟@ X  P@6 (`0`` @ Ր0A6 p@  6 (`0`` P 6  P <@6 @7 <(`0`` 6 & |Y` (`0`` ```@@㿘`  `` `  > `0`    㿀'H'X `'&@ 2'X  (`0`a2``2 D >`0` `    @ c`    "92& '' P' (0``" ` #@ &  6  l `2r P:m h*  `@"f X8b `2^ (`0``2X 8(`0``"   2O`^\6 8(`0`  2B P`N (`8``"7(`0``2122  ` (`0``"3 9` **`) # 6 (`0``6 @͐V 2$x " Ȃ`  (`0`` `" PH`   H . @& P (`8```" ` T @& T `& ` (`0``H P & `H & l$ l& l]'"  P    'E @& P (`8```" ` T @& T `& ` (`0``" P & `& l$$  l ` "' ``2'\'`  ``` l` ' `   (`8``` `'` (`0`a2ab2b '(`8``쀠`"  "   H6    @@8$`$g ˔I'$&  @B` (`0``2``" PO'  @& P (`8```" ` T @& T `& ` (`0`` P & ` && l$& l "$  & t& l& p& t@'  &  @ $ $  P T @ & P& T H```2  @` & H `@O6 M `"* `@H  8(``Q (`0`` L`@J " l 6 (`0`` X6 Ĩ  2 `` `)` ` (`0``"`ʀ`0 ``"  "  ` (`0`` ```2'@`! 2  & l& p& t`"& t (`0``" ` >0  @ ``` (`0``  6 (`0``6 Ot `2X"  @   # 6 (`0`` 6 2㿘 (0``>!؂6 (`0`h  ` (`0``   5 `>`0`   㿘 ` (`0`` `@  @I b1>O @㿘 (`0`` @#    @ڐ   `G  (`0``"1 `2 ( 2)  (`0``"#  (`0`aa2>  * : ! 2   6a%>8 (`0`` `  `>`0`   `" (0``>U!r6 r㿘>`0`L  E +`H(`8`@; )= >ON @ "  2" " " $ q̐ 2!@ 6!@`&!@` &!@ `&!@`& @`,& &@  `6&@㿐>O#\ @> b  w  D`(! 49 : ((`0`" 8 ?@2 8 (`0`" (`` 2  < ` (`0``  <`" @8`  2 @ ( 㿈 'P` 'H@ (`0``@ 8`  (`8```P  Ă`   `@`   ` ``````'Ă@?``''ă(0``" `W #@ʐ "QP44S(`0`a -8(`0` W48#2 ` (`0``" H2 E 9`2> '  @#@4`2$`"   2 @   `@`  (<9 @ ` 1!.` ऀ6%!`"Đ #4ă(`0``4@`?4 2PbݐP `h P`   i " " ,    ' *@a'@'$@ l((`0``@`hP`h>Map( @@@$(%4`%P`2 6  @$$ %P @A `  􀠠 P`0 `L   2`8 ?4 P`H>0@F 'P  ` _`ͤ  ?@44ă(`0``" P4PP  p k `2 "` 0 `"`2 0 2 `"`2 2`"`(`("`, @` ``    0 00  202 (` , `,  ` , (  " " `> bЀ@0 (`@*`"  @    㿘>Max`P`L. .  d@z"@ > J!>M  P d* * @z @ L@. > J b. .  d@z@ !>M  P d* * @z L@ > J b> Jb㿘 ǰ 7 " 㿘 "' &   @&(`8`` `"    @&  & (`0``P & G 2  `& $& 㿘``h>?"  o  `(  ( (`0``2   @/& `$ $ $㿘  A ? 2  2>"@5 (  @" "  @& (`8``5`4   @0&  @& (`8```"   @&  &  (`0`` P & ˲&@`€ 0&  (`0`` P &  "&  `" & "  2& $& `"& $㿘  `㿘& & 㿘 ǰ 7  P’ 2 h$ `$ \ $ h `2 ($   @ $ հ 7㿘 >N"H` @2    ! 4G #@&(`8```"   @&  a& (`0``"P& ` &(`8```"   @&  a& (`0``" $P&  $`"&  `& & $ 㿘 ` (` 0``@`" $@`2`J``((`88`  $@9@6& $"8& (`0``22&"8/&뇐8*&`((`88`2!& `` @.&@`  @& ` @&`(`8``` ` @& 짐'& & ` @&`(`8```"  ` @&  a& `(`0``"``P& `@&@6``2``"1>@6"X` (`8```2"  @"(`8```"   @"  a" (`0``"P" "`"" $!` "(0``2``2`$@`5 @"(`8```"   @"  a" (`0``" $P"  $`""  `" $` "(0``2``2`@㿘  & $` $"" $(`0``"@`ʞ@㿘Ho(@a:`(`4&`4Q&`4Hp@(`0`bD<@ 㿘> 8 bp6 8@? a`  8(0``@(0``  6 8 4 8 :(`0``@*@?> a" 42`>bx ` 2 ޞ@ `2 Ӟ@㿘  6h06 ɐˁ㿘  6`86 㿘!>M!x P d(`(`"@wG" L@o 2 0 4(`8`((88(@S />O 4@ "L  6<@DX66 & 6 6& <& & & & & & @& D6 q6  $\h& @ & 6 & \& h6  `>`0`     `@  Jp6 @6  㿘  ``6 ֒   ,`6' P 6& 㿘@ (`0``2>"@  ` @@   ! 4@Y W Ē  R@ $ @@+`2$@$&(`8```"   @&  a& (`0``"P& ` &(`8```"   @&  a& (`0``" $P&  $`"&  `& & $  Ho (@aHp@  ah"㿐` '` ͔ 㿘 @ah@ ``j  `  @r    ah 㿘 L   (`8`` &&  `" 㿘` g`   ꁔ( (`0``鴰 7 $ q 騐$@ (@㿐@ ( (`0``  9 ` L2` E  앐  `   @  ``V ` L鿐㿐@r 0`   `(_  `   @  ``  ` KҒ`醐㿈@'8 A` ` `Ԕ  )'``(`x ` `쀠" `" ` 8'`찒 `  ` K 㿐``r' "@ s  ;`h. ` `   ``  t( (`0``  7`  f` `$ ``(` 7 ` K2㿐@ `C`( ` K`''   ''''''' '؀ ؄`' *`(؂  #\Ȗ   ؀@o?  #j؂$'`  2  ''耢  R耦 &ٔ  G`2 `"-&쀤  &  쀦@` &s (  &@ @`" 2 $@& `0@8`0 H8`@C9 H  ` Ji "쀢 p`p "` rƔ!  c  "`'```` '`@'܂ ?'''԰8`C  >p  r!3$0 (   c `耢 '*! @ '  `' @*b˒ h'U   ''Ȃ ''''' 'a ؄`[' *`G  O`"'F 9  Ar? 6`(ؔȖ 7 ؀@?  #" 2  { ذ &' 8@9 8 P8`@C9 P  ` If 8`s  4oΐ  qÔ!)$& (   b 耢" `*R  `@''Gܠ@*b p`o "` q!```'` @'܂ ''''''԰x`0/@`@??ςc' ` @`ْ谒 ,cTܐKQ  0`0` > c `K> `( h0`0`  ` `(  `(`(e谒 2E```2` [谒 ;` ﶔ  4䀈@ ! `"~@"~ `@, , ` Hr, , ` HebH H’'HH'耢 b쀢 㿐'n "@ p! ( (`0`aa  % ` H ``  2>  8 (`0`aa ` H帰 $' 6>b  (`!0``  8(``  84 8(`0` 4  ` Gϒ ??" 㿈'P'X  Ӕ  % `(@  6(`,  (`0``2  (`0` 2(``2 2 @? 5(`0``  54 8!> U  2(`` 8(``"  8(`0` 4 8 (`0``'aӐIє  `(a "  6 0hܒ  2(``aFGaȐ    2 |>h"N֒  0` `0> c  `(J 2,PK ",ayFGaa0  b~`@, , ` FX 䗐 `% FԒ` ?τ c `>7c@   ``@>7c㿐@) `.`( ` F㿐`m? "@ o ! ``   `(9 ` Fw㿈`@' l `, nܔ!`ڐHؔ谒   ``(` &'@@?`0 0` > c `@?ϒ.@ `EېF` (쀈@   b~`@, , ` F &D`plH\,㿘?#c(`8``2 ` ( @2 `2 0``$  @  2  ބ >:>9bԒ`   >O"`, 2` (`8`` !,`#!,,` , ,` @ &㿘  %>O `$  `" " ( E$( @&㿘>O`>:a   >O a, ,2,> %>:bd#>O>9c0 `" $ ,a, $a,"$`2! " , `(8$ , (" @2  (`0``"lN 2 ,a,`2 >:a  &^ߖ >:a  2  ,`2  !  `  2  (`8``` ( "??<@ Ef < &]ڔ >O a  ``` "` `  "` > bԂ@#@㿐 ````?c2B @ 9 >Oa(>8` 0` @mw@,.`  Ġ$ + (`0`` ]  @#b (⺐ (`0`` ]t 7@#M ]k  $@ .`$ `@ '>O+c@D' '5  @2 / @",  (`8```2$" ? ` ` (`$(֐ '   ( (>O  㿘 `0`>`0` 0` + (  ]ʖ `` `    (`8``` ( ``  `@8`  &@ `^k , MN` / F - ?@`C`? (Eg`^c ,``@@(` `@``( `@В   >O  !(!!(&,@"a %& `^3 ,` \x @(`8```  ` @ m@㿘  0& (`8````$  2 $ @2  0  `N$  ` `F㿘68` &  \ H㿘@((`88` @ )` (`8``` `2>0    T"P` `u /` `i`j ,o  @!T h g  ' D'܂ '?'''@X X `R &@ @5ߖ J T`F =@@((`88`= )` ` (`0``3`(`0``"0 =Ւ "* =```  沖 Ӕ$ @ `$ $@`$ (@`,$ ` ` $ ,`$$@!^  `$ c@ Ő 㿘 `"  `T @"0&  `"   6   6r `- >Oa(`  H [J [F  `r` ``h<  8 / ` @" ha ⺐   j`@!&` `` `(@ '܂?'''''@ ,Ā @6Ȁ@!ΐ0@ R@!ɐװ 0(@ '((ȃ(`0`8a',@4Ӓİ ߿$" T$@ `$$@` $(@`,$ @6$, 㿘 ` X` H(`8`` `` >> b>  b> b> b"  H  Z 7 "$   8㿘`  @ `  `  `2 - ``2 `>.`>9@  8 (߰ `2۰ ٰ pӰCΰʰ dܐİ @(`8`` ` >`" >"  " `P``" "   k @(8`` `4>`"0` `T 8! N  `"H 9  @> b`PȖ  7  "2 . `(`0``" % !  P 2  `(8`` P% `b ` P$`$`貴   9 : "4 0  5* `&`?&  2  8>Oa < @8a  8 @> &(>@>0&H&8 >   >_" - _Z -Ho$(@eHp@ 0>c" 0 0@ 0?c" 0 0?c" 0 0" (@" 0>ObȄ` `` `$`( `,`H `L`P>O `T 0`X0 ` ` `( `H `P `X `\ >Oa0>a` 4 08@8`' ((` 0(` >Ob@@   0 "@   ( ` 9   ` ;@  >OaH` ` 9 @ c 8`>OaH```@ c 8`@8``>Oa0 ` $ `$"`  $ @㿘   7``5 @f& 4@,@ *@ 2 4>/">a`88@d> ` $ `$&` $    0@@! ! 0$ ! $$ @$$ 㿘>a` 4 08@8`, ((` 0(` >ObȐ`   0 @& 0 0? (c & 0>O @ 9 aH`@ C B8`: & >OaH``` B 8`@8``>Oa0&   & $  @$ 㿘. .  @>OȢ@?c?c>a>) =cC 0@? ` $ `$$`$ $  0 4@& 0 0 (@& 088 0@& 0 (`& ((`(`!  @ @ C 9<  0&   & $  @$ ` À`( "`㿘   ?`` 㿘>O bȅ,, @ ( @ , @ ,,㿘X>c }Ɩ  0aU 0b 0 }$ 0 0d  @ " 3?Ȑ <@YX  0h@?- 0` 0" 0@U@㿘 0`  0`& 0#@F 0`" 0@3@㿐> 7@k!/>``>a>8! 9 8 @ 8b`+>8 #! a` ! 8`@e8 @g d%a@g#a* @&%aa>O c(4`  d, ,`@@'>O@fB $$ܒ d* * @g>O d  d #>Oa@`&fa$a@a@@8$a@a@?#\   $a@!>O !>c !@a@ᨃ80`@8`0(`>O8 a8>O@f ba>O @ <㿘 "      >O !H@@9!H 1>O5!㿘Z 0 0h& 0 0h- ` >Oa``@ 0`"  0& 0 @̐ <@ 0@ &  0?c& 0{>O 0?c& 0@ 0@ >O 0?c& 0{>OĀ`{ >Oc0`!>OaH>O`a<8` ` @>OaH`p >O `t`"#0{q#0㿘 0a>#  0 \a& 0 " 8Ւ ` >Oa``@ 01 @ >O 0 ?c$ 0@~>OaHaH  0 0 0@2 ( @9 @9 ( 0`@  0 $ 0 0`* 0?c$ 0{ 㿘 0` 0`& 0r@v>`0`` `D> 00``@ (`(` > /b`O`0$`0`0a$`0㿘  `2(T` 0@ ` >O $`@  " p @9 @9 p>OaH` `0`C @8` 8`0 0 0?ނb& 0 @H  >`0``  H` H 0@& 0@1 \ 8 㿘 L `2`4@$`8`0d" 0l 0    U= `0`a`0?c$`0zD㿘>Oa܀&!>O>a>8 a@d&>O$!<aH @, <@  <`8`` @>OaH``>Oa8 ` 8`4>O>O@ >OaH`p >O`t`y#,h㿘 W``>OaH``>Oa8 ` 8`4>O>O@>OaH`p4 >>O`t`>>Oy#,>a``>Oc(>8a@(0p>Oh @ <@>O>aH1>O!<F@8`2 >O@>Oq >OaH >Oa<@D8`4>2 p@> p`4#>8`> t`>8>`0`>Q`H>Oa>8>Oy_#,>O#0>` "#0 0#0>8a8`4 >O`@(%>O>O>   @ z%`%>O蠒 !Pc!?$ $ 8$ @$ D d  h < x@A< p<@-  > >Z#P 0$ h$ $ 0 > ""􀠠$   >OaH!"@8aH$ >a`@*@ 0@$ 0@G 0@$ 0^㿘    " > cp <X3@:?@b * 0` 0@& 0y.   0h>OaH`@@8`@ 0` & 0[@t 㿘   0a 0 @@" 0>OaH`(`8`C @8`(@.8`8>`0`` " z `2 ( T`  2  x@: x@: 㿘`\  $ y 2 .@  &B㿘 '7㿈 >'a`(F` @.2 `耠'쀠 @@b  S  㢒,@# @< E$  . @?0h 0?  R 0W? ސ,@$@>O> aH ` % `(8`8`C @8`(8`8@ `0 h@ 0@B8`x@# `4 `8@ `H@ ``@8@ 8`h@`$`ׂ 0 `D: x" L>C" 0`"  ( 8`C @= (@-= 8>`0`` 㿘>O1>8a!>Oa@$@&$$!$@ ?㿘>`0`>O a>Oc,>b>O'>OaH>O aȨ 0/>O;>O->O+  ${a0``8 ` 8`4 `poa0@m `p`4 0`ea0`t`b 0`$0w  w Ra0` ` 8`4`p@`p` ``t`  @b 0h" 0&` 0@` @  0@$ 0: @a0. ` r)a0 2`0 0 H`" 0 P` T `T>OcX ` P T @>OaH`p`HC?8`p@8`H㿘 h `>& `a& h>O& laH  D@P@" 0``D @=` 4,@8@8`@醄㿘>Oc8%>Od@D  8c8@M>a` >O!H d6@@C 9 & 4& `> h㿘 4@  H@@?,"@& 4㿘 P` T `T>OcX ` T P >OaH`p@8`p H 4& H@? 0>Oh!㿘 H & H 0`"  4>OaH`H@8`H 4@> `` w =  0`& H P` T `T>OcX ` T P >OaH`p@ 8`p 0>O& 0D`Du D 0@>O& 0XX& P` PX `T! >O cXcX& T>OaH`p @8`p㿘 H` >O!H H>O@9 H& PcX`>O& T` P  pD `@9 p Du"D 0& 0㿘 H`2] P >O>O#`c@ >O>OaH`p@8`p@0!#`cX>`0>O!>OaH)>Q>'>Ocx#D`ve$#DX H  `p` `#D`t`#D#D"> a'> h `@@$ 8 ,@`@ 48@@ ,@& H` T `T>OcX ` P T @>OaH`p@8`p>OaH`H@8`H 0`" 0@㿐> ch>O cXcX `>a ,#\5>O &`#`` ?@y*? `>V#>O6  c@>OaH 8`h8`p>O1>O #H cd@ |` <` `"`"; `@ 2 ``  `` "`2  " #`    ! !   `  2  "! = " `2 ` ! 2@ 2 ``  `` "`2  " #`    ! !   `  2  "!  `"`" `ڀ 2j`2 "``"` ``` `@2  ""` `"` `"```"````2`2      ` ! 2  " ! `` "` ``"` ``` `@2  ""`h 2 "``"` ``` `@2  ""` `"`2-``"E```"A`"`2``2 `     ` ! 2  " ! `` "` ``"` ``` `@2  ""`   "`2 "2 `2"㿘``8 6 `"   $`"&`@2$`$` @" `@- `"&@2  `` ` ``````$`"&`@2$`$`ɔ  " ` "      " ` "     6   `㿐>P>P ` `#\ ` >O>#hc X   㿘> b`"2&@  \  "` `, $>P` `2`(>P`H`@@8`@ `8(`8` 8`9&@ "@z&&@ `H`H@8`H&@?㿘 0`" ` >P` ` >P  `  ` >P` `  >P @ @ (   X ( X`" 0  0"2 4$2- (")`2% 8(`8`4   :(`8``.2   9(`8``.>O ` $ `$ ` $ >O#h @ 㿘>P ```(@2 2 (>P `` `(@2x 2 (㿘 \m \  Xe X >P` `& $  & $ 8 `8(`(8`8 9>^`0`9"㿘      㿘     @>`0`&@> b` `$ >P`H`(@8`(?(`/ؕ:@mْА X 2 >P`H` @8` ?&>P 0`2(`$`>P >P`H`@8`    >P " `` " ` ``H`@8` 4@>P`H`@8` >P    @""  @  0@`$@ A ' @'\@& @  :>P `@2'  @' "@]?cK& @  `@"   @',@&`$@'!>P@; H`@8`>P`H`@8`@   `@}?@'  v?c & H@< H&@ 3?̤ 㿘       &`&`&`&`6  $㿘> b``>P`>8`>P` >P` ">#>O ؐ##>O ch" 0  $" 4 $(&`,&`(.`8:@A`9 X` X@ Ӑ X  ch1>P&@&` @>P `1  `.>P`8(`8`4 ` `:(`8``.2  `>P`9(`8``.>P `&` &`$ @` $ `>P&`&` @ >P @`` ! @>P`@>8`>P` }㿘` `` + @ `* K? "  " `  ,8`D ڐ , % 㿘\`D )    `@``2뢄````   0`ۑ1 0`ɢ`%Ţ`㿈 p  &`&` &`&`&` &`&`` `"`(`@2`(2`( 8` x: @ :@ 2`( |@"``(@@Z`8` ?`V'` 8``D @@XH< 2#\@2#\`E 2 #\2#\@#\#`"D  (`@%̒ `e * J4 +` 8#\#`H  8/( +J K>` 8D@W8`@  x@%G   x | |&`  x>`>`>``&` >`o>`>`:`@ @  #\ #``&` D>`ސ>` x>` "   `"  8@ `2 @     (`8``` >  b H   @`@2" ( ?`2 " , 㿘 @d>P  >Bc 㿘 `>`0` T "    @ɒ 2 @!8  h-a" ab& > oX  & @ @2  2 "@  2 T h2 T~& @ 㿐$   >P> c#\@, L> > c c `@  $@DDDEE$GGHHIdI㿘 $`0 `0& (0, m  $2,㿘'``Ĵ  `? "  `7   ??2 "&  @  @ 2  @ (  ?2 "& @ 4 @   @   & |'  @   z   @ ?e?  ` @]$??K    2D  (A    23 (0  ) ? >@ ?  4   8 2> >#耦 =    㿐 '@(`8``"  (`8``2   2  㿘ߐ   6`6` >@ 2 2 &`&` @ ` >` 8&`6` 㿘 4Kݲ 1>P" 2!㿘KӐ `"` > cc(`  >P`! ? " 4㿘 `@ 2   @ 2  `&` @> `2 4 `2  4 &` C?& >  @ n @`&` @< ` $& @$ ,> $ $$ (㿐 @ "I '>O9ah?`8= (`@  @     "  ! `   n  @:  '  @ :  C  㿐  (`8``` `(-> a ,> ac(`0`  @: #' @(`0``@! ` (`0``@  ` H d@@ & "`( (`8` 2`( f6 6 `(& & ,& 0 @$`(lӖ    ,` 0 `0 ( 0 , &  2'>O a      * @@` @&  (`8``2  (`8``2   0` ((`88`2      @ & @T8`Q (`8``2(`8``2O`` 0 `0 ( , 0 ,  (! ! ,! 0 @& ($ 2 ,` ` '& ` U & `  @8`'r `"  @&  @8`   㿘`(`8`\>`0]`$@2X @C Q?`?@@G 2@B`2 a@   77`a@ ` M@ ` ,`@> > & & `& 6 & $ $6& (?`@`, & 8  07ΐʐ 㿐>P#\!> @`   㿘?c & @!b>@(``  > @S  "?IF `(`$`A @ `@2$ (`$`2"`(`$`2@2@ `ڐ@ m  `@ b @  @ x&@㿐 , (8`  ( 0" ," ,  , ?@& & ,&  @ ޔ <(`8``/%;(`8``/"   @& <& ``u (``; `2 ,i  , & @& ,/   <& D(`8``" `/2 & @N ? & @& (`8``/2 ,(`8``/"  , @ & ,& & ? @& ,(`` , ?@@& , ,@@?߄@& , @`2 , <(`8``.2  ,(`8``. ,@?@& , ,@%? @>P@2`& & @ ,` ,a?'`(@ `@ @ , ?@& & ,& @% " D2Ĥ ,Ħ    (`$`2" @}&  `@& D ,?@& , D   @& & D& (``2  ,@& , @ f 2` @< ` @@ Se@ & ``  `T ! ,aߐ@`` ,`@" ,  @ & & @`& , ,@" ,< @2  (  @ & < < (`8 + `(`$`' "   `(`$`2    ,@& 2 ,@ l  ,`2' @В !    @ @ @ @ Q  @ L& @ϐ& p 0 ,@& 4d (>P  & 8`@``8`ч$ E$ 2`8`2`, `8>P $`* $`$(`8``/"#@ $`($`$ `$`>Pa$``D" `8`8S 2`8`8@(`8``/2`#` )ǐ  `8>Pp  (`8`` ( ` `8>P _ @L ;@`>PШ` (``8>P L $`<$` Ɛ 2 `8`,2 `8>P7 $`,@@2`$` @`$Q$`$``H `8`0``4' $'''''''''@  ``1>P -`82`  c ?( `8` @r`8$`8(@``@@$``8@(`8``/`@ G`@ɐ ( >`8>Pѐ @ ;`@`$`2`8,$`$Ho$(@eHp@|`<` `"` "; ` @ 2@`  `` "`2  " #@   !!  `  2  "! = " ` 2 ` ! 2@ 2 `` `` "`2  " #`    ! !  `  2  "!  `" `" ` ڀ 2j ` 2 "` `"` ``` `@2  ""` `" ` `"`` `"``` `2` 2     ` ! 2  " ! ``  "` ``"` ``` `@2  ""`h 2 "` `"@ ``` `@2  ""` @" `2-` `"E`` `"A`" `2` `2 `     ` ! 2  " !@` "` @`"@ ``` `@2  ""`   " `2 " 2 @2" 㿘@`8`6`"   "`""@@2"`"@ @"@9`9 `""@2  @` ` ` `````` "`""@@2"`"@`  "` "    " ` "    6  ``p4 @8  4    8  2 p @ >P bx2 2㿐 > J`> 0a& `(`& (`` 0>Pbx', ?0``@(`@@' `'Ő  > J0b& ???" "" " `" d" X" H" 8" h" (" " " " : : : p: P: @: 0 (` ` 4" 8 8 8 8 4 ` " (``" 4` 4 8"``" 8 `" 㿘H  `& >PcX>Q`8 `2& , ,`& , `0  & 0 ,& 0 @ 1 ` `` `2  ,` 0 `0>Q`8 ` 0 , , " ,>PX" 0 @  `"   " ` ` ,` 0 `0>PcX ` 0 , , " ,>Q8" 0 @ 㿘  `@2 ` 4@  2 (㿈>_'''``@ . : >Q@P`?(`  2 @2" 2T  T``  h" @@`  @2   2  `"  2T 㿘 $a b `2 ``"  `@  $ $b2` >\`@ - `    㿘`  x`@  `0"````0`p`x``> P> `& l&> @> H& h`> X Z@t a Z@p !<al@l Z!a@h h㿘> cc  @j "      `   $@> c&` `2`>  c 㿘> cc  @B     `>  4 $` !@`(` @㿘 !Pc!       @&  0` . @ D`2+@ L$  P P L P @ D ``2>  T> `0@ 8```> `@Mג `@@`& @  $@& 㿘 2>I @!Pc! "  @   "  D`2  L ?&  P P P L `㿘``> P2&` `8? T` &`D @`&` @` & @ @&`㿘`   H `c$    H`㿘>`$`D 0`  0`>ߐ hLe @`0笐0 …`   `D`0㿘`( >  D`@̔  `H``D`>q ѐ>  ``'@`@ Op"`Dp`0Y`D E 2  p<  >` p`3p`&,0`0@&0b "`@㵐0`  Ȑ@n0;0h&0π `@` `D`> ` 逦㿘  H& H>   `& a H㿘  0 a`H`&`HŒ      @!Pc!& `     @` - >>bd` > >c|#㿘>`0`>9` @  c"`>`' `@)>  a"$ `0`0@`f?"` א䳐  ` > ``݀ `&"㿘``  @"0 /`I+  @ ! @a 2`.@@ "7  @@ !(`` 2 ` (@!`` 2`(@` `  㿘   >\@c ;ǔ & 㿘 ` @  1 ; 㿘X $bf `4Af ` $bT$ $Y ``US`Q 1` ;ԐXT`ƒ 2@X `@4,`` X\ɵ /` @4,`4A- 2$ ` `2  ` @C0 7 ` @ @" $`0 ;I 1㿘"j $|& $a  ~  $a& $㿐`U\" > c@" 2 -#\`, @` `/`+ -> c Z`+> c  ` `2` - ;, $@Ŕ $$$ Z$ $  $:ڐ7>O xZH 㿐? c. @@* @` @@; @`㿘 >`0`&  @ۓ @ ` `㿘  "  &  >a.!a & @@`  ? &  ` ?@@ @@  >! ` &  >`!0R> aT l& ) @ & & & _T㿘 a b5>& H `+   (`W `8BT">@ ` @` 2`T\>h! T@ ` @2 `2`  `2T> !P w! w&T 9 (&T 1&`-q `">Q>!`1`8`8,0 0 `,0>Q 88&,`,8 `0! >Q `8`8&0Uߐ!x>`0`l@㿘 h2 T  @@` ` `  2 ` "  2 T㿘 ` : 㿘@>`00`` `("   `"#  `2  ` "` `   > `Đ& r  `&` 㿘 >`0`&   @ 2 @6 `  `l㿘 a`H b&  > _   0` ``"  ` , 0>P cX 0 0>Q`8 ` , 0  &  ``&  @ "  `& `"㿘  `>`0M`>`>Q@P`?(`@ @2  @2 `k   2 2 T  (` ( `!  8Δ $ T"  T @ T  T ` T ` T ` `$ $ h$  h&  @ Ҕ  & & $ 㿘>OaH>`0`>Q`D8`  !> J"!> J"'>Q@`#>Q$"0@8`@ $`D$"@`D>Q`8`8">PcXcX"`ː >P#` >P"$"  \$ <$ X$ \>Q$ `@`$ @@@ݐ  , 0%` 0 `0$` , 0  $  `$ $ T$ $ $ & $ d$  > 6!&㿐?&@   > nİ &@$  ' &@>`bȔ >`bȔ >bH 㿘 ``> 8a``?``` `@8ʐ @ . 㿘>Pbx>`0>a> a>a` `@@L "     ` @ 2  `㿘Ho@>Ԑ">K`؀`2  >9  @  1> " 1>"0㿘>  c@  ` ``  7h"p z$ $ @$ $  $ $```$` $?c$ $ @n  /!,  Z ,!l Z & &㿐>8`>Q(#\ `D t   >P>#`b8 8>P "  >#\ؚb@>P>Q>P cX 8 xcX8x `  @㿘   p 4  8 2`@` `4 ? 2`p "`"`"@"` 6  "M `p4 @8  4    8  2 pHo$(@eHp@㿘> `> `>Q`L ` ? L" P P P P L  ?`@& > Jb@@(`@@`& L@ L P&@& P͑㿘> "P㿘 `2 ( @a   ` L" L P P L P  $ h$  㿘 ` (> `a  `$` ?$`$  @  @`$`@$`$I 㿐 >  .&   `> J `> J"b#"> `> J > J"08#b0`8 !"> `0#b@8`!""#"> JTb& 㿘Ho-4>Q(@n>Q`H  >G Hci/>  > ` 0@8`  > ` !  `  㿘>`0`>Q `H>G/> c+> >7> Jb`9> ;> -> ` %`(@)'%` W  !@ @>`>0 `"j ٔҐ`%؀ ([0 0㿘#> `!>Q  Ru L L> J` $`  `((0"@0`(㿈@  В '  (`8`` ( `"  `2 `? `  `" ``#`#\x  㿀@   +  (`8``$(``"! ``2 ```''􀠠?``  `" #`#\ C  㿈@  j '  (`8`` ( `"  `2 `? `  `" ``#`#\z  㿀@  9 +  (`8``$(``"! ``2 ```''􀠠?``  `" #`#\ E  㿘    (`8``   (``"  `" & !8'؂`&!8@' @'܂?''' !!@(@F !@`49   ```h@ ːP@'' @'܂?'''~   ( ` ```@h``F @ ? (`0``0  `,  ( `(` ''Ȃ ''''''@` ?`@8`  @ޔ ؂$@& `  @!@? >  (`8``28 ( `"3  `$ ` ` `` `   p@  2 @D"< &  < >@ @<@ `$ tȂ '`'''''̐ Ā @@Ȁ (A` '((ȃ(`0`8a@',@ ܒİ cā ``>e`@!8"!8`@>e`? ''5'''~'ܰ s``,,' 'l'h''p'lh " |@ H ``  @ @ @" @? "@Ð|@ g@ p  "@ b`^t>P  T>P Ӷ? ` ``>eb @!8?"!8`@>eb ?㿐@  `(@5 `@  @  ` k@ 2 (`0```6 (  @`` @֐ h>?`@ T @ M ` 0@`` B `(@ Ԑ`(`$`+ ??6 > c`?@h@  ls@h?h@'t'x'l@  @  ` !8```&!8@'?'''''9 5Ē @ `(`$`* ??6 > c`?@(@  ,s@(?(@'4'8',@ ɐȢD ``?(`'''''' 5Ē @ 6(`$`* ??6a > c`?a@(@ p ,s@(?(Ua@'4'8',@ j ```` >g`H@!8 "!8`@`>g`H?`?/ @Ĕ ( `(@ ސ`(`h`$` h`@o'l@ + @ $ ` ?+?( `?(`''''''[ Ē @  (`$`  (ܐa@',@   ` ``>gb@!8 "!8`@>gb? @ s`(``$`! 5 pa@p@  p` pa@'Ԗ@  ÐP?  `?(`'''''' Đ ` ``>h``@!8 "!8`@>h``?!8`&!8@'' @'܂?''' #Ē @ `` @ @ D @ ΐ  (7`@?H@ Mc㿘옐 2  `  a@ @@  L@ , P@'' D'' '܂?'א `&`㿐@ `(! ` `'P  4͠ @'' D'܂?''' ` `` `$` j$`h$` ﱐ` '20 'W>> 2>9  沂a&??  沂a ?? @ 0`(`$` !@@ ` 㿐 `( ` Ux`  b "@?''@ՔذX` L ??ȃ) )  @@(`+`'+` @@ (`?'@'АP?  `?(`''''''n ĐFx`   "` ?''` @`ՖذX!8`&!8`  ??) )  @@(`+`'+` @@ (`?'@'? ( '''''' ` a@'Ђ '''''''''@ s''@Ð  ` ``>ic@ `@`>ic?P@'' D'܂?'''ސ `@ İāР?&  `?(``'''''' Ĕ0@ u|Ā  36 2'a `@ >ja? ` ``>ja@`@ >ja?PK?H !@````"  3$@  " "   D''''''k  Ă@ (` 2 @@@  @ q $@3  ` ``>jb@`@ >jb?P: ' '؂ ''''# - `  Ȁ@" `! @Ȁ0@M؁@@؁900!8 "!8@>jc? ``>jc@!8 "!8@>jc?Ȓ >P{ΐ $ * 7 '؂ '''''鿐 )Ā`@3Āq (3 `((`0`8a',@>P}c  ``>k`@!8?"!8`>k`@P> `@ (`''''''m /`` '܂ '''''[ Ȁ`@Ā  0 @_| ```` >kbT@!8?"!8`@ >kbT?<  1 V`` `I  '''''ز 'ܰ <Ā' 쐐(``('(`0`8o@',2  - <2  '(  '(@WȀ  ȒĔ@0(``@ >kc !8 `"!8`@ >kc? ` ``>kc@!8"!8`@`>kc?x 1 *@ = #Ѱ F `` @ A ( ` 0@  ? $c$ 0` "8 0 #@   런 F `` @ X@  ` Ȓ ' !@0 ```@`Ӏbϰ  ,-20찒 @'@"@ `(@  R `` @ '  -@` ` d!@} dd `w  @n q@ ld(]'H'L@s \@7 T` ``  `0` 0` > ` `0( `(7'''؀` '܂ 77 ` ` @> ?  0@ "' @Д,` , @&&, , ` 0 F` ^ !, 0 /Ԡ *@'' D'?'''A   @g ('' (``$@ `ܔ 㿐 / ''͔ ` ``ǔ   `h h!В"8㿐@) (`(    `   0`@ ` r ? $c$ 0`P@'' @'܂?'''  (  0`@  ? $c$ 0`㾨` !8`&!8,a8`$a8+ ‚@"(`(( @''''''?$`80"   *2/ @  ?`8 ?R'@" h$`80 0` > ` 0. `(7''' ' 77 ` @א ? 0 @ؠ " a0L @c,` ,0`(`0``  (`$`  ` @   鈐'(',`@ " @(ߒ0 @'@, , ` e*  ` ``>na@ `@`>na?㿐 @հ B (`8``4 ( `0g @@ @@, " T0a 2 T`` @R` I T`  ? @ $㿘`@9a"8>P@bx`?c$ :`  0 `@  $@$ 0( "b8     2Հ``(&& & 㿘>Pbx``@` @H$ $ !@` @`@ $`@$ $Ր   ` @ 2 $ 㿐 `9 T ` @ >=>Đ"h`  @2 襤$  @2`蜤$ ``2`!>P!@2 莤$!㿘 $& $   ~ &  $` @` @ " @  `@ " @2 $`` O` >Pbx `    " " T ` ` `>B"1 "p'ڠ P@'' D'܂?'''R @ (``@ ,˒ "`$`$ `    `jX> ```, J`@ Zm  D'̂ '?''''  @4``켰 `(  $`t!@ `,h X,b +`  G@ $ x$ $!@@e :!@`Ā@,? /,9 "`(r `$`!@   ``[ @  > N c@ " `T 2= -`6   '#"p 5 $$ $ ?c$ $ @0 $ !@ `$  $" $$ $ $ >߂c ^ $ $` @@ 2 $> a<  $@"($`T $?|$ $ $?|c $ $$ $ $`     "$ $ Ӑ 2. >P`$$x$  @  @ $`p  0`@ `@  `T &G"p듐؝㿐 '`` -@㿈 '''`<` -@㿈 '?'`$` -@㿈 '?'`@` -@㿈 '?'`D` -@㿈 '?'` ` -@㿈 '?'`` -@㿈 '?'`,` -@㿈 '?'`|` -@㿈 '?'`T` -@㿈 '?'`` -@㿀 '??'`4` -@㿈 '?'`L` -@㿐 ?`` -@㿐 ?`p` -@㿈 '?'`(` -@㿈 '''`h` -@㿈 '''`8` -@㿀 '??'`l` -@㿈 '?'`t` -@㿈 '''`x` -@㿀 '''''`` -@㿈 '?'`X` -@㿈 '''`\` -@㿐 ?` ` -@㿐 ?`0` -@㿐 ?`d` -@㿈 '''@` -@㿈 '''`` -@x ''''?`` -@؁㿐 '`P` -@㿈`8 (`>r @$"& & '''`H` -@㿀 '''''`` -@㿐 ?``` -@㿐 '``` -@㿐 0 ' 02 >|" ``  -ӬӴӼ `" 㿐 #\ "@ `?>s` (㿘`@"` >`b a b & J  <  2 `(`  8`>rc ( ( ? (@`2 `" b@@p `$ @&a@`  @*:1 `a@aT` ` `ꊐ @ߒp F @g >`&` `t(`>t@     (0|x&`0 (&@@0 &`&`&`>`P>` &`(>`0&`8>`@&`H>``&`h>`X>tc4 (㿘 (``  (`0``  @   (`0``2 `2  `(` `$`"  @> @&@C >@_ 㿘 ( `@?  ` @   @> ` (`0``@ >*@$@@C >@$ p\l`'?'''' '''d h  Д  &` " 㿘` &  㿀 ,` ( 7''''7     *`ԓ:`㿘`& `' % # `aP`      =8  `  `  !&` &`  㿘 (`$`  8  (@`&   ` @L  2  0`@ddb;a  & (i& , L& ,ް ``2`p6'ph't`'```( {"``(``$`N$`h`t }@?`@`& (& ,y l`b -_ >@bX bd` `! J`d`D s ? ݖ 8d`pΐ'' % d`d{&$` &dɒ ` ! ` `&Ր 㿘>`0`Ӱ  ?*潐$&@@ $ K "$&@楐&@' &?$'L !@ d !@'(b'>b' ''''' p%&@@%H"8" !O    Ȯ!@ ?'''''''''̐Ѐ `1 `) +ؒ$(`0` ! @@2@`@2@L ` @ ` "@L @4` `"!@ 熐%  㿐\'D''` ` `>PaDD x <D'D@2 `Z' /V( @DD ``K $D!@ "!@A>(`'DD`5 D > D+D('DD`ؖ?   ' /(''D@? D& "DD z㿈` # "   Z',`4 #\ ; S   $@&@@ Hp@㿘 ` `ET` 2 `(`(` > 0a@ 㿘`T` 2 `(`(` > 0a,` -@㿘 `  D>OaȀ`"4 @4 `(`(` > /b@  `"  ` ``  ``"   c        㿘  T ` 2 `(`(` > 0a@ ? T` `  T@`00  0 (@)'( 㿘   㿐 T?` 0`@`Z  <` `8@`2 ` (@)  T,`` ?0?(0`#@@@`@* p@ 2  T  `@٧<`  ((@ H T` T0` `(`(`   > 0a@@  Ԑ H T<` ` (@)(   @ "  (  d" "`T `  $ dd$ 㿘>w7"㿘`T` 2 `2>(`(` > 0a  (`(` > /b    @ w"㿐 `T    #\ ؕ 㿘>`T"` ? ` @  22`v `    T ` >rb 㿘     T ` I T  `      T ` >rb 㿘 T  =` g>䦐 5``aT`"5`` ` 5`aT` `5``,`,` > 0a(`䀐 ,` aV ,`,` @> 0@`11 a2     ௚  a 0 3T 5` a*5``(`(` > /b1vF#    a2       ` 㿘`0Hod4D(@eD 0`  0`>v #(y͒%0  `>@   㿐`T`( ` $``4_`Z > 6b`/> 0`+> 0>>bd , ,  > 0a$`"? > 0D? 8   `G Y@ S> 0, a,  $`2(``$`(`b @ > 0a(>>bd`` , ,  > /b`  , ,  > /b@@  p  ` ``2> T ` 2 `(`(` > 0a@  ` >a'T> 0 a2 `65(( @> /@` `* `h@  # `   ( " ` 2  @,n( ` `   `8 Z'8 8`?T `ؚ@- D5` = @   @@ C  ?#`#\* TGT8` <z@)ԕ='@ % 8 H@:)b   `eTt#P 㿈 ```2>M T ` 2 `(`(` > 0a @ ܐ`` `` T` > 0a>a2 `5<(( @> /@` `* `h@  #< `   ( " ` 2  @+( ` ` <  < `<< ```, 4` < @@Ș <ΐ@)($ $8H@9}@  ŏ  ``x `sؐ#`   㿘>  cpb & A_   a㿘 `     @@ 㿘  ``4@㿘>s#㿘 >s# 㿘 ">s#``` ? 㿘> r#㿘      G 㿘` " 20d 0Ho$ (@e0đHp@ Ho&(@gHp@" `"`"` @>Q aT `"" 4" " " 4" " " 0 L8`: (:`" (@ 8`@ : ( (`  ` ,` >QaT@p2l㿘  `>QaP @2`,` @ `  @@   2&@` 2 &@ p t tpt  @>b$ x㿘 \`& \  U   Q   M  ( I  , E ؁㿘` L d$ d@2  ѰY㿘>QaT@2p 2l x" lTT`" pT p t T" t O >Q㿘? 6 ذ   >  \`" " \  " L㿘  0 &   + & & & 㿐  $ -1> 9> !':) 􀠠> a耠4 '!!': `$ &! 㿘`  3> b`aܒ`   a㿘>QaPaP> 0+> 6a)>Q>~+b@&$b` @0`@& 2 `pl ޮ  `@ !T m  2 & L㿘    2" >q#" " " >QP" P  @" 㿘2 >q#耦 @߉&@  8>^cd 㿘" ( ,``@`=@& ,& (U#b.   ؐ`,`@ @ & ,& (3      㿘 8` . 8 @q     > #  `> q(2  `2&  ` @& 㿘  @" >Q aP@2@` @@`2`  $`$`$` @㿘>QaP @m 8 2 `"`  ( 2 ` `x@ `"$~$`$`$` @ 㿘=d H`  L` P T48 X}6 `& `㿘 ` 4 @$  2  4`& 4& & & & & ˠ  `&$` ` ` @0` ` :&  $>9 H@    & & & & $& & 㿈`<>a @  + =`%& 0 @ `8@2@L ( "?~ <`"``6` 2 0㿀''7' `@6㿐 ' >bx 㿀`(`0`` 2` @Œ` ``&7?a&` 77&`  ` ``&` &`㿈 >^ cd   =`$ 0 (@ɖ "?, <@ 2 0㿐` `  ``".*.`f .``i` ] .`W..   @@J   $@" ," `  2 (`0``5 7$ & 4ڒ , @g*%  @*!  `  @ܳ.@ܭ   @$ $   !"  㿘>QaT ?6 @ p 2 l `O@ǰ 㿘>QaT ?6 @"` p 2 l`(`8` > a&`L&`H \ d`$ \&` $ d $`>9cH$ $ 㿘>QaT ?6 @`A p 2 l  `v `  :`"  `"   $`>9cH$ ${ `e㿘>QaT ?6 @" ;p2l ;`P, J|@Ej@? qv@7f@4h.@@0 +/a@`&(bkbn@#  `w@bo@bbp@"8 bkbm@0b{@ bk@"H t@"[Df@"Uqi@v@h@L0@ s@@j@Bb@n|@"2 =~@".@x@. <bo@bn@`w@ P}@"   y@"}r@u@тp@@ق@ۂz@}w@"L  `v@؂g@>~@bl@t 0 bm@mbf@0b{@HZ`] &`> a耠&8z$  &u$  2 L80`& 8`  @`  ,8#`` { `|. v  M>8`ܒ@"8`>8 @$` c$ `"Ӱ ? >8 `ܰ @%? > @%ג>8`&0&4& ,:  66 @ $D  ,;- @ ,< `,= $@ `"$ ?$ $H $P!@`$T!@`$X   `  $LL &  㾐>QaT ?6 @"  p 2 l  `d(`0`` 2 `  ,  `t @(`| (" ( D`` /Ho`4aL(@aaL @F㿘>QaT ?6 @"``p`2`l``& ``! `\` `$`\ `$`2N$`$>9cHJ$`$H$`$`2 `:`2:`  `"` `2,`` H`$@:`!9Ĕ ? #d2````2 `T۰ ` $`$`$`$` $` >%>9`8``"`ɐ``1`$`$` 2$`44X " G"@ @: ` @" @ ` ` `((`) ' /  @ `) "` `2 @ @ @   ((`)   ` (`()  ` `(`(@(@@  " "@ @: ` @" @(`@(`0`  "  @@( a> a > z`(`0``8 (`@`@" ``"f`` 2r  ^`"``2i `R@ ``(P` `@"J````"E`4` `>`02L 8``4`p`P2`2@ /`2-```2(` ` `` `0`" ` `@2%  `@ @ 0 @ : @ : ` @ 2*`@(`0````? P @1 @ ??   (`0``5"6 Q`\`"3 $`%`"U ``" * ``2`  ` ` ``2U  +`2O 8 "  `%`-`" ` `@`2> "l`$28 # `- `0`(c`,2- _`42'  `\(`|`E" `M`="䀢`@`<2  \`D2  ݀`M `P`Hl`L2 `T2  `|``d"  `l```a2  ΀`t2  ` ``&`2ܐ $\`2֐ j W 5  *M@Ć`   :N=<  @& ` @ @ ```((`)   @& `8 @ M`2   @ (`@(`0` *@w` r  :@*@e` `! :@`ݡ(` (`@(`@ (`@ (`@     8  :    "  "  (` !0  *2"ְ @!  *2  Ho (@aHo&(@gHp@H`@"㿘!> "` `$`  hT h"2 Ё>   `" ` " >QX` X   >Q @X X>9cH>Q a|㿘>9cH>Qa|>8`ܠ$ d@ T 4 > bX > b( x` d(0``! 2 H``" H2 d H`& H d~6 d(`0``"   d!X 7a؁ "` `"`  @" `` " `` @>9cH>Qa   >9cH!`>Qa!`  @(  @:   :   @  @  㿘>hQ H㿘! !@* h d(`0`d h`"!T `  `> b `    h" h!T@``" " h>  "   @ >Q!>Qa@ā㿘 e& 㿘 @[ >9cH& && & 㿐 В @ '**Ɣ  p Д (@.`@֖ ' @Lϒ >9 >QcH! `>Q\` \>Q!!!`>Ɂ` 㿘m!` b(` 6 b(``>8>8!@?`b㿘S 4 ,%WxH d` !X 76 da d!X`76 d a  `"  ``2 @,  2> bX``@q  `@t  ,+ @}`   d!X76 da 㿘`@>g9 X@&`   \     -  >c|   .\@㿘> b@ՙ "  $    $  ! !X`!@@`2` 㿘> b@s "  $  $` 㿘> b@a    8㿈> b@R "  $ 2. `   `&  2 !  耤`8' ''' @d`8|       㿈 `$`   `& 2   耤 8' '''@@5?M   `  ` x@ > "2  @` 2&@ "` FG 8@*  '''' 27@?/   ) @  @@ә  @ (  2 @ @ @@ 2 ՠ?   @ @&@㿈>QaX &`$     4> b 耦 " '''' @ԙ?  `   㿘~  @!>L bp`@@, $!``2`,s㿘d> b  c㿘 $@"   2 `  `& (   @ 2         ` `$`( (> b ` `$`( @     㿘!   &!㿘  , #   @  & & & & $& >  $& ( @ 㿘@(`` @@ ?(`8``/`9  $@Ӡ 2   2              > b@Ӏ "  $           `$ $$`$@  $` @$ $($( @$(h> b>`@M "  $  '>` "'   / '''/ @   4 >r`̔ >@҅ @ @  4 >_` 㿘 &    & & &  \ & ," ,  `  T & 0" 0  `  L & 4" 4  `  D  &!@  ? &!H&!D㿘!` 8 8@0 q @`   `` # *,  @*,  q,  `4  p, &!㿘!` d!h) @h` h l !&! ?) 㿘@& 0 (ˁ㿘 d `36 d@&>Qax@y!D>`=@㿘 d 3u6 d    !` !h0) @h` h l !@&! ?) @&Gxw% > b؃(`0``" Ɛ d!X4 d7!X@  2 dd㿘 `4`h+  @б >Q  2` ax  `@"`h2`8{&`4&`h@ `& &`8㿘 #' ` <` `@28 " " @`d(`0``" @@ ( `@v 2 `  @ @@(`` ``  * @   2㿘 #`8`` ``   `& @o`8&`8 >c0 㿘@> b @2``d(`0``"`` `@2   `@    2``2`| 㿘@> b*@2'`!`  `@2  @ `d(`0``"   "   " @ْ    2``2`| 㿘@L> b 0@2- '  @2"``     @ @@(```   * "@  "```2@  2 |㿘  Ѓ(`` 8J "H (`8``A  `0>  (``29> b @2@ 2 $`/ 2` %@ @,`,`?Є    Ф(8 ``2&@ 㿘     `` - d(`0``" ``@㿐|     @    (0a$@ Saz@8 0ay@bU@``04ax@ 0  a@T0 @@L09 T@0000" \0     / Za@@0!0 Za@@w0|@w]0yh y aJ@>`d@J0 @"{2@1@:-@@@26 @@1I#@@  @@x@2 0da@ϐ8 a@2 0aF@ aF@2  @"a<'5@~@"L`x@H@2 ;6@"@`t b@`8 aX@2 נ@"aX0 @"@$@2  a>a@w0 @2 `a6@0aK@2 aX `h 6 `pr  < `d(`0``(`0``2 9?(`0``"`d(`0``2 &f,`daXa?bR {4`dv7  (`0`` " @v(`0`` `h` @'`h`  (`0`` 2@`h(`8`@@"$`hB7 ʒ ^78$`x`t  SaX`F@`t@%@"7  >aX`1@` @@ΰ, @   @d 27` @@, @Ε @7(`0`  @ Д @΅ Mܰ f  7 27a<7* @ˑ2 @54a<  N  ,a>`| & ?  @N 23@E @O> "@+`|7"`d(`0``7@Z@*@ur@.'aX@ n$`|    aX@^7 "Y7  aX@ "H7 Β baW`S`O `p`  8``` bP@  @@aX @a 2_7`$` @7`d(`0``.e``ʐ  - ֐ _7㿘q d{!@6 d>b&!T>`x&!`6&!X>!D8`쩐@@*0>R" @-g@t `  `> b `   @ h`" $ `  `> b `   @ $`% `2    ,@$    ,   0   4  !@  !D  >Lbp (`@a`"   2 0@ i  `> (`0` 㿈v`) ݨ>`0 `:@`, 2 !H0 @  2  Ő㿘@  (`0` , | (2 ``   LB> @` > @ L   > X"$>Qa3> 7bD㿘``!` !h 2!# !!&`@/ 7!&`(`@al2  ah`@(`@ al!`$!`f$! <`@ ,0`b<  Ȇ@< CR 㿘> \?c \ > bX> b> b\?c   \   > > b\]j  (`2>  b\6 `> b` " $`" > bX>  bX:(> ( bX & 3> b ,`@-b ٔ &b $& $& (>`> b\> (` !`>L!&!>Lbp`"!@Y!@>4`c!D>cd6g @?㿘> &  &  @ w㿘x> & `  `! >  bb$ a㿘1>Q>!``3ݔ >  7_ >Q  a>\֐  !`㿘 ``%   ``@```1>@ܒ# `@``#@Д  ߁㿘$  >9 >Q !f*@>Q@GacH>Q a|㿘+  >9 >Q !N*@>Q@/acH>Q a|Ho&(@gHp@> Jb>a  :0` ( (` (  ( > a@(`0(`0 2 > `>a0   0 (`@0@(`(2  *  >b|? >bА?㿘 ``(`A / @7 `   > @sbh> *bp.@ ^.` .``.`.` .` ` 3 ` 3 ` 3 ` 3 > @Jbx> b @D .`.@ .` .` .` @2.`㿈;  bX @  2  @ȹ  2  % `$  "       7 b\&b\@ȓ  b`&b` 4㿈 O $`耈`2bX  @f  2  @_  2  `$   7   7& 6 @ț  & & bX`& bX  &bXbX& b\`&b\@,  b``&b` 4 2  1:d 2     -$ 8  t (`` s@$@ 㿘4!H   &!H"  ]"X 7 㿘 ?."P? > J."Q?."R": ."S!"."U."T㿘"P`  . q. p . r>`X%&!L& t  l >a" !H" `&!H& '! q "P @&"X  L豗 㿘`  @`""` d(`0`h2 > !`   @~ > "`@w  `ab6` @> `(`0``k` c,  d(`0`a , "P@Y  [, 0` `5db*b (" d(` > `> >c<b`(`0``;> 5b d(`0``3@"1 -%+``&`"(`0`@`@$85  ǔ   `@^  P P 㿐 d(`0``A`Ap 2 `bP```"? C`8.`?`86@"a "` #U (`0`a4(`d(`0`h/`?`,  沖 r !@-?ᰒ b݁ @   > /X 0@N(  O 7  4 @ @ Ӑ``d` "`d㿘 2@ 1@ @ d@" `@16 d >bP& t  㿘`(`0``>Y! L "  ` d(`0``" `  `(`0`&`,h#`" zh@# `@? A  @< `@8`C<  8 > >  b`>X ؐU /cK 7    @< ` @8`C< 㿘>Qax   ["P 㿘"P   - 8 >W $`t?`4`d>bx$aX>c $aL $@,`p,`q ` ,`r!>Q$!x!xe01`L  ° 㿘1>  Ɛ" >Xx!m" " "" " " " "  8   @2 2>  b 2(@`(@  㿘  0`@2  $ &   є   㿘 q`om0a50 a6" "` ` [`" @2 &@& H&&`  &`&`&`&`@  `2@` `$   ;     .*   `$. W &`  㿘    2" >W!" " " "   @& 㿘. 2 & 8 >V"`` 2&   ђ 2& >Ww"(㿘  `㿘 > @XbP>Q  a>WZ"@㿘'>Q +)@H`(@$@@ @?3@\ጀ ‌`Ho&(@gHp@㾈"h`8?`@% ?@ĉ aX2@      "x  㾈`"h"x 8' `8@]  82??!X@``8aX??1@  㿈"h` AX`:@Ԕ  2``@͔  2`x@ 2   !X @a2 "      "  㿈"h 4K!  L A`TX$  @z 2  @s  2 `@ǐx`$x `$xx$!X @a1 "   ʔ w㿘 d(`0`a"`"hN  " `` "hB "&" "h ss `* s>c: 㿘"h`O"` d~6 d"|" ""| "` aH"2$aH2@ " d `0x"`4u"` . s!$"h$"%$ $ t  (( @ 4"T$"P 㿘`p` +h@2 aHr.(`00`@ aH$`>bЀ   c $  "  `$h``<```t$t$$t$`d?` 4da:4d`` "va$v (a0"a$a  `  *`*`@ `@/@ P@@* 4r`0 >$`4 >$(v"(`0>Q>Qaa`` aH @&aH >Q!,0(``$|!|(` b! (`$!(`$㿀>`0 `2@@@1@ @"h@780@ !"h!@@c `"F  d`6 d``2> @ "P@¢  `"0 `-$,  @8( & t M   r (``2h `d(`0``"`d`db4`d  (`0` ` Ґ `d`@F4`d @¹ "h 8 >SQ"r73 "h`"Ѱ )"h`ɰ ̒"h` v㿈>b@ ``(`0``  >Qa?*a,`"0``? a d ` `8`  2`@<   6`&>Qa>Qa`&(`0`.`@0`o`?.`@>Qa,`(`02b|br(`0`2 b|bv(`0`" `db|`2bhؐ@<؃(`0`A`A `2`d(`0`a"`2`bP@  "`+ (0``  6` 4 @ } ~ 㿀 ha!h!`   2 L   (`@ ah al$ !&!d L ピ d(`0``A`A" @ `@$> ϐ! ``8`?` v(`0`@  r  ` ( 4 !4 &   `7v( 7r }v7   "     4 K "  @> @> 㿘 5H " @㿘" Ӕ  $ ""x$`  8>Q۔`>@j"`?• `?a4"v>aP$!T>c$!X $!/  , r㿘   >Q>Q  a> 鲐!   >Q>Q  a>R"h1> 频"  @(``"   (``6  (``"   (``"   (``6  @ ` @ `"@    ((`88`'@?   * (`` * ` "  (``  * `? ` `2> Jb    @@(``"    *  㿘@` o      ) +`8`8  * `2  `8``4" -`8`  (`8`4   4  2 '`"  (`8`4   *`" ` 2`@m "  2 2:`  ( 0 * ` 8@ " ( "?2㿘@`   ((`88`  *  :&& ? @(``8`` ` @@(``"`` (`8`@` ` @@(`` &`&` $ "  @@(``2" " "  (`8`8 (`8``&    (`8`2"``(``" "`  ` " @ *   " "` " " "` `2 `㿘 @w @2  `` ` 㿘 (``6 2   ` (``6  `  l@   2 `ސ 㿘  p@> JbԒ   * *` $ 8 P2`$ @' > Jb&& \>aH& >b& >c<& >bD& >c&  㿘`   p  j $Ƒ㿐 #\>Q !  >J b>Lbp>Q("4!" b` 3> P9b ɖ > J  b>">Qb> J b؄> J b*  ?>Q ! >"P@㿘@    @S:  @0`㿘` (`8`@?``" (`8`  ͐   2 `?۰ 㿘 `?\`2(  `) @"  `> b耠`G$ > Oc    >@ cHO?$ $ @> Ocp  `!$ { 2 2 ``">QG!`"߰  `@ >Oqc `Ѱ? 㿘>Q E!   > O]cȁ 2 *  `" "  " 㿘 " (`(`88. 1" @" `  ``2 $ `  ` (`8`@`  &   Հ`` (`8`@6 2 "㿘  (`.8`ߐ )4 (`8`@&/ @41 `" `"   `@"$  `" 3> N̓c`@ `$ &k   2  2H$㿐>Qb@4" @&>Q > Jb> Jbؐ `@<!> J"Д$@@6"А" (``"" 1> " @6&" >Qa` " @ 6#> J"@ #> Jb&" ,'>Q᠐@ @   T`!>Qb  0^ bД 0@᠔@` @ >N?`     `"   ( 8`  82>`x@((`88`   "(`@86  `. 㿘`   @G$ `H  "|  z @2  2n `` 2  @"` &&& ` `  `K`L "@2  `7$  (``>Q`2`* @2 `$` `"` E ``2  a @ `  2`  >>`HXM    .  (  㿐  `  0 ` ?& 6 .      `& @6 . `  ?  A㿘`   ` "  1@ ` 2  `  @2   `2 㿘 M" "    @  `(`0``@㿘   7> b$> b( >Q$  `@4 4 `$ ` $ $@P8 Hp@>Q b 㿘 ` \ -   `r p Ho `(@a`_>.`>@Y -`(`0``S NuJ  `"F 90 K?  `9 8$ `3 9` `@* ($ a3    -     "  9 @P&  >L[ xxΐ㿐>Qb#'TT'X'H'L'P'J `(`0`` 2D @((`00`2; (`0`"  `(`0`2/  "  @Z 2%  @P 2  bz   Pv x}   2    Pa }xd  (`` `l  㿘@~`  / @㿘`@o   / @`  㿘`@[   `@ " `2 㿘`@H   @ " ` 㿘`@3   @   ` >K|  /@@Ho (@aHp@> b, >Qb*   `>R`(`> b, >Qb(  > b,>Qb* @  㿘   >Qb.   -" > b0*  2 (`0`@22( 㿘> b%>  |   #   $ `,@`  `>>`8,* 2 "> b0(`0` ,`" ,  > b0 `   >b$  2 ( *@ @*` @@  ` @ *  * ">_` 㿘. 6   >  b0(`0`@2   2(   "@Ԑ ".`.@`@: 㿘(``Q> b0@ 2  , (`($ ,0  `   (,(00`@",00cP& 0    @  ,4 (` $ ,$$  @ $$> b0`$ ` ` ((`0` 㿘>`>Q!b"     `  `  `    ` IA H 2 㿘> a H> a؅9  @ )> X@% "     `  `  `    ` >H >QA">Q 2 >Q "?ڰ 7 <`H" " (" " " $" "   $`H `H" ""   & ` 㿘 2 >I!` + 㿘 p4& p h`0 `+`>Q>It! 1>H! M 8 " t t* 2  0      1>QAK#㿐#> b8` >IF!H  0 #\>Q>"BϚap>Q!> J b"> /`<"!  $b8㿘> b8`     >Q"" " " ⌰" `⌂   & 0  @@[  0  t'''* c2  4'`a 8'' 4 h@  Pw'  @@5'# "' ' ha" p`" p  8@ ' p `$ p  hb  0 `$ p ` >Q ` ` `  @@' @ C 2㿘`h`  J`p`4D&`p`h`&`@ " `@ h`2`@&`@`@``0  +&`@`@ h`` 4@" hְ A&`@ h`"' X > a؀4 2 '@('@ `@  A㿘@` ```0` @` ``(`0   7 ) `0ﻔ $`0`0@`@ "`h$`@`h`" !  $`@```  `d`  d@$`d 㿘    2B  6`2* 2    b 1 2ؒ # p h" p ``@ 8 " ```@  7 2㿘     * ޸2  2 4ௐ  4`2  4  " 4䵒& 4 4`2+ 4 `  `"  @ `"  ` & 4  `  0`"  4 0 c& 4 4` ?́ 3P  @؂ /؂ /ِ / ``0`2&` `` R`E r`4``  K h"` `4 ` ` 2+  ha" @* @ " D$ @ D" hp$ D p h 8$ h` @>Q` & p``_$ p ha8 `"&`4&`48@&`h@v@`&`0&`t* *2 &`,`4`# ʀ`4 a>`` @  7 ` ` >Q@>Q <#  1 7`0`,$ h, v$ l $ H 4 t ` `$ $ 8 1$ 4`8 `2 >E!x`8``"@ `8 `8 4 `$   P`P@Ҕ pv`, v p$ D` " `  >Q>9# vk "? J @h @Β` vU`"& h@"  @ D " @ @ " 0 0   힒 >Q =#`@" h p&`$ p ha"` ` ` X> ah>Qb>Qb<>Ha"     `  `$`    `"  @ @@  ` '  (`v[ =``$`D` "` @@ 8`@ 4 2`8 ``2`1 X>Qb>5a؀"     `  `&    `"  @ @@  ` '  (`v =F `& Df  2  "       Ҕ 0 '|` > `  ry 7 e `c , ,0` + " p" p   8@2  q@? A @K @''Ād'@'<ґ* R2  '`'@ `    􀦠ƒ @"p@ p` `:&p pА0 '  | !>@ @'@'Ād'!'!<ґ*  2 `' '@ `, 0` D 0􀦠-p8&p>>"bHC8`` @8&8 &4  `&  @@ T X 'D @@D D''0 'h'v4 @  Dp`` pD㿘 4@  h ! # 㿘 h@ D ` @5   `@.  P\j 3 o   '@ " 0 @2 @   8@E  A > h: `" h@`  h A`. `!" ` <  @@''''''  8f>Qbh ` " hf>Q  b  `` '@ ` >Q` "`$  @@Ԑ''''Д@  2 㿘>Qb    Φ !>Lbp>R ``"   $ * @  2 %>Q` `  $ 㿘  ``> b,@8>Q`   땰    뎖 ,  꼰 %>Q !> ",@*",!>Q"@* ꥔ " ꡔ >Q$ b>  b,>Q␅.`@`۰ >Qb @㿐 x   >Q>#b(R  % `@1>Lbp  `",2 >Q (b >BŐ"0㿘 ``2   `>ʔ @Ӓc    d(`0```| " h@  ݒ`  㿘 ``2   `>ʔ @c  d(`0```|   h@  / ѐ\\\ּּּHo (@aHp@  `"`:㿘 @{ , (8@`  ` `` *㿘 @^ 8 &` &` >`>@㿘 @ &` &  `     ``^ , ` (@@&` ``` @@   , `(&# `'  ` @6   O  錔  ' '  ` ' @ `  @  6.6. X  @@ؐ> bs" a``(`0`2j`a '̒  q``"` "'` `4'```p4 `| 4 `d (`8`@$ $ `w. E`@&`'0` `2) ' ' <'```" ` `4  ``0   $  `v` `@&`    ͐ '''``2` x a `] ؒ @O   ''܂ ''䀦` '   p0>`0``ah ؂`I(`>X@> `aи  @2  / +  %퀤`0% `.!>Q  n 27h X  7}ZV -  ' @@& (( "@"&0@`2`` h`` `  v `@2 W `@P  @ @  0  4'' '! 8'' d(`0``" t' t֑* 2  '  4``%` " ` ` ( h P$  v`,  p$ @ 4``4 4 $ u` "`&`@&` 㿘    &  ` 2 `O   l  E  l”( (`0`` k 4  & & & ,@* ,`@ (@ @@&@``` o[  "l-  ߃, ,`4@4`,` 㿘 4`   >   PbL  4 $ 4vl>8`@  ʓ㿘`  T"6 k  1 , "0 #  ` @&`0  `@?  &`8  *kX 0  l  '"   `0l  '"  `8   * 㿘ۢ`] `F`t   <>$`a >`0``  " ` 杔  (`h0``$ 8>R` `> >R` > bL>R$  `) ``@;4` 4`7  `P`X`d``! 42* &$ 4   (`0```>R >R >R  ͚ `㿐 T'T'X'H'L'P'>Qb #`(`0`` 2@`@((`00`2@`(`0`" ``(`0``"`2r@` " ` @ 2h@` "   @ 2^@  "*`4`0  (@@"P@ *`8(`88`8`4?"`4 (`0` " `4 (`0`22@`4`2.@ ) bl  "#` d ` X P! 4!$   Px   4` 4_ jy`t`@`2q` ! d ` X P! 4!$   PP   4` 47 0tejL㿘>R`` ` Ē 8 `4  @ 4 5> 3> 7> b\L6`<X>R 8`` `0   @@'a' ' '؀ `` 0 $>  b\   `|0`2`1 1 > > > b\L<㿘>R`` ` o  p `4  | 4  d (`8`$  h@$ $ 3> 5> b\7> 6`L<㿘>R`` `!`H @  0@ `0>  b\0 03> 5> 7> b\L<(L'L'P'T'X'H'' H' `m͒  J 7 (`0``2 >="X`  (`0`@  ` +`_ h (  ֢ 7  hЖ>`0  (``,'  `7  (`0`@&ɢ  8Ģ -( 8(@a -  u   (`0` 2   `2 z 2}  2   ?c ' / ?`'  `?8 `   `( @" 8  @@ ' * 2 Y `D'``#8A `#9 `5 "  `2 2 ' `` (`>l@`  􀢠P $ ( p p`v`/ `4``7 `h'  2 `p`''`p   /t " `p`'`p "` ``?`?2Т ̀ X` '`0'`'`t* ]2 ''' `0" `4" '`8@'d(`0``"'`8`'`7    ט (`0`$  㫔  2 7*@?2 \    `h' (' ,' `v`P` (/ s' `0 ˶  @ԒŶ@  ``"  X  " `8@" `` @`8'`8  `$ '`4 "  $`h ('`h $ (6`P`4``7 `v`/ `h' `8` `` @ " `t* q2 ې 7`ty`` $`v(@'`` 8 $ @'``/     `" ' `@' ```> b\0`"``(`0``@ >R`` `4 `  Ⱄ g 24  * 2j  " gq  (`0` @e9 ⊔  > > > b\LI<   4   7 2 6>b"`㿈 g  7 $$   $@ > @2b`?`57 ,  4(4  ,  "P4  @  @ @ / /a4!L@ 㿘>R``- >R `>R  `>R `#>8>bp`ܐ0`  : #>R??>R`>R `  3>R` &@>R`&㿐ɒ㿈 g   : $$  |`$(  $@ > @b`(7 4 4` , (4  ,  @ @`@4``4`4`4` / /a4!L@ 㿈'@?@ '7 / '' /`  p hd& p 0``"  <`  @  㿘  ˰ > b@2  !`0 ` ` @@  2   2 |㿘  2 p>9"x`$ 4 0"  4`2  4(  h& h` `|Ahп , 5 .`0``- '@@ ` ``2<" 2 ``2<"2``"<20<bP@s   ` >  @gb`  В @2 > 9b0@2 ( А @!ǐ> 8b' (Ӡ`?  .` 0` 0`.` `"E 4 ``@$@ S  h" 4Ж @ ܐ`8> 8’b0@`8 @א  4| 8>&c8 @Ȑ n >8cx   < X@ А @ 4W 8>`8c8 0O ` `,`@#  X \"  h> a> b̆@ 8`@ < X h$ h `2 4"$  4`| $ ;>Rc`'`aL @@"!>R d$ c 2 .``.`0``"d֐@Ԕ   (  ?   4`p` `p` @ 0 ``@@ ̒@ @  5(5 @ @(7 / /aL@ 㿘  (`0`` 0``+>R`k`$& ,>R`1>R `2>R"P @  >R 0` `0` >R0` `0` & >R dS ` (`0``@(``@ (`0`@>a㿘> #,bԀ`8 h_  $ (`0``   @(`` : hJ  (`0`h@0db 2 㿘Ho 4> (@a> b##> >R``X a؀ 4   8 2 Hp@㿀'(`0`a> b` b"` / ^/ / `/ / /  '( chd  ` @ >!c<`" @ >` |  ` ' @ >`P6А C􀠠?0 ` @ ` @ڐ >`x> 6'X " `> a؀4 `2`d@(`d ``2`d " `d `` @@; (`0``9>Rc+  c>8a80`@8`6```  a` c' a` `' c $ 0`!>Ra  bX\@h h` ` > a X@>  \@/> a8`X` > b&`  8@`bP #h`` h>  Xb7>R@8`C9 X&` b&aW  #㿐>R`0``< `4 #\ >R     >/`> a؀!> Ja؆@8a!> J>"a "͒ `h`y  , s `` `&`h`h > " `h2`h> a؀ X>`X`h" `` ``` ``23> @`8 p3>5>8`5 ,``74`>R + &`< 3>5>`ȴ5 >R >R ` ! ` `h>Rd&`h$ $` `$   ``2 ` <`"&`X2&`\>Qax`8&`4 `& &`8>R "  `h&`<{!>R&`ha$ `  1>R-f l|||Ho (@aHp@㿘> J c `2 `b    2㿐 ``   9>R ! } $ *> #\"6 㿀 a֒  =>N`c` $` $`$`0( 0 (    `` $`$` (,   $ 4 @S4 `` $`$` > J c 7//#\  @# >R ` 㿘 "!>R``2  (`" `& ( $`2  ,``    & $ $! 2㿘#>Ra`C> b$a  A㿘 * ˻2 - $` 8@   d(`0``  ,``\ > Jc  c @ ! 8>b$ 2㿘> Jc @ 2  80    "> J" c " c 㿘> Jc ```((`00`@2 $`,`` ` 2  8 ? ` * F2  $$ > J $ $`,㿘 * 72   & $8 "& ( d(`0``2& (? ڐ  2& $ & (>R a& (㿘>R a> J  c a6 > J  c1>3>!2a ?((  (( " 㿐>R'T'X'L'P'H`  L' , Q, 0` @4  `' (`0``` @ :  dR 2  `'   @& @&  "  >R`  @& & ``̀`>Ra `' `d(`0`` 2-   ΐ" " 82% `9>R``2` `(`2` `@  2'`$ '`('!` `2@0<@8"( `'  @ꨐ " `>b )3>R``2%` `@" ` @@2` `$`8` (`@`(@( `  '`$ '`(&a '`$` `2@0>Ra `! `d(`0``<8@2S 2O  ?2````"(2`&  ```2  "" ( 20c>R`  $`" , Y`W U" $``O O" $>Ra `! `d(`0``D<8@2 "   `! _?2````"(2`&  ```2  "" ( 20>R`  $ (@`& " $@$4Ho (@aHp@<8   ?@`?`?*   (``"  @@*: `  2     8@@"*  * x `&& k * %2   ' / /!X @a2 `  `$     6~ 0x` ``2 @@ 2aX` `: 0 6ٟ  4 ,  , @ $  $ ``4 $ @*aXؐ @a1  6 0> <` `$ ` `&` &``:$ z 㿘 Sa L`3 `K >b  d(`0`` >aВ`H`ޞ@㿘 줒a   L`3 `왁 >`Ȓ 㿘 Ԑȩ h 3& h$` 矁㿘  ,  `` 0㿀ȁ`8 @@ !X`  @a @{ \8O`,`2`X` ?0 @@2??&`,`,&`\`,`X@&`( x&`$ d(`0``"  d`,2`(&`L0@&`L d(`0`` ``I`"v`H2 d] d(```h` 8`'Ґ&`h]:`"0` @ 8`(?`  `@?c8@*㿈 @ 0a@ @ (`0``@ -``22  @",80@"e  @2|: @Y@2s U #@ %!@R` a@d @2_ F``  ``2<2 a@2 `7 1 (`0``H`9  l   8" H"  X"    * 9* 8* Xd(`0``* H* I$`   (`0``%`  1 ``2<@"2  @80@"<d @2X0h@[@2Xt"@"#d # a@m!@2X @ %@2X `8d(`0``א`H@  (`0```X(`0``*`H @@ X`@  @`Hd(`0`` 2 2o,ے j$`,$`\  `9``2`8@   `< " 0 0`" d`X0@ `\ $`,d(`0``"d!`2 d`H  @ d(`0``"!`2 `H@x  Ǵ`  ,ɐ ,r |,e ~ ` @   - >.! @0a@@Ð - "` `2`"`2`"`2 `  @00a@,@ -    @@̐??@Ȓ ``"@ / / ka'    ` 0a@   ``2   0 @0  2B 1a@ 8 8@d(`0`` H@ H0 @l! \&&'   @x@a??x 8@d(`0``" X H@w H X X@s ai 㿘❐> b@2d(`0``"``2 <"L2 22| Ho&(@gHp@*`2```  >R* >R0a(@0 (@@a(0(0 (@@㿘 H & H㿘 " ``"`"`V&<@8@2"* ď2  " |2C 1 ``9 <  2 1 " h` `"&`" `4`2 .  .`" &I &&& " 1 4`"  1 8``<&  1㿘 H "  H h`2 H& H H`28 H H @\ $ @` `@``2+ H `  `   $`  (` . Q   . P@d X   P ("  H. Q . P P"  & L & H H㿘` &`  @   ,,  >4  8$ X H !  @& H@  h P'' 0 '  ' h 4T  h` v U 㿘 @` `@`2`@3T &`  @  ,,  <4  ($ 㿘 @f `X  H " l la@g3 @d 0@0  "     "      `  `  `    1>b,!Ȃ ,$<㿘 &&  ! & > !H   $ & >!h,'6 (& , ˑ ` 7L@S'  @T- L  @T'   @S  $ . 㿐\@/ 7 ٔ.@ ` @ 6 '` 2  >(`0`@2 `x la"  ,`2 0`2  4`2 8`` ,` `   `  , @آ " } `  `2  `2  @  `2@ `2 @ $`2@ (`@` `` ``` `"?` @  2I  <(`0`/@`20```2,```2(`` `%`"`a20  (`  @2&  <(`0`@  8`" @@`2 ```"  @6  `2'  J` 7P7X@R,'  @S<   @S6 P  @S0   @S* X  @S$   @R   . 㿘߶>¢c.0`>– -a"* >(`0`@2$ <(``2 ,@  2 `2 `2 $`2  (`2w "D@ 2 lT>– .-0`a"* >(`0`@2$ <(``2 ,@  2 `2 `2 $`2  (`2; "@ 2 l"    @`&@ `'@& @  㿘./ 67 ;a"8 @e  21 <(`0`@2+ >(`0`@2% ,@R  2 2@"    @`&@ `'@&  2 l` 7P7X@Q'  @R   @R P  @R    @R X  @Q   @Q   . 㿘ޑ>ba  .0`>b a2 >(`0`@2 <(``2 82  (`2` "6@ 2 lF>b .0`a2 >(`0`@2 <(``2 8@2  (`22 "@ 2 l"    @`&@ `'@& @㿘 ./ 67 <7a24 (@2/ <(`0`@2) >(`0`@2# 82 2@"    @`&@ `'@&  2 l㿘H       > *ؕ2`&   "&     @ la ݘ < >*+`23`  ,݉ < >*+`23` ( 8`& `"&  㿐    훐  핖    >  7 & & & & $>  "  )   $ 㿘 @` `@` `2 6 <>ʐ c@ 6 <& (6 <g @`(`0``㿐 @  (`3``  "@0 >(`` 8`"   (`0`` 3``` "x l ` `<8@` 2,"+. (. 6`&`&`  (`0`@. `2  (`8``.  F (`8``.  <`@. 0`"6`ԥ 2  Ѐ` #\>b a`  "   @ `Ѐ2 0 . #\3 >b a`Ӛ " ` @`(`8`@" 0`. $ 8 l`` > c> c e # "X > c> c ,`0`(0`@<(0`,`0`7$@4(>ba 8c(4((`0`@@: 4( (`. *`0`2`Ԑ 耤 #\ q ܀64 >4(>ba 8.(`4((`0`@ @( 4( (`. *`0`2` 耤 #\ < ܀4 >0   1㿈 @'` ``@>`0@0? la"` >'!`K  ``G /`(`0``A 1ܞ "  5   Hz 8 -`' >@+ '`  *3 2耢 " 8 0`2` >(``v 1"  1@$ 8`$ (`4 <㿐!> #`#\>b Ȑ!Ȕ   > Ia $#>b !Ӱ 7 ] $ , , , , $ @>`0``ah$ ` ``,*`` 0@&`,`ד*`@ `$  `&` > &@*$ 2a`$    ,$  < >*+`23` (_ 8`$ `"$ ` $`?$ `@`2$ !$ l$  㿘``&``"@2 2  @`   la  (㿀   #\ >%Ѐ   @ѐH    ݔ@P   `1  @ 8`(`@   @(`+@  #?? ؃(@`    $??($?>ɐa ?֮cA@`@ `@27` T :*/` K :`*2,`,`쀠@,`` %b "6 @_,`@%$l &$``  `  ր:  :* ր  @*@ >P>P>P>P>X>P>@>H>H>@>H>@>H>H>H>H>>BCC@$CC>`>l@XCCC@̃Ho (@aHp@㿈  @`(` @ ` @ `` F`B``(`0` @``* '0`(' '/ // 7 T    `T  QT 7 Or 2`>$ѐ! @1 4  4`  㿘 2 h>$"`` `(Z㿈 2 h>$"8``2$ `  @t`(@>bb`(( @@> (`@```( @ f`"& d㿘> a,> J> #˒aX`?@  @ / '/ {   h` `">   @@' 0'  'Ԕ 8 ں  P @ Pڲ> a>@` ڥ 㿐 '  ?.`0``2& `  d(`0`  `(` >2b 4`t>b (`0`  2 `' 4`t( d" `@8" d`"" d\㿘> a4 ڭ>  a\㿐`F @``/! ;> 볘a49> !\  a4`7%'!\ؔ0!a4 |'!\  >b!p#  *> #\!8맔 m㿈 T@ج *+` #@(㿐 `(`0 $#\b 6 $  @ 㿀   `'䀢   ?@@6= (' / '''/ ' X  h28ٯ2# ' / '''/ '>   >cT` TO A`P`8@ٌ8`P $ <?$ ,  (`쀦N `I@  ` O   $ `86  @#`   ( `( 8 ``D`2 $ @@O @$ $ ݢ@ ` 0 (@ `$ $ @( `|6  &@㿘  @``>b` `(c0ʄ ` `%(`"  * @`"`` ` ` `` ` ` `>b ` (`0`c`  "`>b` (`0``8  *   h8' O  r `(t( O( (`0``2k(Nc  @& >`("h1 >b.`@`` `*"` "*  `2 *2* 22*M  (`0``2    D쀠@: >"x! ,?& ,& `& & ?` >`. >NPNK   & ((`0``& >㿘   [ B @'L'P'T'X'HL ' ,  (`0` @``$>b`  $ @@ : RA }>b  @ " >b` @ (x@ >bc(̂` @ ```j(`>˄@`|>b(`>˄@        >bfb>b  (`0```#Rѐ`#>b``(`@&>b>b`<@8@"E>b``)2"܀`C>b`0@6`  `*`Qǒ@ 2  >b` `(`ܒ @X  /܂ /`'`>bb@(( @@> (`@`` (@`0` > a$`2[/@ (`0`c>bS/@> a(`> a$`` (`0`c`>bȂ` {>b 4/@'`6'` > a `` n>bܒ @  /܂ / (' '8܀  /@ \'` `2  `d(`0``` L ?' "  L'  (`0``>bR>bĐ` @( `  _' (`0``> Q> a0`[> a`W m>b`# ``(`@&>b>b`? ̒  @  @  @  //////`'`' ' ( #\ 쀢 > a4` >  (a\>`쀢 րI4 @ӐLu㿐> J(`?  (%@> Jc, * @, 0@4@?cc#> > Jc, a` (`0`@!@(`(44 (0 $a`GdIIIIIIIIIIIIIIIIIIIHpHGHHHIIHI,I,II,I,Ho (@aHp@p @`(`0`h" l  ?]W &@ l`"  l  ]J &@ l`"& l, ! 2 В @  /Ђ /р   `7///ՐВ  ]$ &@@`2 l`@"  l  ] &@ ld  '  #] &@㿐``- @`!8r&(`>ф@`>>bd` 9>    !  !>  !!` ;> a`> a'aa`OLla'a   ;> Ԙa9> !`9aӹ!>9>c   "9>c   "~ 9>c   !> b``#\   7>c   厙 &4 -> #\滐!ā -㿘#>cb?   >c $? ,  $ ,bՠ $?>cb` `8㾈 (`0`c  '' 2 >c(`J (`>c ( b? (`? "Ȑ$? ,  ,$  !>c"" Z $"     q   @ 7 I˨ 2 <'(`0`D8 D  I '' ,`4@20 `h`02, ` `"' > a`"" 2  (' 2 `8" ( ,2  `h`"`0 `    > a#\@? >c! @ | >c b(` ($``+ $,` , X "$  (   7   >cL `  L L   ט 0 O)㿘  @``(`"@u   @(0&   @& @ a`9Nݔ 0 ``,` J  &`` `(``& `(! , ,   @Ô  ``? : Nג 㿘``+ 4N    @0`$   `Nh 'H `(`'ȶ̠      ( @4 @ D"  2b  2> `"  `%@  @6  // ( '؀ ` 2ؤ @  '̒ˤ  @/Ւ/Ԑ@7    (  ` (ؐ '̒`ؐ$`<@  @<`-@@8@@ '( @ $@  @ِ /Ԃ / ('ؒ   (ؐ'̒  `<@  `l,$@ޔ 怠x倠u@0````(``R'g @Ô ````6V @`@P  @ H/Ԃ '/ "- <'`@9  @p ('؂ /Ԃ G/Հ "`/$ @'@} `/&4 Ȁ> a`H p      >cP` P  㿘 >c#> bHG    a$a 2 "     1>c!(㿘>c 2b)>c'> %> `$`# (`80`@8`?2`㿘>c#>cb`$ c 2 㿘>cc>c b`* ` `$`  2 !>c" $"с㿘  @ `(` $ ` $>c u!( *>c"` ` &` <.`  .` &` 6` &`&``  ` ``  ">c`+` 2` >c`   `((`00` 2 H>c ` `((`00`(@0 @`8>c (`0`@>c E> @0  @%0`(0`6  3` 0E& *GO    $>c%> bȀ   ```((`00`(@0@ʈ @2 ` `&` `&` `  & `& `& $`    (`0`@(`0`@2 `t?  `(`@$  >ch`  h#>cF&bf> b   [!F%!4`$ `$@"`` `@ >c>!(  `(` &   (`0(` &  2 & >c`F >c">    㿈  ('/ '''/   h  8u 2O < (`0`a`80@@"`| ?c@ K?c@F`|Ύ (@?`8c 0? c``2``< @ @) @  @% ``2@ > a`  @ "  a6  `d(`0``  㿘   `@(` ?υ(c0>c (`0``>cJ( 2  >c ` >cc ((`00`@2@` @2 @` @2@ ` @" @`2`    @(0``4 (0``">c` (>c``W `( 4 (`2`>cb> a'> `@$u d>c @"Ȅ d`4$d (`$ ,@`$@   `(`4 >c'>c4` 4 >bb@(( @@> (`@`  @ EY㿐 , >cbb b `8  I  2  `$ <@>cX` X0`(``8 >c` @( IZ 2  >c`  `"`d `2 $`d(`0``2 $>cp` p(`0``2 `>c bt`@&t " `j&(`0`@6 >c`_  >c`V  ` @2"@& & B`(  8 D '5 ,< 8@# b6  ```2    2>cb|8` | @(` (> a`>c(` ( D㿘> b`%C\ 㿐    #\>c>"bВ    #\>c>!(ybؐ  A  > >ݐ"c>b" b8((  ( @(` @@(` @(` )  !2) > ```#@ >b b@`2`4`(`8` "`4 `4; (( ( @(` @@(` @(` * 4@ *`> a>c c> ha>  a!>R !@> b0`(` ($@(`0` `>b>R a0`(`@ @  ( @ @(`0` ` >c>"@$b >c>"@b1>c3> !@cm0mnnHplxxxxxxxxxxxxxxxxxxxxxxxxxxxyyxyxy(y4uu u<uXutwdwdwdwdwdwdwdwdwdwdwdwdwdwdwdwdwdwdwdwdwdwduuu$uwduv㿐   @`` (`(`2@d" 7*   ` ``?7 ` ```     (0`(   F| 0 㿐 $(`0`"E $ 7 @`` (`` ` ` (01 0`@((`00`#@) 1 @@ @ @ (`0`0@?c8 7 ` ```" *0`(   F1  $0  $(`0```` >```P`!>4`l 4 $b` >```P` >0`V 0 $6 $M $}6 $㿘 沖 D   ` 4 `@*`4 㿘  . .(`0` 5 Ȳ 5ƕ 㿘 Cy   &   &  - " `  `* 52  2  &``" <  2  & " ` `* " ` `* 㿘`` (`쀠``2 .@  `4`"@@$@`4&@ ` 2.@㿈@? 5   5  < &@,,$ 444 ?`6 -(`>ل\@-  `2*@`2'4' / ''/耢  <@ 1 " d(``6  ` 4  `2 @,  `2@`8,  `<@8@2`' / '''/ 'T "Ȱ 1˯`4' / '''/]'쀢  <@ 1  1d(`` ) 0`, `((`00`@2  2  0 2 ) (`00`2 (`. 5͔ y *@ԕ2 5 $4 , $ f 7 `a4^  `Z<@8@2T` ' / '''/'耢 < <@2; 1  (` 0`" `@(`0(`0`@2   ,    逢  1 )  @@ (0`&4  1 ;a(``  5 @ 5 &@㿘 @l%` ` @bF`a`@:? ` &` @(` @ (``'`  `* &$``2` &` ,` @@$@`4 ` `,% @ 㿘>``0` 2 @ 䀦  " 6Զ -  %` 2˶ *0ȶ * $t €`0u " $  - * ` ``! *`^ P ` `?` !@* >ل@8, q`8 2, x`8 ,,  l&`$ l` l` l` l `@ lb}$ ld  ld{ lhw M ` `J`@` ` `?` l   l ` l ` 2$ l`Ӷ ` `+` @%  ah@ `Ւ  " $ ` ` ` ` @$  `"?!! + &"& *00$a  *^  $%  - 2~ *0b# 0m`!b q *@/ & `"W" `  "   @`@ & " ?`!8' (`>لp@  q x  l l0` l0` l 0` l 0` l0`  l0`  l0` `  / @r?  '"  l` ` @ (`   @?ڒ &  "  ?ђ  '"    ?ɒ  '"    㿘 ` (?0cH`@`2$ (`0`` D  @:&  ?  3  0@     & $$ & 6 $  >N&  c`@$ @    @& & & @   ` @ `& @4 㿘  `(`&>} (- >c b o7>  G>N$@ c` $ @h (c$ (@4  c<`N <$ $ ,`4` ``"  x`P`2 x $` 4 $ x`@' x4`  H `@' H (`0`@ %;͐$ 5 5 `5 ``" >c`P`2>c$`4$ >cx` x@ð 5 $=Ԥ2 7x `` c@$D4 =`c$8` 80`(` ` 3 `n2ܒ @q   h`  `("ǁ&`2   , , $`(& <8@2 " * 2  "`t```#2`2 &`>c`d`8`4`t`P@8`Ph`20 <@8@"n j <2ܒ @   h`  `("&`2   , , $`(& <8@2 " * 2  "`t```#2`2ǁ &`2>c`d`8`4`t`P@8`Ph`20 `2  <$  <8@2p`8` aa@4`   `, >cT A`(`0``d(``6 >c" `d(`0``2  >cT 3` T`2````"<2`$  ```2   2  `"   ` `d(`0``+c`P``$` 4`$x`@ x4 aL@A(`0`@">ch`" >c``2>c`td@8 d>cL (`. LJ '`0  $`aL@;`2` >cD` D܀܀  Ů;܁t4  Hp@㿘` f bk mdY ] 0 ZnQ `"S 0&   `( @`l&l  <04<2 ' " l`    & "  `(@ [` & <   '" ` @  -: 㿈'P'T'X'H'LP'``l`  ?c =l  R 7 `q`y(( 0 `x0`8  ?(4 ?c:7 ( @ @" ``  (`0`1 `(`6 :ː (``>cR7 >c\ "` \`& (``#\`H " A>c >āb#㿐 >c'c >  b+ `Z`(`0`` 2T``la2P`` (2H` `y"`8 2@``8"`(28``( 20`+ b<Ζ  "%lf @`(`0`h"@S@ POD :K:I'DZ@'``2`@"& lf @`(`0`h"@)@ P> Ob؀ : :D/@`    Ә >c: >cb`0`4 `0 `4㿘`   `` `>.`>@  -> 8#`(`0``  +Ho 4> (@a> b> bKՐ >c憒c -0k*`g(`y`(`0``a 9M ># 2ௐU  `P`M 1`(`0`@`  "@$ 8 K ": 1 6$ 8 `1 `. / NQ$ (( M$ `(`0`` 8 (" 9`K   G >#( 9P㿘 > (! `d(@ @(`>cc@! =4 $@4 $  t@z8!| @{ !|`` 4@z( <4 8   < @z (4   (@z4 pHo (@aHp@b4">` !@8 ) 8` @*`8 @2!@(``4!B 2!@!B(8` (8` 2!B(4 !D 2!B`(`(`2!B2!@!D"!8`(`0`@2 j`8 !@!B(`(8`8@8`2 l*`8`2 l 2 l2!N!|` `  ( taa 㿘``!     t ("`" t > " t t* ( t (> c 쀦*㿐 Y``   (  8X /<(`(0``@?@?8H  8 `   7>Nc`@`(0`ΰ 8(`(`0``Ő8( 7`\ $ x $ , Z 6`v4 ` @y|@y  ,Z(6`v 4(:` &`c( &` .`  &`D<6` .` .`(`0`.`.`@`0@`c&`(`0``" Y@B` !> c,T@! P!  Y``2 &&4 6`@6`(`0`0`,,. 26`"@! 6`` `| Y``` `4  `x> a`,  `q , &```(,00,, Y``1 /> a#\@ *  ` `4@# ,#\   @M `>Nc`$`$` $`$`,. $`(2@y7 Y 1 N;`㿐\7``+> a`c`Z ^` ZX``/`2L@ 2I@ `"D  h(`8``4> `@x 4` 67 24@ `"/  h(`8``4)  t`@& t``8  .!S 2@ `$@@xy `@xu  `"  h(`8``4   ta& t`&!Tc,&!\@&`4@ 㿘 ``& >> ``> ap(0* @ B ` ` >ap(0@* @Bc > c0@!>* !* $@@&@@2  X@w^ 2@@wW t 2֐ 2 2 L㿘u> x㿐> c0 >a ((!? @@ !?  #\>> c8   w 㿘 " 5 O& > c|Ȳ 㿘 `6    H(`(` >a    &       H(`(` >a0> 㿐* ঃ(0``ः(`0``6>ba@8a㿐  @`ϐɐ>ba@j8a㿘!dx]`2`&!d㿘 (`0``K (`0`` <>  > & b􀠀3>ba@ (8a > c@6 (0@(`(` &  (  &  `2 > b >8`ܠ 0`A`: 50 bap@8apY㿘>``2  YuG>uD ap> ` Y``2)& L X X``> v`>ap(0* @A,& L```> v`>ap(0@* @Ac & L L'> @a0* & H*  @>a> c8`(`0`@ >ba@'8a>`> c4*%& >bax@8ax 0((` @ @:`2 & 6 > c@(`(` &  (  &  `2 > bC >8`ܠ 0`@: ad`& ad &adad&& `>& ` @>ba`` $`@8a` `4`#  \`Dh X P d `\ @ve!> c  da|#\@?``'Ђ '7`༐#` 20? ` ~ `} ">ba@  8a਀ "&3&&P  >b`h`@ `h `@>  2  ?3̐@uX@@ut `&&&6td` `&6ଃ(`0`` `,tY%%@6ஂ?c4&D&PЂaaং`s6&TЂ```` c&ఆ@ 0``` ("Ѓ+@*&<@&ఒ&a>  bi`h`@`'`h'`@ ^a@?a 㿘 |> c "g!|` 4` (^  d  `1" $䀢$. @ +" N d(`0``2  t` `> a`" t @ "`" t " t t   t %`2 t"`@"` t  `" t t*  t @ > c*`44a2a2(`0`` @`* ؀8 @* @`tሀa4a0?> `p?$alc$ah(0 ,$`t@a ? *"$a c(``, a, 8$a "$a , a*, @8$a 4`p㿘 | pU`@ ,.` 0`, X?@|>ɒ> bВ C X?@j>> bЀ PC㿈\``˔ 2` ``!`?`D @ @` +?JFޒ  "`l la@a$ lw, w`$ 4 > `` ,`@sp 0 `~$ 8 $ `$ $`ߐ  H``   $@sY $` 3/  "`&` @s   0  la ޔ @ݒ 1͐1ɐ` D`D<`t`&t`@ 0`.S` `0`&t.R`(`0``ta&t@ &x 7@20x`T'>8&X`P8&T` &`&&&&6h&> &&c,&4> bܑ0`=ߑ: ݴ>` `*`.2``(``"``(``"`p(`0`& `&``&&&&lܓ*`0`:`=: ݃`D$  `4&Ԑ&`>bah@G8ah(  #\@ 184>ba?@8a㿘@@( `D@L(M`(L @"@r  & >&@`6 >#H㿘 | h(`8``W@ T   `@N>Pcp  `(`0`&  ` `` $`&     |" la" H "@R(`0``  1D̐`"  t` `@Š t@@;& t t?c& t 㿘> #p 2% `@` Ԁ0 ` `&  @>`0    `` @`@`2`, >```(`0` @@ "" >"  `! @ 8`@ 09 >%#p .q @&`@&` >"  Ȃ`! >@ ;`cp@ (9 ` @@`$$$ (0`@6 `   0.I` $ 0r@@`` `& `@ `2`$ 6` $`$ `& & $`$ `& $$` Ԁ2  ` Ԁaj>b`|'L'P'T'X'H `|L'7' (`0`c b 0``` 0 2  ` 5耢  `*> @ `  @'` 5   0  2   `2   ?c & `  ` ?c 2  `2  `2  `  `   $(`0`` 2) >`@ `! !0``!!0`   @ @ ( " >` 0`(` >` '|'B'   @5耢   : >#`@  >`  '`  '|` $  `2  @B` 2  `2  | '''|'  'xx (@'tt`P7'p'@'l``$>  (*+ 23 >  R h  >' h'  (*+ 23 G 20 > >`> 0``>  (*>2 ׀ h >'  (* h2ؘ 2 >` " D ` D`> `h(`` aP(`0`(@(`0` @(`0``5>   @p @p ` `> / / '/7 /' //@o7 // @o  7(`0``"`h`7`2> (@oa> a >@oat>a@o (`0``5> x8<>p2  l`t .>ut`#\ "g `D >S> b`2  ,@   "   `" )  ((`00`22` `22  @nȔ   @22>`. 4((`88`>|#`#\#h#df?>` 5> ,`h(`8``'a4>8`>``09ؑ: `8٬|#\ (#` 뀧`؀`"`h" `haX,  ''`h(`8``2cP 7`2_P؀ " aT܀@,VP `Ԁ2QP`"NP`@2JP`a2EP  a` `4  > c,'a\'aT `` `$/Pa `4*Pa `*%P`n(``2 P>ba a؀`" a8"a8> c,"@"  a< @`> c,"@Z ` >"  ` < ! @ `9 `| la H "@N>Ò`t" ah ap @`?c'`tah@*'ah -'``a2`4ː`0`>8`l`ܓ*`0`:`9: `Ր@U(`8`@`"`t@@7'`t`t?c'`t` `t2P@`Pd`X! 4@4P >"! `!! `Ԃ@ '`  `! @ 8`@ `9 `|" `tla" `tH "`t@N`t`2 `t> c$` 2`t "`t (`0``"`tR , " `tM , d(`0```t` '`t`2 `'`t>`LY`(`0`` ","`t`a,: a(>8`܂ @:a(@'a('a,@'a(*7@P`t@@6p'`t`t?c '`ta`Xd` #@ 8 8` @!'@&`h'`'a((`8`` 'a,` `2؀" >` `a `   ` `a `  *`@  =$#`  `@'`'`׮` '`*`E2``j(``$`t`p(`0`'a `t`܂`'`t'a 7'``` @`1>`@  7`h>8`>``07: `8ו`t````aSaR/aP/aQaa8"a > c,"@a `p(`0`'a  7`h `' `Ѐ@(  @)p `>Т`@ < 'D Ф 8 '` '`؂ `؀`" aT܀   @ `kl`'c @@@ '7؀`"& 2# aT" ܀@< a\> c, @Ҁ@ >'aT"!   `!!! :@ %9  `Ԗ @G ' (0`` 7  ߖ4 `t >"`t >`"'`t  `: @ !  9 "  `:! @ 9  @ ''  @ ' (0`@ $ ߂ 7 7 (`0``"``h(`8``$``" `@ Y>`  `Ԃ!@ @ )>bЀ`"ؙ9 C:`Ѐ` `Ԁ`t`'`t`"؅<  @ :ؐ(  @'؀`aT  a` `   @```4'aT'aT> c,'a\* a`" `h`Ԁ```h(`0` 8 (@ebp2 6`  =687`h> ` >2`h`tA`(`8`` >` ) `?%  7`h>8`>``06;: `8`t```` aSaR/aP/aQ (`0`(@א '` `!`4s`n` `ԀyaH t>`2 2k7`n`@U>b`&``"^7`n`n> `7`n(`8`@6`p`a (`0``2 @ ( 5'a$՜``p'a8 (`0`'`'a `X`@&X>`@Z`n`p* *`: 5Ǔ2`a$`$`'a '`$a `p(`0`@@'a ڀ`7`n> (`8`@&7`na$a @8'a 7`na >"@` `x!  ` `! ش"@ >@ ` 9 "a8> c,"@a8"  a< @`> c,"@ a2 `4(``t @'`t`2a >8`l`ܓ*`0`:`5Y: `-a `pa$(`0`5L@aP?c(@8`'a `|" la" H "@J `  @'`:0:` @'`@ x(`8`@`"`t`t@@3*'`t`t?c'`t`t" ah ap @`?c'`tah@*'ah `@'`'``h(`8``"( ``2K 3` 2E7>8A(`0``  = >8`>`T04Α: `PԢ )7`h"( @ 7`h>8`ܐ`P0`@:`*`*`ԏ @ < @*Һ`ܐ`P0`@:`*`*`z @ 4 `  - `  & `@" `2'`` 2 '``@('`>` '` aH'` @'`'aH`t @'`t "D` (`0`">``h(`8`` 48`P> Ђ@( 7 3 `؆ `$ '``P @@`&H`@60OaL/aL ((`00`@(`0`a2`؂ `4'``2`h`h(`8`  `Ԁr@`nl`t`!`> c$` 2`t "`t (`0``"`t , " `t , d(`0```t` '`t`2 `Ԃ`'`t>`LӴ`` >@"'`  ` ! @ 8`@ `9 `|" la" H "@I+(`0`` '`t%;kP`t@@1'`t`t? c'`t%z`t`'`t' "F`h(`8``$@` 4 `h;`t`Ԃ`'`t'``h(`8``" ` `2*  ` 2$>87`h7`h @ @7`h>8`ܐ`P0`@:`*`*`1 @ ; `ܐ`P0`@:`*`*`$ @ (`0``"`ta|` `2`t(`>:`(>:`t  `t `t> `# > c>> !c >`;`'`t`'`t@> b>> !b '`$`    (#\  " `'  ( #\  @&`!`|`@`(`0``a|` `(>:` (`>:`t v &㿘@!㿘 !@`!B>6#x!D((`88`(08& j> (c@82@  x x>8`ܐ0`@2:` W j(8`` 6 jH | t`@@ & t?c@& t! '> !4c, l (`8`*3  p(`0`-&! @& t' t?c& t> b  ''''   !   r h(`(`8> c@   6 j @< p     4& 6 j\  p *0`08'Ą ' @ *  d X ` P @"@4-`f@  t`" r@ * r (`0`@2 r t@"Q!| r(``2L!|!H0* 2D!| ! >`?!Q(@! ԅ* @0!@6-!|(`@ 6)!| t2%!|2"!|  @`4!|"!| @"!|   `2 4`26 jאz !|``` (p . ( <(   t#&  .  .7 @f" tz t`   "!R`@"  t!R@ @& t`2!02!0 `"!0!X!T> #,@B` &!, ` `  &!,!0(`0` @  'Ā"X t r(``"  2 `l`'`l! <`X`P `A '`P ?`X`H`D `A '`D?`H %L  >N``(` %\(`(`0``2`0O  $X` @ $` 'K  $@$~g p @< (`0`@ "43``h`'`h" `x` '`x @`$`t`p`'`p`'`t $  :>N``(` % (`(`0``2`$) p$`,$` x`2` > #``@f  x``   t`  !& 2  2  4`"! $  Ԁ$  @e 0`(`$ ,  X0`@  p(`0`@& !Q!  ?#+ @!@= 4    ?c >4 ` ,  & `$`4`$ r(`` 4`2R   & "    t`& & t ! ` & !8` &!> #,&!<&!8``'` `  >8 l`ܓ*`0`:`/: Ͽ 4`ϟ6 j ` ` 4` 6 j#0! `4&!@ (`0``"  | h`*`:` s  |`$`(!|```6``0 |``x( | `q( |> a @ #\* ϔH``؃(`0`0`, ,  `,  |@ ,  |``H#\  @9 ",!l7( p (`0`f&!   |@ג?_ A A22  t h(`8``$ t6!NN `"L>`L% @8&!l`@`'`@ t`` `'` $  t ! `4&! t Ԅ&!`& t& tĀ`"!  (`0`@ ' t>N`@$` !q$`$(`/ >N#`$` @r$`?*!Rc ` (@ *!R㾀 |%>;`Ѐ`' #>c$b!>@  b@x  $Р >@c`@l  |`>@g  |`<@b !|`  |`,@Z  |`  `8@Q  |`( @K@K>H p H@&!X& 㿘 D    h`"Ƞ?㿘 D )  p h`2  pȋ  p,`(`00`  `` ɒ? $ `㿈 #\>c #`#d>>˔ @ @ؐ h㿀``2Ͱ ``Ȁ ƅ. >  b@?`>a \>> a`^Z> `(``+ ''*3 2` h[  `D "  , !< !l(`0`: e!h  t?c& t`a>oc !p@<&!p & t&!p(`0`&!t 6!x`_6!z Vb̀ "R>VL`(`  + ''*3 2> h >@`: D7  3/@˒ ``&. > b@`A`3`@2  '7 / '''/낐 >a>Ő h p``@``` ` ` `?``B?c> < :?`>ta  m> c@`mf>` P`   @c$  *+ 23 >` hd  @Ғ@ > @` D7 3> c@.@``> c@`A`3`@>a#\#d#`>  @q h>a>`@㿘 Dh(`8``  @`A`3`@20N`40Nj(`8``$0NN(``"0N6 8 6*ܐ*ց㿘>cp `  `$`     2@ 2㿘Ho (@a> ؃Hp@>` 㿘 | @@[ t` 5& t x " t  t & t@!4$ Ds 㿘 | h`@(>8 b6 hߐ `$  `$ `<2 4`8!N(`8``24`8㿘>   R"> & c>2 p2!0` ʵ> c,`@,`,`" ʩ``,`!>ʠb> c > c@?``($ t8( $ |4!@4 l4!B4!D$l 4 ll$!l$!$$! $!h  $!|la> > bh,wa,x$D㿈 \ |@`P`d```X  @4!|H @<@@  ` `    >N ``@'% `;` `(@a0 (@a,  @` @` @` <" <@a <  ``@a  @a     ($  $  (@` (  44  c,!X @$!T$`  $  $% `% 5 $ % , |`% (% (`#`6 `,,, ,,   |@ B ,(`0`0`,,    |`'\  @50 4 > a, , > a @ (`  |'\ 8  㿘 x`- | ْ  "t!|```2`   ($` ` >N`$` `@`(`(!| >(`(`0``2!|p !|  25>`` @`  ,  4 8$ ($ `"`, @_  @_ pc0,0,  , , 0 , , , @  , ``(> 4#\ `H!   >> 돚c !> #p  #\>녚c> c<  #p >Ū h>Lx`;>N < x>Nc``<`(>>ِ#@А#@Ho (@aHp@㿘>``2>`@ `>P`2> P>\`!>`@ \ L`>8`@ $ L㿘 > #,>``H>P!#,>( `T#`Hő㿘 t! h(`8`` >`T> !4c, @@>8`>`P0)ב:  Pɫ0M㿐 tP>b`4`#`4 h(`8`=>`X`  |`@`(`0``%>8">8>`T  > !4c,>`` :!>`8`#`8 x ` Ԙ?#\  >8`>`P`>``0):  8X0 ><` < <B㿘3 t; `7>b`, `, j!@(`!B8`` $!D> !4c,>`\ ) 8+ 8`@+`8`0*> )Fct >0` < 00 . r. r㿘 t& t` t@@"< j | "8 j!p ,3 j p(`0`<- j!x!t7!{?c @& t># ! h>`6 j(`8``  6 j$` $!N(`8`` <g(` (!@!B!D(`(8`8@8`,`0`* j> (`@8`(6 l* :  6 l$ l 6 l l>8`ܓ*`0`:`(:  j> a`": j |`"6 j h(`8``0 j(`8``$+ j`@``"& j " !| h`"!| ``2 j!|`2 j`('˅` "  j ```$ `a a j(`8``$    |!@!B(`6!@8`@6!B  p ! & &!8(`0`2 @ ( &! (3>&!$6 n\` \㿘 , , " ې  ,               d $   D ` ` ` t t |XL ,t<h PHo (@aHp@㿘 |`@, X > c|c| \" X!(1 ( @(  X> c> bв@8 X@  P p, 4 ?@_',㿘 |,`@ > cxcx`2  p! > Ђ @8 p, 4 ?@;'``,d`  @`   $֔" Ɂ @b$Ô" ɀ``Ȑ @– Ȑؒ @  ȶPɀ "`  `*+ 23 >` h `''*+ 23 >ĖV h Q "  D"   @`(`0``2  52) @>ɂ` +?Е*>2ؖ  y h Е*>'ĕ2 hĖ Đ ? @(`0`@?' @`'''"&@$-"  㿈 `^`8Q(`> @t >R!9   >  X9> #<' &#<@#> #p '#<  >"!G * > #\# 㿘 h(`0``8 (`>T@6 h  6 h  h(`8`` |.w`@ h(`8``  >8`>`T0& :  P㿘 | h(`8``@`(`0`` `(`` .V,`P 㿘 ` X`>  +cx  > >  \+c|  > cx> c|+ !>Ơ`h  22 h ?4, 4  4 7`la  "!|"!|㿘Ġ``   6I ` `@` ` /@+}vW`D q 8G "g  `(C  @`t;&t V  `2 @`tM&t% h?c(8&tؐ 5  ` @ p(`0`(6p" *ؐ0  ' " 2 *t  `t @ p (`0`  2ܰ 㿐   `@`@   `    8(`0``  fސ D Ch,>l@A - > 8̐ :`(`0``" (``2 x6)`D la@ є >(``  la@  þ ` 4`h`%`2 `2 `2` `耠  `?c" @ հ <8@Ѐ`'  Ȱ Ĭ À`M $`xO 7@6> b1(Ԑ>`8`  4`h>8`> b0$#: *`$`$`$a$` (`0`` ,J }(`0``"t p +ؐ 5e&`` H`2 (`0``@U (`0`aO  aL`K`I # `&` aMA(@ aL `=,aL! 4>- 7+l`@ $`2,`r,`r  la@  Z  la@   >#  `(`0`` - :`  2 L $T̃Ho (@aHp@㿐 `"``  ;9>Z ! 9>    4 *> #\#ɔ 㿈`?c"4 ( `  ` `z /`(``u 1`(`q 8```H `8 h`>(``2>`0`  T  `O 9`8 '  G 7 F `@X 4  , 􀦠@$ `($ `>4 `< 4 4  `x `q, , 4 > c`>`$`6`$,` ,`&`(`@```*#\2`HҖ  A (㿘`   `@`@  `2ư `8>.`>@ -  > c> c(r >#`а   la> > bh* wa* x la@:l la" ( `2 8 `2 8 $`2 8 (`2{ 8@Ӓ `2s 8~ m*0i la" ( `> ` , $`c (`"V 9>ʀ`"Q 9& 8 ,c@W   D4 */@  la@Tі*'  la@8   la@  h c ->>#\㿐`D``2A @`2= ``8 6> b. @?`>)a $ )!>`(`` ''*+ 23 >   `@`@͒ >b> ¡ а H``@ . ,?`>a  > c@` >`> b/ԤbԒ @V9ܔ @    @W// @V%@`,' @ > b  Ԕ @Vܔ @q ]G` і '^'  @V͐ /  /@U`,@|'Д @I  ܕ*+ 23 > Ѐ@ l@ *+ >#\#`#d23   >>#\#`#d Ж@Ԕ  @)>bp 㿘 @0`8 @ @P>'`  L'L'P'T'X'H'@0```   / / `@  @  쀢  : >#`2 >` (``2>`n `(`0`  @@!> $؀X    @?c4  @>`F ؒ@U, "`2  `2 ?c1`2 `2  ?c#/ `2  $> ` *(`0``%a>`(`` (@rԒ  6@ؒ 6(``>` ``2  @U  //7` '  @U //7@  (`0`c>`и >-沪``(`0`` 2``la"`0a2`` (2``>((`00`2`"`8`,``,`0` `4``8`"``,@T  2` `"`(`2w``(``` ` `$``(`" `@S   ` 2Y``<((`00`2P` E   >0? l@  @`(`0`h`@7` lf  @`(`0`h֒ @ P'  ` `%`  @'`@`(`0`b ``2F`@> 0? lb  @`(`0`h`@` lf  @`(`0`hƶ @ P' > @> (*+ 23 ͐  `  '`'*+ 23 Ė G>``$ > `$0>  (*2  ` '*2 '>``  (`0`c`x  6  @ ؐ@SU 6     ' l0?b  @`(`0`h`@Q` lf  @`(`0`h` lb `@`2  @#q )'@` lb @`2  !#` '@̐ @ P& > `  @㿘@A!> >āb `     @ ">   * >c|  >!>a 0㿐  a 0`/`aa%` >a(`a ` >,`  ,&   >`c a6 . a(& a & 6     ̖.   Ɩ  ?@6 Ð  0`/6  ). / @t. `2a%a`2 a%a`2a%a`>a%`>a,`a0`a4`a8` >,` 7 ,&* `2` ` `2  ```2( ( `2`` ` ```(( (Q   >` & 7` `. .. . `a$؃(`0`0`. . > a .  @6  a @1    ) % . % ( 0`/ ). / @ה   ) (`@((@ 0. .00.  .  />&(` (>a `! &a ```@(`0````솃@C >`` 솃@C 9 a `߰ `@(`0````؆@C >``>a`ذ @C 8`㿐!>!` $! 0```8! (  @ s :0```>  ` /`@((`0/  ` >` >)  ( (` ( @ ;  >` ) Y "   /  (`0`l@B?   C  `(` <4 @n64   ((`@0`/@ʔ 2 > `^   ) (`@(<c,0,0,0, (`@0`,,0`0`,, zJ ,  >  d(`0``2? > ``":  (ɪ> b/@2,`&` `2  "  `2  @P  2  >$` $] ۀ``2`| >a` 8 @ 8`)>> >  b`Ɛ# c L  `rƖ * 4> ` 㿘> `` (`0`l2 @> ` !@ !㿐> `'H'L'P'T'X` (`0`l2  > `  LH'  Hc";jc" &.`" " "  `v" P ```(`((@@@'  @` 5کx@@@ (0:1V@@ĉ( 0Ȉ ۄ@ @(0̂@0os@@@(0 Ђ@=_@(0Ԃ*@@( 0؂*  @@(0܂@?Q@@@(0 @`&؂@(0"=@( 0?ֈ @(0@"W5@@@(0 @"@(0?f@( 0)P@(0m! @(0 @=@b@@@@(00,@@@@( 0 Q@@(0:m@@@(0 @5ĺ@]@@@@(0S@@( 06(y@@(09Ȃ@@(0 @xs@@@@(00ւ@@( 0=5C@@(0V@@(0 @*x@@@@(0?;@@@( 0ق@@(0?B@ #J`@@(`0` (0!}b@@(` 0`@@gXa"@@@(`0`?yN` @@(`0` )/bD@@@(`0`c@@(` 0`@@=҂c`@@@(`0`/`p@@(`0`  &߂bƂ@@(`0`:Ic@@@(` 0`@@5;̂`@@@(`0`"a@@@(`0` 6u4`9@@(`0`9a@@(` 0`@@蟂`@@@(`0`1+be@@@(`0` = HbD@0@@@ʿc.`6`0@*c. 6 1@?$`9+@3@@7@@@@VւaÅ+`3`  0@#3`+ 3  0@?`}* 2 1@!aaѻ*@2@ @7@@@@bO*`2`  0@?9b* 2 0@(Pc, @4 7@@@a,`4`@@7@@=߂b,4 6@,4 %/Nb51@- 5 %  b@0@@@-`5`@'%:ᴂc0.6 %㿘 6 .@ + @ 3`@  @ `? @ > ? @Lδ&@ `@ǐ? @L㿐``0`/0`/0`(`/3`(`/3`(`///3`/(`3` @? @`(`@> `  ((0`((@K X@'>c   '' '' ```@(`)  @("* @@..6 6@.6@..6 6@. 6@@ @` @     `@ ` `(`@``(`@`(`@`(000(/`@@( 0 0@0(@@ @ *@  ' @ @+ + 3 3 @+ 3 @+`+`3` 3`@+` 3`@@@@    @"@@ %@@%@%@ @ @ @ 'D ?`  0? ? ?  ( ?( 0 ?0 8 ?8''''''''''''''''''''`  ( 8'''''''''''x'|'p't''''' 'D D     0> X +`   (@67` /` .  (/ . @D 8**`     @ x@ 5;@-5'-5'-D '5-'-5   '؃-5 '0  ( D ++@ D D   - 5`-`'Ѕ5 'Ԇ 5 -`@'Ȇ @ 5`Ѕ- 'ȃ- 5` '@5  -`'0  @DG@? 'D?8G(  ???(O?0?X(0>?PX?p?H'@ @ `(`@'l`(`@`(`@(0 0+'(0'('E0('(00@7`/ /`'7 7 '/` @'7`/ F ' F /  7 7`@4  F,`;4`', 4 ',`4`'4` , , '',`4 'H@X  @ @F+@+@FPP *  2`*`p'2 2 '*`2` 'x * 2`* @F@@ F'|'px2 *`'tp@@ @ '@Pl@?pG@HG PX  l?P  ?X4?H`D@=@ @=@=P@ @ 8@ @ :@;X@@;@ H@@=@㿘i @ D+`0`I @  P@If @ , @C > @@(@ H@> H@&ڐ+@IL @ .@B > @@3 H@> H @@ > @2 H8` H@> H`@I P @ .@B> @@ H@> H@㿘' @ D+`0`?*? @ @  P@@H @, @C @&> @@@H @.@C > @ @`@@> @? P@Hϔ @.@C > @㿘 @>@H’` P @I & @& D& H& L㿘 @ D+`0`!?(P`p`Q p"   PQ "@Is  P  ~@Ij  H P @Id p?. P H @> >  P㿘ʐ@H| 0@G 㿘@Hq @@G 㿘 @>@Hgbؐ P @I; & @& D& H& L㿘`@`D+`0`?!?(P`8`?Q 8@"  `PQ @@"@I `P  8@I `@`P @I  8?.`P`@>`В`P@H& @GN 㿘 >@H` P @H @& @& D㿘 (`     @@@ `@` ) @;(` !..  *@ * ((@ ``@+   2  ``* * ((``*  2 ` ``* `* ((``2 *` `  ` > 8 `` *2` ``  ` ` `  **2㿘  @&Fg&  & F > a؆X@> 0㿘c9;> c @ a 0@2  4@:֐   @%0` @, 2,`2 *  4 ,  @* 2 "㿘  8@GF  & 㿘B'H      @ ;) F1 0`(` . ; F6`;    6 .`@  ;   0D) 0` (;1 (@0 (`@@; ; ; H'H㿘 #? c(  ,`    @ ??  03`(+ @  (+` ?? (0 *@2@  3  ?2   0@@  @4@ @ @q> >h` ;?   ?7?   ?  ??  @??  -??Ю  ?Ȇ `( @ #?c  @,`6 @ 7`  .@*  @ / 2@ + ?  @ 3`) @ 0@-` ,(0  @@) @(/`@(`@1 0кت@01 ȃ(0@@1  52 .@3 @  2@    @ @ @@ۆue@>am@> Y\ea@Y]bs@& (& & $> > 㿘 (  " @F (. ' >    @ @  @ @Dؒ 0㿘ؒ `?+` @  ?  @(0@ *   ?,  @ 3` ` 4` + ?@  (0(+` 4 ? ?   @3 2  0 @   >㿘 , (`& (  @  @ER& @EH`}    @E6hȒŘW 㿘 `8  N   `" &@.@.` .`.`Ӓ 㿘 ڐ   "       㿘 `8     @4 Ӱ  7` `.@&㿘``(     ( (`0``2 G  & "@`@E㿘> L`21> ʂ > L|#01> -#0@ 'H'T\< /'   (  [   '?' @Dx   ` #?c Z  ` @ '  "   c G   /   "  @  8      ' " (@0`(` `>9 1  >֐!8Ө   "  @    2ƨ    @ % @D U T " < "  <@Dd>  `H$$ $ $ $ 8H$ 4$  $  $ ' '2$`$`, 7@i5>   ?'    >t!H0t' ؖ > H>d!`='''''#\  & #'? K&`!    `` @H ``"`` >!`>!'   <8  '  ` `4T` ''@  7SQO㿈ab@  o6   ' "      o6 ?#\    `8  \  2' 7 `6Ho$(@eHp@h  0'  d'''@+'|Hx80'( ( 'ԇ0 '''Ѐ@> c(`@'@@+8`@`X'@'8`X@30 H8'''' ``w>[> >#( 8>OaH`(|x`8@*` B`8`(C 8`8* 2 @9 8''Ԑ@*ӒȰ  `$ 8| (`    H @@Cb$$$`:  `6 X >\`ఀ@"' >H!W  c(`h >O!H ( 8''>`0`@B:`h`9 (C 9 8a@@+\͐! "0$@pd >#( P>OaH` `0`|xC 9 PB8` @8`0@0"@': 3, + @'C''`  ?' '0Ȕ$0@2Xx}Ð  ` 0`$0@:00$0@}ʐ0?c$0  0`"$$uϐ0`؀ 0b$0 0d$0$$@`4$$$<@ (%㿘> a `1> !>`+ ǖ !4>!4b#>!4a0 0 2&  0@& 0& >8 & $ @!4 ` $!4 >c(bH@8bH 㿘 ( dbh `$`@ >8`ܤ!(`4  " "  @ { 2-  > b  (0``4   @ \  4 (`0``  4 h  = ဤ 4 (`0``  P4  㿘 (bh$`@! 'e7>8@   ܐ+`'V    'M 'D'H (`'Ph`'` d[ ``W $b``D@ `(`'d0`` p&&DPU DPU 3 D P"LDP ' >>L PP&Ld`8P d'\08 8d'XD` D`DHP@)```>>>c(`0\@8`0Hd@Ȓ @[> X ?h`P`Ȁ`K`E @I @A * " Dd   0a 0 @ $ 0i "  0h$ 0#b`E@E`Ȁ@d@D@d@˒d  @Dhld "s `0a H`0 @$`0 c HH`< @c 4    "%` $"```@$``0`h$`0`0`>8"0Uj XDh"D @&0/ c(``D@ 8`` $  `0a `0 @$`0 H"ϐH`<`$ @8 "@ H`H~D`` "  H`݀ D  `(`  `h`d  (0``"$̂5b@'"!(`0`` %%  ‌"%%hSb =`а `̰ V P "%P~%P 'P`$'`?`'X0`@8` 8`x'd'\'T@>c(`H@8`H\ '@@8X@A=` @԰@  " `5@ F@    @   = @ߐ  '`   2 (  'd `4$ , 6  H$ ,TK ƒ H "   0d$ 0!x$$  $ @@* @  $  &    @  $  $ 8$ $ `(bh`$bzT 0`"  0$ 0@@5zTP 0$ 0P` @$ ,S &@  0$ ,`$ 0@!1 "K``l`0`l `d@?( `g@  @%㻀  X@>אXX&&"&& >>& h&Db`>>&"p' Ӡ@?J$@`Ȕ #\ab C ,> Y'쀢 ' '#'Ӕ耢  ' @> .Y&\ .X> HU"` ">e"Zb)a @"K 2?@>ʐ'" ` A ?#\ K?  25> }& `$ H    &`@` H $& @   ?'  @=D耦 " >"b aBbZ >֐"ȁ@> :,  (`"****n а H>a@  > h 2 >b(`0``  ``2`d>:"`8@=g>Ζ#   $ ">Đ#H0am >#h`7 ma >#  >#C 4>\#` @ @=@=  't /p /q mja >{  [```    2>k Ԓ @=` L '؂! //3>> W&b`' "  %a$`$`$@o$@`  $`  o7ւ?'#\ ˤb` 9> `    $'  @``7'ؠ >>&b`Sbp '>>>>"xa`Jx ' '> Hѐ H$"耤`> pΤ ؔ >>> ͺpԔ @< |`<` `"` "; ` @ 2@`  `` "`2  " #@  !!  `  2  "! = " ` 2 ` ! 2@ 2 `` `` "`2  " #`   ! !  `  2  "!  `" `" ` ڀ 2j ` 2 "` `"` ``` `@2  ""` `" ` `"`` `"``` `2` 2     ` ! 2  " ! ``  "` ``"` ``` `@2  ""`h 2 "` `"@ ``` `@2  ""` @" `2-` `"E`` `"A`" `2` `2 `     ` ! 2  " !@` "` @`"@ ``` `@2  ""`   " `2 " 2 @2" 㿘@`8`6`"   "`""@@2"`"@ @"@9`9 `""@2  @` ` ` `````` "`""@@2"`"@`  "` "    " ` "    6  `㿘  d (#> bhu`P\uΐ`PL "PyP y'  d>b!H& d 㿘"`d` $`>`0`R @ y:  s $` `4` O  `(`(8`8 >^`0`"㿘     㿘    㿘      &`&`&@&` 6  $N>"h`0`-> Ph;u'(7\ u Ē :G &u >  :t &tP@  9t0Ȓ >!H $ d?c$ " Ģ>!xt`p`0@8  ` `2  $  `$ `$`@9\4`h??> ``0(`8 >a >a $`Hp  @9h$`L@LՐ> tA X>b b   >& !>qqࠒ -> > ``@"2 8`  rʔ  " " "  > : : : : (x" 0 `"! `>b  l$`& l> t# X㿘 L l$ l@2  > s X> 4``@21 > t&  F s `X>` `` `& > `2 `@2  r' 81>  2 1> sԑ X>;> b `X>/> ap7>8s`@*`d 2x `s$ a@L% F $$`lX`Œ 0T   ( `l0@2 @2@"  `l `<< @2 $Ā@2(Ȁ@" 0`l` < <(0x@ `lx`s x$0s3 $ $ 2```Xs='" pF s9" (@ 0`u:0gHo (@aHp@㿘>8`>@6c& * & & & & & & &  0 (> `@ 4(ࠅ9 ` @8`@ @;`#@@ ࠝ㿘> .``@ ((`8  (`@```8 8`@```8 @>8`>@c: @* * @@` `$` $`@`0*aa  㿘 8   `(>a0p  '''` `@ @'( ' (@ = $ >c@0@ @  ' @ % >$ $ b4@ I>b,@ J` K2  $   $ ` `8 L ` L2(`> p$ al>b(c` `@ @  '@Β찒 i` `@ @   ' @  U $ @6 ` $ $$ ($ 4/` `.@ @  @'  @  0 ` D@`. 4 @`$ H` `@ @  '@g찒   `$  $ $ $  㿘@`" $`   @8(`>!!H`  @ @6 ` @`&` @&` `2㿐> '` `  `" S  `a ̔(` $`  2 > `    } `"  @' 2 B&㿘>>ǿ!pc&=c&g㿘@?>Ǩ!c&?c&P㿘 >`$`@`$ @ +(`/->8 8!   $`$ ` %2`$ܤ (``$$`$ 㿘 `  ``8`$`@@ (`> a'@-)>8` `  `&a2 ܢ (`& 㿘]+> c(>`0>a> `d`2@`$ 2@`8 7 `4``&`4 $h"`0 t , @v@$@ 8`$ & `$` 2 `(`(`$ `(`$` &`$`( &  x@<`$`r&`$``dl&`( di&`( t e?&`4    ! ` &W@ $h  `$` b  6J@ b  "C@ $`        @ "`$ )?' #"&@ `"!4 8 @`(`&`$`d&`( d&`( 8``& !& 8@<8&`$ a& &`4@`2I` >c 㿐 $ >Map'  @  3(  @"  `$` ` I >c >>b0  >a /c ` <$` >c   5 c  JJKH2 @ L2 @      @  ""    @ @-$"`''@ >c(a@8a 㿘$`"T= t 2`@J&$3 &$ ` (`8``2   (`0``"  (`8`` `?+`  $`"`@  &$  ? # @? 㿘 t  `tr с㿘 & t` x |  t< t` ` (`8`$ 24$ ΐ   "  @ ה  ђ    " (@(`0` `>9А    "  @   $`"` 9A>8 ``6>a+>8* Ȕ`, 0``"``8(``2`` `8 "` ?4``(`0```8(````8(`0` 4`870h4>8`܃(@4`$`A"4`4`x 2 Ēa  ă(`c(*(3c("` >ې!` (`0``"`  )   @ ?" c1 ` `(`8``2    @  "  ༃(`(c001 ``Ă`@@4`4`ݐ$$$ഁ㿘 >Gc> a?      " (`@" $ 2 $ X>`0`&&@  x`" $ ;>c(}xa>bX>b>a `2  $`"  % `t`%%0 8@=8 $ $ 4$ $L " $  ?"  "  t $ $ `@ږ  i $`2u' '''''Ԃ''''' @#\'    #`?`  $`  (` @=݂ @ {Ѐ  `("! .  `(!> à80j'Ц @#\'   # ? @ O Ѐ" `("! z 0D''ܨ '#\ #`?`   $`w  ``ޒ 쀈` >“" `" Ѐ @R' I?J  & >`( )b  $ 6 "   $0, t` `(`0``  '܂b@'''#\  # $`'Ђ @' &  @@a?'4 p >c($3>5@/]  % ~!  y?w #u`qt`20`80J'`'` `@ @ ' @  c b Ԇ@=b '0+`2(@` 2$@$` $`$`4 `$< @z $$`$$`$$`$`" $ϐ$`2` `@bԆ@=b| `>k"`> "8 (bh" " " 8" 0 2   $"#>8 `!>`@y#  @ `x`      @ ` `$Ъخ0$((`> `$4 $$$$ >#("$ @?9"``>cU$`$` @`t`<&``x` `$h``/*`` 沐 ( `t`  ``+  $`@`a&`$` $$?$4` `&` @``ې$` $$`&`2  $` " >Sb ''Ѐ '& @ @   'ؐ @ U >"0 >c &`  - ` `@ @  'ؐ@t 0` `@ @ 'ؐ @g `I +` `@ @'ؐ @N ퟰ2.`$b$ c F퍡,<'''L >>8 >#@xy* *  @4Ԧ0F&&&f>"8`"  H` &@"` @ "@㿘 >  a ( bh` @u  `````փ(`0`((`0``0@   @ (! @ ,  @ @ (@ #`(@8 8` @@ *"   @ @ (@  `(@"@ 2  2"    `@@`? Ho$4 (@e @2 D 40``0 0 2(Hp@ d!`!h!p`9!X9!`!!!X@ 4 9!X@ 2!p!\@ (!p9!X!p!`@& 9!`@2!!d@:!9!`!!!p!!t!!!!h!!l d!` `|!X`x0(` `  ( 2!`!\@ (!` :@ @  @`!d@` `` d!` `|!h`x0(` `  ( 2!p!l@ (!p :@ @  @`!t@` ``㿘 d`|`!`x/` @7`8`) @2!`>!X>!`&!@& >!`@2!X!d@:!X>!`!X@4>!X@!\@8>!X㿘 d!`A`|!``x0(` ` ( 2!X@ 1!X> @*  29!X@89!X 29!`@(9!`f ` 49!`29!X@(9!X9!`㿘 d`|`!`x/` @7`8`) @2!h>!h>!p&!@4 >!h@2!p!l@(!p>!h!p@&>!p@!t@*>!p㿘 d!`A`|!p`x0(` ` ( 2!h@ 1!h> @*  29!h@89!h 29!p@(9!pf ` 49!p29!h@(9!h9!p ` ?(>c(@4 (`8``@(`8`c @`F> c@㿘 2>c$&`&@2 &@2 &@?&@Ђb?&` @v#&`㿘`&` & `& `2@(> a @&`o&` &`$&`p&`t& `h0``&$`h?0`@&,&(`&0`&4`&8`4&<`8&@`D&D`H&H`T&L`X&P(> `@&@> c` (@&`$&`(&@`2`h?&`p`0(0 @& `,&$``P&(`@4}<{㿘 @@(  i `( > "$"  @$ $㿐`' ܒ >a"`" Ԓ >a"`  Ȓ >a"`  "  >a"`  >a"` "  >a"` `$  >a"` " `$"  >a"`8> a`0@`4@   "`4" `8 " w  "q "`H> a`@@`D@ a  "`D" `H " X  "R "&㿘` F >a"? X>a"Е 㿘``2 >a", >a" " $" D" H" T" X" ϗ㿐>`0`\&$ F + `0@ # ` `@ G` ``2`(`0`c  @(`8``2 `2)``d```&& `   (`8`(@6`"$ $`ٔ? 㿈`$>P\  $ 8@  @ @"v H " (8``"k `/2+@f  `@ '@*  @ &  & 2N 8 8 4$ <$@$ #\ S 2> 8 `* 5 8$e$$  ,ca$ ,d$ 0 2! 8 ,@  `)G  *  )@  $ " 8$ , 8>P@ 㿘 d >> ad@: d > c(  >c(`@8` c(@8c( 8  2    `2=  (`0``" = 8 = 82= @(= = 8 @  @)  (`0`da"  >`0 >`8 (`0`b >`@ >`H  㿘`N&`` &@"@&@@ '@<@`< >Ő" @`  "$@ $` '@@)&"`  `@)`` @ $`$` &@瀤`$ &` &@ Hp''` `@ @ '   >@` `@ @ '  (`0`o&`` `@ @ ' g >@` `@ @ ' N &` ` `@ @ ' 8 >@` `@ @ '  &`` `@ @ '   >@` `@ @ '  x   @>` ` `@ @ ' ՘ \`"`&``&` @ @  '  ? >`0 &`8``0`?&`` `@ @ '  `&`*``&` @ @ ' { ؁ >`@ &`H``@`&`&$ 㿐@ ( bh`$b@?" MT 6`@`> (aP`(@`H`D`'( ?c(#> (a0@`8 `4<>  c0 @`4`8 ` (( @@(``2 "  @& d`%  -`8& (> `% ( "& d$ d> `% d(6% '&'&>&&`>X& (8`&,` `< ( ?$? @??>8 `&` `@>a&@"` (`8&@`/`& `  &$`&(``  @>8` `   @>`8`4   @>0`< >H`@&P`L >h`P&|&p&1&& ` &$`&(` >8` 8`(` &0( &`(&48`&0`, >H`0(( @@(`&P&P&|`<&p >h`@&&&x8 2 > `2>(`0``" >8 >82>@(>>8@Ŕ> > a؀>@& (`0`da">0>8(`0`b>@>H㿐> a8a8#\ `!   >>!Hcv 㿐>8`܄ (`> b4> c>  c> b0> c> c > a> b(ab> ,> a>? a>! c$@p2#>  c c#\>>"8c <  @ 㿘    {($ 㿘&` @ &```` ~@` @$`  ِ  U($@$ "&=( ` ’ $@" ``  @@&` @$` &` ''Ԃ' '' '''''p '''''''Ё>8b@ >8b `d ``*>8b@:>8b 㿘`` @ @L`$[ @ "W  (`2` H` "@``@%j`Ɣ``@ @< $C&`&>`@@8`&@&`@ @ @ %4`%'@&  6ѓ@% 㿘> (`21> ʂ > (#h1> ݸ#h㿐 ' `,(`8`@4 ,`  @!   ` lנ& $>c$ >b4$ >b,$  `$b  $   0 $  0> (a@ I"" " " ` " ` " " ` `  `( ` `,㿘> a @P2 '> `8  @>9ct>cȐ  ] 4?>  a   y  , `6 㿘>OaH`h>`0`:8 !8 0 @ 0(@  >OaH; < 80  @0(8 @ >@   > a- `- >   >a0 #@:80  @ 0 (8  @   >a0> a0>a0< 80  @0(8 @  > 0> a0>0> 0@!4`?+>b >a8cж49 !  a8`Sa8 "O```$ `$'`` `$ 4 %4`0@"`Ғ 6a8Ho4! D(@e D 0@`2  0`$ 0 ː 0@$ 0A H` H Hp@ ࠐ 2`a8`2` a8>0 > ! @- 0>!! a @ \p㿘 b " N -    - -㿘`: @  4 -0$2"p& bo"p& >"p뻐#( @ `bp` 3>c(뤕"p > }# w 㿘`$ `@7 2 4 D` $/ 7 2" 4 2 (㿐"h`p鳒`0 `&@㿘@@ "h*  ڐ``  ]  ܁㿘Ho`4 $(@ a $` @?@ c & $Hp@ `` ``,!>8#> @lc @l & c@l ܀* & *  4& ``"  $`0``d4 d&  $`2` e& ` `  `` @" ` ` ~ `& "&  @@  @4&  @@4& ``" `$` ~ `& "&  @@  @4&  @@4& ` `(`|c & $"  &  Ā@4& `` " ``4``$& ,`" ``8``$& `" ``H?c$6 Ԃ?6 `"  `L?c$6 ւ?6   ԅ((`00`@86 ``P?c$6 ؂?6 `"  `T`?c@$6 ڂ?6   ؅((`00`@86  t`"" "  x`2  >p   c>Gc>a   &  &$ &( &, &0 ,&4 &8 ԃ(`0`&H փ(`0`&L ؃(`0`&P ڃ(`0`&T㿘`$@   [ ܢ&bh>8$`(`>c@kya$`$`$` $` $`, $`$`  $`p4`4`Ԃ <4`4`  @!ܒ`0`  `@"``@!Ӕ Za@!ϔ Zal@!˔ Z@!ǔ Xi$``$@$`$`` >)Ēb $`x `$`|2  &`8  [S )㾘 X邒 iX` `x Ht \ Kn Xt?߂c P'tt5@@@H> `6 $  8  $@p"h 2 $7 t}!'tX@* l< 2$ Y 2  Z"@!@\`  2 'l)X 㿐>## >1  $ @ $   @!$  D "> 0>`0`%>v>” `X⁖?  >% `>>" `x#>8fa<>> b>P$bx`$ `h " `a<!@4 > #> 8@+Y8`a4?> 6bh>8"b a4> >- ؐ>”!`;  2'>” >>#$|`#"  ` `?$a4$"!@4k ">>!>’!|!( 0!8$a4 p>c(a D@8a''ВX ''ؐ Ԁ`#'` `@ @ '  %`  Ԁ Q` `@ @/0 ' 0c < : ~&  :`& &  :~&  : >`& &  Ā|&  Ā: $ <`& &  $@& $xh"h`$b'`p`0 _`2 耠` `$ >P >#(!膀@9!@? ?* D''̠̒''ؐ` 耠`'Ѐ`#'` `@ @ 'ܒ Θ ,` ܔb !쀦 ` ` @? `4& `4 'ܔ4 c``8耠`D&`"&`   3 + &` @3` @&`    3 + &` @3` @&`     ; @8 0 @ 8 (0 @ >`      @>`( $    @ >`8>`0&`h &` &`8`&` &`8`&` &`(8&`,&` &`$&`0&`4 ݒ^ | | | |0 | | | | | | |< | |H | |` |T |` | | | |Ho$(@eHp@㿘 ` @   ( `82 @f^ <   E`d (0`c(4 ``#`(`$`pw (`0`a"  ? ? (`0`b"  ? ?  2{9㿘`dbQ0<㿘`dЂaF0;= ` (`$`"   8  (@`&   2<p t  | 㿘>`d!`0`, >~#㿐 `d    #\ސ ȁ㿘 0`>@! 0` >`0` 0` ڤ x  ''ؔܗ܁p (bh$ >c(a( D@b8a( ''РВې " " "`d'aP'ܐ퐒 Ԁ`S` `@ @ '  U>@` `@ @ '  =Ԁ`"'` `@ @ ' ј $` e Ԁ '` `@ @ '  ̒@  @k a1ԁ㿘 0 0`>`0`>k! 0 ?ނb`d& 0de@  `2  " ``'` `HY `H``o` x  !xXv 0`X % ?J 2 !t4`,` <, @%@  !h  @  0@& 0>OaH  0@`C < < 0> `0`   0?c& 0  `0>0 @< XF 0& & & 0- a1` v`(` 0@& 02   0@& 0 ``'`>Aaؒ 0 ( d 'bh?'`$?`@@ (``?@ 'L'P''>OaH'   (bh`$b"'>8  D@A 0``6  0@$ 0, @  |  x1 (` ) : @  2 @ (    8B8    SL 0@`C =0P= &a1Ǥ ( ,`? 0@' 0 ` @= ` @=  H?ނ`& H 0`' 0 0@' ' ' 0F` @΃,`'>8@ DJ 0`% L`2B`2? 0@@$ 0>{v`Pl dܬ (`' 0`>Ð! 0`2* 0` 0@$ 080ސ0 `L  `%>`P# ܬ (`' D``(0`` `̂0 >  ``>B` p (`bh>c(` $@ "8`@?' ?''В  `i ?Ӑ`'\'꾒  ` Ԁ`Y` `@ @ ' + ?>@` `@ @ '  'Ԁ`('` `@ @ '  ` "Ԡ> ^ Ԁ`W ` `@ @ ' Ϙ >>@` `@ @ '  &Ԁ`&'` `@ @ '   `3 "  d `0d`0 d ` ``d ` `㿐>` ```0`#\#` p ( >bh#(`$ b'@@?܂`H9  ?@''В( ?Ɛ''ܐ鳒 쀠`^Ԁ`Z` `@ @' " "Ԡr E d>@` `@ @ '  Ԁ`%'` `@ @ '      . d `0 d ` `  ` @`>Db`  h ( >bh#(`$ b'@@?܂`H d9 ?@''̒X ư ?''ؐ    `耠``   `! ` `@ @ 'ܒ m "@׸  H` `@ @  'ܒM "аם q`@ ' `@0``(`8`@2 (`@@ 2 ('' rЁ`耠`0Ѐ`#'` `@ @ 'ܒ  " "@ܔ 쀤 @`= 0'ܔ "-`@`   '@㿈A`d ' Rz $ X3$ $}``/>°b 1  x $ @\$  ؚ    Ț `  W Q $p (`bh``$@ b' (<`@ bh ̤ >@>`@쀠@? ? P''В  쀠`"` `"` " " " "" >0' d aL'쀠`'Ԁ`#'` `@ @ '  [` ﮖ PKԀ`` `@ @ '  3 ' )` `@ @ ' Ҙ `   H Ԥ0! $@쀠` 2 "``> c( и`4:p ( >bh#( `$b@9 @?' ? D''Р5>`0`''ܔ `&Ԁ`"'` `@ @ ' \ 3`  (Ԁ *` `@ @ ' :   H肒 ԰{wԁ` (`bh'`$ db'L'P ''    '̦c(a D@8a쀠`   -''В쀠`ꭒ ""    `2" "  І   ꗒ " ĐĒ  `L''A쀠`'Ԁ`#'` `@ @ ' 쯘 7` C , 'Ԁ`` `@ @ ' 쇘 ! ! ` `@ @ ' n ` @ @   ' V    @ @ @  ' ;  ?`  H`" @@$` 6@@ @ @ ` @&``@87'̀`5@@= - 5 - `@&`` @`   ﷖ |@$@@(@@ @ @ @ ` @&`` ` @ @  'ǒ W` @ @   @ @  ' 뫘 3̀` 쀠`"%%% `@̀ '쀤 ` `@ @' z ԰`?̀ b>" 6@@ @ @ ` @&` "`Ș   9 P`P  `>?"(p  ( bh`$b 'tr`>P  >c(`І@8```@? ?ܐ HK''ВŐ`$`) ?`'` 'w 쀠`]Ԁ`Y` `@ @'  ԰6 D`>@` `@ @ ' ǘ Ԁ`$'` `@ @ ' ꯘ  D 2 `>Pr  d`0 d ` ` l"l<ܒ l<ג ǐŐ ` h>(c(h` $ @ 8`  "@'' @?܆<`L  ?펐''̪̒  ϐ耠`d  d$  ?耠`2  > c`>@"$$ $0$ $ Z$ @W  ' '㎒  ` ` `@ @ 'ܒ  C`F 耠` ` `@ @ 'ܒ ߘ '  @  H` ` @ @ @  'ܒ˜  ( "а   `耠`2` `@ @ 'ܒ 雘 ``$` `@ @ST'ܒz T "dЀ 'ܔ XЀ`X ` `@ @ 'ܒ Z >>@` `@ @ 'ܒ A &Ѐ`''` `@ @ 'ܒ )  `ܔ꾖 "аn  jЀ " T >P d``0d ` `l;N @p (bh>$c(` "'@8`  < D  ''В쓐쀠`  洐攒 >a-"捒 `> c$`> c ($` 2$ >c$$ `2$ >c$$ `$`0 $ `@ݒ ''ܐ 쀠`PԀ`\` `@ @ ' 腘 D>@` `@ @ ' l ,Ԁ`,'` `@ @ ' T ` ' ДАԁ㿐   (`(  K  ""  (2E  `(  d``2  `T 2  l":_ P    #\ #`l"`l:K `l" :F  `@  `hf@ @#  ` p  ( bh`$b'( (" ``>P  `  %>c(`І@8``@? ? Ԑ''ВNJ`$`, ?`'` '  ` Ԁ`)'` `@ @' h ԰ϸ k  Ԑ Ԁ`X ` `@ @ ' = >>@` `@ @ ' $ &Ԁ`''` `@ @ '    衖 "԰Q `M`>P̐ d `0 d ` ` ld ` `"l91 l9,   ```d2 ```#  $hp 2x`(9  Ζ     H    `2 ݔ >Ps $$ِ`l"l8 l8ے 㿘  `% d (`0``"  ( bh`$b     4  K $ $  (0`` 4 p (bh'P $&``b '<@ +'L`< ' c(`@8` `@? ?ܐ Xi''В쀠` `"` " " L"  " ݒ ` " " "" U>0' d aP߀'쀠`oԀ`k ` `@ @ '  >ᜀ- ` `@ @ ' Ԙ  d ਘ    ం@ @  Ԡ Ԁ`"'` `@ @ ' 奘 p` 9 daԀ`S` `@ @ ' ~ Ia @$@ @ @9 `@#```@@c&`>```2 $`2 $ $@ @  $@>% $@]  " P  @  'ז  Ԧ͇L d`X``8`8`{$    5 ̀>L &` `   >b `   >b 㿘 dd - 2(2(82 (H2(" (`$`2  2"AH 8"( (@`2H`w (?8?2;< 28< c ??0< `$`]    { Q `=`8=`@ 28 `    ^  1    { "  2=`$"  =`=`8@     @l  l6 p`(`dbh`$b'(0`c0ΰ ) >#( @9 @? ?X D''ԠԒѐ ''݌  '嫔삒 ]Y؁```dl  ``!L " MF $!L`  `" !P " M7 $!P`   (`0`` ˱  A@Q$ $ ``2 $ $   !cp /(< ![p ' 2 ` 2` "$ ``2 $ $   {   @< < $ $  p `(`h`d`$$`" !8`8!8 (@`&' !8> "& as@: d 4   !@` !H !D@ @ >c(` H@t8`''ВА `0` `2 @2   "`2 @2 " ''ܒ ܐԀ`#'` `@ @ '  &` 䕖 Ԁ ` `@ @' ݘ ԰- @2 $Ԁ`?`  y0> !82!H!<> !H> !D@%!Da=!8`%!@%!H%!D`" d`d`h 8`   X9 s@ (`bh'l d 'L'P''x'| 'h  'p'tܨ2c(a \@8a''̔ ̐! |"x"   2" "  І  lĒ   `L'۸'Ѐ`$'` `@ @ ' ) ` 㽖 쀦 j ` `@ @   '  %%` `@ @   '   ?` p `" @@$`h'p0@@ @ @ ` @&``@8G'tE@@ .6.  @>`@p&`` 'p p@b @p@` 'Ć'  'pW L@$@@(@@'h@ @ @ ` @&`` ` @ @  'f &` `@ @   ' Y t" '|&'x&܀` @ @ST '3 T ` `@ @ ' & `` `@ @ '  `Ѐ`@ H` ``@ @ @   ' (`8`@2(@  2( 'ޖ X`Ā`Rt`P'''ܐb z> ''`(`h<@8` (Ā`42,') @ @ '  N` `@ @  '{ ;Ѐ  ` `@ @ ' i !t h܀ ` `@ @ ' J 1`?Ȗt `>ph"p h0@@ @ @ ` @&` "`| x  =P   `> "H K  ( dbh``'  `ΰ  "*``@2&`` @2"``@ 2` 2` 2` 2 `>c(`  @8`   ``$b$$  Cq  '<'Ȃ$'' '?'''>0@'$@Ȑ c$?@%$$@@  Ȕe c* 0       4  < `(`0` ''<` "  -` 0`    <  Ԕ<@ `2?? B$ <``>`@2 >c(`(@8`(    @h'( bh`$>c(`Ȉ "'@ 8`Ȁ   $ < H  ?@9''ȒⳐȀ $N L ?ܔw䀠`ɔ ܨ `> c`>@"$$ $`0$ $ $ `@  '  'ԔB 䀠`" ` `@ @'ؒ ޲ ̰  `B 䀠`! ` `@ @ 'ؒ ސ   @۬ ٰ H` ` @ @ @  'ؒq (q삒 `䀠`3`` `@ @ 'ؒ P ``$` `@ @ST'ؒ/ T "f̀` 'ؔȖ Z䀠`Ỳ`V` `@ @ 'ؒ   >>@` `@ @ 'ؒ  &̀`''` `@ @ 'ؒ ܘ   ؔq ""  d `0d ` ` l  2!``2  l""/ "`` @>Pf Аh' (bh`$b'`h`> c$; ->c(`؆@8`@? ?`< ?ܐ T''Ȓ $ţ  ?͐䀠`"# > (a @" `8- h0``"h?0`@"  > c (@$>c$0$ c$ $ D$ @A  ''Ԑ w 䀠` ` `@ @ 'ؒ  EH 䀠`" ` `@ @ 'ؒ ˘ ) ̀ @  H` ` @ @ @  'ؒܫ  `(̫삒 "̰  `䀠`3` `@ @ 'ؒ ܅ `%` `@ @ST'ؒd T "ỳ'ؔ l耤  쏚 `䀠`Z̀`W` `@ @ 'ؒ 0 >>@` `@ @ 'ؒ  &̀`('` `@ @ 'ؒ    ؔݔ " ̰D   ?̀ " "& "&@@&@>P `d `0`d ` `  ߀X'( bh `$b'`  (@`@  (` 'Ă0ܮج''>c(`@8``@? ?`< ?ܐ L''Ȓ:`$`Y ?䀠`7 (" "  "/ &`D  `# `> (`> @>$$ $ $$ $ ؃؀ `'`  'ԷȰ 䀠` ` `@ @ ' '  @䀠` ` `@ @ '     @$ܰ H` ` @ @ @  ' (삒 `䀠`3 ` `@ @ ' Θ  `%`` `@ @ST'խ T `̀ `'F ~耥` ``` `ؚ `䀠`̀`` `@ @ ' y P>ᜀ2 ` `@ @ ' _ 6 `d     @  @    ̀`.'` `@ @' + ̰{Đ۹ "̰i  Ā"''`̀ 䀠` ( ` `_7`" `;``"`(" `` ` 2``"F @`>P d``0d ` ``l,  㿐  6 2`l,  `( bh`$b'?c$  %@`(`$`"`` ``} `d']   " 2n%@"  ʔ "%@?c$  @   2 %@@(%@%@ @  `d฀@ༀ@/ `9 `@ ' d฀@"ༀ@>c(`@8````h$ Ű א%@L%@>c(```C 8`@8`@?܂`H  ?'@''̦̒ܠ $Y ?g' 'R  ,耠`&Ѐ`#'` `@ @ 'ܒ ؿ J` АܔS 2?/ `" ` `@ @ 'ܒ ؘ #@ а HW` `@ @ @  'ܒw "аǠ " ` "􀥠"(`8`@2 `(@m  `(V `耠`LЀ`#'` `@ @ 'ܒ 3 ` Аܔǖ Ѐ`.'` `@ @ 'ܒ  `"%@ܔ٢  'ܔٗ v%@G`h$ @$(`8`@j@ c耠`NЀ`$'` `@ @ 'ܒ ׺ @` ܔN 5Ѐ`8'` `@ @ 'ܒ ד `"!ܔ' 'ܔ " а̠'  @$`(j   ?c$`耠`MЀ`#'` `@ @ 'ܒ : ` АܔΖ Ѐ`0`'` `@ @ 'ܒ  ``ܔب  'ܔ؝ |쀧`""C  "A?cu$`( `耠`LЀ`#'` `@ @ 'ܒ  >` АܔT 3Ѐ`3'` `@ @ 'ܒ ֛ ``ܔ/ 'ܔ$ "а/ `2 $ @$`" "h$"%@`2%@%@  `  "    `(`$`@? "%@" %@h$%@  `(bh(>?\@  !c   "  @ ?ༀ  @ >  @ $    $ b @?c` 㿘'D   @I̮!    -@ t` 8`4D @ D`T  8`2@ \ 2= \D`X "7 \  <8` 8@8`D@F: @  D Ր-@@ : D4 \2`8 \`@F֑:  4  8 2 \@( \ 8@J  D.@ 2n 8D<@(`0`@@2  t ɜ   Q-@` 8`4  @    <Ʌ  ;-@ .@  @E<@ @Hv   ,@JX#@E< ,@`@ &#L #L@`@ &   <%"ԠK  ,E, 㿘 @    6& @ 2. ,  `@J @ " , `  ,  㿘%$``l`h@ @. 6@@ (@@6@@ (@)/@$`p480`@8`@@` ` ??   (@" @``)   @ @,?80`@8`@@ ` ??   (@ `9 @ #@  @@4(`@@ &@(@ @ &@ $$/ @ @ &@$(@`4` P(` 㿘 @E8`: 8 0 @0(@  `,80`@8` `@bUc؃80`@8` @``@ 8> a0(@@ `? *@ +`@bUc``@ 8> a0(@ `6` * @Ö   >’ "h>S" @(`&`,8`@bU>ÞcH;>äcبcl!  0/ @``@:80  0@ ( @  8 @  8 "@8@ (@+`)   @:` B 4`  8` >” "h >"B8 F 㿈`H@bU '`'2(E8`8`@D   @9 <89 8`@?@D;`袀 @v@@ : D   @Dx= @B@Dr= 袀 @X: @ D88` :  @D` @C @3 26`8Β   <8` 8@8`D@D5= @ D-@ : @CАD4 `2%(@8`%(`@Ca @ ?%L@= ( \Uaa d@C+8` @CR'@bU *``Ђ `XPǐ * P`, @Cx8` @Co@CÕ8` @C"@C8` @C[D@C>`@C8`*` 6 @bUTT(`  - 8@C8`@ G㿐` ` >@C8`  @ 8`Bi. d: @ @BD  y   H@bU Ԁ@ަ 㿘 ``,B@  >”`ː"@E Z>  Haؐ8$ $ $ @Fu` @bU" \6`@`8@`2  >”#Ė` `҃(``2 >#8@bU" \ +@(@( 0@*$ 0 -``$ dcL@  2 8T>  8@@; C8`4  28@( 8 >[#`>W#``2 <@9  >H# 3>`p9>¶Բc# 9 @B    '> a H8' ' ' 8`@B-0  `@AÐ@ bU# `@ǖ 2   >#>Ð @bU# `@B  .`' L@= `! \UaHd@Ap8` @A @ bU *``Ђ ` XP  * P`, @A8` @A@B8` @Ag@A8` @AD@A>`@AW8`*` `5  @bU T T/`8@bU#؀ @  `= 0`@8` `??  8 @?  4:@ @hT>@ bU$#؀ `*2@  8@ `  >F#>B 0 `  B(@ `@)@ &  $:`@ ' $L@ .C= @ !  @bU# `@88  @ :@ @ ` =@bU8# `@A "k $8 @' $8L@ :`c=  @ ! <  `' L@= `! \Ua"Dd-@C% @bU* `Ђ` XP* P @D@D@C@D@B* `4 @bU T T- `  -㿘 .`cL@``ʨW Ű H `>   a؀8$ $ $ `8`@@r @bU " \. 6`@ `8@`"\  0` 80`@8` 80`@8`@bU" \ @K  @bU" \ @;   0`>& P>% p  @@bU" \@ *   8`@C 2`$ 0C ) `@`>">Ð  @bU" \@bU. 6`" \@ `+@@+ $ dcL@`" 8 < 8`@9 D@?ז@  D ½.@: @ D 8@?l@?  ` : `l;  @3` @ C3`+ @ @ @``p  (@  2` @>  `(   ,aؠ 8%`%`%` ` /$,n 8`>À@" 8 ے< ګ    㿘 .`#L@`` 0"ذ ” "Ѱ H `>  0@+> a؃8' ' '  0@2  Tw _ 8<@,`0```@&@Q `^  U 8`@> @ bU# @ ` 9 0@ @(@ `   (@@*  8  $"@ ' $$#L:@ C<$ *@ !  , 4` 4M @ bU#؀  `+ 3`@  ` ` `(@C (* #@@&  $< @' $$#L@c<$ ,` @!  , 4 4$@(4` 4 >`@>8` Fڦ 㿘 .`cL`T@` '@8@ `8?@ F8?`B >    8 Ɛ > aH8$ $ $ `8`@=`T ?#@ bU @ ` 9 @(0@  ` 8@``l  & `8@ @@#bU@ ` 9 @(0@  `8@`` & ! (4 4!(4` 4`T?@ bU%# `  ` ? @0(@   ` (@ + $$ $dcL@ <@2 ,@`  @@?KH ` `* `* >eHa`N  (  `@ "`d(`0``" h> > `" ฅ8`Ԕ>! `h `dl`"ข` l l`2 ?c $ ll``ɂ "l> >Ð#bpYJ   >>Òc!8>Ò !Hd %$`    d`x8`p@;c @;/`@ `x@;X@;tȀ@ Ɛ@쀢 ?`E@C  h@耢 쀡 `()  0@@   H耠`(`X``@ 0'@Θ q`H  @=< >fcaL \ , @  "" 8 @ข`(@> $`׻`&$`༐`@  > a$`ןϤ   d@ @:`x 0   d@@:< x 88`D-  6֕ข`(@֎  > a(` @ 㿈d''X`\ @`` `@:[<@@B@;8` @: d@ d4  2  (  -`(` 8` 0>!x>H!d`  0  X `8X`'< < @p 2 8`@:?X 'Y / d `h `h `& d@9 x@2> |@ "$ 8>Ð!20 a 0`HX@|@d h`28@8@4 @2 <@8  "@21 <`4@@:8` @9 @)@2&$ @ # $<0?@:n:  @9і d@&쀠@  @   $>!>">g`< B> ʀ`@>@h XZdT%?8FLd `h `h `& d@9W8`x `80a 0`HX@@d h`2/8@ > >Ð#bpW   "` >>ÒcJ"0>ɐ"H  /'" `@n 㿘`%%  0@\##g> `?`  `@8#$ <$@@B@98` @9 d@ d ?` M> ʀK>ù?` ?` @2 R$8@ @2 $<@  2 `@<+  @88` >g0`< 4 ` 2`( ``h `h``%`=@ > >Ð#bpVi    >>Òc"0>Ò)"H <0@@'T'h'X@>`0`'l\ P>"`2&@@8y  P`@8l ` g a^40 80@8=F8 <2 0@8<0DL@@@0= 9`(0#\T: #` #d#h cP@8 F< ฐ`@ฃ.@䀦` `(` %X@X2฀ ฃ,@`(`SP`@7ېD8D`@8D`?0מ 8@L<h@@@@`(0ׇ @Ӿ" 8`(8T#`:  #\#d#h& "Kก@7D`@* D@2 0` @ :0DLh@`( T: #\ #`Y `0 օ &@0&" 8d@7T@< xX`" @ `8@`H@ `<ฃ,@ `(`% @찒 '*@`X`  'tEЖ8  0T: #\#` 2?'0  1'd@7< x `8@`H `< Ԇ?'t'x( `XX`%'tX ?'|'p'x'd|'x`'||0@֣ | Hp*@\8``'px2 0p#@D : 0T#\#` P '|0`ռ 'd@6< x `8`H@$  `<ө 2|t(`$@px`dxdӓ|[|`I0T:  #\#`D "E`'0  k'd@6=< xX`  `8@`H `<&@pX(@(`$@I,`mX`0 "В  )'d@5< x&@'t'xЀ ltxXa@  U  08`0 @*t`x# @ (0@?Օ >"?H(` X`Ҟ`lT<`<` @ h @ h`%la@    @h'X'DX   '1`'`@&t  耥 2 ?`?:@5?D08` ' Ԃ  0a+>`0` >O!H`  ( 8`C @9 (9 8 0 8 4 " 0>": xI  ?Bd @?H'܀# 0 (J 'H@0 +` t@@ `(`$`@0o t袄`D ` @ : d+8`$`8`d@4D#d? #`#\?R 2@0D@E>4ԃ.`䀦̓.`% #.`" d@48`: @5`D#`#\#d 2@܀` 'x  d0h$0Кd '88'<'T`t  ``( k  8 < `"`(`(8` 8 `@   ` h`  (@   ` `   `& \@ 2;8<@5 & 0& 4& 8& <& H& @& D`8@  @G8<D<08@* @2  4<@ :  8T#\@?B   28<   @8`@  ]  `& @ <@ݐ<<@ 2  8R8`8PT#\@?B   28@3֔ 8 8` 2 ` 80 P``@3B 8 <2 0@8<0DL@@@@``$`H @6  `8и00P8<B?@@3BB??tB?8@d< ?,'@@ : d ? +`@ X8""! X??;?  H +`@ `(+` 8`  2 `@(`) @ `(`C 2 ` 2   `& @  H ) @ `) @   `( 8 X  \ `  8`8 <T T>`0`  蘐?'D??t 8@dD??ȸ : @ dD?? /``X",@d/`@8@2ސ #d#`#\H 2'D    `X@0@`6 ʲ  , - @`( "$  `( P` (@8` 8 < 2 0@ 8<0DL@ @@9 v< ?D D4 8 \- @`( "W 402P 80P @2hE8 <2 0@8<0DL@@@8< 2 80 P`@2HE8 <2 0@8<0DL@@@`%@>}z" = T8@8@  < @ 88` h@& h @ h ? `& ?@h D 㿐 @Ր `?`h  w& e\FaT2  e,`4   p0 t0 `@5J` 8`@2 ``@`8`B,@D @5Ґ@52`x```d*@@1ŐD `0 ё "   (`8`"`x>|#@5 * `H@@h  (`$`@ο·㿘 8> (a0@@ (` `>ó.`cH>#cl6`>`" / @ @ @2 (@ (&)()  8  8݂@ 8   "* @ `*2@ @   (*2@  @ ((@@` @`?2@ @ )@`@`? 8   **@ *2@ @   (*2@ @  ((@)*@ 2@ @ *)*@ 8   ?*@ *2@ @   (*2@ @  ((@@*@ *2@ @ *@*@ 8```* @ *2@ @   (*2@  @ ((@ `?2@ @ 8@``㿐 P@0Ô   2 ` 80 ``D @08 <2 0@8<0DL@@@'0] ̕0 " 8<H@&' "@  㿘>{#(%\FaT@ 0g h  8`(`> 0@  㿘  @* &  %L&  &%P%,`4+$ 0 t*8 *$:?< @0>%0@B@0>%0@B@0>%0 H@888B&%8>%08&%<&%@&%D$`4$&$$` @&$ 㿘%\Ua+ 0 $ (#\8 #09  #8?` #@?  #H> # ̃>#>`#> ;##4#<(+Ӆ8#D#L#### #%\FaT $4##$$ " " " " " ȁ d 2@ "``l"``  & @ "     "  - > " >  "  > !( > !$Bž@㿐> Ѐ`  Д   #\>>Đ!tLa    >>Đ 0atB#\@ 㿘  `4`@2?cL. @`0`4%@dH`d <@/FB  e  H@`ʜ`8U 2`8&`82?`T`dc@// @  `h  < > ,`aؠĒz !"h> `al>a>Ĩa> aT@ | &  5  p     l% ` `d%`%% %@ -% "; h0Ґ8`@1,8` @/E8`@8  ; B9  @/7 @ D@1x@1 8``@._`d @.[D0 '   ]&>o 0%x8`@0 `H*`@@ F`(`8`> %a@d "Z& l`2\c $ ll``  l`(`$`2\`%\FaT,` (`0` p(`0` t&㿀"h  `Ѓ(`` `҃(`` >x`>xH">y#!>x `8)'''`'p $@```R 2`2'   l  2  @ `Ѓ(``; 2㿘 ` d``2` D``V  ` `` 2&@` " 㿘"h`F\aT>x!4 &`0&`@>`8@.$8`@B>`<@@.8` @-~ d@ d>` ,? >`(>`8>`0s㿘 $"h ` #  ` @``2 ֒  Ӕ@ ' 㿘"h $@@ (`   G`҃(``2 e`` .`Ѱ "cH "cH.`с ”   `T `     ?^` (`@?? `` cL  `h   `$?$bhc$`$㿈 T` '?'@' ݐ >8a<@  K     `$`?@? `_` >'c 9FaT,/@􀠠 4`0@ 0t'4`@8` 8`, ? `H%\@`" 2 % ?ӣ<  &  т, Ѕ($%>`$ Ԓ v! %L>ĺ v"  %L "   O  :  h 5 '`%\FaT '` ``H@ h hc0h 0'` `у(``2`4e`$e`4`,`Ґ@.?e$``,(`   )$cL@`0`4}%dH`d< @+@ ˌ`cL@q`Hǻ'`8&`8e$` $cP e$ `,(&bh&```"` ``2&`` `&` &`e(`$&`(&`$'`'@'``t'`$`d'`(`8'`'`,'``T) `"`,$cH  $cH`Ԓ !@`@h!e0>?`a`0@4e0(8`0`(@@8 v"``< 8 0@8 (0 @ʓ R HV Ű LP h$cL$cP,`Ғ@mhc40h 0Ƭ(h%(L04@-F?L( @044%Hd< @*w@ C { H@)r@8&8`"$$`  P ,&$''''>{a㿐 ``ަ    2U``  ߲ "@>uc"x d@-|8`@*ؐ @8`B,@D @.x@-e` `d*@@)D 0 Ę @`x@-H*  @@⥐`(`8`% p hШ ! $@"  $>t." $>c& $ $ @@@{  "h҃(`8``*(  & $!@ @ $`& $@@? `) $>c& $M  `  $ ҃(`` >c& $23 $ `4w 2'`E $@А!L "ђ  !@!N a 2у(``2 $>s!>Ġ s"`" ,!@ 2,  G &HЀ` АTດԠ 2ר`д8 Zؖ 2̨ ZV ? @@ Z @&, &?&(&&0&_ 2`2 T> 0` 0``@  ϒ " $ $ !@   ?!̒ ߐ  $@"'  `TT` @q \ l !@D Z@⭔ Z!l @; Z8@⤔ Z#Д Z@1 @⚔ Z! Z@( @⑔ Z!l Z@ @∔ ZД 8Д h@9! `@ 0`/@ $",҃(`8`@`( ``` (H :   $`  㿐> 6bh>`0#>8$bbf`  >> 8a,!>8^!<  >r"b <0>>"`Ȕ !<i `  C "pb!< @>Px! `  bh``@ z 0!@$0Ho$(@eHp@㿘  d@Ő  `">k 0>j!& d㿘``2 `T``"  `$"  8 /``??c>O aȤ>ĺcH- `D0@ 0L`D 0@G  0`>rǐ#0"  p`&; ` ` 0@`  @   0@$ 0 , 0@$ 0}` `´0n .a`D 2  `  uZŐ H`D``J`d  ``?p'D   '䀠``d- `` `%>Ā` #x"`= d`"    @"   >Ā#Xr+   0@  4@ 0  `'?@ (`('<0@ P$D#\` @ 2   @ =`@ @* 9 @ @: 9 ` '@v@& @wq 40 2` 80P``@&rD 8 <2 0@8<0DL@@@<"@4H7,  ` `H@`"0o @> `΅`  % 2   "  `% 2k  ( D `"  ``" s0  `l@? Ò` " 䀈"  D @@  % &`= (  `"  `@  @%  㿈'`d ` e0 2  e4( `| c'`@e 4 `P 2^ `([ `P@%”e<`0@' <4 @%E8 `(쀥@ `(E@ `,@ ` N 2?`(<' H6=  t' 2`  h(`$ ```'`㿈 ('Tbh' '> @b  ` }$B? @& @%@g 2 @ @(@    g @%Ԓ  @    ??@cF?@> C @@$ C <$ ) "(T$E? @% @%@%@ >&& 8@% `גT   H'D (\ dh'%8@( @?' "`"DP @'`4 (-`@`((@8`&`&??>`E  C % * +`` 閂 ,@(`(@皃`  (`@`X >OaH{8 D w``p` O ' 8D ]  0a%(@$-`0 ?`x@'`0`(`8@`C >`(>`8>`0``) ! `H) `-8`"+ "(    *`:`%  B$ 2 @( @6 `H,@@@B` `'`"((@#˒ 2H>??>㿐 " `d` `      #\    a `2 `   ~" 㿘>8`  >3>1>  ay!h>'D'HʒaD  ژ H  Ԕ > ad >a . 㿘     l3ג@2 2   " 2 a& `& `"&  㿘>`0`@2 @2    0퀢 2  㿘 @2 "  2  㿘 d  $ `@ R ` "ܟ@V 㿘`d ? (``; (``*`(`$`2& @* 2 ?@+   @  @?  `( @0@  ` $  *@2  `"  `@    `@(``` ` > `0: #l #\ #d#h#`  x 3`0 ) `+0` # (`8``.2   )  (`8``.) 0`D4@8  `` `'D A >ܨ`0%?# `   `<   #\ #l#`#d#h  `-@@) #G`(  `@ ' 2>lg#  ,  㿘`(`0``" @ >Ĉ  ` # $@># ` `(``>Đ#l0 @`(`@ 㿐  `9  @ # @`(`(`(```&`0``&``(`$`@   `$ 㿐 d  ` x 8 , x`  @0`" `(``&`0``&``(`$`@  x`E u `$ 㿘  `(>Ē k# 0`>l#㿘 &`.``@ `(`(`$. @(`0`.㿈 d x`` ? >Ā!# #\9 "@    b 8`   `$ @p"6`(bh`H `8? @٨] `@   8`  2 @ : 8  `9 @ p` ``(`0` @6`(`0`&  ```$@ʰ x` >ł@: 6>Ő k (66@@ ` )$  |`%8`  @ `@ @` w @ |8` ` P  ?c'$ ''%' d< @(`0`@@ * @ x ' (`$` `8h O 6a`?/`?@ /"   ` 'Ժ ' (bh@`8 "$  9 `@@2$ ` @$   '$  9 ` @ 2 >P`H`8@8`8 '  `?'̄@0 ('І@'( '` "   `9  @ ب `!2`H?'`H`(`` > ─`` ` >9@ !" @I$ "+@`@(`0` `` `Ԁ@`  '2@Ѐ?' Ԁ@&@   @'@"` `2 `@׬` "q$ ` (`0`@$ @`(`0`' ܀@y@؀  '$ ' .ǀ"?`"; `"7 2]`2 `$ x@0 (@( $ ' $ !' $ x $ x$ x&'?8`0$ |h$+ (&# `؃(`0`$ >P`H`0@8`0    ``` @>kP `  ` 9  `$ @ `  ~I$ G`E덒 2ܰ a @$ x$ x  @2 (ѭ%  `@ 2 (`0`b` p  d``p@ ֊ ,%3쀈`0`.A 2  @  (  `@ ~%h$2w9 @m$";  ,@$ (  ` @  츪 L?cG$`:`"8%즒  "?c%$ @2 ( %  `@  ؒ @$%"        -  㿐 `  @ &@㿐 `` @ "& d`(``l`"&՞ F&㿘> Ԁ`   㿘"h`TT  4 0&&  " " " " " " #D #D " #D " " " " # " # # #8 " #XHo$(@eHp@`d`d` ` `   d `    E  `(`>p@  #c    `(  `4  @ ? `( `8  >  @ $         (`8`  > > b> bb H L l " l Ll l@2   L`@`d ?`2 ` D` @c  : ( <`   `"   `@2" ( ?`2 " ,  <@`@ @ " 2  ?@2  @ 㾈`d&%< ` `@ >P_ 0"``dt` `t `` p 2   "`>P_p ``` @[Y``$`> c0 0 @  ``$`0``(`0`d"`t 2 ` "``{0``@  2̘ 2>P_! &>P_  `$`0```$` `㿈 d`@> (c0(@` $ `($ `/ -```(   d&`d> `$ dQ$ ܠ$``` `$ 6`` <``+`+` @(`@@ (`@@ <``&㿐 `d   ` #\O h`d` -@`d` Z@㿘` ` d>f h`x`p@2)`x`t@2%`x `xn "`x`0$`@d$`0 ː2 `x`|2`x`H`8@ɒ $`<`x2 `|2    `T` $`D`@`d>b0 l `d` l>aؔ  `d >aؐ l d (`( @`2  h`2>aܐ (>rc, X  `  a@ @В @ӌ ''Ԃ'''    '$ !@I@0Ђ` 0`(`7 (`@8``(`0`D?@ ? `/ ``@U/Ȑ` *2"@#Ȑ*`+U2``(`0`@ `@`(`0``@@( ``@ `(`0``(   D =  `d`@  @2  @8" " 㿘  @> (c@ ݔ `l" `d` `h `(Y `\$㿘 > (c@  @ `l 㿀  ` (@ 5`l"   @(`(d @Ҩ ( <`  `$ >`0 ` #\ #` #l#d#h  š 㿘 ``#`d``d`2  d``d`2  `" `l" l\  l"W  C0ǐŐ㿘 dd@ T`  ,ѯѬ `V  `2R B` ֐ "K B``d`D  `d`>l`$` $  Ȗ   l``$` `($  '`  0` `$`0  `$ (`$ `@`?* llӒ LJh d  `(0c  ` 2 `d` `p``t@ t 2  ? "`>P\ ``` @ ``$`0  ``$`0``$`0`$@  2Z (`(> b> b @m`' '` #\ "@  2<` "8````$`@h`H@I ``@   2В9J 2  l"` ` $0`$``$0``$`Ѐ>P[ z㾐  `# r (( h   "d Zd`c(0(d D`"` 9`$``0```$`@  2`ɘ " ``$`0``$`>P[ l" l  l  㾈   ''  ((  1("d 哐OҐ 倐@R``d` d``d`ڒ'  `Ұ cϪϨ` @% %ĵ ' ܔ  dc(0`d _ d`  `d`"M  <(` 0`@@<   &   "   "  , i` @(`8``.@  @`"     J` $`l d` `d`$`0`$@   j   ʒ  ݔ`@ @ @ ( R  d " S0G>ŀ  <D d d 2S `V &`c(0! ``$``0```$`@  "``$`0``$`) : "l ``$`0```$`@ 0" `>" > >ŀ `(`0`b"  `"  p `p@  <@(`0`@@` `4 B` s  B`   @(`26 `"'l2 `$`  $ ``0```$`   0  `$ `d @@ el{ `l"s ` @%>  2gQ`2`d`2 >\@ `d`!>Ő ` "> b`(`8`  $Ȑh $`l * `͠`"*͛&͕ ͓` `$  $0`$w㿘 d`p`tp @ t   2  `p`t`?@`hd V= __g `tN `p BH :F <0-5 >`!!@@ @ ``$ `w0$` {0 `t `p !㿘 d `p"  0`"  `b& O  ``t 2 d  op0 0 `$  `   @(`0`b@eQ 㿘  `d`8ข (@`&" `(`$`  `d`  `@`t`p.`6` 㿈 d 5 (`$`2.  `8$ / ` `     `"       `"     $ `@< ` $ 㿘 `}㿘  ` d"      ( h  t ` d"A` (`$````p"`  ```d" d>>bd`ް  d dd? d@ а ?  d` dd@  d``$` d` ``d`2  2 ( "  (`$` 0  ?2`) ` ` 2` (`$`` @  @  @*  @  $@:   `2  ( 82 ( H"X  (`$`h```p" H ! " H `U  U H" ```" 8``$` 8  (`$ ```$`Ð H"  8` D ` H  8" `` 4 ` 8 ``@     (`$`1 l ~   㿘 d`$ ` < `@(`0`o$ `$ ``p$ ``t$ ``($ h``< ``$ 48`$ 0``$ 8``$ D8`$ @``$ H`` $ T8`$ P``$$ X``d$ d``l$ ```>a2(@`8$ (``h8`(` $ t0( $ p$``< x 㿘 `) >a@ @@ * >a@ @@ 8" 㿘\`"d$@ Ք $ @@ $$֐@&&@  㿘  ` @ @@ @*@  @@ @8 @ 㿀\ ?@!-!>&`,`(#`$ #\#`#d  @ X&` >>c >>c">>c!h㿘 >S >"b" " " 㿘 >S">"a" " 㿀 \` d >a@?`"F"x  `@"*8" b_ @j  V d@  ( $ ,@@@(. @2(  ( $@ ,`8#\#`#d 2 􀤀 &8&&& " d@*  `   @ (2 ( 㿈`2h>a` `@ ) `%``#\d#d#`\@ &@  >``@`\$!  㿀 `\dhlpt  2E 8 G?@7 $86  ,@ 0@#\#`#da  &@&2& @@ 2 ( xd l\` @* 0`@8@ `% @ ,@!>!!8,`!*, 2@*@ @?#\`#`#h#d#l#p#te 5#t#p#\#`#h#l #dT $#d#\#`#h#l#p#tD #\#`#d#h#l#p#t4   㿐   !> !h#\>TӚa!hTǒ    !>  #\>Tƚa T    !> ##\>Ta#T    !>!!#\>Ta!T !> "Д   #\>Ta"T >a>  >łb, >`" $ $ ( " (*`$@" 8"`"*`" 8 " @ `㿘 D @ $ >a` ->̅0 ,`&`@    b@@& @@@@ (`@@ @,㿘 > a`>ų6@@@ "H .``2 >Ő"hZ  @@ +` @.`   @(`  ! 㿘 > a`>ų6@@@ " .`@ 2>Ő"ZV "  `" >b@  @>ŀ`"   @  (`  `$  .` 㿘 > a`6@@@& >Z&"(`㿘 > a`6@@@@>Z# .`.@lj@㿘 :  7  ( @`- @'&# (@ @   +` @)    @(`  &  `" @ ʀ㿈   ɖ@@&@̖"ƒ'@@` ?>''>ŀ@#0!=@@@&"''>Ő#PYn@ 쀢 {`L@@Ő㿘   b & ?&   Z㿘`& `&  ` 2   " ِ   W 㿘>a`>ŵ6 #  @ @`4 >Ő#Y`2  &`@ @&@㿘`D>Ʈ`>,`-`(`@2`>ŒX#Ѐ`$I`4`2E`(`(H``  &] - @3     @9 2@@C @86` ($` @H` @7ϐ`@&㿘#>@ b@`N  @* *  @@ * & *  @ & & & & &O b & & & b@P\ 㿘>a`6@ʑ6    *@ƥ R㿘 D>a @`  $ @6@0@@@& 8J n  @  8$ @ 6 "\    8% {$ * - - "@/     bp   .   b ?$ . .  b"ה   `  b  *@c $*@[  &* ,`@+ $*@M  * @$`  *@> *  @@ @ $ "   ˖% $$  bF ?8  b>  㿘  b6  ? b. 1>O"@㿘`D`9"+`$>a` ``$ @0@`(!`$ ,@?@ْ@! `$@(` @!`$` &`@ @  &`D`H@`2`$`H&`H` >a` 0   `D@`$ `H&`H$``@(`!  @ "`    @   (`  `$ `  ("*@\ @`'@``"` '`` 8`H`$` >`@a`"2)?`H&`@&`D&`H㿘 `* $" ( ( ( ( $  ,  (` "> `>VŐ `" @  & && 㿘`&ʁ`2   `" &  `2  2   " J    Ǘ?@>c̰ L'' ( @ $$ (`' $ `(  $$ $'Ȁ$ '  @(` @ @$  `@r$  $ o      އ)  ( @Ā (Ƞ @  " (㿐1> ,"@   >ƚ`@#\O"@3K H`@"㿘 2 4` (@   ( 4& 4`2 㿘  @PҒ & 㿘  @   @PÒ  (& H` >ch@>b@ @4 㿘 ""` 4`"  "` `" ( 4& & 4`>̰ ( b@ @5U `>p p1>M# 㿘> K#  "" " 㿐1>#\#     >O`H>a`8`6`@>`JZ# H`@"H`(@ " `" 㿘  >`(`@>` @@2 @ 2  >KN# 2@>>Ɛ PU#b`"@ `&@" : 㿘 ` `@$  Ȕ  `(`@`.` 㿐?# `@d8`  ``'*+ 23` @:;  O -`HD8?4<86    (`` ``@O  &'   `2"    > L# 2 `@& (    @(   *    @ @OZ 8` @8  >p @ p㿘 ` "  >Sw p>TR  `@$/ @ -`(`@` ` % `"   "  `"     >L#.`@ @ 㿘  @N 㿘>`a  `8@  ' ``8 8; 8F  @ @ 4 >ƀ` @ ` >S  >a`@:  ` b` >#>aa7≯T@R@2Fa8`D  (`` K ( !J a8`ߤd`` 8.> 4*> 4`р 0`2̀@ @2ŀ `4 4 4` 0`2@  @Ge@31Sv! 㿘>a`>`@#> @ P W㿘d'X@ 5> 3>Ф1>   ;!2@1 2`(`@ X @3   `( A`(` `(X 2   ! `& ! 8`D&'`h  `lX@ f`@, @1k    @3> 2 (>@>!!(j ( (` a >Ɩ  _8W &`Ґ`, @2. ( @SQ  (?C@M  (`" (N (< @2L6 @cP@&`8`D@& 㿀>a` ''@/>`  #`#d#\   @MG  I (>ch@@1G 㿘 w`t& !> @ϐ# "  $ $  $#@ >'>̤a>a@ (`  (ɒ  Ȗ   @ @@1ڐ    `@4 >1a `>a>c,`.`@` `@L p$p`.`I 2 `@  c " @Lђ `p$`p ,    c ~1>I֑ Ё@㿐> ؀`  X   #\ >>Ɛ#KWaH>>#\ КaX (  KM 㿐>`!! c  #$$  `"`Y   ``" ( `@& c * $㿐>`!!`8`a8!@ c$`  \     @`  `! `@2` `8`a8!@:` c $`$`$` 㿐>`! !:a8!@  c $`  `    @`  `! `@2` `8`a8!@:` c  $`$`$`㿘  c\        c  & & `@4 ޞ@`@H@@㿘  c - `I   ` c L $`$`㿘  c   5(> "cO (`,  @``  " ` " Hq   ݐ c  $$`@$ !@`@@@㿘>a```.0@> ,>ƀ`N!`> ʂc܄  ` `  ,` > ,>ƀ`=!  ,> ʠc ?>  FP " " ` `3  `@> !8! c  $ >ƀ`!  u c $ `> G Ё>Ɛ!O` $ > @+cb!> @o#> ((&  $ (& $@V# `" 㿘!> @V#> c(#M `$` @= "`m``@8 `!+`@ 6 ` *`- 24`2@` ?`6`%`@@&  @   `, `2` > @#  !@`  `"  㿘 H'L`0 \D @̠ 85 `(`(` > 0a &@@`C ` ;>1/>`L@%L@ ᨟ŀ?'  `LaВ@  `D@  >@:c"0`@8D.`@̐  `D@w 㿘!> >ƴ#4b@ `& @v ` `& "W        @ `#4#4@K q 㿘6 `(`(` > 0a >aL{>atwu#> ?la8`'F 9> >Ơ#4bP#> @&c0"   2 0!` `& " 0`#4@&  #4`@&  `"> 2 > #40& @  R @c02 > @ِ  0c@@)͔ > & & 00`& 0   0> & #4@ H`@"H`(@ ">a`8@> ˄ `` ` 8@> ˂` ` ``@>`0`4> a`(*! 㿘  >a`ؒ `$` @p    (  @ `ܰ `$`܁㿘  ʐ`  @ @ 㿘 & &    , 10- `@C  @6   @  2 ϒ  `$  &  H`0&   `(&  >`< 㿐%>̐@ Y %!>>M}"`@ !@' $@ X`@F@+ !@,3!@@ ؁㿘 @Ք Ų @z 㿘>a` `` >`0`` >`0`` >a>ƺb>ƨ b+>>Ƭb +  4`" ( "  (`! (Ւ  Ђ`&  `     w   "   @-X   d Ȑ`@85&   Y `&  @M = (` ( ( C (`  >b @`> / >Ԃ` ԁ cP @G.&?@,b&`  @@+Ր`"   @_ @ "    `]&   >!!.@ 'Ԩ'Ѐ'؆`?'L'D '8LВ  R L 'L   X8@ @ '@ 'L H`"4 DL` 0`+ g  s `H` ܔ    `H` N>@7o" F  `%  D 0D:  " \ ( > ˚`@"@0@8 > ˈ ` $ @ 0@+"@  @ 'D        @&  –`\`2H "E  ;> ` "` (`2` 4`2 ` 0`2 `b@ @*`@&@8  . &`B @  @ . %@.  'H  PI'<>@ؒ ?6&"3&`?-&@& ''H #> 4`  (`!@* >̂`%  `8@a<`X@? ? 0>`@@@Ht "s'` LL @#\#`ПP Ȁ 0k `'% H8\ `@?&@L` @ C #\ @#`#dP`:'@@?  *`0" >@'@** `% 8`H>@Є@? @   ( >!`@& '쀧 ΃,`В} "`]LU`4;`L`25 `3L   @+  2 >"@*)>b@ `"4 4 `(Y (@)&C$ AN L`"H `$D !`%!    @*͘ `?` 2 ͐Ѐ`2  p h2  ̂`% ́ >Ƃ`"% @)В( A "@ @Ζ  &`% ` @@L>a8(    p h>"L` @((ؒ @)=ЀL?  '쀈` `H0````쀠`>0`p > 0 ` N  `%  'H8\ Ԃ` @?@L` @ C #\ #`#d   >G >Ɩ G#AL`H` D? '    @d"@   쀤 `쀢?`@( (` 2 G (L`T!`%!`H`2 4`L`     @)  (`   (@(В  >d#@(͒(  H>b@  (`   (   @'^ @'Yo'   8 `? + @)u`?`.쀢?@(> (`  Ȑ (i `> p h>̂` ́ & >Ɛ# `P% Ȁ?!`@(c%!`>b@  (`"~  (@' ! `%!   @"@I @@L>a8(  L(`(T(j C   p h2>Ɛ#0@3$L`@'("((N  >a@E`c(@'(`($(: CЖ    㿘%>       aP8`0  aP8`8  aP8`   aP8`(  >!  aP(  8`P>=`@`@2 (`8```"2)2D> D D D>`0` `>́` 㿐>aؒ>џ@ @&Y㿘@ <& <㿘> !Xch@&!X㿈>> al`> lch>b`d#\#`@A#d#h @ >a`8 @  >bP 㿘>a`8@@@" }~ F$`.@@@,> ch@Á>a`8 @   @ 㿀>'LaL 8@@@@.    ' %@#> 74 />̬a`@ؓ, @@ Z a@ @ & > 'ch@ְ "B #>a''> 7aa` #\#`  @(ܠ %>%> ` `' 8@ a쀠2L&@@|' Đ@'@ܗ> ch@- 㿘%>  h>a@ ` @ f h@`8@ 5 h @  㿐>a`2>Fː#@(>@* @ > cd@@]A*@..@| V,㿈``e` @ ] =cZ>@ @a @8@@@ (`  -> ;@  4!14 `(@@:'&$8 h @  h   '@'h @  @   $@ `Ɛ H`(@ "㿈(``P (``">#d@ؤ &&&>Ɛ#@؇(``" >ђ @+''>'>̨`#>@ a@$\ 2">E#`"  @'a ؐ@x@'@@:(``@>a`@8@ @>a8 @㿀''??c# (`(`?```  >a@Ð `@#\#`@'R ` (``": >#d@>c (`` @Y  `(@`` '􀠀$`>`0` ` @ >  #>#>@Ґ#d5(` @ (`c#>ƨc@@` ,#\'#`@  "`(``  (`` ǖ @@&ݰ >'>ж`%>#> 8(` ` В @ 㐟@ a@' 2㿘 >a@ږ!>@|#d#d    $ (@ `>@`#d` > ch>a@C @$㿐>%>̦`!>@  !@#5 >DĐ#@$y! ؁P>cd c#c#;> />3@. &`2 >>Ɛ#     `$$@@L   @@ڢ ch ,#`$@#\ ??@F` ",@ @  ,`@`(@ ``$ @ΐ,` @``ch@@  `( C 0>>>Ɛ Ĕ>ap 㿈!> @֣#d#d `>>a>a`80`@8`$ @8@  >cd ` >cd h( (`@  )>c# /> )!4h` ,, '#\#` ?@? 2 4 !,``@@ 8` @  ' @ 4Ԃ @,``$@c >cd b" > "㿈>a ,` 0@ @.@@ >bc#>Ƣc ,d'#\#`@f 2 (  ,?>`Ԗ?㿈>a ,`>b`dc#'#\@ #`.@ ??@= " >a >a 㿈#>a ,`>b dc#@.@'#\#`??@ 1> ch`,&@>`0 >)>'c@# d  (!8 @ ᨅ8`@$D@ @ &@ @{ @.\ ט " @[&@㿐 @ >a`  @ 8 ' '@}@  @3 @( 㿀> ,ha' .4@c##\#`??@  "`   > ch `, @'쀏 '   >a``h`p4@ 8   2`\`d#\#`@$N쀢   @@ )>'>*!>@`` `'`@  @  7`(``8㐐@  !!  @ !8`F@㿘'>>Ơ  c<ᨒ@ ͔ "`(`"`(H``  ʖ ᨅ8`@d@` `(@!Րp$pᨅ8`@D4Ő㿐>a`.?@?@c##\\#` ?@? "@> &@x@ @ @@  2 @>ǐ 8A@ I@&@@  > h㿐'D iD>b!> `d H@ , D>т`$ H HDc#&@#\#`D ?@t? > >A > > `H hHo&(@gHp@㿘` ```"H@H&H  * @@ @  @*@@ @@ ! >a`1@ ( (  $ ,@@@   2 㿘 ( $ ,\`d >a>a@ @) @# ?@9y c& @(\&  ?ߐ#@@&ysM6N&G@ 4   G ! @!@ * 9   ! @@ . 8  @*@ @( @ & @  && @8&&@  ` ,`d*``d*㿘  d@& d  㿘` ```" H@ H`& H`HHI `$ @DB`X`>X`:`LL5`PP0`TT+`\\&"`D`00`8` 8#@@<@`D`"D@`  D` @``?㿘 ܒ & H`  @ $@@   <\` \>a@ J `@2D>c@B D " 4@*4 @ 64@*<8@* X<@  @@X "@*  @  `H  `` @  @  `$`(@@>a@: 8   `@2  D>c@:8 D" X@:8@:@8 X X2 @:8@:@8 `H @:8@:@   <@:8 @ @@:@8 4 4@:8 8 8@:@(`,`(`$ 4  8  `<  `@ ? 㿘`H``" ` "G `  @2#@`$  `r ` &` 2  &$@b$ ` \$ ` $$ N` $`2  &$I$`" ` 2 ` $ $ F@2#``$ `* ` &` 2  &$`$ ` $ @ $$ ` $`2  &$$@` "`` " `"a  ` 㿘2 ` 2#$ &` `&` `А`` $ `@2  &$&`  "``"  `  `"`` `"` `` `2'` 2  $ $  ` & 2  &$ & "```  $ &` ``&` `o`` $ `@2  &&`~$2# $ &` `&@ `T`` $ `@2  &$ D&`  "@>@"  `27`  `"Y`` `"U`"  `2(`  `2 `   $ $   ` & 2  &$ & "@@` $ &` @ `&@ ``` $ `@2  &&`$   " $ " `2 & 2@2& 㿘@`A`?`"   $`" &@@2$`$@  @"@<`< `" &@2  `@@` ` `  0`` $`" &@@2$`$@q㿘  ` @?@   2  &`&`&@  &` 6" "C$ ` @@ `  2   "` "   㿘 ,@ , 0(@8' "% M  H` $: L(,@L@     @ 0 㿘 `@2 >c@@G`  =&`@ ( $ ,@@@ *& )&$ @`~@   D X k?  " ` "    6  `㿘>a ,* 0& H㿘 @n `$ @\㿘 @d  @R& `  `>a4 㿘 ` ' ` >b  `>bH 㿘 `%  @* `@ @  Ah`?`"@ `3 @`" (`& ( `>` 㿘 `2, (>Ƞ a  @  `&   ј  `@( ! @א ` @  (`& ( ` >^a @㿈@  ,@*߰ 08۰   ޒ!`` O Ⱥ 2 $ ( ,@@   ; G   @* H `D` `0 ^`\> x`W@`$JHఒ$ ?> ; "" `0> 4,> 4`+> 0`( (@"">>@ @>`4 4 0`>` $ `$>:!>`@2` ` (`$쀠` `P` `H`@`8 @@C   @C   @ "   ? '''쀤`` *a`H  㿘 7t>:L!`"" " 㿘  @`2% xx`"  $2`, , (@@$`,$ ` $ ` @&` 㿀@7t`Ѐ >``@" :" `,#`#\ ` #d $`$#h (`(#l ,>#p9"8㿘> ta`c1 d&84 A>a` .㿘 ```,>X>&P X P+1>!@1>#1㿐>b `X> ˄`h X! X h2 X    #\>>ǐ h3&b!>   # h#\>3bȐ#3  h   #\>>ǐ!@3bА#.g.㿘>a`">ǒ9l"` `$*D`,&$&(`$`(&H &8@&< @&X& &D&@& &,& &`( @&&`,&`$& &`,&`(`&`@@#`H`` `& "`,0`" 8``"8@8@>8`,`[㿘'!  L X`` `2 X 0`2 X d  X`$ X%2 H     `  $@   Ll`2 HF`   Ք @`` `$`L` `X`&`X  $ܐ@2`H`  $  L` X$ X2 H`2 ǔ         㿘@` `H`` `$&`X͐@2`X㿘`X`` `$&`X껐 H+ `b  &@@с" 0` 2  $>@$ > ch `, $ 0"̒"@ H$ 0$ H $ @㿘>a*> 7a c @ "pk㿘 @ D?`>8`Ԁ`D> R>b`X .3>a>>ǒ`>ᨠ >7Ӑ# & a@ h? `h. .  @@(`>3$ >  Ic >>6ڐ#P>P` P>b `X . `ch2 >>-Ɛ!@ . `-#  . ` 7t`&& & 㿘`l ʒg@ `&`$`(@ ` @ !&(2&`(NL&`( `,` !`(@`$&`(E   `@2`,c `,@ @&`,@$@" ," " $" (" 0" 8" <" H" P" L" T" X" \" @" D)>+>2 `㿘  @`2  ( $" , v? 㿘\& 4& 8& <& @݁㿐    @* 4@  8@   <@  @@ #\㿘 ` >a> ,c>a i  " 0,@ $(@*.,`* 0 @8> c 0 , >at 㿘>` 2& 0  & 0& & ,& & D& H& L& P& T& X& & 8& 4& @& <& & ( >ǐc @ْ @">i c& T ` ( A >6S# `㿘  $ \"㿘`@Ȑ@& AB `& \@߁㿘 >,> h ڰ㿘  &  ( $ ,` @@@ې  ` `$2 ` "` &` `$`(`,+`&``&` @& K< &㿘8f p3㿘 +㿘C@8>  ,@*`0 @2   ` 8 "$ $@ @:  @($ \ǔ$ \  @* $    㿘@@8;  ,@*`0 @/  ɔ `  $@ @: k @($ T$ T`  @* $  `  㿐 0@PM ,@ I G  є "'` @:`$,`$@(C􀠠!  @$@ 0`D`H` ` H `0 `8 `< `$     㿘>a`8@o `, k `0``  ( ` N $@S H`N  H`J  $  ( ,@@@` "`  @ 0 ``2 $@ , H,`X`"  X` @: X X`  $@ ` `  `2  X` @: Xm X`  $@b 㿘 @ ,@* 0 @     $@>%>  H``" Py @hs `>3# "^  * $X Q H`M   L@2 P@@A: $ $@  "$ L L$ P@$ L L"  H`@?` 2 L X`2$ X Lx  $@  ` X@    $ Ϙ  2 '>Ѐ  * $  㿐 ,@ 0 @^  $@ `"`  ` @:''?􀦀@ ```|`H` 2&' `@"`H`0` `H` t` `$$& t`H``$`   @ & `` @*`$㿘`\`$(, O$`8$`<$`H$`X$`@$`D$` $`$$`($`,-b&`(&`, U&& @$@` @2 `(q&``&` @ $`$@ )㿈 '', >2#\#\#` 8 @ H H \ 0 8 L P T> @ D& 0> 8& L& P& T& \`& H>a @` $ `" 2 6 @2& @ H` 0``  8@> 8`@㿐 $#\#`"   H D` & H $ > @a`" ۈ2& D& @ H` 0``" H@ H& 0& H㿐 $#\#`"  t HD` " H`2X`"D   ~ X` D "PH`P`" H>Lcx $@ H`&H`> L@cx  $@ 㿐H`   D  $ #\" #` 㿘`3`" D D   $  @"2 H``@? 0  "   0``" @ `  `&    >`a ̀`㿐  '1'@&@]    㿐 `&  , 0  ''@   㿐 A  " D>1@ ( & D D`$ D`  X & X' ,'$  $  @'>`0` ` ͒   '    '  ٧? @t&㿘 \`& \1>( h㿐 @ <''`\`21`  d`@Z`@H$``,`0 Y `d `@">`2$`, $`,$$`0  @m  $ <& @ѐ 㿐 ''!    ֔ ˒ 㿘`D`" $ 2 @ "" $(&`$>`(Ӕ&& @&㿘0 Ԕ   2~ `D` D`ﺔ   2㿈\`d `H#\#`#d#hӽ    X#\#`#d#hӬ  p>a`@@2 @*  ,'䀦@ ' 0@  j  (,@@ H`2 " $ H` `"  , H`p  "!>  @* H!> #h * >aP>#ha @&@#`#\#de B> &1> ' `! &@ $@#h ""@#\@#` #h@  P" L "  * H  #h   ذ > > ch    |  p'P?\ ` >>a@>aP>a ` @@8@> >a `@''4`'(@ @ ` @L > ch  `>. X :   .  .' ] '@' `@2@>c@ :@"@ B " x @ >a` `@䀤`@   # [ 䀈`"*  D`%#\#`#d#h* F  `@Ȑ D#\#`#h#d,  `@"#\u#\#`#d1   `@#\#d#`   P `?  2 @2 @> ch@, @@#`#\ "c <`8$`L$`PP$`X$`04`$`T4 `$`\P` `H` @`H`$`H@`H` $`H `H$`H2 $`@ $`H $`@>a` @  *`x*@$`D   @@ & P` @ t@O& t   `@c    x>aa `@7 ` Ǣ ''    ݢ  '   ''@ @  " B >a`@    * * -@ D` #\#h#`#d S#d#\#` T  "@K #`#\ >7 `$ L$ T$ P7 $ 0`$ 8$ \$ <@$ X H` $ H  H$ H2 $ @ $ H" $ @>a`@  *`ԑ*@$ D  t@& @@q & t  (   㿐 @O ?">>aP >a@ a @@?  @@@*@V`  ''$ [`Y  2 (`0:Q `  @`2@' $@@< 8'0`$`(@@@*@@#@`4(`<`8@ `<( '`@@' ښ  ' `2`,  f "&@㿐 <  `0``,  `d` d@" & t  ''`  @`2H$AH`` > `2T>Ȑ +` ``, HŘ  H H`2  H $  @ @&  H`  $ t [& t 2       㿘 @ ``  @`2 , 0 C @' @&  ` @ `@ & `2    հ  @`2 ` H`$ @2X>a`H`` 4  אּ   @`2 , 0 G  ` @@ `  2  x \   p   X  8 P㿘 @ 0>=`& > b2#)`8(` 8`(`2`" `8l ` 6 #:  `6 `62$>& , l@ @& l@&   @& & (& & & & $`\``H ` (`>ń@>  0> !T> a`ܐ\ >a X'  \ `@`_R P d$ X@* $ L>a \'  X `@`_6 4 d$ \@* $ P>a `'e  \ X@@`_  d$ `@֑* $ T> c - 㿐> aؔ @o  y>9>=`' 1(`8````2'0`2"0  `8l`8|``"|` |@` |@`(` 2)>Ȥ a>b("bm* bi@4` $ 2>`0 (`@ `  h) @ +`+`)  )  @(@ (` (@0` # h  2>9`>  lc0@8`s &8 &8 &8 &0 &L &| &``@` `>`!! !\!`!!`9!>` !`!` ?C ?`  Ĕ_\ >a`8= c @ ~`{8w  8t @@ q @@ m@ j  @` @ `" 쀧`ހ`2[ ''/`'->7>  1%> @>a``- ``h  h @  h p ' #   @@@@Ю`!> #h 풔 #h>a@   #h E :  㿘  t `">a`H`` 6  $ @@8 @ @  @+@    㿐>`a\`h@` @ ( &@`@n h'@ ``?@.c`* "& @.7" T` ?ٳ  2T?`` ?٢   ``` `  `@@( `?/ (@@@@#\#` 2Q`@㿘>a\`@` @ (&@`@' h@ @  c `  ,`e 㿘   E 㿘@` ԝ   aP1`d  2 #0 㿘>@a``8@@$`8@@8 p 2 @  2  㿘>@a `8@&@$`8@@8  H  6@ #< 2 @ Θ 2  >@a```8' 8 @8 *>DŽ@  >a4    @ `@?(` % `"`" >a`8"@8 @8 @   @?  >b >@a```8!8 @ 8  >bX `@``>a`8"@8 @ 8 @  >c8  㿐>@a``8:$8 @28 />@+c'  H       '5'     @`' ` ``  `c 2`  (h`>a` @8@d@ @@뀌  @8@@>c@'9 ` ` `(8&` `( ```2  D `  T@H`  ` `j&` f `2  `2` "` ?``(`0`` ~   "`a@hÖ 2p` `" f b 2` `` aPt` >a` (@c 2`@ E `#\;`aP` `d#h#l-=2` `` aPt` >a` (@c 2`@   `` aP`d#\#` [  `@&` `&` B  㿐!>@!@ ``(@?20@@    ɰ ϖ   Ӓ ! Zb $  "X  @SH`"00@` ` !@@, @  0/0*D,  @$@ ` ,! (``!` `8$@@C @  ,! @@ ׀`0' "  @    ` Z r  㿐@`' `@`5 ` `@ ` (`  (`'??` >' В &􀠠  ` N" "" " H`@"H`(@ "|` <` `" `"; ` @ 2 `` `` "`2  " #`     ! !   `  2  "! = " `2 ` ! 2@ 2 ` `  `` "`2  " #`    ! !   `  2  "!  `"`" `ڀ 2j` 2 "``"` ``` `@2  ""` ` " ` `"```"` ```2`2     ` ! 2  " ! ` ` "` ` `"` ``` `@2  ""`h 2 "``"` ``` `@2  ""` `" `2-` `"E```"A`" `2` `2 `     ` ! 2  " ! `` "` ` `"` ``` `@2  ""`   "`2 "2 `2"㿘`` 8`6 `"   "`""`@2"` "` @"`9 `9 `""@2 ``  ` ` ``````"`""`@2"` "``㿘  ` ? @   4     2  "`"` "`"` 6  "` 4  @8   4   8  2  " ` "      " ` "     6   ` `  ? @ 㿘 U  (s  ` 㿘   (t    ,& `& ,㿘> &  & '`A` AѐH (㿘 `Ր`  ,$ `< $ ,> c> b(@  @ ``!"@ 0@8`0@8`@ * *  @?㿐>a`6ְ ? * *  >b(((H ?㿘 0`@ (` >b `  ( >  ("!>  `  >b ` `  `>b `  ( > > `  0`& 0㿘 0`& 0&>!>& ! @  ` ($  $ 㿘 (` >b `  ( >  (, > b& &  @ &&  @  (Z>>ch`  (` >c@ T 㿘 ("! 0  `  >b ` `  `>b `  ( 3>  0`  (@  ` >b `    (>` &>b`& ` `㿘  (>c@㿘 `(>c @>a `> c1>0b0  ` ` @  &@㿘 (` 4` (ɒ M`" (`" ( `  (  @&  ( ` >b `   >  ("  0  `  >b ` `  `>b `  >a` ` 0`"  & 0>   ` @&  (ay f @c㿘> a)>/'?8* (`` ~ (` " ( `"@  (@ @ԁ`˟k  (7  1  &㿈>OaH`>Oa>a` 8b  8`  >a < ` 8` 1> 2 @@ + @8` 4 >O & @ # >OaH`>a`D ` 8`  >a`8`B4 > @ >#8      `?>a,4( 8(>`0`>b`@" >Q`H' @?`#\'#`'     @  5  (   㿘> c>b`$,, >b(^2 >! 2+  :' >a`(&  `$ q$> `>Ȑ!P ?@G c&   2':$>a`(@&  $ D$ > `Ղ ?@ c&  ?耤6 '` :!>a`(&```$`@$@> ` @ #&` 耤6`  㿘>`  @! >X!x (@@>a `@@㿘 \` >OaH>`(0@>Oa@ 88`b   >a <8`b41>2 @@8+> @8`4 >O2&>@#>>OaH`>a`D `8`  >a`8`B > >@a>ꤐ#8>a>`0>%>Qb >Ȧa ( 89>` @H  @  (9>! @>!!*@ `2@ՐV"'`7'\266@㿈''>!!>!  `@(@0#`#\  F '.D '`0`( H@`` `'`@ " `2㿈> 7aa!>`!  .0@#`''#\     ' 0`  `'   .  MD H  (㿘> c > b(>8"  >Ȓ 0"H1>-"` &  `?`G > ch$-` -` ٕ@  >"1> ">a.  &`@&`D&`H&`L4@*ᨀ@ᨀ >Ȑ`(F" &`0Ȑ#ᨢ``P@2&`8  > &* &* @>> c >b( .`` @&.`.` >b(?@ @ $$ $ `$  $ -`-`$ @$ > ` 㿐)> #+>`a#>3!>3`@˒ ` @8@@$ $` %#>3>3`@(@ @:>#8 ศ(@%>O >Ȑ#hL@ ! 㿘> `` `  ` ` ` `@ `@> c`> b(  >%#  @ &#>aa`P @4** * @` > b(<+>  @(>Ȓ!#) () $  ?@ $  @ D H L    `$  @P2 8   "@ @(`(`@ $` @R@c@& >3!>`! >@(&>3` #H( @(&@ $ `$ X $ T$ L $ ( $ , $ \  $ P>b `$ ` 4  @8   4   8  2 H`@"H`(@ "㿘>ׂa!>& @#H>& b`` & $```D ``#H@ǁ㿘)!> a  ->@+>Ѐ;9 2(@" `"  @̔  (`"(@@ ( Y`` c " `h@cP@  (`@&㿈'XX `@` ` ;`#\@&'@ & /`?@ ` @ `@ @`? `" ` N``Ge ``:X!`    `(@"` ` `>a`@Y`. ` @h '@@d '@ &@㿈 'X`X`@ @& ?@@?耠@4 ?耠@쀠@(?>a`@@b8`4 &2  @( & &@@b*`&    & /> `  8`@@D T`(@` M`` ` `2 `(>@ `( `(u `(` 7`( n>̐h >@ `2?&(`&@`D&`@4`@@8`@@2`쀠@```㿘>a4@8@*2>@&!(& 4 (@(#>&La4a4 `2>&>@!(`> ch5Ӻ㿘>a`.@>є@r 㿘>a 0` 48@@ 8@(``#` @ "  0>0``  `,],   @ Hɦ  />%->  "`( `(`@`" "h@P@  ( @ ( ܀`C>O!㿘> chը&㿘>¦@!(> a4?c>`0> b(>Ȫ c+@"( ` ܐ`" . `@@(@ 8`2 ` (@@>$ @N!(,`@`8 2     3(@5  㿘@?%>`` #.@'>Ѵ+>̤`0a`8   @ݠ &@`2㿘>q!4 >@!(>b`\ `\ ``> c @` @2H`@"H`(@ "㿘>a`` 8@@Ϲ *`,`$`<$`<`< @Ϭ, $`@ $`@@Ϥ $`Hh>a`'D@8@'('`' # p #'܆p '5>9T7 _ >OaH>O`ܚ@ 8`` & @ (``2 C >`$ @ "`(,`$$,@````4`(f$`4`(`2 0$ ` $$"(0`$0 `$(`( "p`$p @e `$%@(`4"'`(hp@2l`ΐ٢@2`(" `(`` "`(@l ` ``(@" `(` @E`c`( @`(@ @ ଀`D$଀ " `    @E % @%C@8'@S  2  ؃/`  % @` ۔``쀧@&x''@  "@@@4'' 4`$4#\#`@?#d     8@$8`I$`(@BDC@`@ `(``(㪐`( `(` "%*$`@ @` @>>h@`>h@>P@_ ` `(@D@ @ `2>O`   v 㿘>OaH>`>Oa܄@ 8``  >  @ @ @6!!`l$!!` ! d`" >>Z# >>T# >a` >d`>>E#>a  @>OaH@ `!>O Da  l h   p@6@ "  @ :c# >b!>)a9>L;`(`G@@```2 `(`4`($`4`(`27 '@"`(`` " `(@ ` ``( `(@`` @`  @ `( " " @a<`%a<` < @0`< @0` 2`(㿘>`0`>>bȄ> HaL\7<@Z`\`L ? `\ `D% \% `@> L 0@"   48@ $ Hod4 (@e @Hp@>0 `  @,H@ 0㿐>`0`>b `@Ho@>a3` >c>Ȳc>O;> aH>cl`0/>O@ 4`2  4 < ֘ `$ 4` cl```$`'` '''@ɐ " @̼@$D`$D` `0`ܖ@ 8``   @ : 9 `  " 2 *`(*`" !@*`jj`1`@@8`b 9 8`  `2`@`D ` 8`  8`B @> @k,``ᐐ` `$``$```0 @$`` % 8`@ v@7 `L%0H㿘>`0`>b`@ >ΐ  i  >Ɛ (>8`ܹ8`3>@"c>#8N1>c!"H`@"H`(@ " (2  |` <` `" `"; ` @ 2 `` `` "`2  " #`     ! !   `  2  "! = " `2 ` ! 2@ 2 ` `  `` "`2  " #`    ! !   `  2  "!  `"`" `ڀ 2j` 2 "``"` ``` `@2  ""` ` " ` `"```"` ```2`2     ` ! 2  " ! ` ` "` ` `"` ``` `@2  ""`h 2 "``"` ``` `@2  ""` `" `2-` `"E```"A`" `2` `2 `     ` ! 2  " ! `` "` ` `"` ``` `@2  ""`   "`2 "2 `2"㿘`` 8`6 `"   "`""`@2"` "` @"`9 `9 `""@2 ``  ` ` ``````"`""`@2"` "``㿘  `8@? @   2 8 "`"` "`"`6  " `8@ @ `  2 8 " ` "      " ` "     6   `|` <` `" `"; ` @ 2 `` `` "`2  " #`     ! !   `  2  "! = " `2 ` ! 2@ 2 ` `  `` "`2  " #`    ! !   `  2  "!  `"`" `ڀ 2j` 2 "``"` ``` `@2  ""` ` " ` `"```"` ```2`2     ` ! 2  " ! ` ` "` ` `"` ``` `@2  ""`h 2 "``"` ``` `@2  ""` `" `2-` `"E```"A`" `2` `2 `     ` ! 2  " ! `` "` ` `"` ``` `@2  ""`   "`2 "2 `2"㿘`` 8`6 `"   "`""`@2"` "` @"`9 `9 `""@2 ``  ` ` ``````"`""`@2"` "`` " ` "      " ` "     6   `|`< 4<` 8`"8`@"; `@8@ 2 4`4` 8 `<<` "`<<42 8 4" <#`4  4 @8 ! 4! @ < <` < <42 8 4"! <= 8" 4`@24 `@ @! @2@ 2 8`8` 4 `<<` "`<<42 8 4" <#`8  8 @4 ! 8! @ < <` < <42 8 4"! < 4`<"@`"< `@ڀ 2j@`8@244 @"`@`"`8 `<`<` <`<4@2 8 4""`< 4`84"8@` 8`"`<`@`"`<8``@`2`@2 @4  8 @ 4 <<` ! <<42 8 4" a`<``8`800@@@2&) ) @@@2 &`(`(00``"&`>a`<``8`800@@@2&) ) @@@ 2 &`(`(00``2&㿘ؐ (& (`(`<0``@` (`@ `@` @(``P>` 㿘؁㿐&y`"АĐ`<<@&`< `<` <<@ <& <ג(`&(`<`(0` `"@`(`@`"``  `(``P>a 㿘㿘  >a``8 0@>a``$" 8`80@@ 8`80@0`@ P @  (`(00``" P㿘>a`8``<0& @C 4&@(`(`@, @, @ @     @' P2 < &`<t   &<;h㿘  ?" 0 , &`, `,&`0  @$ &`,&`0 0`, @& 0 >b `(@( 4@82㿘>a 80@I)  0@ @18`8 8 8  @@:28 8`8>@a` 0  ! %` @ 2$ < ``8 8>a`00 <@8&㿘>a`<``80@@@ >a`q>a` 80@@?2  b  8 <0@@" ( 80@@뀠 (0``@L  0``@A  8<0@@ "(80@@*( 0``@& 8<0@@ "(80@@*(" 0 (0``@T 㿘>b`,> aĬ"(  :, "(@:,(`", (`@`` `80@`:@ 2`80@@:@0+,@```2` `8`<0@@: ``80@@:` `c \ "6`<`8 `<0@@@(.`< @m`<"@$`<*` *`@@ "`< `<@ `$@  `&`< (`(`@@&`<(`(`@@ ``<@ `?(( @"$`< `80@@@8$`< & `2 ,` Y,=㿐>`0`` ((l>c>'a'>ɨ`H$@[  ? $8` 0 8    @16 ("! @1   `$@@$$0Ý㿘>b`4@ @( ` " ` "   $ $`8 0  2 㿀>`0`>b @!>@ >a` ^6 @  @ߐ >z P>8`ܐ` ;  >׿ `>a >ɦ` 8?''' ' $ 8 < פ ``0`   6 E 8 h'X'P'T`\` X #' `X 'X' '쀢'5```' ''(@`5` '5`>`@l#PP'T  '''̄  ''X>P>T``  !>, ( '؀`",` @:z,@:s,:L'O>'8`0@*X TԸ?%>`8`<0@@Ԁ@8T` ̂@8&$ @8 % @:Z'  Ȣ'`` 2䀠2 ,,`",`$$2@,2}(䀠` @`  w @`D   m @``> `...@ 3X>>Ը#8> @w#!>! > @#@m$ @ `'2%@m`(a` $ 808@$ $Ԓ $` (a"  `$ `P$ J ( ` `,` ,@'`͐`( 㿘0?b>` (@"@ϐ@%!  (>@$#> a`8``* $`   `>$8`0861>3$1>@#㿘0?b >` (@@ِ P! (>@#>a8`0@8 `0@  $<`, $$`, @   $8`086  $  8.@ 1>@#㿘>b`$`2 DꟐ D   @ul D $$ $  $ $ $ $ 㿘!>@#F "{# @:w#@t#@|#6 ">@* > b#$% % $%  2 > 0@@ga`2`8 ` `2r,><a8 0@@@($` 84 &E$<, $@, $ < 11 `$ >-#$>1>#(#@㿘>a```8@66@om>@#>b`( `4`2">` @ `" , @ ,` 0 `0$0 , 0  $`k$ $c(Ԁ ݀ 1>@#㿘!>" 4 ,$ 8$ ,$ ($ 4 $ 0>" a`?0@` ($` ƒD> 7a     `@ 4@ ` 8 2  `@ 4@ ` 8 2  `8@ @ ` 2 8Ho$(@eHp@H`@">b@2$D`$D`$H dH $H$D >d d 2$@ 2 >b&$D$, $D 2$( 2 㿘 $$@"$$㿘> b"  $    \     `  㿘>b  @ 2  ""  "  `"    " >␈␀`" ␂  "  \˔ & &$D $D&$H  @$ >d` d㿘?$($0& }  "$ >ɒ+!$ > @$$ l @ l㿀>a`d`J'>¤<␀`"5$D$ $@4.$D$0    #\#d#` 2!$D$D`$H dH$`$H$D$D $$D`>$$H` @$`$ @$$ l@ l$( 2 ` `2``` &  >`g@㿘 ` `$X& #  " $T`&$T0@H` H$T$P & 㿘   < 8`< @ $`< $  @`$  `n>_" `"`<`0d$`0 $`@ `2T ``2 T `2 T>D!UT$Tm㿀>b   #`#\#d X >+!8&$,&$(㿈>’ E!`8`H" " "" &`<6> . . " $X$@8`'@ ۚ  耠2$L쀠2 $L>!H$`y< @  ’ "`0`,`@" 0>`" ," " 8" 4" @" H" \" !P" c!" `= = @ @ : x "  " ``8  @" !$ `2`$  $ `8  @$ $  $ >a``>"`` `ma$` Zې>%@D`2l$L`` $```0&`@d&`0>[!T㿘> |a x0(` ( @i  2 0 d& @& 0dTjd($@: d@* `2` ``>+!pKd@n)>& |M& x^㿘`d(d, &`= 2 d(d,   d d$ 3d@``&`sdq]d@d@>8a<!@ d>h  @ h)d@ >ߐ!g >d(d,bD d0 \p$``0Н>8d@a< @!@]  ``2 4 `(`(` > /b`"s @( l a@pc e>8(  0`@ [>8(`8&dL> `2  &dP4` , @dXޒ &`>a`4 < , * @@ `   3 > d4` >S #\  \   &d0   >H!j1`&d`>&`h h >8a<a@ے 8> 8a4?b?2 [>>>bb'r O4 5  ?>ɚ ؛3` [@3` ``a \>ɒ [ \ א$ \ Ґ  $$@pʐ \  $@p$$@ >`0`  Zn@ \i  \e$H> `#@`>a`d &`1>`b >$a6$D$  @\8` (0 @$7x$ `$  $7  d$D ဤ` `2`& - > `$6 > $ 㶐 D'؂ '?''''e 2> @`w```2 (``"`w `"`Tr ` > 8n a0 \ `"   ݔ0\ \ а 0Vq Q  \ $ \   &@&``?`T` &``2@& \ &&@oĒ7 # >``2l \  \$0 )   ``" ĐmƐ> *#㿘 @ , 㿈%>@I'>``,@6$&/ ᨠ''9#> 7aa` #\#`  b  &Ր (@` ' @`  @  x>a`''܃6܂```?'H(`@8@(``#6``縒 > 7aa`  `8@ @ &   @ В 璒  @@ /@ !  )>@m!,@f (!@榒'   Ѧ`  >`0`>b`@  `>O0!袒  `慒0   `@$`0>9`$`,!Pc!`$`$`H$`H$`\H%>8@:`2 * $`x2` @$`$`|$`jܐ>a`.$`8 $`4$`$`H` H`>`0`0`>b`@`@ @@$`0>Ղb$``R Ov`0d@ #(``0d2 ` ` )>`!!@m !` ```i!瀠` ` ">OjT>O]! 㿘>at'D` t p p D   >p` p   `?>a*㿐>8> b>a `d > 6obh "#\>!#\>ɒ "( \ ؚ >€  b>ɐ"0    !>’ !#\>bX! !>’ "   #\>b`"y ā㿘  @ >  xa`( @  aP0 @`0>`2$ x@ ($ x㿈 @ >a`8 @ *,  aP `&@  $@ "  p`(@@@@ @ @'&@c#\#` ?n?  &@>ɰ "p` p&@0@  @@ ` p @0@ $ p 㿘 >y" >a`8сH`@"H`(@ " `" p@ ` `? `> b`a & ϖ  ` @ @ $@ `?(`f`?` `& U>a` .@D '   ('#@ ''Ԃ'>?'''`0  @ ' [ B ;   a@   a@@ * `@>`0` ``&@> >aa6%    . @l")  & `R @ (` >b 㿐d @>ɠbؤ >ɴ bȪ3>'>    #1>! ' (`"  ( 2   ! `& !8`@Dې'R  `2Xᨀ+"S)'    ݗ '{ ( (`  ʾ  &`א`"ᨐ  ǘ  (` ɹ  (ܶ ( @cP@&ᨴ8`@D& 㿘> @  @> $@8@>֐"@>@aC?` 8 8C 8  @?`>a@8@'؃(``'ܜ# p`''8 8; @ '  @ 8C 88@?F     @ `@ `  `%>  ( 8`@D耥@ '''5>̒ ؀`(` `(`+```'` " (`" (@"(@ (` (>@ ((ْ ( Ɛ(`"-``0`2>@  >>(` ( >ɖ ɧ>8`e@ ۹}> @ ` `Ԑ '';`` #\  ``"Ԑ Ԁ L `P>H`. `@2A``(``(u`( cQ `>P@``0`2$@ ڕ"    >#>#X'@ E``>8`E䀥@䀠` >&     c ` "   ~& /'܁㿘 `  2 > ( >  > 㿘 `;`&  `H &    l >ɠ  c&  ȵ  `  `& > #" &  (" , , , , ( &  Ǯ㿘 `E&   $  ` `    ) 02&         `& >c`& h  ` `  `b `  (" , , , , (  ` & ei㿘>ߐ#p>c> cxcx `  (@2 ( `2 ( ``b{ `$ cx`$ 0 0$$cx ( 䀦 >cx ` b (" ( , , ( ,  }& q 0     11>#p㿘`` ` $` b5` !>` 0$`   }I  } >ɦc  $Ɩ `T` 0``(`(` > /b`    ``a ``$ b>〈 `$(。( , $,b$$`)>T ` >`0`2 `(`(` > /b `h@  2G`(  (`0`   @@NB   `0`@{h 2-> c.  < $$`0c$ >〈 `$(。( ,  & ,b& a  K` "$0>>> c#p>aԒc㿘` >}#"@  @```` `?. ``@  㿘`2>T .@   ``.@.@㿘`  &`  @g ,,  <  4 @f  @۰ 㿘`  &`  @gt ,,  >  ,4 @f  @° x\ d``` ``?``?c" >`@@fe ?` @ `?@ >ʐc@fW    >âa> c@/ 0`(`.`0``0c w" ,` 0` 4` 8` H``h`  X@eƔ  P`  @` p@  ,@e  :` @e  29: 24 @`/  >(`0`@2(䀠` 耠`  ,쀠`` ` ,@e  2` ` <(`0`@2 ` @   la   㿐`@ (`0` ` ` (`0`` "`l `l`` > c> c > ̒  #"Xc> c ,0`(0`<(0`,0`d$4`(>¦c`,a`(4`((`0`@@: 4`( `(`.*`0`2`; 耤`#\ ؚ ܀66`>di4`(>¦c`,,`(`4`((`0`@ @( 4`( `(`.*`0`2` 耤`#\ ˣ ܀6`>Η  1㿐 @>b (` 0` >(``  ,` 0` 4` 8`  ` (`0`` ` `"v` `{```~ /`@? 2u `&` `` `?`cg 1``  (`0``2#"",`26`` `2 6```26```,`6`&` (`0`@ ,` Y 29 < 1,`0`  `#8   . #\>” c " ` @`(`8` 0` ,@dv ,`` ,6 >    1 `2 1Ƀ,`h` ''``>`0``` /`(`0``" 1c "`  `2  ,` `?`c 1 ,`  , 0`? 4c  @d#ܒ@ x    '#\ , H@ 2k H h`4'@. w ` 0`2  > 4`2 > 8`" > *#\+ 23 d  "; 0`  0` 4` 8` >(`` >`0`  ,@c  @c  p6 <?> & pb` @#c & p$ Ho (@aHp@`"@`   ` `* @   8@@     8@@ 0`*+`@?" " `2 `2   ``2  @  2 @  (((`6` d(`0`` `A`A`?㿘`@? 6    1 / 㿘  j   e  $ `!$ @?$ $ $ 㿐>```? 3>C`H @c >`0`@8` `@ (?@.㿘  >`x! >0`@8`@bo   ` ??    @   @88`?㿘` ` `` `"  > ```` #@b7    ` `    㿘ΐ?  x  |ܔ @c4 /܂  /@bT   @ha4@< 8 㿘 `"  ``2  `@aє    2x `-& @; * ‘2     @b /   /@b !Xؐ @a2a `  `$   a  6 㿘 " 6  x&```2    @ay "  2aX`$ ` 8   6"    7!&,   , @a  $ `` 4 $ @aaXؐ @a1&  6  ` `$ ` `&` &``$ @;q㿘 6    7&  & 6  㿘   ````2$ !X p`" !X d(`0`` !X`  @a " x  x`&`$  d(`0`` `a` `  怦``&`  d(`0``>Ac(&`ېh `  `>ʂb `   Ѐ2,  0`2 0 1``- 0`  4` > 8`  <`>˔ @``0  0Ȗ .X >ʔ`4 0 & ` @R & h @K@`d(`0`` ` ``    "  0Ȗ .' >ʐ ``80&   Ԁ   Ԁ2{㾰 o'`"j d(`0``" `H`-``^ /`H`[2`  ``H`Pݒ@  ؁ Ւ ؒ`,@`] d(`0``"`-ـ`2`-`2`-``2`-(`0``7(0`  `-`2`xd(`0`` > `܀`>ʐ  a@  `܀` >ʐ a| 0`x`|@> `܀` `P ̉ .>ʔae  3 1  ؒ c  (" * ) " * (> a: : d(`0`` `" " |& &&>ʂb`&`  ``@_ې( `H`H`""d|`|= > `܀`  0P 7 .>ʔb  '|`H@_ d(`0``0ـ`-`hh@_I  %`  "> `܀`"`0P . >ʔb` `&`@_ `h@_{ ?> a؆@>&&?> a؆@>&& 5'`d&`d`"&> a>`1&' "2d`d` 2.d *&@``$`'?7 '?7'  /// 2> `܀`P .˚ >ʖ8bd `" Ԃ  &Ԓ  Ԫ" @_ //>ː@_`  @_ؐ //>ʢĒc@^|`'7   `@^    @@_|('('!'''@    'ĢG 2> `܀`P .7 >ʖ8b 0`" Ԃ  &" >>b`>>@bp 2%Ĕ 2> `܀`"ĒP .  >ʐ b8 Ā`" Ԃ  &" Ē  @_T /  />ʐ@^sc|`'7   `@^   T\  @@_3(|'(''!''@   *'Đ” ~> Ԁ`" Ԃ  &"  `d` @HВ `" W d(``ߒ Ӕ C Šā㿘4 (`0`0`l@" 0H0aN@W@2  aM@"  b@` i @"b -@ 0a@@ H @@E!0H @ @ӂ@Ђ @^  -aF@,a @&@I@MG@"@%!@`@< @  5 b@`800H`"+ ``2' ``2 ` ` ``2`` (`0``2` (0`I `" ``(`0`? "`` 0H"@I!@<` H@,   a@# @2W0H0\@Y@2P0H`@"!`Q%@E0H`@R@2=0H  1?@@ / /0H `*0H 1*` 1 ?> aa؆@ 2$@$?> aa؆@4԰ @8ϰ `%@;R Ha@ ! a@2Xd@"@2Xd@t SI@Q@2X0@T@2X`((`0``ΐ`` `|`&   @]f@   !@]]`!@\ 0`@\{ `?`Ȇ `   (?@ C ?>`U `Ȇ? `   ?@ C> ?`@\B `?> a؆@<`$`$``?" $`> a؆@<` $``l @a ޒ  P 2d, h3  @QqH >ʐ Vc(  Ѐ`$  `" P@LI, TE , H0`@ -  h >G#@@0a@@) - "` `2`"`2`"`2  ` @V0a@R@ - - " 1`@` `    H  @\E@[۔ @[גX``'h` 'l `  @[ɒt` `'` ' Y/? cH'a'''' $BȒ  @[̚ @Ј Ԇ''''Ԓ @ZѠ  " 0a@    Ȕ @[{ $ `2 ` " @[m ܚ @ '؄'''@Z   0``2@N 10a@`( `(@[Gd(`0`` ``@[=``` @[!`6 &` .&Ȕ  @[@['  `(@[#d(`0`` ``@[`` `| @[z  `|`|@[` H',Ȓa 㿘 >ʪ *#h> b ? /> @2```* 2  `* 2 2z`t` `2p  Ő 2i 2f 2c `V<R`6U " `∀`"N ``"J `` ":" 2: / 44 ) 4$+  2``"  `2В"`4 `2  6 0  0\  2``2v`|`2 ` >ǂai@-8i>ǀ,@i膀@8i@jh@8jh>ǀ,@j膀@8j@kh@8kh`` ,>ǂa+膀@9+@R` ? " (`8```.&" `?88?/`p@[@(x``(,  ``  p  @ZM . .?6 `6  . @Yذ ?㾈>>b`>>ޒbpݐ @Y````.`  x @Z 8@Z   // >@Y5`0 //!>ʠ#@Y-// @Y'ܐ` '܂?'' 㿘!]Y  p `G`2 8  G" 8   B  => c@X 2> @Xc؀ +  `@YP `2` .` .` ? .` ?.` .`  .`  .` .``` `` .`` >  @Xuc ? 㿀  > > `>ˀ`.`h8> b 2 ``" > `܀`"&>  8>ː ``8>   怤 '  > `܀`"> >˒`Ȑ Ԕ`8 > `8>˰?!`܀` `` ` ` ``` ` #l>#\#`#d#h`8 굒a( x @Y+ 8 @Yϒ ` d7 >/' 7/(0 '!'` @X6  `77'`/u  > `܀`= >xa`? / / >@X`܄?` '''Ho 4(@a xpHp@  / > `܀`>˔ Aax?   d(`0`` p`2 @M< `  ߂`$ 㿀 p`H'`* t `B  td>  d(``6:R 2 dN  d(`0``"  >ʐ@Wc^  K``2   `" @B$  2 h` " @O 㿘 V````.`x  ,t  `` 0@8Wܒ  @X( /܂  />ʐ@WGc ` |7ݒ "   4@2 a |2  @X ܂ /܂  />ʐ@W)c ` |7 "  h 4@2 hC | h` @Me h& h㿐 @ >˔酐!Ѐ` '' /'` `(`0`` ` ` `2  ` ```"(`0`   `(`(0`0(@) 01 @+`@+ 3`3 @ *@ 2@ @ `` `2  ````(`0`(`0`(0((`00`) +`1 3`+  *3 2 * *`22` @8  & 2    @`45S -0?c4 @ (`(`B @```` ` `````````(`(0`0(@) 01 @+`@+ 3`3 @ *@ *22@ *`@ * 2`2 @ +@, 34 @,`@,4`4@,@- 45 @` @<`` @``(`(0`0(@) 01 @`@<``"65-0?c4%?`(`0`?<@`?5-0?c4 ?( ?@  (0` 2@ (`&?c`" ?   (0`*`T&`Q5-0`@4 @ (`(`B @```` ` `````````(`(0`0(@) 01 @+`@+ 3`3 @ *@ *22@ *`@ * 2`2 @ +@, 34 @,`@,4`4@,@- 45 @` @<`` @``(`(0`0(@) 01 @`@<``"2-50`@4%?`(`0`?<@`?5-0`@@4 @?(` ?@  (0` 2@ (`@ `2E ?>燐"?5 (`0`5-0?c4 (@ `  `> b``bh `2` ` `  ```2 㿘  @TȒ& @`2``` `"```` (`0``~Y " & `(`0`@& 6    㿘 `@T`&`2` ` `@ ```9% ``` `  ~ #`  * ~ 2    ` 6   ~  6 &   㿘``` "   " }  \`2 `"  `2`  `  2 `* }ɑ2  2 `H`D /` ` ` h`` @S  "` `&` `@S &`` `2` `` &`  At  h`"` l&` @2`4 ` ԰ Aa&`  4^ "[  " h`  ` @Sf  "&``  @T &@S& &C &`"``*  "  4`2&` ` A` @  @`d(`0`` @``(`0`@2 A@ @ A A >ǂa`@8` 2'`2'@㿐\#\#`㿈 #`'#\ 􀠠h`"8@?  A`` `2'x'P\ N`` `  `  `>` 1  @Sߐ؂ /؂ /ْ@R 􀠠`2`` ` ````7؀  `@Rܔ $ ` @`2R$``2N$``2J$` ` D$`  `` `` ``7 `3` ````  |M ' * |@2   '` "* |62 '   $      @0U Q`4  0`8 G 0$ B`"`h` `@Q  "N'` `4`2   @S /  `/  ' @R; ` ' ђ '``8`   0`8  0$ 1  A㿐@ `  @  U *> `"7!` `(`@  @ 9  : >h#`@?%! `> `@ >ǂa`@!8`  $ @?  $@`4 &@ !Ho&(@gHp@㿘>3`    㿘>3 `> `` `㿘 # @`` @` ``@Qn  @Qj   @ [   `ܔ ` >Â` ` >  0ਐ @  g > 㿘  >ǁ@< `#>àa` 2 㿘Ho (@a~>`>a@<`( "#> 9`* 9`(@< 0`@ >)>àa'> ` p``2 0b!>" $"@㿘 `  @QH   `& &   ǰ 7    p'D'H@  `@ D  : >*#` ؒ  @Qw /؂  /@P (/   ' 8`` '  (`  @  Ԁ`Yb `>ǂ `  @  ԀG@`@8`!>Lja Ԇ@`9 b@`x@8`x  (`?c h@9 hԀ H@`@8`H @> bt>`@>`   4((`(@ 2 @O  2 @O  2@'Ѐ2 > bp>`@> <`  U >$` `> ``$ $     ((`@( x, 9$ 4 @Oѐ  @O͔ ?$ 0$ , 'Ѐ 2 $,,8  ,(`( ?c @ 6 0 20 ? c`   $`   @ ` @O  @O  @   "   , @@@ ٔ =   ((`@(#` #``#`#` 3`#`Ѐ`2O   ((`@0``1  ` ` # 2 "  a  `  2     `@ @`ʐ   ``  " `#@ `#` #`#@ `$#`>`  `0`$0 @Ԇ@2(``@"`` `@ `"     `" $     2`    Ђ@(`0`0`, ,   @N  @N  8̒ 2_@*`>Â` `> 0 @   >  (`0``  >2 % >ǂa`h@8`hԀ D@`@8`D @H "      Z  ~  20>ǂa` 9  @ 8` `>Â` `> 0ਐ @  _ > Ԁ`" >b@`@8`>ǂa` @ !8` !! B B B( B< BP h h oH i hЃHo (@aHp@`"7 `` `2Y `* (;`2S `M X8N `*> @@: @:  @:  @:  @: @: (" 02& ` 8@: 0@: 8 2 ` @@: @ H@: H P@: P@: X@: `㿐 ` " ?퀠`  97>ô  ఴ@)Ɨ  *> #\" 㿘 2 h>"(`` U`(Z㿘 2 h>ސ"X``2  `@`(zE`"$ dP  6 h`'>   @@N '' 0' vc    P @M P> b̖>`   㿘> b>4>  ےc,`?㿘:`        *" ( ` 2  (  `` @MK  ѐ *``ܰ    '  " ` @M6 p>ǒ   > bX`N L`K `h`G`4 C   @M~ /܂  /ݢ@L `* ,2 '@+ ") `$     Œ    ۔($, $ %% q` `0@   `0  `h`  `2  ``   `, :,?0, ,,@L,@L ?,((,`,`,`,`,``h` ѐ0@L 0@L @@L  | @*`( '&@ q`  @@&@ hdd&@ 0 `&@ "$ `&@ ,`(8.`  q @@Lp`*&@$ @1$ %@?@ $ ````"   `  @L< .` .@` $ $ $   `2  ``2( ( `2 ```2 `(( ``2 ` ` ``2 `,` ,` ``2  ```2,`,`؃(`0`0`,,,`,`$ b4$#\   @  "``@8`" >` `@8`"``@8`$`@9$`  b `x  ````(((`@d> b̀` > > c$`   c(`b  @L܂ /܂ /ݒ@K3  `2  , ``2 , ,7 ,蹒' (ِ܀ 1>  h`9 ``5 d@8 4`. 4`" t @ "tt @t@ > `@9" db`@ (@`>  .P  .J h .D >3 Ș$>:x    (` @Jt^ , +> bX`h` @   @.  @ : >#`@` `>Â`h @8h  @JԐĒ`@J~ Ԁ` Ղ```7Ā` ł```7䀠`> ``> `܀`"K >Ò .ϐ >˔'b `> `܀`": >Ò .  >ː ܙb- >Ā`> `܀`"$ >ÒĔU>˔c ܅  >Ò  @J /  /@J ( 7> `0`` ``> `܀`'+>˔c`[ 0`@I  %> `܀` .h >˖c> ސ >`܀`" >Ò>̔`ΐԀ` Ղ```?ԪĐ@Iz `?`> `܀`" >Òِ>̔`@ؐ`(@$@& > `܀`Ð>̔` 0$#(` q` @> `܀`"x >Ò .  q>̐ ϒ`c >Ô  `Ԙ @+D8)> #0'> b`H  @J/p  @J*T  @J% //T/p //U/qx@I Ē@I \@I  (#\   >#0 (c"8  @I /8 Ē@/9@I ɐ  `@9@"@0/8  >Â`h @^8h `0@  @ 0   0*> `@`? c 3"  <+,,t2  `* @  S  *>   `3 ``(```(` Ϣ@ `  @  - y *n>  p>  `*(` `2'  @  @  V *K> M>`2 0``" (` @ `@* @   / *$>  &>  (`2 b@  @ 0 –  `0: >ڨ#`@`2 >Â`h ?@8h  @H  / /`` @H   ,噒'Д e > Ԓ  @Hΐ /Ԃ ܔ /Ւ@G ,~' K " > `܀`B>̐ 3a0=((`@(c 'ج''''/''````((`@(''>‚c@(( @@> (`@``   (@ ?'`''> `܀`ɔ>>̒a@!p  (ߚ$0`((   (PߖE `/8    0  @Gܔ (  `/8    0   :`.` `(`( @GS`@GO Ē  @H"   //@GB ,pp    @H /?/? ,pԢZ  >b@F  2  `2 '  0L``  (`0``@'`*  $@Gϐ (#\Ĕ  š    > `܀`̔P .T >̐ /a0 @Fѐ` `.`.@.`.` :.`ps , "> pn ,"``bh.`-- $ b6 $6 #\    @  `S b``@8``I b``@ y8`  "G  44`Q [ +`0@  qz`0c  `0` `b``@8`` `b``@8`b``@8``b``@8`b``@8``vb``@8``kb``Ȇ@8`ȁ`_b``@8`Ub`a@8a`Jb`a@8a@b``І@8`Ё`4b``؆@8`؁`)b``@8``b``膀@8`b``@8``2p` '   @  =  : >##` Ԓ  @Fp /Ԃ /ՒĔ >c0?b /ma"j v`:2f,`,0` 4`8`" ,@E  2O` ` $`(`" @D  28 ` 0(` (@@"+`&   " `l@@H`@ P '+`@'2l`!0?`lb@"Ԑ`@Ԑ P !`@!>ǂa`P@8`P!0@'`,n` eb$`@@8@   >Â`h @B8h  @@  V   *(> ' 2 >Â`h @58h  :흖 "! > `܀`> ` . >̘a >Â`h(@8h(b``@ 8`>É) `(@@9(@ `"2b``"vb``"Jb``2> 'bH`2> Rb8b`퀦 b```"Bb*$b`Y`2> rb(@8`> @ ``@ 8`) >4@  b ``@8`  ``0@8`0b`` @8`  ` >È ``(@  8`(  s  z>ol ``8@ n8`8 沖 R "`(`0``2`` @:=`` *`":` 2 ֐/'  6 `` 0@C6 `$`4` (`0``2  D&  @D0 (  (@D+  0`0 @& & | (&`` @ 4     `: >#`@?,  ,>Â`h8d `C @8h88d `2@0``@@ 8`@@(>À`b `p@8`p `x@8`x 沖  @{'@w@``@ 8```H@ 8`H 沖  @8'@8ݔ@``P@ 8`P > 沖  @9'@9@``X@ 8`X > 沖 c @+ '@+z@b```@ e8`` i> 沖 F @..e'@.*]@``h@ I8`h 'M> 沖 * I'A@ 2>À 5>9@`܀`" ` .' ` .! ``+`>̔ 3`a  (`` @  "@!>Â`h@8h`h0@8h0@Ő!t!㿐>`>dž@ 8`j `'8   (  (`0`c `2 ``ˀ`2 `2 `2``?'  )@ 6`:24        `: >ԝ#`@`2 @>Â`h @8h * `>À 2  >Â``@x8`   "  >Â``@i8`d$"@ 0J   >  `/8  0 2  > `܀`>̐ b(,!O  @A̐`` @AȔ  `2` ` `2  ```2 , , `2` ` `2 ,`( ```2,`(, , ,`(6`((6(((6(& ,.`>Â` @ (9 㿘> bȀ@2  {ڔ  > >"H" ȆȀ`" ` " 㿘@p> b>  b> b>  c0㿘      , @J@+ , 4 4`@@:@ 「`㿘 @B?@& 4 !$4@ @& 8 $4@ @& < $4@  ?& D $4@  @ D& @ @@  2 & D@ @4 "  `,`@``  @%  > & H& ,a  0@& L   (& 0㿘 ,  > a L8`@? ,  @@*    @   D @& 4$ 4 , 4 <  H@  8F& , 0㿘> 1#4ð#  `( ( `3 `(``(` `,㿐``3K @`1">`3` ``6? -`2J`5`2F`5>6`3  -b$`   ' 9>ǰ  ! ,x  9> "> ̀`Ho`̂(@a"Hp@> c`#\   k]> #\#ȁ -` 2 >~"h(`0``"c? &_?,"`3) +?0)<2P?9``(*J? (<ƀ&*=? /?(c0/&`*'? "& `(``*? & `(`@?㿐?'  &?㿐  (`( (   `3")` `<`"$``+2= &@"` 1`@. `@`&@ ` (`@@  `3`(````(`@ `3  㿐 ~3``(```(`     `( (`0`` & H*  Q& h @`(`0`h`  ?6 & l@"- l`@?> ̀`2`͂` ` `͂````7΀` `, l@'ܔ@?̔   ) & l" l `'@?   ) & l" l @ ` ` `) (`@(c0'  =Ֆ ) & l"& l```2! l (H G>  `(`@< l@@? )  &F l0 (``/+- 3 3 < " +V  3 ``(```(` @ 3>ǂa`@8`"/ 3 < ") +! l l@" @@?  @" @@? O ) & ߐ 3㿘``@%`@``") 0%`"> a>ǂa`@8``@8`````(`0`c ?0 < ??㿐?ch`"  a ` `2FE> U`?> ` @=  (`0`E&0> `"  +``(` >ǂa` *@=ߔ `8'>ǂa` ,@8`"  ?   *>ǂa`@?E8`"f? ?&4  㿐 `) `( (  * *> `"!>` `(``(  `( (  @ : >φ#`@` >ǂa`@8`?`H? && (?'D'f , D(`0``>)Ȇ@-9))@(9)`@" `>Qax``>lj) a1 >ǃ(`0`` (`@h@ 8h(@9(>ǂah@8h >@@@8@!D@9! `'!Ȓ (  'D @< @D>````  @9 @`@8` (`@`@8` `"    `2  `2   $`2  @-9     `  ` `"d!` `` `` $``d(`0```>ǂa`@8`@` @8` 2  ``2    (`2d `2` ` `2  ```2   (`" d(`0``2  >ǂa`@8``  `` D`(`0``@>ǀ   ` ?c2 d `2 d ?c>d(`0``"(d`2  ``2    (`. .  `2` ` `2d ```2 d  (`. . d(`0``. `2` ` `2  ```2 ,0`0`. .  `2` ` `9D ```2D- 0`0`+. `2` ` `2  ```2  `. a.  `2` ` `D ```D `.  a. D >(``&Œ ">ǂa` @8` @`8@8`8@`@8`D`2@ `2 @ `2@ `"@`D `2 > `2> $`>` `1> b0@`@8```2   @:  " 2>Lja @9  `2 @ ``"s @@m9 @b bh`>ǐ  @:f   > `>ǂalh@ 8lhalp!>"@8lp$"  !>ʠ" @;} ?,`   ,` @: $` 3 $?>b%h"> 8`` .   .    .> `܀`>̐ ɒb0> bX ` >ǂa`@@8`@@`8@8`8    (` ('' `WDD DD  (`2 `2 >ǂa` @8` @ `8@8`8@`@8`D`) ( ( 耢   : >̔#`'D  >ǂa`@8` > bX`2 D ؀@ m>ǒ`( (  @" D`( "@ ` DDD@ @k D``2  `2 ?c>` >`> ?c>ǂa`P@` 8`P>  c+> >°cDDb@`@@8`@` D`@ >ǂai؆@48i  >ǂa`@8`@`0@"8`0"  2  `'   (( @@(`@` @!b|TD㿘> ck. 㿘  1>ʰ"@:>= c  p㿘  ”  > >˳"c>†" c8((  ( @(` @@(` @(` )  !2) > b$``#@ > c@`2`4`(`8` "`4 `4; (( ( @(` @@(` @(` * 4@ *`> bb @b `@Ba0 (`0`c  `> `2=  `29 `25 `21 >  >a؈!>  @b> bx@9 @@ 8`@ 4> jh> a> Ȓ8b .!  .   ,>̐ b0O`  , 4$А  !>ʨ`""   h```>r$"!>ʒ " "   $">b.`"   h` `@8  ``"* ,Q> b  !>ʠ" @9% ?,`  ,` @8D $` ۔ $? 2 ,>ǂa`@ 8`  >bbս4``* ն2 J>ǂa`@``C 8`@@8`4`" > b@`8@8`8> a> b> bx@ 8`@ 4 > #  > a> 8bȖ .i  .c 4 `` ,(`0`>̔#\c7   ) h`04 ,``(`0`@ `> bd`02 `d(`0``" >@Ґ" "  i  c `2` ` `2  ```2 , , `2` ` `2 4 ```24,,4@4"   t @" t t @ t@)  `@8` 4b`"`t* "`t`t*`t  C@ʖ >4`" >b@`X@8`X>ǂa`@@8`@a 8@9 84` b@`H@8`H   H@9 H ʀ 74  ( 0  B    P l  @ @ @ @ @ @ @ @ @ @ l @ @ @ @ @ @ @ @ @ P l  @ @ @ @ @ @ @ @ @ @ P h $ h 8   ɜ  0 $ L Ō t ä ԝ㿐  ) (`@$ " ߀` 7`: `"    * ` ?7   @(    0㿐 $(`0`b" $  ) ʖ   (` 0`  ` `2   ```"  (`0`       +`*3`2(`(0`0(@) 01 @+ @3 @ `@  @ @ ` ``2 ` ```"``(`0````` (`0``(` 0(0) +1 0`3,`4`1 @+`+ 3`3   (0`0?c8 7  : "   @(     $0@ $(`0```` >```P`#>4`  4 $b` >`a`P` >0`  0 $6 $ : $}6 $>>a$"@>>c"@㿘 `(4    m 7   4    0@5f4  & 6  (`0``2  D$   `$  ؂`(&  &  ($$ @5 (&@ 㿘 沖  :`(`0``` `'8`d ( +``2` ` `2  ```2( ( `2`` ` ```((n` 㿘 2  2 5o 㿘    &     - " ` `(`0``2""  " ` `" ` > bl" `" 㿘 @5 p?& h&& d㿘8`?``.    {n &  ?`/ ?& ?`= ?& d 2 `0  " }}&    {n &  2 0`1  0  {n & 0 2 4`#  4  {n & 4 2 8`3  8  {nu  < & 8}I& < 2 ``2  `  {nb & `㿘\^`?퀠`Z@ `݀`8  (~`G퀠`+C(`>'@9`. ` `` @` `` `` ` ` 2``.2`"`@````` ` `` "]  `2   {n2  &Δ `/뀦@ a &@ a&d ؐ 0@``° /``2`` `2 ```2``````2`` ``2 `](` `6` `Œ 0@ {mД & @l C 1``(`~ {m P&0 x*l``(`f`# 4`2 `` 8`4` { m'@`, 7 3q 0IA`(`;``7530`/ 3Z {me &8`(@3l 0&@ `(C&h >&h "l@`l  `&l  * 7 㿐`2  { m, p&#`#\ 㿘 ?  {l֕ 㿘@`d`l`&& d& l    {m g$``@2 ``  {@l$` Y`@3 `0` {``(`l$`0 F`0@2`4` {``(`lԐ$`4 2`4@2ٔ``` {``(`l$`` ``@2Ŕ`8` ` {`(`l$`8  `8@2 ? 7㿐 <`; v" v  /`2+   (& !@8 `)2 #`#\ǚ  `޴  㿘>`0 `=?$ p {lF $`` ` ` { k p    `+  ;  "$? {k۔ 㿘"+`"`h` @1K  "z&`2  $@2p|&  .   . @1   {& & )" 4`"t*  d"tt* dt d"*%% #  ``"" d2   A`"t  " tt  t  `''@`@'>`0``  5 k 7 X> &@2 bl* " * ?`83 -(`>'|@*  `& @1 쀢  Z   d(`` 14`  `  @1d a 2,`> bl,`  ` @1M `8 ,`  ` `2  `2  `2  `2 o " ɂ `Ƃ     $@1('Ȃ /̂  /@0Ȑz9  'y 4 2  d 1Z<   d(`` 1 `2` ` `2@ ```2@ `4 @ ` ((`00`@2  @0   x 02ٔ "o`@`" @  $@d" `  `\ `2`2`2 `2 oc "C `@    Y 25 `2 @``2@6@"  ``((`00`@2   @/  "   ꀤ  1"      `'`(`` `> l@ `` @` 5@i &@x?''݀`(`>'@l *  `M ؒ  @0 F  "V d `= d; "N  0 "I   8 "D  4 "?  ``"; ``(` "3  `"/ @  h "' l`"' '( ( H &  Ô(&`   `@/є   㿘)` 5 1 * "` ,  + `' @"` `(`8``:2 ఀ `(`8``: ఐ  '  "   20 㿘    ` `( (`0``퓰 7`$  @/e&  7p`>`0`'`  @)` ဦ+ ܰ (`0`*`(8`*%9&  6p'q퀠` * A $A=#I2 *1 59>3506< l."9 l)+2 *$& *  @=Ѐ;<2 * @v`!Q *|wu  `2q (@N'(/$"* l &2\ e >R&5 l)/ ;)<+K J({@9C l la8@ $ :  l } /0 - c$ l& "  l  ? l ? l 8``ڀ l (``  ,` 0` 4` 8`>b$`ް "ܰ ڰ ְ ? l ? l `2 @ '  ` @ '* >'@ l@$ l`"o?@ l@$ l`"e?  l@$ l`"Y?u  l@$ l`"M?i  l@$ l`"C?_ lb   `]  S N^ `J @` '` `> l   l ` l ` 1$ l> `*  @$  ah@ `lJ t] " $  `2   @$  뗐Y+$9#Ă퀦  6 G퀠`<`0Ѐ#)62'098' 39>3 506 ,q. 7   @=6 ;<  0@ `! * 삒 '" ''+1> %'2 * lm%4r l$ n l+ ;()   l@9{  l lX0`V0`[  lX0`Tb$ S  P d'E0` lB0` l?0` `'(`0``W 9  H   M?c@8'Д @-  ' '   @, `0 (`>'@  l l0` l0` l0`` l @@ ' A$ '  "   ْ  '"    ꉐ  㿘( ؒ (C  +&@`"(`0`` ! (  @& ``& &` 뛒    " &&  7㿐   뉒  <  " ,`'&   `. v  ) ( (`0``2$ꉐ 7`@$ ,` ,@`(?,` ,```'@+ `   7 @+$  @`& 㿐޶&&  i (0`0 `X0ꍒ  X$k  S>N ` ($  @+; ($ I A$@(`0`0`((@@ $(@`(`0`0`((@(`0`0`,,n  @" @`$ @(` (`(`(`(`(@@&   7  `'@*А @+ `.`0`  `ʕ* g`4`  `* \`8`  `* Q```  `* F` ` Ā`"` Ȁ`"` ̀``     %  $?c,      , , 0`0`* * ̀8> $ ``(@ <,```&>` `(,`` @$Ā`>`( <(` @!Ȁ`2`>#@( +( @!Ȁ    `  @*` *@* Б*  @* ?2 ```2 `` `2 ```2 ```2 `>a`> a` - @8``X@8`X| @* $``8``<`(`d`&o@ @ ` ` `((`@( `  "X@ (`@0`,`,@0`0`,`L,` ``  ">  bl,`  @*u ` /@) /(&(#\+  A >ǂa`@8``Tb`@)q ``P@8`P ` b@`P@8`P ```"h` `"h``20 ``Z4b4` b@`@8`d(``>ǂa`@8`° 3@`X@8`X```2   @(    2 ` `" ` ```d(`0``  ``2 ` ```2 `i ``2` ` ` `2 ` ` ```2 ``d(`0``",` ` ` (`,` ,` ``2` `` `` ``````d(`0``",` ` `(`,`,``'@И谒 <쀠e%`" ``h`% `` `%`h`%'`@4``(`0`$,*ư  |$,4`d(`0``/ ``2` ` ` `2 ` ` ```2 `,0`0`,` ,` ``2` `` ` ````- 0`0`,`,`̐`"`l`耠` `" t @ "tt @t@8 耠`쀣@ @}  ` `(`?`b@ (`h@8`hc8'Ȁ`2 `Ā`2``" `` ,( ,,`( l ">ǀ (a`"b @`"b@`h@8`h``@8``$>a $ x@`ǂa`p@8`p||| | ppi gec0 (_|@2,` `㿐@  `    : >Ɛ#` 2 >ǂa`@8`!` > @`(`&@ a` @8`"  䪰!Ho (@aHp@㿈 * P2  ç    `@? 7    ˒  2$@僐$`,|`$`( @$`$` ($` (, , ,  ```( :,  0>ʒc@&͔   @&Ŕ  $ ........ @& `2 `$ ``2`$. . `$.`b4`$''>``  7/@9 ``@`8`````@8``a@8a`a@8a>4#\`?`  㿘 !>4``2  4` & 4 R  & 0 $!P 2㿘#>4aP`,> b$aP  *㿘 > `2` > `4  0` @%˔    ``  㿘 >  ` @%2` "& 0 ``& 0 & 4  % 2  & 0& 4>4 aP㿐>4!>4 ,  aP ,  ,  7, ,  @&T >4` `0㿐O , `   @ ^  `: >D#`@`2  >Â`h @8h ` ``@`` `d(`0`````` `2 ```2```"`````2 `` ``2` ``.` `a.` ``(`#, @om ``@ > `0``+>4A```2=  @%  "5 ``$0 `` ` ```` @$  2 2  4 1  $ 4 $ 0`@(  $I $ 4 %aP 2*`(`0``@/``+` ``2` ``.` `a.` ````2   @$  "$ 0 2`$ 4`` ` ``.` .`  0   d  0 P Ho (@aHp@ p`G`` `50``  㿘 @% (&`& && 㿘ɢ  @>bx% `0@`  0@%q ,` ,@ <` `<`  .,`, ,4`( <`  ``4`*`2`00 ܀ &@@? &@ h 'L  @> a 5 |?g@@8e`x  @@%,`  @$P@π " `pȐ  .>̔ch `p$ `|,<`h$(`l$,@``48`h2``$ $$ f  2< @(< @ < ` $4`t,=$0`x`- 0`(`(` @  @,  -@ `@$ `1` 4:`x (`0`(`(` @`` L&@@@? &@  t`d "` 8>̐ >cc"`@㿘< @ `4       ^ # * #    ]  |>b$ 㿘!>ʔ >:"cȐ".> b'> `` "`q`$`$4 "I$``, |# @m$` 2r㿘  |] 8 *  @* a0","  #| "@m֐@#$  $ $ [㿘 2 >#Ѐ2 >̐#  ` @   (``@"  @#ޔ (  " " 㿘>̀   `2 >͐ 8t`d>͠ `#> >%> `` 2  `; > `@ 9 (@#?`8 `܃(` 8`(`62*`2*```ܐ `& `"&  & $`Ԑ Ԡ $ > ` @@> `܆@` ;@ >Ͱ `` 㿘!>ʔ >="c > `">bx#> a؀ 2 (@q > b#> a ̂ @( ?"  a ̂ @ `"  >  ?  a #> a`@c @ @n hI8 ؔ @" /؂  /@"@? k`'   hd ``j'`*`W TQ  O   @@"''$'Ȑ  m < `:`<?0 `p `p hdd` 0``` <`   8` @` > `܀` . %>̀`8>͐ ` 㿈0l"8 0H0aNmW2h OPMM ``@!{ 8 `$` ` @° @0#>> a ``"b@2 " `@  Ѐ >  `   a ``"@ " `  S@>bx @1@N ```?耠`?```` ```(```7&| " <2 ! (`8`&`0 &`("(`8`&`,>` 㿘 ` `` >  ``((`00`4> &a @ 2#  t`"   ( 2   , 2   0 2    4   2|  @  >`>>ʁbb㿘 (`& $& & >0>8`> a@j8@& $G> `'`Ƞ p`G"``` `50``2!L`!`(jO " dR(`0``g` "!L`  ` 2!L  hd <P   |  ' <`2 d(`0``2s!L"```l .  >ga > !  @&&  ` d(`0`` (``4   6 >8`> `ВP (`8``2  6 >8&`> `Ē? (`8``4&!L"6  #& ` &" `>8`@i# @j !L@  㿘 - hdd( < $ 0` `` (``>  `& ؀@    6  4b>8`f` ۓH  `@i <> bX`O` `4@   "5 " "1 " (`8``2+ "`"( "> a>8`ܡ>`@gJ >  >  ( `> aؐ@g<$ `"R(`@ `" `4@ 耤 "@r6 @  @@`4` `'' `v| j< )㿘>bx@2@ > (` bx@2@ >  (` a @ " h@ 0` > @j> ``0 `  `((`00` @ 2 㿘3> a(`>3>Ͱ aX bxbx `>>;"mc| !>ʔ "&a(>: cȒ."@Ձ㿘 $` & $ >̀`!`4 2">͐!`<`` ` @>͔!2 >͒ߐ!`(`0``8x(`>9@ > `̀6 & >85`@h:# ? S& `4`` (`0` $ ,۷  2F A&   "A&   @6 7 `  &  6 >8`@g#i  @06 >8`> `ВW0 > `Ȁ6&  r`(`0`b p  2; 3/ / /  / / /  `2(ܵ g ܫ`0 `" >L"` . >͖>͒b0 ܎    @h>ͨ "X`2@>͐"x`2 |``2  |``2 |` ` | I 2  h | @  2 hh  hdd" <   0` `` `@ @ @   ` q`@@ 2y  q `,` q`@@` u , `o ( k?i `> `Вn $     $ `2 W    " 4" 4"24" `  4"'"(``" h` @[ Ȗ ., Rѐ>͐ b 8 |`4 >8@ `0`<$`4`h`"!`h` '>ʐ @4  2`h` "`h `"   @%  2 `h @  2" (`hN p`G" `` `50``;  `G"+ ``%`50"` `&`h݀   `" `2 `h `ha  `8 `8 p8>>͒`| `, `4  @ Vz &`<  >>͒`Ȕg >4 >4X!\` X!!\" >? (cz ?4 $ 4 [ `h> d&`h$ $  `> b)>4aX@&&`      "  @  "&  ` (`` ?2 , `` "` 2` ` ? $ 4 >Qax`8`&`4d `& &`8`hx? $ 4 d(``I` ` @?7`7 '?'/ 4> `܀`0 . 8>͐ ɒbЁ` ,>4d(``(X` Ԓ`@\ ?7`'7ւ '܂?/``2   @   2>4>4X? X@` `$` @`h&`<{&`h%`  UI Ho (@aHp@ p`G`` `50` "P>4a`@2>Ɂ`X ` ` `0 ._     8#\ >5c``$``  .H  8 >"c``  8>c` >4a` `  c  |TԔ > 㿘 >4>(#a`@"  2 0 ` `& 㿘 >H aP  $@Y | q' ټ  >Nc` ` `@@`(!$, Ȕ((`0``2$,b4 `?7// @$$ >Nc` $(,,, ```( :,?@,  @ // //@5 @`2 ``2 `` ` `  `'7?7 ''/c@@ (#\  ܚ > `܀`"` .t >͐ Ocؔ @ @?,((0.@ `2` ` `  ``` . . "  `2` p`G""P```50`2  "P`2  ` q2 ``@ 7` q  ?@$$ @t < ,` . q @,  c, 0`0`,,6.6.6....$b4$#\   >"``@8`"``膀@8`>Â`dX@ 8dXbW bPL |$(@`2 @ @ $ |`' q {  >Nc` ` `@@`($, ؇((`0``2$,׺@`  @b4 `?7// @$$ >Nc` $(,,, ```( :?,,@ՐА @є   ///р`/@    `'Ȃ?77/Ȃ ''Đ@ݔ  <  `(  %@5 (#\  Ŏ > `܀`"` .& >ΐ `@ ''''ؔ @?,((.....0@ `2` ` `  ``` . . ,  p`G" "P```50` "P q  ?@$$ @0 < ,` . q @,  , 0`0`,,..$b4$@ #\ K >"``@8`"``@8`>Â`dP@ 8dPa a |`$( ` `  d(`0`` `@ `0`  >E` 㾰   @  @ ,> AbX  * m   : >S#`@`2  >Â`h @8h Ē`@  `> `܀`"Y!> `@ ., ` .& 8>ΐ `XD!> 䀠`&耠`$쀠` `?(c0> ؀` > ܀`> `> `>΀``!> 䀢 > `܀`"!> >Β`Ɛ  !> Ā` `> `>΀``!>  ł``2``7ƒ`pR  t> `܀`">ΐ a   (```` `2``2``2 Ā` > `>΀`aP!> Đ (   @ /  /@  (`  hײ  0``Ө   ˲  0ʮ `@  ` q` @> `܀`"|!> Ĕ@ .O  q>ΐ )an!> @n   @ .: >Δa 䀠耠`쀠``~z ` `?#耠`!쀠``>ʔ @c`@7怤  @ *  @   @ (`ߔ4 ܀` @ Җ .>Δa  ܀`  ܒԔ@ Ė .>Δb  ܀` >ÒĔ@  .>Δb(  > `@9'  _#26h>Τ b@>4a`@" @`2`>΀Ȗ .  0 >΀ bp 8>bx2`Ȗ . n 0 >΀ bp 8>ΒbD 0Y`$`> `܀`"?@ >Δ8b5 7@` 6`ƒ b>8``@_#805``@ @ ː0(& > `܀`"@  0Ȗ .%  8>Δc @``>4a` ``@ |  O^> wcH 0㿘> a0` >4a`@ 2 ` >4a` `  |  O^R> h> 0`2  >4 a`a` `  0  0 . Ĕ >΀`bp`8>ΐ 1cp> b`2 & `2`d>#(`0``>4a`@p2b 8 .  >΀`bp`8>ΐ ci @ >4$@` >$` @ > `܄ `!   0Ȗ .m  8>ϔ`G $` ``& > b$`$` $`$`$`ђ b>8``@^̒#@ >8``ܑ0`: &@3 |O `  0  @ @>R , " > `܀`" >Òh . 8 .  `8>ϐ `0 >   @    : >#`@`2 >Â`h @8h `@a ````ć((`(@`ł` `` ł`````7Ā`5`> `܀`" >ÒĔh . >ϔ`h z >ú`Ԁ` > `܀`"o >>ϐ &``^  > `܀`"d>ϐ g`^`` > `܀`"J >>ϒ` TC >æ  (`Đ "# `>4a`@"2.` (h .I >ϔa(% f䀢  > `>π`ÒaP >"`| `q` @> `܀`" >Òh .$  `q>ϐ a >`|Ē ~ "<"0`" , `65` `q`".`ِ.`` `q`@@` &6 4b>8``  6 >8`> `X̐6"@hd ``  ` `q`@@@ @# @ ` `, 8``2 6 >8`> #`В 2=" Ĕh . I=>͖b o`8  `q`.` `q`@}@` &6 b`>8  ` "" 6 >8`> `T"(``"6"26" 4 @k > @0bX`4@6"h$h &&  G 2Ѵ&   `@9ѧHo (@aHp@  x@  2 `?> "@"`a؆@:@`?> "`"` a؆@:`㿘> bx@2  @   2 X 0`' ``2$ `@  2  hh`   @@  h  0''''Ę @ ]p  㿘` ````|6 `| >LXŔ$~㿘 l h  > `܀`  >fa > & X& \a؆ @> X h?> & P& T aؚ @> P  | `V "(> `܀`"  >Ϙ#8 b  @ 8@K /9 @/8  @3@@D@ H@ L'@@ 'D'H`$'L` '@2(@D(@@@(@(@HL@?@'H`0(@'@`4(@ 'D`8(@ 'H`<(@ 'L /p /qx@  l h'`'Nb8'Ta@ R@\"X$'`@'( ɐ`> `܀`" @ .} >ϔ bP @ 㿘> a  @2  | |2   Y   2㾘 t'`> `܀`   .}  |>ϐ ]b> a  "  t`"  | |2   &    퀤  2 `` ``2@k>  @ ( 0 ??/ؐ    .}:  |8 >bS a  @@ '8' @''|  [ݖ  >  " t|Z  t`$& t`܀`!  .} @ |`x .| H .| >#\#`#d8cϐ 􀠠" p p`܀`"   t'`> `܀`   .|͐  |>ϐ cؒ  @  /ٔ /ت @  @ (/Ĕ @/H  @@'L'T |  [] D>  t & t |Y > a  8>-> c.",  t`2( `2%  | |2   7 "  " ܀`"  .|h  |#\`8 @  Ӏ`܀` .|P  |>И 8` )􀠠 p`` pX㿘 x   | "  < " (``  h> a  # @" ސ >   2 p>a &# `2 p ``"  p@"  t`   t`$ t t`"   "  t$ t  2 >  `2p``" p@" t`" t2> a ) >'> `PDȀ`2 p ``"<  p@"8  t``2 tӐ " t܀`" t  .{  | } t`2  p@"  " ܀`"   .{  | a  2 >b`@"   Ѐ " 8 > 2 +>b`@"  Ѐ "  $  `$  2 `@" 2bx`5> _a bh tb& h& lW " > `܀`"  Ȗ .{%  |>И 8`  `)       x  |H `$>Д8`ڐ  |H ڐ㿘ʤ ``h0` `'```2#  `2 `@" `2  ̒  |2  0 "   `2  @  2`M 2"   `& `@?  2"   `& @" | `& Yz   | @>b$ 㿘  |Hg "  x`" x `& x x" P ` @'@Đؒ  @  @  @    /// ?///?'d?h' ' |  8X   W7`|p`4& (` pV& (㿘>bx  ؔ '@w  @r  @m  @`@h   /// /// ??h?''d' `|  8X    V`|p p  & (Ɛ㿘>bx Z>Ф `  h` "'2 (| + "  ( < " ( (``4 (@ `"```  2  `>@@>bx``|  @ < @ (`` @`^b㿘>  bX`bƐ  (` ` >ʂbx `  @> a @ 2 2x, "`l``&` >Д8a0  |F 㿘  b B `,+``2`    `. (. .6 , > =0+`` > ``h` a0b 0@ |F @ | 0>bx`2@$>ʄx$  @ `$㿘> )a `2 t ``"! t`2  x`2  `@"  Ѐ@2~ " ``   @  h%> b`0@8` w}`@V  |Fu O@  2& |$ x ( ( @   8>OwϒcL>  $ `     p`$ ͐ `> `܀`` Ȗ .xP  |>И 8aX( `’)``$`  @ (`0`h O `p@  p@ $ p`p@"`p p@$ p`p@ " `p`h`l`X`P``$ h$ l< X< P< ``p@ ` t``r `> `܀``  .w  |>И 8a͐ `"C`p x@">`p2]5`p`h`'`p0İ ' > 􀠠2p> `܀`` .w @ `|#\ 8>А a0` h `l`p  `   `d1> ``2````2\`` `|2U`F`0 "N```@G `@  ````" `h耠:9``l쀠:4`耠`" 耡??!`Ȇ ` 4   !؂ !`h@8 '耠* '耠8'耦"`l'`l'>`@ Ô !>```2@"`h h`2  `h`" `l`"  h`" `  >` 8v$   $    h@ e 'h/ @ t@  |@ ''  (/c4'؀  ' /   `@ P3 , > bX`" `> `܀`" >Ò .v `X .v 8>А bHq >䀠`2 耠`2  쀠`2 `i   @Π   : >#`@  >Â`h @8h  6  > `܀`"8>А ?b2(` q` @> `܀`" >Ò .vG  q?>А !b >Ô   5   `@9ȫ㿘 h`  > a8 a8" 0`` > a8`1>tK"ā>  a4>>Ɂbl"@  `@ 33 , h` ``> a4`<" `ݐ < ``> `܀`" >Ò .u `X .uې 8>А b >䀠`> ``> `܀`" >Ò .u >Дc(  >   @Ŗ   : >#`@` >Â`h @8h `[ 6 `> `܀`"k>А dcPe` ` ` ((`(@  0@ Ӑ(0@ `/V> `a`'@(`@7TC ?H b8` @"` $4 |( #@Sw> $ a$$` ` ``(((`@2$` 2,(Ȁ`>Р c#> >Ьc/> `2  `ܐ `  ( `܀`"z  t ` ` ```܀`"e   .t >є`  `  @`܀`"Q   .t >ѐ `PD  @ 9 /   /@Y' 0`(`' /0``(`' /    ((`(@'  ((`(@?'  2 e (`(n Ѐ"C`2?((`(@8> `܀`"-` .tv >ѐ Q`  "tt  t> $`܀`` .tX >і`2 (` q` @> `܀`" >Ò .t;  q?>ѐ a( >Ô    )   `@9Ɲ s``  d(`0``@>Tc< 㿘 h`  > 8` 8" 0 >V^̔ $  㿈  qƹ  >Nc` ` `0@`(M Ŕ((`0``2D  ?@$0 $ @*< ,` .` q @2, 0`0`,,    #\L >"``@8`"``І@8`>Â`d@@8d@$,$ |b$(44$ `/7? 0/$$ >Nc` $(,,,>ʂ```( :,,c@`0 @?,((.`.`.`.`.`.`.`۠  ,  q㿘> a8`+> 4`;`<(` 44`<>  < 4> b(`0``@"``h` " `l  E``2`d> a41>q"ā>>W"Ēb >ǁc  m` n n mX o mX nL p mX p n p mP mX mX p p mXHp@`   @`  -    >ʔ ">a 8㿘)`:7 03-`"+   1  `(%`@ [` $`  +  '" `` @  VC  'X`'T'H'L'PT ''```  `|*+ 2;   0p ` `(`8``: `8  ;  _ 7 `@ (`  T   @`'`U F ``'`#\`H`, 8 @ڔ `H" `ph`"`p4'`pc/ 0``/00/ / `v/ / ` `(`8``: `"``*  `( <쀢 2  4@  (4@``l& (`#\@ *ڠ` `(`8``:ڢ`Ή,b``@w8`"I "2>6QZ􀤠,A`lt`0_􀤠,`` `b``@8``,`">b``@8``,b``@y8``v,b``@o8`m,b``@f8``b,b``@[8``X,b``Ȇ@Q8``M,b``@F8`D,b`a@=8a`:,b`a@38a1,b``І@*8``&,b``؆@8`؀`,b``@8``,b``膀@ 8`,b``@8`>Â` @ 9 >ʂb`0@8`0 7ß|?Ø㿈``D@`@ >?`(>ˀ  > c@`12>ˤ `@` >>ʒ`# ` l  v`@`?>Âa>#\#`#d# ̘ >ʒ >āb#x> b'@8b`2  `2 ?c``   ?c  !  @ /؂ /ِL >c0?b>ʠ b/沺`(`0`` 2|la"x v`",@2q,`,0` 4`8`" ,@  2Z` ` $`(`" @r  2C`@<`@ "  `@-<` )    "# l@"@Ļ@m @ P׈  `(@<`(̛ @'2@ &0? lb"@Ē@D @ؐ P_  fd>ʂb`(@68`(p @!>ʈb @9  (`0`b; @9 ;2@D>¼, ,   "@`( @8`( $ >ǂa`P@8`P!p`    (``0`.`>W@  ->р M!h ް +Ho 4> (@a> b> b >nc S0P`?/ v'   =D  ' hݰ 0 @ 0" 9 >ʔ @Βc  4` 2 >ѐ!xC  <ݔ $ h  `` 1`2` `2`?cw2`` ,`(`0`@  , 2H 2h b 1@ ]  '`W`T /    ,#\ HG G@m  @i 80<՘9 4 8ؒ @1  /؂  /ْ@Ô $ 9 `  @E ـ`2 /   v >l! #`2 1 , @`>``0 ` h*2  ڨ 0 "S` ` `` /`(`` 1``2 `` `2 ``?c" ``2 8` ` 8`$``(`ؔ @אڐ7  ``#\`H`, u`>(`` 0g`2`<` `2 `<`$`2`<`(`Y 9`<`,`' 0  7 P``>`(0`(?c0000``pc.0``.00.. .`H`" `h`" `4. @l @h`$>`6`$,`l` ,`&`(`#\@ `H*c  Fh̛??㿘>Ѩa>`>Ѥa T 3         ">  ? ?ۢ$@@ 40ѐ,@̢`>#,@㿘>`0x!|@LԒ#((( @@#(`@J$* @(` ( @@$ 4$xc$x㿘 @  `@ `2 @@     (`8``@   "  (`8``@ @ @ @ @ @ @ @ @  ` @  ?2   @ ` ?  2    @((`88` `2   `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*  6  J?*@` `";" " J `* "J*@ `"" "R2@ `7"R2@ `"" ""@ `""@ `" :@ ` ""@ ` R2@J *` 2J *@     6 " J"`*@ `"(" " " J"`*@ "" J"`*@"" "" R"`2@"" R"`2@"" "`"@"" R"`2@2J? *   ` 22    ` 22   ` 2) +`@ (` 2  @(" 2  (`ނ(@` `2  @((8`8`@   @㿘" (``2 & @/() `2 (@  ((`` 2  ( (``   " ? J "  @((8`8`@   @`2   @`((`` 2(2 @ ` (``"@@ @  `"`"   @"" ?* / @  @"``` ``z `` `@ `Z   "  2  H/` /Hp@>cL>a`>cH<@2@@?*``@ "0(#@0 0 `>cL>a <  @"0@(`  0 ` 4"@` 0㿘>G!㿘>B!>a` >ǒ*|>>b㿘>a>*!a` D(@`?`(`>a>ǖa>>ǒ`Ȕ|JV &`'` @1> 2`8>"# @ @@` 㿘`,>Ѧb8 ->8  V }M U "  &0&`,&`(㿘`> " 㿀@> 'a> 7` ` @@@` ` `` @  `#`#d~#\'@\ @㿈>a&`,#\Ś   &&&`0&`8&`4`2`8>v"`@' @'@` &`(&`,㿀``,>aU #\ I D`>bt`2`,>bȐ@`,(`(`@@? `0`,(`(`@@ `4`,(`(`@@ `8`,`&`,>` @ؔ@@  @' @'5>̶`㿘&`(&`,  "   " 㿘&`(&`,x 㿈#\@ `? 0 `  `  ` \ @㿘>8`` `3``?@> cL>ʮ`H cP``>b>#``&`L>~b&`P>b`&`T>ac&`X>`b&`\>aa\&``>`c&`d>`b|&`h>~cX&`l>~b&`p>`b&`t>~bP&`H&`x>`b&`|8  @ɐ0>&`0b@ߐ>&`Db$`"&`D`D%>>ʐ cH>@4b`0&`4@0(@&`8  #\ @''#` ?o > chJ@ 2>3" 8%> &`@`@ @ 2 8>` %>Ԁ`" „  @Ġ%> <(`@F,`@* `8?@F%* ?%?@`0$j:  0$ „D$`@ >@>` Ԁ` @&`8?K&`<`0 ``07`` `0 ``0 `>`0`8@`42`3  @>ѓ2`ܐ#>ax&`8 >9c0 2' '''@>Ѩc8>a`x@@ې ''n  @ >a?@>є >c 㿘>8``+>a@(>`(` c>a`?09c?cĀ6 @2@"   @ >a`㿘 < 2`4><#@? @ -?(@` І= `?(`@  @ &`0  & 8㿘>cX>ђ#X?. >ѐ# `2`0 `02 `0` & yא.`> 7>d`P@02 8 4Ȕ >d>א#`P" "@ 㿘> b. @>8`(`8@ ?`>cT`4@?>#>>ڐ# cX*  `"  0@  $ @<  0 2㿘`> " 㿘 `>҂`& " 4 >" 4> >8`` >  㿘>8`` ````? ```?P` @>8``>8w>b`>8<@n>8` ''耠' $.> '䀠`  >a?@@ ` ''?'` '`8'2>`0 2>`8 2 '>Ґ`@ 2' ''@'`@ @"'耢`h'>d kÖ` >db@ >db@ >db@ P>8``>``$8#  @0&`0D  @<%>&`4H@  >@CȒ  &`< 3&`8 >Ғ PH@P> cT`0>@ p `8  >` 2' ''D'>҂`0#>da<'' kD''>҂`8a<'k 㿘``41>>8``> >``` ">1>t#r#1>#X` $ 3' &#X>A >ejՐ P㿘``41>>8``> >``` ">1>E#C#1>#X` $ 2 &#X> >ej `P>8``>8``4>>#>ej pq>8````$>> ##8  >h`@ 2' ''%>Ґ@1H $@B  &`8 2&`4 >Ғ ؐH@u@">ҤaD>d a`@> >̐ @ "`@9D' 'k `@ (``ސ>Ѹc8>ҺaD>Ҩa >d'> /-a`@j   `@  (`$(@D' 'jٖ @ʐԐH/` /Hp@㿘!> #|>cx.,#|(@ #|㿘 >>c\c`   @@,,@ذ 㿘>8```$`"  >!X`?>Ғ!h  >!p`?㿘>cx`7> 7a$`3>8``>|?8`((||?8(|`(@``>|?8`((||?8(|`(@1>>8`>b2(2 b#`㿘>8`` >>̐!xa0  25>>5!h>ʀ c>ʴc\`221>ɐ ,  @ *&5>x`2&1>ɐ ,?8 @ >8``>?8&x(|?8`@&x(|>>f#`c`t > 7a$`"1>y 1>#H/` /Hp@> c`㿘  @c2   0㿘  >4h` h``  h h`? >b>a>c >ђ @  >8``>c>`X** * * * * 㿘!>## ( @.>c (㿘!>## ( ,@>c (}> >  cc>bx 㘁㿘!> >Ұ a(# #>  Vd$c$c  #!`  $#㿘> b: > c`%f ">@((88` .@`@@ V2@((`88`"`   >%> a(#>8ܒ 2 > c`6 㿘>8``M   %e   ` % @ /+> b`) % 0-  `  @(Mw   `x /ɔ I㿈> ̒//////`P/㿐> c` > !؀ >c`l!ِ!؀>c_!   ,@@ @@, , @? @@, , @? @@, , @? @@~, , @?ڐ @@s, , @?ϐ @@h, , , 4 8P@? * @@@,  `,P㿈//7/// 㿀'''>ʀ  c  Ya@  3>!3 c > c`: 'M'  ' `@,' ' '`0`(`(`@@/ ' '`0`(`(`@@/ ' '`0`(`(`@@/ ' '`0`(`(`@@/ ' '`0`(`(`@@/ ' '`0`(`(`@7 ','z?䀐 X?`2 >>X>Ґ#a>!㿐> c`>">8``` >#>'􀠠 # ` >c   ?` '> bJ>c>8``>c*  ` ?(`  㿐A> c` >c `' >4>8```>c@0>4?`'>4l@# >8`Ԁ`Ő 㿘> c` #>8`܀`d>">9!>ʄ d# c< c$`>8   (#  (# (`Вb@@?  1>9>p"@ d>8$` c 1>9#@`#@`&#@#@@?  #@>X"p d&#@#@>9 c<@=> b2 @8``d48>8`>   b>c>8`(` >c* 8  8>8`?`(`  (` 8>ʂ"  }>8``Z 㿘>#0  @L%>  b>  c㿐>8``  $(`(`?" @4 0?  @. ?>  c? >ʲ c>8`` > ,?  @!? >   c>ʴ c%c@ d'&@V >"6 @`d1 c`$c  (@@>8   >8` >4  alal( ` `Ђb@(@8`!> #`$ $ W2 > c>" >  c>Җ3> @*7>Ұ c@% 㿘> 0    @ c>˂`X` `` `((>ʉ)  c>>  c|>  c c ( ( (`` (``ؐ  ((`>Ҁ`b>b><# >8㐀` $`>3# >8&`> 8b `V ` >  c>Җ3> @7>Ұ c@ 㿘>8`>b`">p#X  U 8@ `8>^#P >W!0`? 㿘>8``>b`> c B`  ' 8@ >3!(`? 㿘>8```(``>b`> b`    8@  㿘>8``>b`> b`    8@  㿘>8``>c`>@Fch>y#p>ܒc#>р 05>̒  @ `@ $0` @    @( `@ >8``'>b`>`X>   b>  c  ((`(@@@>> |> c> `@(`` >c"@`(@㿘 0 @S >ʄ  c> 1>(`@#㿘>8`` >j#`?H/` /Hp@" 4>&"". """a"" ""("",""0""@""4""""""""Ё""""(""@"""""`""(""""@""  "", ""0""4""  "", ""(""0""@""4 €@@  &Ā@Ġ@㿘> `  >Ԣa T??V" 2? > cȁ!Ȁ`H!8``"""!"!"""""""""""""""""""">ma""؁ ""  F @@㿘> b@2@2  @ 2`2>Ґ㿘!Ȁ`<H`"4 >Ҕ?@ܒc?` 4 >Ҕ?@ђc?< `>8`?`;? @`"4 >Ҕ?@cЀ?` 4 >Ҕ?@c?$>8<  `>Ҕ?@c?>a>Ҕ?@c?>a?>@c>Ҧc@?>8`> ct@2  @2  @2  @2  @2 &!&!&!&! ``@!`2! &!!܀`2" `&!"`2" @&""` `&" ` @`"""`2">8``""#>Ҕ @0c耢 &"@qc@( &""`2" `&""`2" `&""Ā`2" `&""`2" ` &""`2" `$&""Ȁ`2" `(&""̀`2" `,&""Ѐ`2" `0&""Ԁ`2" `4&""؀`2" `8&""܀`2" `<&""`2" `@&""䀠`2" `D&""` `H&"㿘@>8``>Ҕ` c @ &!&!>Ӑ@`>&!ܒc@ &"㿘 @>aԀ`?c #@>֐  Ġ@㿘 ƀ@>r" &!Ԃ&"@2> 8 !&"a &">ra&"!Ԁ`"  &"㿘ׁ㿘>Ӓ  P"@`)"8>Ӏ`X>b>#"D> b"Lbؕ8>ӕ2 h: >Ӡ`"\`/8`"d2>Ӕ v: $>Ӏ " ",8>ӓ2` @i:` >"`>`>Ӕ`"(",8@?2` @>Ә h:` S >Ӡ`"t` >"|8`2!E: 1>@"㿘`9@&"8>@a0 &" >Ӑ@a@ >Ӑ@aP>&"(a`@ޔ  &", (@&@"" >!p&"<(@&"4 &"0&">Ӕ @Œa "`&"㿘!!!!>א!㿘"` >8`0  1>@3>Ӵ (#a؁㿘!>˒  X X `"" `#`!( &"`$" "&"&" d&" &!܂!&!6ya@ &""&! &!? a0 &"!,&"!&! &!_^`@&"!&"$&! @&!܂!&!}b@&" &!㾐'pp8```&" > `T &a>Ӕ @Cb  &ãX8```2aȂ &aaȀ` >8>@ 0><">8``` `>>bb>ӂb>  P,aȀ`>ab`@>`T`>aab (b@^ah d> >/"8 >>Ӑ#Д@>~0>(``>"H>#b `"araȀ`&`0>ٔ"b `  bğ@@s 㿘`_``?㿘`>@EbP>&"8b`@  2&"@ &"@&"(!>@5"h  >@.bx x "@`u"h @>&"Tb@  @ &"L` (@@2@ "&"P>Ӓ2"&"P >@cb"T&"X &"D>Ӑ@Vbx>&"lbА@P  @ &"d` (@@2@ "&"h>Ӓ"Y&"h >@1c"l&"p"P"h@&"\"L"d&"0"D&",2&" >@c>&"4c(@  @ &",` (@@2@ ""4>Ӓ!p"4 &"0>@c8|z&" !>@#P "3" #P @ސ>&"c`@ؔ  @ &"|` (@@2@ "&">Ӓ#x&" >@c"&"EC&"t" `1>}#㿘>}">>Ԑ"(}@>Ԓ"x>}ܔ`>~"㿐>b@ ''Ք㿘 + >Ԓ}"> `+> Ā@"  €d   ` >}#> ` "   㿐>b@` `>ԓ2`}#H > #Ā > c`@ > !#Ą? c>  cȁ{㿘> b>b>>Ԑ#}W㨒>>Ր#}P>`x`" >@>>Ր }E@>~  p㿘>8``2  >`x`2& >~ `>ː0  @ h > `x1>}&#㿘>8``2` `~``?>w `?㿘'>|>`0 ```}  >| Ȓ `>| |`0  `㿘 `2 &`00  @ $ &`0@4  >Փ2`|ݐ!`0  @>> `|>s` |㿘>a|` >/!`?Ho+(@lH/` /Hp@㿘` .`@4@? 4 @4: 2 <`,=,> 㿘 @ . M@. K . M . K@@"?. N . O  @??. N. O . L. L. O. N >al> c?c( (" " `>` 㿘%>8`   . >`@㿘s#>8``  ` ` g >`@ (@>8``>)b\ 㿘 @>8``"   (@>8``>)b\ 㿘@>8``" j  㿘(@3>8``"] (@``U 㿘(@3>8``"I `@" A  㿘    0`*`@: @3`㿘`" >{!8 >{!@ 㿘>`%>8 @`  `>{!P@ `` > " ``   >fb 㿘 ``!>  `     $  & ` 㿘Ho%(@f@g㿘%>   $$@ `@ 2 4`P` 8`P`"@ 0@,`㿘 >ˡ. `@ `@ِ $@`  㿈`>ˡ- `@`@Ð$@`2 0@>Հ!p0`>z!>Ւ!z > c-   >1>8``<>Ղa '耤>Մ'2>Ղa'' ' ` ,@, `,>Հa>Ւa@ ,`',@>  `4,$$$$ z &$  > b > 1 ] `"@ِ$$> ,L$ ,O,K?,N  >t [Δ 2` ??  ` d>4က` >4  | >  `8@` |@>Ր"{# >t@b`4&`0!>   ] Y >8``<> @b( 5>t`4 ``H>t `\ `X`8 `\ `X ``㿘``y *` `>8``8  2 >8``2 >Ք?@b8`(`8``?>a <&88@ 㿘  @`4  P`  * P` @  @ * P * P * P㿘    ` 6 %`* 6* 6* % %>t`Ȓ 㿘 8 4 ݒ  ?; 8  8  `@@  ``@  ``@   8  @@  `@ "Ȱ `@° 㿘 y`  V p ` \ 0` 㿘 0S T  6%`@  1 2   g 焐 !  J $F  *B  # =  %  8 &4  /`" ' ,  '(  .  # +  ,  -  .  /    #  %  T``6(`%   /`" ! 0  !  d X  L   T   (Ho$(@eHp@ `p2`` `" `؃*`*` >  `Ѕ(̐> a 8`(`   (@ (@༂(@ ༐ @ ??  P`  D`/ `,` (@`4`" ` (@(`@( h(@(@`4` ``  (  ̞@ֆ 㿘y  $& {㿘` 㿘>8``  $     ``P` ?`h (`h (㿘ab @`` d (@s??2 `?㿘 P`" ` h ( `? (_ `(@ P`  h(㿘 ! 6`ܠ`  (@&(`ܔ `&8`>@b@&,`ܢ` &4``&0`3>}`$a\8`$ <4 p >{`p 6r aW&Y&6 ?1?( @c6  `6 .  (` 6@㿘> ` 8`@:ᴃ(` 4Ғ "0  `"  ܀@(   `$ $ ?$! А ` (  @ @$ $   @$   㿈 D>ՔbP  L>w0"X 1>w'# } |5>1>մw "p   | } ~ #`>Ղc@>>>#d#h#\"Ȕw "㿘`>w#  >>} >a!\ >>} >a!\㿘ab  ` @`Ѐ`$ ` (  d >հ?wc @(|X2 ` >w{c?$ ?㿘O  P`"  h (@(`(:  H  &   c!a)# `@`Ѐ` "  2  2   |` `  |`` `? P`  h(   㿘 r 0x + ` db   ]  _W R  P`I O ? 㿘&  $r!!&!D!``&!! &! ! @!D`!&! H&!  H @$ H:!`O $ L㿘 DaD& Xa8 T` ``6" `" ,* `2 P |`؀`@2  P }`" P>Ւ`u#/ `@?`1& L`  | >Ւ`uҐ#  ```  @.*@? >>Ւc^@>u#>}`  0 8d$ @$ <$ 0| T`& T㿘 p`2 & p L` `` & L& p& l 3 5  D2D& L 2$  & H  @ x` ` 8 <0$( (  @*  @+0: 0@  H L`84>փ(`>w$@& T$ 8 $  x*2` * :@@+*` <NR``` & L$`(`@`4 "  `"N;!` $ `$ P & LH $ P`" 0@"6$@2?$&  & Lp0@\P a/@ @-@-@%@ 8 $ 8 /@ $@- H 0@& t `& x,( & L 0& l[& N, ) M m, @ ` e _ Y S M @  u A, @m ` 9 g 3b .%`X ` $ R  L  F  M@ P & L   0 [  `) |`` $ }`(h:$ & & l Ђ  d& LMy 0>֐Β`0M 0 8 <  @ [X0i DM 8 < 0 @ [K0 ` }`2  |`"% T` 2  \`@2 T ` }` \`4  X``@`& \& X X``& X `" X`  @, *@? >>֒c\2 >s#& T & X \`@3& \& X $$솀 8@ < < @% <耠`$ ` @)F:e I D d & l !& & LLؐ  Lq & L  & l& Lc  / L] P  & L>8`@+  Lj  `C |`` > }`:$`" P `0 L2 & L㿘 p```  L> @ L>֐ `s[ba㿘QXW㿘H D`  L p>֒ r  & LaD`"& L L`& L=<7@㿘 $!`D&!&!D`H!&! `H @$`H㿘 $ &  D L`㿘>  D`8`@Wᴃ(`R  x &O$@ 8`  (@@,Ԓ  4`> , ,` @(@  05  6 $<` `$*@@*ӑ* x8: 80`@8` 8`@ 4  `(` $8Ki`D`~0  $@0d$0t㿘> a 8`(` ܒ   7 *$,$D`$0@`~|``xܐ@`  r*@: 0`@8`8` $x$|`(`$Hd$8  㿘> a bA 8`@(`@  b@@"a ep@s@2 . e@Cr@: b>@2 z`܂a@"e ) `q@{  `h@2v ,`Ђb=@"\ n c@`)0f }! `А! . T  N `А @! "`Ѕ(9"? `В Z 8 e`g@4 `Ѕ6 1? (6 ?6 c.  (` 3>}@a\(`8`` ] " `n    4  " $a㿘>}aHaI+a`>wI&c " > 0  >qD ?q@ ?&`&a&`؃,`@  `4? < 9 &`X` &`LhaYR`02&㿈 `"8&`00 @R &`0`P&`L`&`l&`P&`p`D&`D&`H >q ``>  a&`> c@ "`>p!`^` >|@c`0&`Ȃ&``&`d&`h`2 `P (`h@`"|`0`P 7` &`P Xe&`\ "`P`>pɐ!8` 7 ʐӐ  7>p!P 7>p!p8 3'>8``>a>Ւc 2'``" ` ` 04 @" `  `< `@ @`'`Д>}HS`H`>}HN`$> '`Р>y` Q'`'`  @畐 &`h&``&`d 2㿘>8``$``` >Ձ  >`>a cߥ      8@  /> =%/>4%4/>  @`E < @   7A2Y    @2 $ a$ 4@  , ,2 @$ $ +>8``-?8 -0-?8 - ?$ (` --00 @-a""  Ѐ2 @ , ?$ ( @-a"  Ѐ 2 @`  ,` @$ ( $  h %8+>8``+?P `-`0+-?P%/> @̀㿘L` @`@㿘 @a<8@ ` `>ְ o!㿘 8`C`4>a  ` ( @ >8 8@&a<   ((@ @&a@ `` >oe! `0 &a@&a<  4 ` ( @   ! $ *(@ ! (`  `0&a@&a<  8  `@    4@ 4 4@ ` 0@ & 4  `&0 㿘>8```2 ` 8`  & 8 q``? 㿘`"!H >n"( >@b8 (``"!H>n"H!H`"!<>b>n#P!<!@>n"X!L F?H``$ `>nА##>Ґc@愔?  &`0@c_^@{@&`0@`0>n"p>֔ @ob ?&`<`> <&`8 @&`4  @_& 8!&`@̔ @Y #>&`@`H@Ԑ $@'  &`8 L &`4>֒oe"`H@`"'8  >ޒb 2' ''@崐>Ѭc8>`(>/>8a>֢b+@'` @s D' '`@䀠@ ' (@@'O@刐 ֐Ho%(@fHp@㿐 0 & P/ & L *  "@"8`80``"@"㿘 `- &  8㿐 <`   0`?` /  㿐& 8`(````2`2 0 //  @` ` " H"   ` * @ * @ * @`` >>`0"" <㿐 l`j @ 4@` l@e!b㿐 Q/ L` P`F T`2 LS0`>8`@&e#贒 $  0 & P& L  TF~2㿘 H` >`<>c& 4> N& l㿘c @@8 c@   Hc @ c@" ?` $  & E0 8&  Ho%(@fHo+(@lHp@` @@ 8`? 4LK(J `"@M(J@J  ` `߁(@ 4T`"`6`(`0`*  H`2 @` 2 㿘 4 I H, I K @`" L`l> (`@`@  L``  . `l> (`@`@. 㿘`t&`t &`t `P @ `H`l> (`@`@ 4`O`T " 6` %8@@* %* % %* 6>t`Ȓ 㿘>  lb0`l t(  4> @` |  T X`& T& X 8Eϒ <`t` -`79@> 8 ? > b0(`:$p @ P X`& P& XE <@2@2@@?2  ` ,  > b0(`$ `.  : x2 )& l t h@ @& t t@  `  . 2 -2-!  ` . XΑ㿘  0 `, e `,  `, 㿐 P T& X& P& T>`b>֘bP> b>ւbP#\ >ې lCcȁ㿘 0 `2 J H@ H ` ` ` ` ;` J ` . H I@. I$$ ,. P 4`T" @?`  l@"6 m@ k@2 `D6(@6`}@(6`D` ` " "  #`D>vc  4 N T"`6@(@(6 D` ` ! !  " Dƞ@㿘 (  D`" & D $ $   @  $ $  ` `  `,  , . P㿘 p|t  ?ϐ `p`Ւ 0.@.``@:xِ   &p&t` ., P` d `.-  `. 2, 2, ! 㿘 4 0 `. ̒ . ``tb"  \J >8`> 8  \`2  \ 2  , 2, !  \`@ 4_HM@㿘 s>  `" 4 `O`& A`  `2 ` `  , , ,`P `  , * 㿘 s>  `Ɛ" t` $ $  ta`& t 㿘 s>  `" 4 ta( `$ H`  P H$$ t`& t ,  @`$$ܑ㿘 s>  `y"`( 4``$`@2  ``  \`"  ?@c Ā@ @  2| 2v 4 6`? c  2 5@`@ ` 5,4,6d` `@"@2,5& & & D`@ ` $ $  $D@@>  $ d`$ h  , , ,P `"  ,  b4$ d> b8$ h D`  `, +n h>` a`8A`,@`4> & b<& &`4 &```&`\> c?(c(>i #`\`````&```\` ` > 7 > 7 ` `  ` > 7` `>ܒ``\` ` > 7 ` > 7` ` > 7` `>܄`@ `>b>hΐ >Ր0a  >Ӑ>)aЀ 2>>Ӓh"8>h# >c" >`" p" >b" !> &`0"0   &`x"0&`p`p(`&`l&`d&`h&`|"0&`t X`2`\ & ``\``@ #'  '  z' 2`. 2&0  ` `h` `쐒 9g㿘>  " 0>  `l`( 4@ dј \9]@4@ y@"=zx@2E 7@{@2= `\@j@21 ,c@`("(   S 0  ` &  \`$ `$ `  ǰ 0   &㿘>  " 0>  l`( @㿘>  x" 0>  l`(@㿘>  g" 0 t`  4 l> `(@,Q< t`  h? 0`@>  `";  04td d  2 nt` g$p X`"'@ " 't>ܰ gm ( ' '``` '``"`@@'``@'F 2`- 2L,$o\`2 $ c$ $%$$$ǐ~Đ`t`#$tx$pp$l> b0$t ,` `t`   - Q``>  c/ an Q(``i g `b$t Q(``2  2t``"t`$t@2 Qt` Q(``;!: `  Q(`` " " Qt` ` t}$t`2- Qt}$t Q(``2t@t``0  2t l> (`@  t`  㿘>  " 0Ho%(@fHo+(@lH/` /Hp@㿘 p I H, I L@`@`" .(ׁ.(ׁ`>`  p N`` 6(* 6 D`Հ` Ă " DŞ@㿘 D` 켐& D $ $  `" 2 @  (̂`$ @$ ($  . 2. !  (Հ`,(Ղ ,(. P p Oh 6` %8@@* %* % %* 6>t`Ȓ 㿘L p(׀`& `"M .( 2 , 2, ! ʔ  @  (̂`& @& (& B@㿘) h?&   (І(@((̂`@&((&(Ѐ2$ 㿘 酐 u`2 J H J`. H I @. I @ $`$`,h. P㿘  逰?C `p`I 0.@.``@:M   &&Ԁ` ., PԀ`  Ԑ`.A  ԰`. 2, 2, !/ 㿘 p@`" (@㿘>հ Va  ` 8`  f?㿐x  & & & >`b>֘bP> b>ւbP#\ >ې ewcȁ㿘d p@`"@b X>  b`  p @    `& &  t>* <57@ t)`p ` `@  `& & > <`@2`2,$`@2 @Ҧ: ? 2  $ Đ`(&   @&  @ (Ԁ` (Ԑ.( 2 -2-!m (Ԁ`(Ԑ.(g㿘 (ـ`,( (؀`,( (ր`2,(с㿘 p$u ">  h 燒c >ܐ d   pLK(J(ڀ`M(J@J`  ?J`  (@ 4 6 5 D`?`, 4, 6 , 5(Հ` & & Ă $ Dꎐ(& `& (Ԅ .(.(, P(Ԁ`  (Ԑ.( Pk(׀`.(|X )?& 8& H #@`  @ @`"###24@`  @ @`"  <#袄 `2!& H# p#@`  @ H #2?& 8 >cU 0㿈>a` &`0`T>;"c`t>;``&h&h&`h&h`,@`4> & b& &`p &``&`> c>c* ``  ` ( `?c @(`  > 7 `>`X >cL > 7`  `!> "` *  Ô &`"`&``(`&`&`&`&`"`&` X`2` & ````@ w#0 ` ?      2 !`. 2m z>8&`D``"`D >] jc>@}`  >`Ѐ 2`D &`D`D`H`  '>b `H> b`<>b `<`$`H`H>b!`H> b a '(>ۂb@@2 > b''>b}#"> @Zː"㿘` @@ @`@㿘 $ & , & 0 P@@   0   㿘 $ P@@ 0  㿘 $ & ,& 0 P@@ 0  㿘 $ P@@ 0  㿘`"   (`: >ܔ @2b !( >ܰ b!P㿘88@ @ `" >bѐ!X `  $ 0 8@2   H2  " 4 4& 4 4 0 @  瀤`㿀8@ `>b!  ` `2'`&`$&` '>?Ԥ>cx cF`$0@ d?28`4@  6䀢32`䀧2* `4 @`4' @` '`@'''Bؖ " `$`" 0`$ 0 4&`$" H" 4`(`&`( `'䀢@$`$Ho&(@gHp@㿘 (` X T$ X 84 $@  P T@ @㿘 P`@ `9 (2    #8`@  `2`  㿘 Xa3 T 8`4 $@  T`4 $ 8@  X`, *  $` ( l1  hb b  (" (4 # # ! &2     A&!  X`" X>Ɂ`X l L>b T㿘 X`9 l 㿘 X`  T L*` `" Ė  \h ! L*` `#   \!@"  \ L(``#@     \#@"  \ L*` `&   \5@"  \ L(``&@     \3 @"  ` L*` `(   `<"L \" ` X L`& X *`& h`+  q  `@" ` X L`(& X & h`+   _  `@" ` X `@& h& Xa& L *`  L`0 `@" \ X `@& h& Xa& L`0(`@   7  \`  L.``  - 㿘 T ,` ` 0@ @0q s@" , s  @2<  @ <  㿘 T `0 ` `,`͐`<@ $`0 & `, & \b㿘 T X8 $ 8`! @? !.  T 8`4 $@ @#"  d2 T L`  X`d T 8`8 $@ 㿘 XU" \ `  @ (` @" T`2 T $`8 8* /2?b 8` 2 `2 T $`8 8* @2 X`@" T `@ (`  T $`8 8  @ T $`8 8 @`" X  T 8`4 $@ ` # a2 T ```$ X>8`ܒ :>ܐ X-??`$ X> lb6ѐ8a!㿘 T`d(`0``-`+4 8 $@  T`4 $ 8@   h`2 d & h d h`@ & d P& d`@A ?? 㿘 T`` `4 $ 8@  Xd4$ ` `((>܂ @@` ` >_p!"`8`8`$`8@ `T`$`8`8@ `X`@`T`8`8`$@ 㿘 T $`, $`0 T 8`4 $ @` T`4 $ 8@  " T`,`$`, T $`4 8@ $"`0$`,`0@$`0"v 2 T`0m` 8`4 $@  T`4 $ 8@  X`@ ` "  T 8`4 $@  T`4 $ 8@   "!!`0   !`0`"$`0!"`0  `0` @`0` `0``0`$`0`0"`0ɐ$`0`0`$`0$`0㿘 T $`, $`0 T 8`4 $ @` T`4 $ 8@  " T`,`$`, T $`4 8@ $"`0$`,`0@$`0"L 2 T`0F` 8`4 $@  T  8/ $`4@  T 8`4 $@  !"`0  `0 ` @`0` `0`$`0`0``4@  @`0$`0`0@$`0㿘 T 8`4 $@  T 8`4 $@  T 8`8?b  $: 㿘 (` X`"`J8`D0>` L0`@2C 0; L0`@"` T 8`4 $@  T$`8 8 $@  `d(`0``" T 8`4 $@  T%b`8 $ 8@ /0 L0`@ ?   㿘>ܐb@?? 㿘>b   >\"P (>&`L|&`T&`P&`8&`X &`h@`T`$`4`8@  ?b&`\㿘 4 @?c !2  4@  0  㿘 T $`, $`0 T 8`4 $ @` T`4 $ 8@  " T`,`$`, T $`4 8@ $"`0$`,`0@$`0"! `0`$`0` $`0 T $`4 8@  `   `0 $`0$`0㿘`>,`802` L0`@27 0/` L0`@"` T 8`4 $@  T$`8 8 $@  `d(`0``:0 L0`@2 ? *  㿘  `>[Ԑ" (>&`L&`T&`P&`8&`X &`h@`T`$`4`8@ ?a &`\`T`$`4`8@ &`` \?b< `㿘 T $`, $`0 T 8`4 $ @` T`4 $ 8@  " T`,`$`, T $`4 8@ $"`0C$`,`0@$`0"9 "5`0 T 8`4 $@  T 8`4 $@   "`0   2`0`0 2`0 `0`0`0 ```$`0`$`0㿘 T 8`8 $ @ 㿘 (` K`"`=+`701` L0`@26 0. L0`@"` T 8`4 $@  T$`8 8 $@  `d(`0``60 L0`@ ? &  㿘>ܐc@?? 㿘>c   >Z"P (&`L&`T&`8>܂b&`P&`X`@`T`$`4`8@  ?b&`\㿘`0`*0$` L0`@2) 0!` L0`@2" ``d(`0``0 L0`@2 ?  6 㿘>ܐ2cH@?? 㿘>cH'   >ZL"P (>&`L<&`T&`P&`8`&`X@`T`$`4`8@  ?b&`\ 㿘 (` K`"`=+`701` L0`@26 0. L0`@"` T 8`4 $@  T$`8 8 $@  `d(`0``70 L0`@ ? '  㿘  `>Yѐ#` (` c>ܕ2:` #Yǒ@ (>&`L&`T&`P&`8`&`X@`T`$`4`8@  ! &`\`T`$`4`8@ &`` \?b < ` 1>Y#^L^`^L^L]bbbb|cccDccddccadddddxddddxd*`2 *@   ((`   (`() 㿘 @㿘 @%Ł" " " " 㿘  (((̐ & h& &  &   ` @@     ((`@` @@  @㿘   & $& (. B& 0@@㿘  p`& 㿘 #>4 a1 ``   `G`21>4>(b@.  `M`p`@(> "b\`>ܐ c>ݐ ^>ݐ Y8@2 @>4!] O1>4` >4>ݒ pX!C1>4 `(?1>4*`6;1>4 `(@`1 (`>@* >݀`@`>ݖ`+ !>43  !>X] `"1>4! >ݖ`@"@ >ݐa0>ݐa0 XC1>4! 8 ,`$>`  + *>ݔ23 >`0!㿘 0 `>݀`qa 0>b >@! XF```   0(``n 1>ݰ!Pg2>X1!p 2`">X+! 2(``  >X"! , 2`@ ` `,>X! , 2` ">>ݒ `,X!>X # 3 " 7 0(``>`>ݔa>W! 7`* 8 ">W"  (``" >>W"0 >`">Wܐ"H֒  (``1>ݲ"`WЁ㿘 `` ``>Gc>bx.`.` @(`"C* ?! &) 2 `? 㿘 0` ``? 2` `` 8 (`>@  $ "|& $}  `@2  `x  < =(`@ $?񀠤6W`h`Q < =(` @ [ V `8T V R VM ?b`8G  $ UE1 $ a2G  = <(`@@8   = <(`@?@`( $(0``" 1 $ `  $(`0``2 R  ? = <(`@@ V   `  ` 㿘 `)  (` (`>,@?(@?  ?x (>Vސ"    &   㿘 l >ݒW"@( `& l$& @㿘  @   ((`00` 6  @ 㿘  @  `"  . `2(> @`  `$ `@  `` ` ``@    4 (``2   #ڒ  WM"ذ $` @鿐 㿘@ǐ  & #& @鲁@@㿘 @鲐 @頰@ 㿘 @馐  `  `$   & @鈐㿘   @鍐 ``  `$    & @m㿐'' @q>b؀` `&  @@    ! 2'@H` `' @2㿘@=@&@`   &@@$㿘@,@ @&@     㿘   !0Q d 2`K `@L  㿘   ’ ?  @  ` `&    `  ` @ `   `2   `((`00`@:  |26  @讐 `"   t  " 㿘 @詐    6 (``2  "  @茐 㿘  `  @荐  `2  &  &  @$  &  @p 㿘V㿘   @l ` &  &   @$  & @P=㿈>b J `">`& >`& p>ݢb& l@A l $&  l`@'Ӑ?"㿐 '' @%>bȀ` `&  @@    ! |2 >'bȀ@ @@2`` `$   6  !`2>'b  #͘  (``@͐` `' @2㿘@>c #  `@私㿘 `t>M!  1㿘`? >˒"@K;    "  c" " "  C$ t" `>b$ w `+ >b'''''U ` ֐0 ` ` 㿘ƒ(    ' ' '  '  ?(6(6(6( ((ِ{㿘   && &`& (( (._㿘h `\ '` '`'`'` ͔` Z*`*@*`?c`9㿘ah `\'` '`'`'` § ` (((  (t㿘=  & & `a0 c& ((W㿘 &(`0`@   & & oc& (8(ڐ㿘 $(`0`h?(   '  c ' 㿘   $    :,  (`  $`   `   `$㿘   & & c&(㿘   2 >R#@` "" " " "  ` >ap 㿘 ``` >K~!@㿘 ``>Ks!@ 5㿘>˒ !I >,a|>`$ $ $ $ - 㿘>˒ !Iz >,a>`$ $ $ - 㿐>4 `    !>˒ x #\>Lƚc0 L 1>˒ $!   >ݚc8#\L!L 㿐& \`dh'`'@'`2$`2$@ $(`0`b <``2 $b #\   2  $ݐ _&/ (`0`j > >``P b #\ O F(`@`< ` $@&(` @`.`2* <`` '`\$`V  '`K$` M  ?@ 㿘 ``** `` `(#`k>04```c>. !`2]>0    @>@   !   >@  (`@&   >@ &        024`+`,-`      @@ @ @((@@** @  , ,`@@ >@& `R#H㿘    ` *  &&& U & (( !Ð`" " " >" a" " h >b8Z ` >b''''ddT\(㿘`@|   v? (`` @`"( ( (`(((`(`(`(` (` (`0`(``(`(  $ ` " @K $  < `$ @`"@ h$ @` `"  ` H  2&  @$  $ ` $  .` (8 ` (@`C .`.``  @`)`   K`㿘``~ ` @y  3 s ```$ ` " @K \$ ` $ @`"@ h$ @` ` "  `  2F  @$  ` $ `$ +$ .`[ B.`Z (`8& (`>@  $.`[ @&`$ `(.`Y 0a  >P"P `(.`Y 0V     .`[`   @``  K` 㿘 a@1@ 0a @2. 0  $a@#0a@2$ 0(`0`j && 8`" (`0`" (`0`"  >``7  0``1 @a@0a@ a@!  $(  2 $`2 $ $` 2 $ $`@2 $  $`2 $| T`lx 㿘`  (`0`2  " @ (`0`2 @`@ 4(`0`@ 2  (`0`@  2  4"@" 4 4 2" 4 2@ `] @` ` ` `"``"`@ J` ` ` `"`"7?` `\` : ``` ` "  * * * \ ``_(* \* @0``0*  @`88``0*  @``0*    @`4 @* `*  `*  >b$ 㿘  A    * * * * А 㿐 (``   ?  ݖ& x  -Ȟ@㿘 I !> # ) 5 ` `(`@/  I# 2  D L    `   %x IJIG 㿐 IR !> #  `   (`@`I>#Ж I  $`> B` `$@5 `0 ``    ݂$   ` ``" `  ``@  ( `%`x Hؒ HӒ 㿘 x`C $Hے  >>``4> c $e *``(`@` 8     "  @  X "    "H $㿘  (` 0`' 4 21@`2-@`O 2"@` D 2@`9 2 @`@@$@'@2@㿘`>M#`  < =`@`@ `>֨b؀ 25>>1>>>#p#M>)c>&c>#c> c>`>`>`>`>` >`(> `8>`P>ِ h`>bؤ DƔ p L  \   *`*2`2>L  $(`0`b" >>L  ->`>L ȃ-`>`>` `>L  x`l @`M``8 x(`>@>  > !>!>!>! Li x``>>ݠ 0`ha(>` >a0```  `$` @  ```_LC` L?`  x`@& ` L2 x`@a8 ``8 >(`>@>ZaH㿘`>L# 㿈 ,     G0W >a$ ( |4 4 $ $ $ $ $ |$ 0`0``"  @ " ` $ `2 & $   $ >> $@4 $ &`4 &> c  :G > c  : < Fޒ : " <"ذ  $`@" $`` `" $r `?`/ "- $(`0`h2' x`"`< x  "`< " @2  `2 z`  `<a : " > !`ؖ  >>`@`( & C`` &4 & C`" C &4 & C` " &a4 &` & @4 & &(`0``" = 4  =(``6' $`4 $''>#,+  >K#7 x"$4 $(`0`h"4  24 ` :F;    4 > c 4 F :4$$4> c >+́ x " $B $  $(`0`@"0  C 0`0` `@ 7 ` 0"(`0` (`0`   @ 㿘`K 0`"(`0`@6C ` (`0`@?&; ` 67 d 4$(`0``* ,). "$(`0`@" `0T  `0` `"x@x "L ͔  㿘`( 0 "(`0`@"  (`0`@     "` 2` @ 㿘 0    "  2 `"(`0`@8 8 `?`? `>cĒ  `>c  >a 㿘  0%  U   \$(`0`jQ  >>``I(E  > B c! ( ʚc " Dޒ(1    (`((@@ @0``  ` " `ڔ`4$%`4`& `(D ɠ   `  㿘 0  `"(`0` 8 8 `?`? `@ `>`>aX 㿘%  , H`` ' ' 㿘   2 `0` 㿘   2 `8(`0`8 8 `?`? `>c  `>c >c  ?>`@?㿘>8`Ԁ`>  c&8`.&`0"(``2`0 6"`0"6`8 `2`8 ( `8>*`!PH2``0`8 (`(0`0@:`0>H!``0 ">" >ɔ >H!p>H#2&`4!Dphhp d ,8DP\hhL$hhHo$(@eHp@*`2 *@2 *`*@2 2 *`*`   (`() ?? 㿘&``?  $~C} h   `$` $`$`b  %$`4(֐ CP  Đ &CA  >>``8hCD aܒ  ` $` $`?$`$` ((  "C D       &C ` ( * `   (    0((@   `3`  0+ +`    ((@B`F  &   㿘 ܠ( & >  &(`0`h:  a> 耈a" &  耠`   쀠`c>  㿘  B ( >(  $` `$` a0$`$`?,@ , ` `U,   .` .`Bm 㿘 (     $ $ $ oc$  B`(`( @(((&Ȑ㿘 ܒ" '$ 㿘 ܒ     $ '$  K((㿘 ܒ ˰  $ b  $ \(( G(((((㿘   ` `$`Âa@$` E c,\ ɐk㿘 ܒ    $ Âa@$ ?(((T `$ 2(`0`` 0`` `2 `@ < =(`@d2 `" >a מ@ 㿘( A . M( % $ ( $ a0$ $ ?(@( f @ `(`@&` ``Av(㿘  A / ( & $   $ a0$ $ ?(@( 0Ґ2 ` @(@`&` `l`A? 㿘( AI ) (   $ ( $ a0$ $ ?(@(`(`(  ``;(A(㿘 A  & `  $ a0$ $ @`  (`>@?. . .   h$ $ _  `0`.`?. . ` (``.  $ h$ F 2`` ?. . ` (``.  $ h$ - 2ː`` Đ?.`  . ` (``.  $ hl$  2 ``0`.` ``0``.` ` 0``.`?. . ` (``.  $ hH$   ``.`?. . ``(``.   ,``  $ o($ ʐ ! f?. . ``(``.   ,`a`  $ o $    F.@?.`(``?. 3$  . . ?.  h$ $  , `0`.@ `0``.` ``.` `.` `.`? ..  . ,``,`  $ o$ gb ?ߒ 㿘 T ? X ( O $` T`$` a0$`$`?,@ , ,` `, 927`T    `.@ 0`.` `.` 0`.` `.` 0``.` 0``.` `.` 0`.`&`  &` &`  0`.` Ѳ`? T @`(`>@@՞@0@@@ 㿘  )   $ oc$ $ $  R  C`.`... ミ㿘    Ѳ     ' / ™ 㿐@ @=  ?'#$ ג 20 @ * ``4&(`` ` ` ` ( `` J? ` ;(` ` ` #\ Ě ` >ޒ#$㿀 '>   `܂ #d#\#h#`  S 􀠠2  > .@ .` .`.`㿀 '`$(`0`b3   > , `#`#\#d#h  ! 2 ` `ܖ "   " >v (`(`@㿀 ' >r - ܢ#\#d#h  N#` ݚ `2  2+@  ژ"  ?" >2 `` ` ` #`#\#d#h   @( `@( `@( `@(` 㿀 ' > )`܂ #`#\#d#h  ~ 2` (` "  " =ג (` (` (```㿘 !Ɛ` d&(&8 &,&0` @Ȗ d`&4`ܠ`$(`0`b> V`X > P`h  6>I`p`&& 6r aW&<6p&&$e 6=#$ M    ` @ ``(  =p#$` 4 1? (6 ?6 c.  (` 3>@Ȇ`  㿘 D? ` @> 2`#@%)2`  ؀`"    8`(( @4$ 8 `0`@  >> >a  >> >a 㿘  (`, 5 l(>0@`8`0 $ 0 @  )2   텐 ذ!@a$  - ?&`@ $&`< `  ?2&  & 虁`0`8d&`<&`0 &`@`0`8 $ 0 @  ( -Ɛ3M㿘 ,؀`@ $(`0``́;ː `x`(4  @D `G`8`(`@``?(`0` @@ C@h `0$ (`0`b)&(`0`@2#    2    @2  @?``(22((((  @?``(,Ӓ ̒   % @?hh@% a0% `H0% `8% ,% >`% l(c% p؀a~%؁6 ֑ 㿘 D? `>  @#2`@$ 2`  `؀`@"` `$(`0`` `#N?`̙믐a 0& @ 8 0& <d& 0bh`ّ㿘? 6 > #4#а  1 ؀`@ 0' # `  e!` `$0`$  $(`0`a ;  $~0$!@! 'А 㿘``2  `"  ܒ ;!  ؐ! `@& ذ 㿘? 0`@> 4##x  p`؀`@ `ܨ`0'  c``?`?  $(`0``7 `@?4 $  Y  є! '` ! 2 ` $ `a4 $   $`А{ "˖  2` $`4 $`` 컔! $4 $'8㿘  >'"d 0' 㿘>&` a$ ,(0$ ( 4 ``&`L  $(`0`b>`>`@``؂`&`?#>a a@>ch &`X'ܓ`0㿐  >Qc㿐? 0`> @#"4    ؀`@"  $(0`V a @I % c@B a@; *<7`@ ``p@"0  7`@`+&  c `q@  0 a@ c @ c`@" 80 aa@2@ `   #@"@ T @"<*@"+ @" a@^ 0J@@W @>0*@7@I @"+ @"  *@ @26  @" * p@s@& k c@"40 c@"c e`e@"s``r# @ @a c@ @"8 c @ `q@ c@ xc@"A0 a@"  `h@2ڂ >`Ђc@`ӂ @c@"t 00c@2Ƃ `@2@  +! ѐ`В! ܔ! –  ! &`Ѕ(& `0% ``'^%w0 ?| w#\.l g?a`,]  9K 0ɘ 2  (`@`tߒ 09/     2``&(`0`d"?(c08`(@4(``2 !  #$(` 90`c8#$  2`2.`  ` @?c?c`@ @ #```&(`0`d?`` (`(0`0`() @  8`8@3`3` +  ``&(`0`d"?(c08`(@4(`0` tL`  8#$     @ 2<``&(`0`d"`  ((`00``+`) ?@8`8@ 4 4 ``&(`0`d"?(c08`(@4(`0``  `(  &#$8A0_^ VΔ Q              =  6    }-(`8```2&  @ 銔 x2 $  o` ֔\H|HHo$(@eHp@2 *`*@2 2 *`*`   (`() 㿘       0.+`* 7`  @ @  @ (@ /`@ @   (@ 6` / . @.`@  @?``(((22(( " 㿘 @?``(, , 7 ,  & 㿘 @?`,   & 㿘 6) 6) @?6`) )6.@..) 6@)  ) ) 6o)  &  ```_*  `*㿘!  &(`0`a  5 (  a& ab& &  !$!v㿘>4`` > #`  ?0` @4 @v#̃(``q` (@? f6  @ \@@U ,   (`0` D  @D (`@>0`-  c@ *@?Ea    ' @' t'  ' [ @ Fdג >4 b    㿘``?  6q"@   a    6Q㿘``?  @"@6W a  @ 2  (`@`< -w $a(t $a,6' @㿘` `? @ 6, >!    缘 0  (`@6 `6 '  祠   `   ```  -5ޒ` 㿘   e㿈``?  "@5Ѳ~ A ! hh 8?'/  /'''` Ӓ &` &` b &`&`z` ` B  >! &!  (`@ @!`&!5~ 㿈` `? $ 5~ 1 ! h (  h %/`  &` b &`&`&`2Ԑ 2 `B >! `!&!&!5A 㿘! `>>`@` l   ! `!$`Xp'''''ג 2P !`  2  !&!5  2!     #` #\#d#h  { 2! `"  (``! $`$0$!  $(`0`" <``2 <```K#\ #d#h#`  J 2 쀡 " `?`2 ``#    0 3`     ((@@2@+ +` @  **@ @  >`䀠`o `` (`@h'䀠b#\ #d#h#`     "! `?`2!    (`( ru A` @b : ! #\ #d#h#`  њ (  $ `?`   (`@    (`@'``r=r; >`   4 ``"P ` `2` 䀠`""&` ` "`80 " `8 @2- ```r@?c!&@  &`" &@ ?  &`@q``@ܔ  &`  ` &`&@&`㿘 D? ` @> 2`#̒@2` !`" !   8`(( @4$ 8! `0`@y㿘 $ 0(`0``, ``8% 2``2  7`8 `@  = <(`@dd a !  ?m X !ca&(a&0a&,aqs&4 &8 d&8 6a >`<```>` a `D a `L  >7Ԙ   Na && 6r aW&<6p&&&X 66 ?(2 ?2 c*   (` >c@*㿀! ' $(`0`hh - a  2 Z> ca ` #d #`#\#h  a F`2 `@  `v@ `0` ``u@2&/& @&  ?+```(a ` > c  5"  c  㘘" 2 㿘 2 $ !@! `DP ! `@`LK ! ``\F !  $  a : > Β`А $2[ 㿘? 0`> @#̧4 ,  !`@"!  $) 0`  a@"`  `p@ a `q@0a@`  er@"O8 `u@ Pp@s@`) `t@e@`9`Ђv@"   `q@bh@`.`Ђa@"` }`c@`8w`) h! q`В! !h c b !] &`Ѕ(9&R `0ǐ L``  e`g@4`Ђ`(`,  ?c> c* @0- @ '(`8``" " !2 $ n " t2 Y= >> >a# >> >a#㿘  (`, : l(>@`8`0 $ 0 @  ` : ᳐!!4`$!  ?&`@ $"&`<"  &`@ `  ?" &  & `@` &`@`0`8d&`<&`0`0`8 $ 0 @  $ (.s㿘 ,`@ $(`0``a `x`(4  @j `G`8`(`@``?(`0` @@ C@ `0$ (`0`b&(`0`@    2 @2 &   ?c @#  0  9 @?hh@% :b`% `H0% `8% ,% >c% l% p ` %`%U L㿘 D? `>  @#̓2`@)2`  a`@"a  `$(`0```"  `i?`ʐaL0& @ 8 0& <d& 0RX`㿘? 6 > #̓4`  ?!`@" 0 ` `(!` "! ܒ !  $(`0``"!  r!`! `$0`$!  $(`0`a H ! $~0$ !4!Lݐ 㿘`"!``2- &!`2'  !` ""   ` >8 >8a8" !  !C!  !  0!L`@&! 㿘? 0`@> 4#g  a`@a ` `0 $(`0``Q  " G``?`?  $(`0``>:`a `$(`0`h2  $@?  ด $`4 $(`0`` ʔ! *! " $``.``4 $a 2` $ 4 $   ``a `$(`0``" $ ! $4 $ې㿘? 0`@> 4`#Ѱ? B?!`@2<? ` (@@2 !  M 2,?! `$(`0`` Ѓ,`@ ``2?(``2 (`0`    @@B  ??   ??㿘 n >"" 0G 㿈> c&a $>$,b$((0&a4& C(``&@4&$(`0`b>`>`@`a`&a3?#aL>+4>a4 cha `$(`0`h2$ Ȕ$(`0``"a  ۔a  :  2$a)$(`0`` Ē ) aa @ @; #\`>2 a` > 2!$(`0``">>2!>2ސ#`&`L`ؠ'' `u  `   '`v`0㿐  >aa,  >> c2>>`" \>`Ԃ`" \>b4" h>a" `>b" d>c" l>b" p 8`  8@  8b  " <㿘 8>}  8! ` > 2n \@ 㿘`"!@ >2a"!@>ְ 2\"`㿘 8@da  8k 8 d ?02  8>>"Hbh2<!a>29" 8!,@ @ 8 @@  8 k 8  k 8 @@  ` (( , D D? c ` wh#@ @,2& < 8 `& t& <>bВ >bВ 㿘 8 0B" <> !>1˖ 8?}  8``>`"da  @k@  8d ?02  @>>"Hbh1"F>"2}, 2 8 8`@`  8@耈 a  8k  8`  ?02  8>>"Hbh1s"F>ѐ" @ @ P`Y& < `@@   `Հ`2+ P` @@`@@  `ͤ`@  `@@  *  (`@@2  P P@2 P `̀`@" P@,  >8 T@>bȟ@>8``2  X H " X L@ P X @  T@ 㿘 8@da  8j  8d ?02  8>>"Hbh0!>5"|` & X& T@?c@ @8& P' @, >8 t 8`  8 t  8 `>8`` T P` @@& L & H>"1 8 ` @ 8@  @2 8 T P@>a`" 8(@ 8 ` 8a~ @,b! 㿘``  @ P `"8,`2  80 @ &  >&`8ђb *>@+b>ƒc `8@  #>c  `8?@  %@  &`xiʐ" >8``> < " >֔?@b?&`D&`D`D@&`D>0'#`8 @<@&`@@ (>Ԁ` @2> >@,@$@2> ># 0>>"#(>">#0/#8>/#>>8``"K`8 >KcH  >DcP   >=b 2' ''@ "#>Ѣc8>b@@ސ  0D' '  @ 0> cP  `>@4#0 &`0"%|㿘`` " > #H `2  @ >a f&88@ 㿘`"!@ >/j"!@>ְ /e"`P `"8,`2  80 @ &  &`<8&`@ < " >֔?@b?&`8&`8`8`@@8&`82`>@#X/8:` &`48`` ''@s>Ѣc8>bp@@@  D' ' m@^ 㿘``i  f@ 㿘`0 &a< L(`(`@ P  @&a@ H  `@   4@ 4 L@` 0@& L `&0㿐  \a !a " (\r `(`0``( ``$`'-   \ݒ  2 [ `a  \L(`(`0``2(` $` &@ Q $`㿘  ` `B@`[㿘 0  $ `  g 1>.V#x D@ <$   D <& T@染*`$   D <& X@易*`$ $  8`@ ` @ (`<@$㿘`"!@ >.,"!@>ְ .'"` 4%>@\H ڔ & L >.#  @ & H 4H@`8 `?  4>8c@ $ >@甒   >-#  P@<  @`!  H& L `4 `   @! `4 L@ `  @ & L  H `8  P 0 @ &`0D&`<4&`P4`2&`@&`4 j < " >?@Wc?&`D>-#?`(>- >֔?@Ab?&`8&`8`8`D@&`8>`<b>֖bP8>2` (@-o:` &`48`` ''>-c#@>Ѡc8>ch@@r  VD' ' @ 㿘``  @ Ho&(@gHp@#(#$`) #h#dd`&#$! !@:!`  2 #$@ "#$ "#({"#$2 #$`?""# #"   #d  #d ##  ``"( "( " #d "`#d#㿐 ̃(`0`a" `@&  & "Ȁ` ̂b6  ̃(`0`b" "?c&@&D&H&L777`*7`;n 9c  `7` 0`  2 7`( 7` (@@`0`(`0`&@(`0`&D(`0`&H(`0`&L ̂}6 ́?Ȉ 㿘# ``  1>,M P ao l i  e <@a `??2<@` >@W `??2>@ PM . 0`>F `>㿐# `" $   'e  $  '0`  $   'e  $  '0> + P㿐# `" $   ' $  'ee `0``  $   ' $  'eR `0`> + P㿘# ` `   >1?+ P В ͒ ʒ  Ơ <@’ `??2<@` >@ `??>@# `pm  j *??@b`^   *??@zxv㿘"Ԃ`` ^     #   dͰ??  0 > @ h{ "Ԃ`` ~`?c @" !b >} * 0`> @   N$ d??  0 >  *  㿘 4a !"  `&`#&`  ```&`㿐"ܐ# 1>*  $   ' $  'd> ` &# ? `?&# $' 1>* 㿈>b, e > *   #`*   @> VE hY㿘#0# c#, `̔ # `(`  !" #� 㿘6 _#4" b "c"  `?  c" c `?㿘c$`$ d d(`0`d@`@lc,c$!hc-@+8!` ) 2!N a`Da!`    (`@ ah al$ !&!2 L ܔ c * ec, @ hb  `   dd6 d$c$b $c c$ 6 b$c$$c,㿘"""#` h# @ &# #`2 # @ {&### `(` @ @+` #` a2#  ##+` `(  ``# @` @`a2#&#$&#,&#(�""(`@$c""(`@$c""(`@$c ($c b  $b  $bP $@# $ # h$ Tb#$ $ $$  $X@$ , ,$ (>a_$a$ ?$ &#$ $  $b,$ 0b `$b c `$c  ̂`@{6 ̐#4  @㿘 a@#@80a @8  da5@+0 a6@2.& `6 d``E h .  d(`0``A`@` d 6 d-  ї"κ h 4 `d(`0``@"  㿘l㿘f @ ``>b>a>>!((!8>(! ې㿘2 `  `  > b`>a>>!(!>(~!㿘 > )(`!@!$"@$"D$"H$"L# h7#4 㿘 h 㿘"""`` `"##` `` ``ڐ` 㿘4`"1>ղ(!?>@̒a&c>ǐc4b   4@B0 &b #`@<<   &b@6H&b&b 0&b>?@a?&c&c>֔?@b?&c 8&c 8c`0@&c>ǂc  &`0&`4`@ub b>Đ>0l ?( #  ! #  ݠ #&b@ ! #  Ѡ #&b@ &  ǐ! &   &&b@  ! &  д &&b @ ` ( Ъ  (&bԀ`" bԐ  Р  &bbа` 6>łc`&a>Ƃc&a>ǂbP&a?`"6`̂ `h&b(&`h͔cΐ>'L"8 >b( `"&㿘```?Ho&(@gHp@ #"`b``@ (```"`"`"`c`  `  㿐"Ȁ`" ̂b6  ̃(`0`b""? d,  (``Q `q? ?, N?0777 )7 ;n <c  `3` 0`  2 3`( 3` (@@0 ? d,  (`` `0? 0,   ?ň  㿘"؂  , ` `?  $@@` `?㿈>` ǐe > &c   "`*   @> R h/㿘# c", ` ̔" `(`  !" "&# 㿘"""Р"`2 "" @ $""쀠`2 @" @v x$"" (` @ @)   !2"  c"")  @(  ` 4 " @  !2"" d$`"h$` $"$#$#$#$`$`$`$`$`0$`4"_) T$`$`$$` `$ X@$`,`,$`(` `,  \, ,, ",  , ,?, (`` _H ", ", ", ", ", ",, `@{4 ̃(`0`a@?, v  㿘f㿘@  > %"8! @>!@! @>!@  > %t"X!  @>!@ @> %f"x!  @>!@@  > %X"!  @>! @> "%I @> "%@ @ !! @a>!C >!@ > "%+  @ > %"#!  @>!@ @> %#!  @>!@@ > %#8!  @>!@ h!  @a>!C > hd  @> db  @> b a> $ܐ#X  @> a`> $А#p ! @`> C >!``@  @> `@`  @> ` `> $#  @> ` `> $#   @> ` `> $#   @> ` `> $#   @> ` > $}#   @> `> $o ` >$i @Р?㿘1 a@#@80a @5  da5@(0 a6@2+# `6 d``/ hM+  d(`0``A`@` d6 d0 ڔ#  h 4 `d(`0``@"  㿘  >$`!@!`  "6 #@  ̃(0`d&# hq6 ́ 㿘""`(0@` b`ǂc߀Ò?    㿘 @21>#9 X?>@`x &b  8@l0   &b@f<&b&b 0&b?>@ڒa&b 8`0&b>̂b &`0`@&`4b͐`ה >̂`P&a>˂b&a>̂`&a?`"c 6`̐<&`h>>Ȕ `㼔   # #0 `h&bƹ%b_>"ݐ"8 >=` `"&㿘`.``?㿘 @'@? 㿘! 0#@  >&bcP&b4`1> ` 1>" &#8  Ԙ# "D1> "<  Ș" 21>">`@  4#9# d\"#@?`88@ c &c>Ic &   @ }㿘> `?Ho&(@gHp@#@ ` `#@ @#@   #< b !,h } !,w2!,㿘 l &` &`㿘#@ @[``#@`a #@`b#@ @ #L``#@?c  Ȃ L L[x@㿘> !! 㿘#< $c?[d? c` 1>!͑! 㿘#< $b?[O? b` 1>!!8㿈#<!,c '}6!,'''(0`a@)6!,#(` 6!,?c''''#  P 2 (2   (@@  $cL$cH$cD$c@$c 㿈>c  Ɛe >!!b  !X#X.`  R  !X@>!XM -㿘#X.`.` @@@(`@(`@@ `N#㿐#l'%!#P , `&&#l@!X@>!X2#P, '@Ӕ   "ޠ #P 㿘#T`2 #\#P @W &#T#\`2 #Pp#X!@ @L &#\#P&#h&#d&#` @#\) )  @) @ (`@(`@ @    2#\&#l !#\) ) @ #@  2#\㿘m s lr D㿘 !,6!*{ l6!,#0  #0Z.#0 @````  1> !P㿘#@#<#0#8Ր?c$`#L``"$`##(c$"P##(`@$# ##(`@$###(`@$#%$## $"0$", $"$"#T% #Th$#D`@`  ` $ >  A!h$a$ $, `$ %Y` > ,!$# sY "  ld$" #L`@?}b$" `$" # `$#   !,`@{6!,㿘 d(`0``s 㿘 a@(@80a @<  da5@/0 a6@22* `6 d(`0``@2K``22  -  d(`0`` `@`2`d6  `"    n lő Ȱ 4 `d(`0``@"  ]㿘M P㿘@ !X?c@@>!X  ?!h?߆c@ >!h?b  >>s!Ӑ 㿘 >  `!h@!p bH bL bD b@#`#h, h #P@`&&#`!,!`#h{ 6!, @?>!`` &#h &#`z #h`"6!* 㿘#0a?b 5 ֒@@㿘4`1>ղ!`1>"h8  @Ԑ0�D  @ΐ<P  @ȐH\  @T&#<h  @`&#@>& hb@3? &#H &#H#H` !&#L>֔?@b?&#D <&#D <#D@\&#D>& 4`& 0 0 @ #>`@ޖ  ½#H>;">҂ad& >҂cT& >͂cd l& < >& >Ɠ㬐???T  `   " E  "V! ܐ >Ђb&">Ђ`<&" >Ђb|&"(?`"6!, &! &"t& 98" 2> ``S "&>Lb " &>Eb 2&3>ϰ a8㿘``4 ">-" " > %"Ȁ #@ 㿘#L`%#@.`(@ @3@$ 0W/ @  >>  "؁ ?cS  $ #@  `#@ @#@ @#@  `#@ @#@ @#@ `#@ @#@ @#@ `#@ @#@ @#@ `#@ @#@ @#@>@` #@ @#@  #@ >` #@ @#@  2#@$ 2/* +(%㿘#L`!#@(`.`5@?c $ 0V @ Ȁ 1>S 1>"  $ #@  `#@ @#@ @#@  `#@ @#@ @#@ `#@ @#@ @#@ `#@ @#@ @#@ `#@ @#@ @#@>@` #@ @#@  #@ >` #@ @#@  #@ >` #@ @#@  2#@$ %x*` @%x*`*@%x @%x*@㿘%| d@㿘%| \@㿘%| h@㿘%| l@㿘%| p@%|`8} %|`<㿘4`"1>ղ:!>&ev#&e`  >@(c &e(e>Ҕ?@"c&e$&e([b&e$e$`6e$`$`0&e$e$@Ԩb@&e$`2S >#0 2L ` |1>#@@  `1>#h Ԑ &e|80 @k $ 81>#'<@$ 0$ @>8`` < " >֔?@Вb?$ D$ D D$ DYD< @C &ex1> ڰ#&`"8&ex0 @3 &ex !>`#PV` 2`&e|& 0@|#P &e|" 0>ߐ#>#`2 > >;#>  aH> a &`e(``.`̂ .`͂ .` @ `@@ _ "`8&e, .` @ `.`` @ ` .` @ `@@  ```@.`.` @ ` &e,@  P2e$ &e,e$#@Βe,`&e4```" &e4e` 2e @ @@&e8@ӵ$&e4@&e8e>3cH&eD&e@e@ @`8 &>c0 "  2e,`  <@ @  2 e, `2e, @b e,` e0`&e0d @W 㿘` (>z#0 #>t#耢 `m` `>b` > a RH&88@   ___`$``㿘>bd>b`   (``   А (@ (`8``(  D"H H $ 㿘 8`5`3> a  @`` > c  @`a     @   @    @    @ 㿘!`  |d T!4&'&! `!      ! `&!!"! #``#dd@"d@@`?! #d0``E Ed0``# P #dd@ #( >5a(` `8>>    Ȕ0 D'' @;7`3`/&&@&&>5a(`& `  >x耢 ''@ǐ쀠`"@&耠`@&   >aH T>b T㿈 `& | & | 8 < 0 4& T& d& \& `'>8`!>#>@n`˒ "#>@g`Ē P``> b P`J "`Q`P "`$B PA |"? |]耢   ''' ' R 4 @4'耤  R 0 @''쀠`2 l |``& | l`` 2 | 0c  |`P |`@& |@ . T |`@2 8 dR X T`& X RRz: & & X&  8`?& &  & ؁㿘>!p` !   &!&! &!&!㿀2`$`> d> b```2 `>ՂbH&`>Ղb&` >Ղb&``` !p>ւa0&`>ւa &`!p&! &!!&!!'''''>ڒ0 㿐>8``" & D D@ʒ H " H& D& H H`" |@& x |``& H& D  6 & t D`" @& t& t  t@& & t  x@&!(& x!(`2  | H`> D`>Ղa$&!( |d T!4! `!      @` t x@!p㿐``>8`2 <n``i`& 0& 4\& 8`2Z 8 L`> "b P@'0``E=&@0``E0````1&@0```8; 8(`>Մ@`"2 8`(`8``"&@ ``"$`2$ 8$`&%`2 8%$& 0#$&@& 0 %%& 4 & 0"& 0!%& 0$& 4 8QJ 0: 0`@8`6& <>@`& 8>@`& 0>@` 8 0& 4Q.@@0Q&80`@8`>@a 0 8Q& <: 0`@8`&& < <Q  4& @Ho%(@fHp@` @  ` `  㿘`> ap @`@㿘> ap? 6  6 . ` (`@`<` `    l> (`@`@㿘> ap? 6  6 . ` (`@`<` `    l> (`@` @㿘 0 4@ @ 㿘> ap ?6  6 `. (`@`<`?` `" 04`@?㿘R t`a`& tT ``$`(" :  㿐 p`(` > ` `*2@  l(`@`?'@ `4@ `   *`@`<` ` `(` p`?l>`2 `" \" \ `   㿐>bl`>b` /`<`">` ` >˂bp` ` @  㿘>b>ˀ b0`(`">4@>b`@> a ` `>ˁ b> a> ` `>ˁ b㿘>b> 7`> a<`  @04`  㿘` 㿘 x |& x(`< `` "   >Ɂ`  p   `@㿘M >a!y `p`( "0#` %.`@`<  2 p  `!$ > X`<  $ # 㿘`>ʐ!  㿘> !0”>@!@.`@`<1>@` `!H㿘 x`> !h |` *`>{!@`<``> ! "& p 2 $ |>! x$ p $ x?$ @ & lC㿘 x`> p" | ` `& x& p*`>:"0@`<``> S"X x"@ x& x 0 t` 4>b` >ږat #"㿘 ` & .`@`<`  g >b !㒖   "   p`" l@2 xV`O `$ |$ xH p`2 l?$ x 㿘 ) ?  q& ,㿘#>   apap@  , 㿘 p`0 l?,, @`<` ` `% <` @"`` `` `` <p  "` & 㿘#>   apap@  , 㿘> ap? 6  6 `. >M"(`@`<` `㿘>  pp`kp(`f t^ H`2 s `T s(`@`<O`H& t& t  H;3  P` ` `@ ;c;   P`  ` `@ ;LQ t H& t`& t>8`܀ 80`@8` .D> ap ? 0`@`0`(`(@`<` ``*@ >  ap? 0`@`0`(` (@`<`"  `` 7@㿘@` `  p`"@ l&@@`  (`@`<    `|``` w  㿘    0`@  V  cPL  e  cP"K 00  L!VZcK2 0` cUN0 c]P0c^2 00p`")&@`"  #&@@`6 ` $` @`8 0@` ` @$` `$@  0 4@@ `` &`8 0@` 4@ L@` `$@ Y@ݕ  8@@6 &` 8(``@۔  8@`(@`&` 8`@`&` 8`@`&`  8`@` &`$ @ @ "ϰ @@  ` 4@@  ` ` `  >܁aؚ 㿘> ap ?6   6 `. =(`@`< 7  `"  `"   v >  l`(@1 & `$@ >bh`"  ` `$@   & 㿘 !>>$"p"ؠ"p$ @ $ $  @>l`$ > > 7a   l㿘`   l> (`@`@ > 6b`> 0 a> b@0  &<@ 2< .`֕㿘 p` `"@` 0` `$@ 㿘` @(``"` `@`@    ,  㿐  " 0Y ` ` @ W  S 㿘` 6 .`@< 0 >˂bp"*  `"$ h`p@"$`p$< `">``0`4` @ `>"㿘 t` ``  <`  ``    @ ߞ@㿐   + 9`>˂bp` #\     #$    "&`&@`"@ s &` `\#\  @ &`&`$)v $ $      㿀 ` A.`@`<`;  8   5 0 4`@蠒 2+#\#`   0 4` @ 5$`< p`  0` 4  @ & p& l/㿘 c`@@0  T@"8  a cV@2/ 4@db@cU@) 0 cS@ cM@2   0cN@C0Acc@ S ~  Ԕ Áۓa ``  $I (I > ?  8G2  $ 804`@ א   0``"Ͱ  4@ 2 `2@A$    0` @ 㿘>  ap?0`@`0`( c@@6 Q(`(`@ ` , (`@`< &   >  l(`@`@ 3  g?" 㿐?& t& `\% #\#`    v M& <>˂bp` `>> bې" @ؐ  >Ґ" <& & p& l >ʐ#& 0& 4& 8> a     `$`> `` `  @& ἲ@@㿐` ` ` #\`"> 7`> a> 6b`> 0 a>b@ 0&`?c((> (a `㿘> ap`?0` @1 @[ap(`V `T ` P(`@`<`"L ` B> tb$ p$ >ق`,$ ԃ0``,ǐ c$  $ c$ %$  a$ &$   t !  t l`($ t> `@@ " ` @``4 @``4 `  `$`  Ho%(@fHp@㿘`A  @2 2 㿘`` (Ӵ>c ԰ #7$` ː`@! `@!  @` @` @Ǡ @` (`(`".."@@``$@ɀ `À@` .."@$@㿘   & 㿘 ` &  &  & 4H  \pHo%(@fHp@`  `" " $` @  ` `  `"* ȁ > aa`  @`" `\` * ?>4b` `\㿘>4b`>4b`">4``>4b b `㿘>4b` >4b b `㿘  @ 2 2 2   l dh`@  `l`  @  @ (@ "  Ϟ@㿘 \`  `" d& 晐  d h@@" X" >a̒ x \'0<cY '䀦2  '܀6 \"' \0"cZ㿘. <0`!!! 2@ `@   `@  `@ @`2]  ``2 \@2R  \ P.=0`%8(#!$!   ` 8:  ?À'+81  =. 2`ْ@  0'@? `?@? `?.*0+@?`? a  㿈'H` `"  ``" &`א` ?Âb & `& `.`.(`0`=a     @   *HF2 n(`0``8P`(`>@H \ H W H R H M H H H C H > @H 9 H 4!H / H *"`4H (`\ "%` 6 h ``%H``H```2 `2``2 ` ` H``"&`&`4`&`H`2 `2   a 0  `(`0``o(<0`8  b?c @`?` @* @2  @ *@(`0``o(1 .<0`8 > 2.?c "+.` `2 . 2    $   ` .  $ 6 &  =0a"j  `(`2  @2 *@``((`00`@2&   & @(`@G0`@4   ̖$(`0``o(76 . <0`8.>@"+6  0(`0``:( 2  (`0``8" " 6  ` 6 6  6   㿐>4b`:>4b`)>4``2%> #>4" '<-8+>$b(@`$b(`}(`0``o0@@"  @@&$b$ 㿘 p`%` \`! `  \@ & \M& \ & \` >`# > #8 ԰0 㿘`> ɐ#X > a? 2 * `X О@ 㿘 @@  c@ c@c@ @"   `@`   c@"8# @"`8c@";`dc@2`d``@"e`t@*>  @2`d"> @"& @a @v c@2`dy@L0c @@2`d&`t[a7a`h``t`"`x`&`|`& `&  &`d`h` c`"``"```"` ` "` ! `` `&&& !   >  ޒa``"``"``"` "@ ``&& & i >  a@۰    (`(`@@~ `@``x``  $` @a / `@8&`..@``$c&?ca `` $@a`߀   `@` ``P0`h`@ 㿘 b}@@8b~b|@0 X@2 `v@' X X * @ && `# `!T `" `,  "  T@ @ ?"   㿘 Ę`& Ĕ ĸ`& ֫> a ? 2 * >c㿘> a ?6 .  Ȕ`  Đ 4`#$  Ă`$ ց 㿘> a ?6 . X    X@ b 㿘 > !`? 6 @#!(`   Ȁ` ``  X`  4J& H* " & X5 㿘 X`/` `` ?? @( 3>  Ach(" "  `$```"`$` `` `aTj 㿘 `& r  ` ` ! \  `$[ ` $ `  `  $ $  $ ᩁ㿘  `"   \ "   `$/   `ቐ 㿘 `" p&   p`" X>4 b X ":  `"6  Ģ`+&  `$  `8$ f  `" $  `>8  aTܔ >8`ܐ* *> @ R  >Ԑ#  K > 6b`> 0 a>`䀠@0 &   uk 㿘>4 b b ` ` M `$>4 b㿘 >4vsb@!>4p" >$" #L" >$ `X>. >4 b㿘&`p> b&`0`>4b  &``  @ (&``` vI `>OcH``` ```&`d  &`h&`&`?&`l $` @` "``>=#+ > `tua`>  ua`">>4> bJ#`\``>A">>#`5> p```` p5@ p@~(\@((`00` `((`00` -(`0`` @(`=(`0``o) * <0`8 > @  ) >c@`) 0`㿘` .`>@566666* ő2 6666 6666 6 6 * 2 66 6 6 6㿘566666 <c8j@" ` ``4@(Y(`0``o(S(0`@ 2Mo@2I=(`0``o) 0` @?c=@"6) <0` 2` 6 ` ` (`<@8(`0``o( `(0`@ @ ``*`>@*2 V*`2㿘`   @ &  g &@@ 0@@@0`@@0`@@0`@@ 0`5pc߄ @Ѐ@  4   >ΐ!(  @ `2Ѕ. @ <8 (`(`0``o( (0` @ 2@4 *?`6 #<?%8ca aa`'=U` (`0``oD*0` @2@@ /}(`0``o +`0`@@" +`0`@@@2 `) )  0@`` (` @(`0``o( `(0`@@``@ `$ @*>2@!@) ) @x@ `` (`@*?? 6 㿘> b`2:>  b - -  @@/`0`/ 0` s ?, (`0`@%@@(`0`%` (`(` 0`50`  Ҧ >  b> (` 0`  0@8` (`(` (`0`@ @   (`(0`0@  (`0`@ `0`@ 0@8`ڃ0=a  > a(㿘  > @(``>  a(> a(t    @  #"""@ !2 `"y? ` ``2**?`@`2*$_?c @c@c@2* "  怢 2*  " ** c @@"c@2*!0@*@2*>!'bH*!0 !^!!2v* !_!12n*  i g f*c b*_ ހ!\>aȂ(c @@a@2P*""L  "ۀ" "2F*   "2@*= ; :*7 5>ah|`2/.*$)$"( '*?c @c@c@2*" 2*  " *  * +@8H<l$t|¬lD„`" "`$" `" `" (" $" ," 0" "  0" p" P" L " 8" `" 4 " X" \" d" h" l" H㿘7>˒␔ښ $` ␐` T    ␐` T   @ >˂b `T1>˰"& ʐ㿘 `` `@  6   ` ` ?     ` ` ?     `" ? " `2 ` ?  `@㿐@`38 (`>@  r   n  D` (`88@`<2 $  $ ,#    `  (# @ P`  ( D`  ((`88@`<`@ @8 & , D`  ((`88@`<2   @8?& ( D`  ,(`88@`<2 $  $ @8= D`  ,(`88@`<`@ @8)  D` (`88@`<`2   @8 D & ((88@`@`2 $  $@8& , ( @   ` P`@ , $ P`  (x"  D` (`88@`<2    (" @  `" @ P` ) D` (`88@`<2    (" @@   `"@  P`  "@@ 0 D` (`88@`<2 $  $ ,# @   `  (@#  $ P`  ("@ 0] D X \ `- "(  "#   2  * %(؀`8      0& X& P& L& \ .& `   2<4 & `& L& P& X& \ D`  (`88@`< & Hܐ 㿘```ρ  P` @ & (& , @  @  ,@  (@ 㿘`2   ` P @ & (@   `"@  `  P"@@ (` @& ( 㿐@` @`  ( , T L@ , $`& ,@   ( @` & ( H "& , ,& ,& ,  ("@ ,">˂b >b$ (`0``o" *<0`8 >   t" 8>`ؖ ?c @  (`) t t "(`0`` >b(0? (`0``  >b(0? co(`0`` >b(0? a "v(`0``  (> 0`@? @`2m"(<0`➀`>(㄂♀d>⛂▀`>8╀U>☀C>Vc"H> D>✀<>❀4>=cP=>㇂぀+>も⟀#>9 &>ダ>#cp)> ㈂ㅀ>ㆀ >c >㉀>  cPcXc`chcp" cxccc" c"㿘@`0*$ D`9( D`;2 D D` < @n  & @& D D@(<Љ(` (`@ < `& D `& D & DȐ "& 4& D@`[2" 4 " D" <" @" 4 㿘@`8U (`>@   ,`FD& ,B& , , $  @   @@8`5`  ( T P@ ,@'& , `  P@ & ,& ( (`& ( >g#  & 4 ( @`& ( H, 㿘>ˀ b x     \& Ő㿘'L'H l d `"` H`'HL'L& &    @ ( , @ I `HL& &  V 2-`8W " 4 ` `2 & 409    "в` &    @ ( ,@  "&  & & Hp@      2>` 2`` `2`(* @@ #     ((  @#㿘 `$7ג <8`8   X7ʒ7Ɛ,<7?77?7  ?         2  ! 2 @   ֆ 㿘 (`"   П@  (& ( & `& $@`   П@  (`& ("" h (` " h ?< l  ((@(@@" d 2``"2`` " `#㿘 @>.h (`"    \ 88`)   <`$887` X7   H ` ` ` ` ` ` `` 2 @ 2 @@ , ,` 㿘 T $6 6 X  $   @`4$@` @8`88 2??2     8,`80?8  2  8(   80* ??Հ` 㿘 T66 X6|  ?  $/  < h`>` 2  >02  (2    &9 `9 (`-)  , " 3   #`#`#` #`#`#`#`` 2#@ ?` 2#@ * ` 23@Ӏ 㿐    o  `!  @! @@ &   $``5`D` * !  @ D @ ``<  䀠`  @ 㿘   D5* & &  ` ?" ` ? `" >ch  㿘 5`D *  @ @ ` `  !@㿘 5j`D  *   @  `&  `   ! @㿘 `D5I5E  *   @  `&  `  !@㿘 !@>` `$`$ ` @  " "   㿈 (b ```'''>@ ` ` <i &`&`4&`8 㿐@(``  `$` @N     @E    @ &  @ & & `$4`(& P 㿘 ` @ $`$@``  @Q  ?&`  (b  ` 8`ٞ@@ 㿘 D 4* 4* 4|@* @i `"' (h",@ @@``    㿘  `D4D*`*  / i `" `(ha@ a`  2  㿘 T4  X4 `$ 4@4@i{ @ 㿘 & >`& &  8 # 㿘@`    ؔ &    㿘  7  @  D @*`   $   1 &@&&!   @$  ؄?$ `?$ $      @ ` D3 @. ܀`$ ` & $  ؄ `& ؁㿘  `@   ?  @& ? "@@&& ?&  >c` 㿘H` ` `(> "  (b`  \& $ $  3A & 4 $3< @& 8& 4  8@4& 8 43.  `? & 4 @Ӑ& D 8@ $& @3 >: & L& <& $$@& & H 32 & T $3 & X $3 ( (` & P 2 h  (& (  (`@!& \ 2 8  <  @: 8`$<  ?@2&  $& @ & d@Ő@ܑ* & `& d& ` (` '> \  "h  8 <2`&@h  8 @ 2 2 \ h">c`& >a& >a& >cD& >`& >ch& >`& & >à&  (`">>a&  a& Ă & ``2  (0@  (@'  (}& (P?b& (I 㿈 `*@  c    @ǖ     @ 4>    @#  4& > ?Ґ B       (&!&!&! &!&!&!& ܀'& ؐQ耢 (& >c& >c& >cH& >`@& >c& >c<& >`,& >`& >`& Ȕ >ܒa ? >" ` ` >b" >`" >c" Ё㿘 ` 1֒ X1Ґ  <  ?`$  l h" h l@ 2`?    P&1`8`( ]>,>a((@8   28 ,   (`((@ @ @80@@@#2    (`((@ @ @0@@@"2 1\   @(`"@ w @` ,(@>`@88    @ @ ??2F  @9   (`(( @ 8(0 @@ ""2    (`(( @  (0 @@@""2 0  -@( @ @-@ @  㿘 ` ? 0Ғ0ΐ X0ʐ  >/  h` `$(>@((`@8 @"??2 (>`@(> ` @<  @$8`//    @ "`4 ` @@ ??耡  㿘  $ 0q  X0l $ <` `` >(>a((@ @"??2 `@(@(>` @88  @" @!?? h ` 0+0'0# X0 T`$ >>>`> ` >a( * @ (`*3/  8@   (@   * + @@"@ * "  @ : @ @"@ ̀` *>`@>.`` @`' @ $ 8`<  8 @9   @>``-  @( .`(`'@'؃(`'''/``  +` 8@ @` $ ؂ @   (@@؀` >( ( @@ # @@##?  @   ` ? 8@ $ #@  (@#@ ``9  8@@`  ` @ (@` @> ( *+,   * #@` ` @` :>  @#@y` >>>ं@'*@(`'@/`''(- ' @  8@   @ (@耡 >( + +@ @" + @"> ` @ ;>   @@"   @   ? 8@` $ #@  (@#@` @`* 8@`  ` @  (@@` .`>(( @@ !>  @ ! @!p` >`@" 㿐 T.F X.B? `(`@ `h? `(`@`h $ //  `2(@2 (  P.&8(   (((` @@@) (1  2    (`$ 2, H/` /Hp@㿘>c  2 >4bH`> > ! cc   ` !! #bH ` ?㿘>c(`0`@" 2 ?(`>&!(0 (`0`㿘>c)` `$@2"` ` @2  `(@2  c 2  (`0` ؀z?㿘m  $ (Ð  i?  > 2 2 2 ``    <$ b@ <4  " 2 $>˂c`$ ` B `㿘5>c(`0`@2?`, "  `0" ?`0 &@(`0`2 (@ 2*"(`) "@  "`(`"`(`"`(`"`<"@ "`<\*@ *@ (`(`>a㿘@'`! @ ! `*@   ` *@   `* @  `@ (@@  㿘@)`! @  `)@    ` )@    `)ߒ@  `@ (@@  >a`8`  @ ` @8` 4>8 @ >8`!`!!(@ @ `@?!*`b* @ 㿘 !@ 4   !Ģ"# ` @  ` ܒ @   (a(c(b>` 㿘@ `! @ `)b !` )[@ `b)T@ 㿘@ `! @ `)I ` !)B `"); 㿘cA@!@ D@A_@$@@2<? $B@C@# cE@.?*& 4 "@ 0"` 8"` 8``?(`"`  < "@ 8`2 ! 8` !Ĵ 2  K! 㿘>Ґ@ich>!!H>a(0`? `q!>@i͒aX: >>!@iŒap @AB&$>@ia @6 &!>@ia$& 8>@ia#& 0>@ia 8 0& 4+,@.?+$: 2 : +& <& @>ɐ!$Ē& X& p> a,`?3> -خbX㿘>aa`?cA@!@ D@_@@@ "cE@  `@`?  4 "0"8" " < ">a`8`  @ ` @8` 4>8 @ >8`!`!!(@ `@?>8``  !` L``@ˆ@`¨@ˆ@¨@H`  `` ((Hp@ 㿘>"`>8```>8   @C0ֱ&`P?"&`P`L`&`L>8```0 L`  `0 @- &! &!@` ``6* ` >8 ``  L` &!> a>@hch >8 (``" >8>!>8>8``>> b L`=(`(`8`@7`?a(`?`0 ^!@ &! G@# '$ 0 4>"! @>a` @ @~–*& X& pĐ"3> -ת?3> -pbѴ 㿘`_` ! `  ' ? `">8` ``     (  >a` 9   @` @(( @@(@8` 4>8 @ >8`!`!(@ `@?㼘>` @a!!` @_I*///?((((` @_5* (((`a !O 㿘cA@@  @@D@  E@L@"? " & 4& 0 &&&   㿘`L0` &`L @} >8&`P``  > b` `(`8`` `?0  ?@}&! ]! i !   s      $# @& p!>!  @  *@} @&! @  *@} & XR 4 0>n"կ`֕?3> -Zc㿘`^` >8``` & ?   E`? >a`8`  @ ` @8` 4>8 @ >8`!`!(@ `@?㿐! ! #\㿘cA@"! 4 D@_@ @@20? !B@C@ cE@"# !?&  & 0& 8!&&  < &!!j !, 㿘>ʐ"(`L0` &`L @| >8&`P``  > b` `(`8`` `?0 ]! u !   ?   $*# @>a` @ *@|ʐ 4 0& X& p> `ǒ>˒cĀ`թ?3> -ncT㿘`]` >8``` % ?    @`? 㿘>a`8`@ `% @@? ?' : >8 `!`!(@`@?%%@ ``@(@(% "%"%%@8@"% @ "%%(%̓*`@a h `%ؒ` @2@*`@(a(a(a(a>`, 㿘%  (``   (%`(%%  `%````" ` 㿘@)`! @$, `$g@   ` $`@   `$Y@  `,@ (`@   㿘@(`! @  `$?@    ` $7@    `$/@  `@ (`@   㿘 8@$`2 X%܀`% @ A(>ҝ`p& 8 @\ %܀`% p q(%Ȅ!(h%؄ @& 8&%㿘 8`В > 7> 7`` 㿘`%耠` 㿘cA@"0 4 D@"n \@@h? @._@`?/%cL@"I8 cE@2T?R B@'C@K?)%F& & 0&%@?` &%`?(`7& %`0 @0&` <* *&(&%`% !6` ! 2` %`   J ? 㿘>읐"88?c1>3@ "H`4a41> "x슁`"`1>섑">Ґ@dHch (``>̒>w!>a( `?&%`8 @z`0"0&%&% &%&%&%&%&%<&% `<2&% `D :`>L" Z!@ $Ԗ# @`D(``?&%&%  @zr 0 4& X>/ `>`%  &%@y&%& 8 %̄ (   %T& p>X`p%耠`"%5?%3> -c㿘`[b` ` @>84@ >8````? !?? h!Ā` @ ` ` !`@c@ ! @ >a`8`  @ ` @8` 4>8 @ >8`!`!( @ `@?H`!`hd{{! hHp@!@?@@ 㿘 Za` @ @4  @4  E `$$$$&&&&&& (& &*`3`& `& d@& 4 `@& d@@& `& d& ` 4@& d@@&@@@ 㿘 ja`g @@c D @4  @4  O ` $@$<$8`$$4' ' ' ' ' '  ('  ' *`3`'! `'  d'  `@@'   d`$@'  `'  d'  `@@'   d`$@'  @@ @ 㿐 `Ua @@Q D @4 F  #ܒ $#ؐ Ƞ@ $$$$$$ $ $*`?c$(`@`h$ d$ `$  d`$@$# `?($@@@ 㿐 `a  @@4 L Ȕ@ $`$`$`$`$`$` $` $`*`?c$a(`@`h$a @2   (`"  $i$i $i #_`$ d$i `$i  d`$#S?$i 4 `@($i`@@`@ 㿘   $ #7a #3 $$$$$$$ ($ $*`aU$ d@$ `$  d`$@@$  `` @$@@@ 㿘! 0`0 ?c߂` !!Ȕ !  㿐! !Ȕ #\㿘cA@"@ D@_@!@@20? B@C@ cE@"# !?&  4 & 0& 8!&&  < &!!Ȁ ?!c 㿘>M"80 Wa  @w &a  @wz &a *@wt &a@wn &a@wh &a``2  `L `&`L>a>Ґ@`ޒch (``>8> !>8``> L> ` @? (`8`@a(@`?! @>aX &$Ȑ$@v&$̐<   ?  $k# @>a` @  *@w 0 4 0& X& p>Ɛ"ؐ> a `>bT&!>c&!>c&!>a&! >`p$&!$`Ւ?3> -Ϛc㿘``X " >Wb耢 " ``  >8`` [>a0?@@v  ʴ?"   ``?>a`8`  @ ` @8` 4>8 @ >8`!`!( @ `@?H``! ``(!(Hp@㿘!(``(``!`(! ! p  㿐!!#\ 㿘cA@"@ D@_@!@@2.? B@C@ cE@"! ?&  4 & 0& 8!&&  < &!^! !(㿘``W$ " > W# ``?㿘>禐"8!>W# #  >Ҡ @_^ch  > (``>̒>犐!>a(0@ `?@u .&! ` +0> . ` !  (( > .`  ``p@2( (`   `` +`02 0 U!>c &$$ @t&$  !   s     $–# @>a` @  *@ub 4 0& X& p>"_>cc`"3> .A?3> .`P>a`8`  @% `" @(`8` 4!Ȁ @ !>8`@?` !!(@ @`@?! ` !2` ` a㿘 8@`!?!Ȁ@?yn \! `X!  p!? `T! X!!?@? U !!@?yn \! `X!  p! `T! X!  c?c! c"c& 8!@?yn \! `X!  p!? `T! X!!#?@?! U!!@?yn \! `X!  p! `T! X!!@? U!!@?{j \! % X! `p!?c T! X!!Ā?@? Usa  !) )  c !2!& 8㿘 8`U > 7> 7`` 㿘`!̀` 㿘cA@-@ D@9\@@ &1&@"_@  <cL@" 8cE@  `@`? 4& 0 &&&  @ &(`& `    㿘>Ґ@]ch>"8>@]c (``>崐#3>屐c>a(0`?&!̔ T!! ! @sݐ"&! !@sא#&! $@sѐ&!$#  4 0 < & 82 : & <%`?&!Ȅ` ?& @!>?! @?  8 *@s!&! @?  ?  @s* &!& 8!!& X& pː!̀`" 0u? 0 4 >?# >@]c0 (``>3#@1c!3> .&`㿘`T``?>a`8`  @ ` @8` 4>8 @ >8`!`!(@ `@?H``!`0Hp@㿘!n! `.`0!0!b0@! d0@!`0㼘@``N!! @ `n ` h `b "ᴁ0ᴐ `,` 002  @02  @02`0 㼘@` M!! @@*!G ! `,  0(  @(  @(!`0` `  2 `ߐ cA@!@8 D@_@ @@ "B@C@ cE@?  4" 0 "8!""  < "> bp > a 㿘>8``  > b` `(`8```?`0! R&  &! $ @r &! ( @q&&!  @@q!?&!0  @  $<# @>a` @ *@qܐ 4 0& X& p>㘐#hْ> ݒ`"3> .ʻ?3> .ʁa 㿘`R` >8```V>a?@ @q0 8@  ` @`@* 2 `*@"@>a`8`  @ ` @8` 4>8 @  >8`!`!(@ `@?$ ($`cƂc߄ (@$!(c˃*`@ *@ $ (cʆ2 *`@ @`(@(a(a> c $a c`? c`@ (?2丁㿘`$@Vސ Q  L 8` ` `6  `B&$>0&$&$ 0d"$ ebc 0 $f@d( $$ @  @$$@&$>b&!>`d&!>cp$&! >ad&!>`&!$(3$?(D㿘@&`! @@!( @`6   ` /   ` '      㿘@(`! @#( @`@    ` @    ` @  `@   㿘cA@"! 4 D@_@ @@2.? 'B@C@ cE@"! ?&  & 0& 8!&&  < &!!p Ӑ㿘>cQV  >QPc`?㿘  d` `$`  d $ ` ېd 3(Ed `@d, $Pd `T d` `$ (`@ X㿐  Ȓ伐@ (`@`h '`丂?(E丐 ` `@ @2  (`"   `T  七(`@ X`$Β d `丐*  T 4丐’* $`Xi 㿘    `$$` d@@ T$?(E$ `@$* $ P$@ `T $`$(`@ X-㿐  Ȕ d@ (`@`h' j $f` ` d d?(Ed `d `@d,  `T d`$H,  $X㿘 `$ :6 d伶0`? ݐ丂?(E七. @ `丂@ P `七, @ T 4七- @ X 㿘>Ґ@Xch>ഐ"8>̠a(  1>2#>a  @nߐ` &$l@nٖ$&$!.`$02&$  ] $#> @X?c  @ @  1>#v `?! Nʐ @>a`@  *@n  4 0& X& p>^ `Ɵ #O!> şc.0``$>  HZ"3> .o?3> .5at>a`8`  @ ` @8` 4>8 @  >8`!`!(@ `@?$ (@ *`$ἒ`($($(`*`@ @ @*`@ @(a(a(a>cԔ H`!`"$8` ! a8Hp@㿘! ``  !! !   0c@@?2ᴁ㿘 :>b8&!>c&!>`!&! >a&!>c&!$&$ ! b! b! ! b  4 0!o(`@ $!&$ ! a! a 4 0!o(`@ ᘁ㿘  Œ? ` $ d a / $d3` a@$d /(`@ !a`$@o /, X a$d o(`@ !a`$@oؤ , a`c$d㿘 `$s?o d iN$3`  /@@$ ` /o(`#@ 4 `@o(`X! o$ `o(`!  4 `@o(`ب /! `$㿐   @  ' ` $ da$d?c a a /$d /(`@  a`$ / /, %@a `$d㿐   @Ɛ %?c  #% @2  (`" #   o(`@ %`$ d ` o(@  4 ` /@,  o@% `%㿘  `$ d`  $  `qa$da  ha ba $d /(`@! a`$`  /, !a `L$d㿘cA@5@ D@J_@4@@E? (cL@"8 cE@29?7 B@#C@#?+&`)  ``"%!   4 & 0& 8!&&  < &!ꋓ\! 2 !`&$ `  㿘>ݶ#> .0`` 0@`"$`0&d$`2`1>ݢ 0! K8  @k֐0&!D  @kА<>&!a(`? "! @>a` @  *@k!& X& p 0&$ 4> `p X!  &$ >`&$$@k&$Đã>§`, `` Y "3> .z?3> .@a㿘> L p >(@`?㿘80 @km &`0*`0 (`01>`$ 㿘>L `?H/` /Hp@ >a` 8`  @F %``@ 0(`?!8` 4,! 2@@ (@$!@?C &?!8` 4! ?@ (?!?@C  !Ԁ @ !>8`` (@ `@?!Ѕ*`"% !Ѓ*`ᄂ@ "% ᘂa"% * @ "%  (` !"% "% 2!Ё*`@ @(a(a(a>aX !Ђ `(`"% !Г2`a `"% a*`"% b!"% "% 2 !Ђ `(`"% !Г2`a `"% a*`"% b!Е*"% "% !"% "% 㿘>!Ѐ`a&% a8` !а a89㿘!Є ``  !!Ђ !Ђ   0c@@?2́㿘 H>`&!>b&!>cX!&! >`&!>a&!$&%  ! b! b!̂? ! b  4 0!̄o(`@ $!&%  4 0!̄o(`@ !&% ! a! a 4 0!̂o(`@ ᘁ㿘  ? ` $ d a /$e  ä@ $e /(`@ a`$@o /, X â$e o(`@ !a`$@oؤ , a̐`V$e 㿘 `$͒?ɐ d ÐA$  ̄ /@$  ` /o(`!  4 `̂@o(`X!̂ o$  `o(`!  4 `̂@o(`ب /!̰ `$ 㿐   @ (`@`h' )p ` $k d̒$  ̉(((@@@#b̂# $ /(`@#  I`$ /, %@̰ `$ 㿐 Ȓ  @(`@`h'&  ̅(((@@@#b̂#&  @2  (`" #   ̂o(`@ %`$ d `̢ o(@  4 `̐ /@,  o@%̰ `b& 㿘  `$ d`  $  `Qa$e  Z  hả(((@@@#"âc $e /(`@c  a`$`  /,  a̰ `'$e 㿘=`  Ő  ?ؐ% `   ΐ%&%,㾸>5a(`U `P #\ Ȑ>耢 C''''@S  9􀠠6쀣`3耢0`,(@80`@8` !> ."$ $ $@$ (|$ 8    >媐!  h& l   $& l㿘cA@4@ D@H_@2@@C? cL@"8 cE@27?5 B@!C@!?)&`&&%>a %&% &&!&  < &!V'!؀ 2 !`&%  `  㿘>ف# 0&ea&eHF $ 4 @g &a @  @g<a&a >a(&e `? # "X 0 4&%&%> La` @( &!@gH%%& X `& p>C X!А$&%  >c&$&$ؔ @fؖ `"ג n>ra ɔ `J?3> .bD㿘> Hv!0 >(@`?>a`8`  @ ` @8` 4>8 @ >8`!`!(@ `@?` $@ @$@` @@` @$@ @$(@$:`(!@ "@ # @ $`(` $ (`$(`2 @ (a(c(b>a 㿘 ` @fې!?c?c??c  ? 0`(`0`` )  ( 0`1 )  ( 0`1    @ 8 $3`( ` $ @ 2㼘@`,`! @% ` `  ` GF@@F 㿘@ `! @ `֔ ` !ϐ `"ȑ 㿘cA@"! 4 D@_@ @@2.? )B@C@ cE@"! ?&  & 0& 8!&&  < &!!x 㿀 @(`8``,`2``>׶"8`2`>׮!@>a(#>`?@Nߒa` a`>ל!p('$7'# '@O& >*`!׊2`0  @e &d @e &dEԐa &`8&`0&`4&`<&`@>i ``@>a`@  *@e&`p&`X #Fa>ax? e > .8bԁ㿘(`8``,`2> aF >Fa@ H`!Ā`h??c! hHp@>a`8`  @/ `, 8`  @9  4 !   >8) 8`   @ >8`(( @@aa(@ `@?`c !̆  % ` @%a (`? (ظ ? %%*`@? (  ĺD"(`@㿘 `$ȒĐ  6 ? @  d0@ `  40$$ 㿘 6  @   } $x d0t `nj?0@  㿘 0/ Q%  &@?* 0@ @`  (@  ĺ?!!&  㿐 Ȕ @  (`@`k'`  ``$ d @` @ 㿐 Ȑ @  @(`@`k ' (`"      `$ܐ d 4 `  x  㿘  $   ` $  d @` ` [ @2  x Ȓ @ ((`@k`k?`  ``$ d  P` 쀠`"? "    ` p&`80$ @f@ @ '܂  @,`, '  @'''   (@ L8(`0`8@܀``(`" ,@)   @غ+   @غ"؅1     ĺ3     ĺ)!   ĸD+   ĸDض`  㿘% `"%>al&!>`&! `>@KaЀ " h>b@&!$ h` `8%>b&!%` !&%>b0&!>c&!㿘`> @L=a &% &%%4!&% (@&%` ``(`(`  @8(`&`4&%`> @La ! @` ``(`(` 8(@4&% 㿘!Ć   ?ς  !!Д ! !Ć  h㿐! !Д #\㿘!??c ! @  8@"& 8!̀``K`2& 8>Vch& 8㿘 8`ڒ > 7> 7`` 㿘`%` 㿘cA@1@ D@j \@@d? #@+_@\?,!̄cL@"E8 cE@2P?N B@$C@G?&!B"@ 4 & 0& 8&!̀`?(`6& !̀`/ @/"@` <*&* '"@!̀`$ !V` $!Ѐ 2!` ` !̀`"   W ? 㿘>o"8>a(`?&e 1> _"x>@K#ch (```0>R!`0 A!`< A!   @a`&!`@ `?** @av`&!@ $Ė# @>a` @  *@ad>&!Ȓb@Jz 2 !`h @(`&!`d&!! 4 0>` "     !%& XA& p>EchF>c&$&$Ԓ$Д @` %`"%?%3> .ۓc(㿘>BCb `?>a`8`  @ ` @(`8` 4>8 @ >8`!`!(@ `@?1``=`5`! `! ` d2` ` d㿘! d & & & `a㿘!$$$$ $$` 2>ߞ@>Ձa`b㿘cA@-@ D@9\@@ %1&@"_@  <cL@" 8cE@  `@`? 4& 0 &&&  @ &(`& `    㿘>Ґ@Ich>!"8>@IbH (``>"X`?4@&4 &8>a( `?$@`>0>&!bh@IĐ $(`8``#`g$$π` (>b@>b@>@Ibx>@Ib & 0& 8& 4d$& < & @>Ȑ `0 @! @!>!  @ *@_ @&!  *@_* &! !& X& p>b`ʒ?3> .ch㿘>b@  >@b`?>a`8`  @ ` @8` 4>8 @  >8`!`!(@ `@?%*``!a  d "@`<%` *`@(a(a@(a(a(a(@(a>b `!   㿘!` `   !  㿘@K`! @F  (@`  ; ` 5 (` ,  `@  # `@ `@ (`@ ,`    . *` `  㿘@I`! @D  (@`p   8`h 2  (` `Y@   !`Q@ `@ (`@ ` B   *    㿘cA@!@ D@_@ @@2-?&B@C@ cE@"  ?  4 & 0& 8!&&  < &% {!%'!  ! 㿘>?"؀ >?"  >?"耠`? 㿘>#1>`" >Ґ@GҒch (``>"8>a( `?>?c&%P  @^-H&!D  @^'<T&! >?!>c%  &%@]~&%! ` $e# @>a` @  *@^ 4 0& X& p> `>c`?3> .c>a`8`  @ ` @8` 4>8 @ >8`!`!( @ `@? *c*a*b$` ` 㿐   dd   ` $ d??@@\( $(`@`h(`$ '`.  @@'` 㿘   dd ` $ d|xt?p\?@ @ @ `P%n* @@% . @% , @% 㿐 $ `P#\    㿐 `P#\ t 㿈 @' (`"$ D  dd @ `P&(`@`h(`&   (` @& &   D `P #\>  㿐 D#\  g 㿐 #\Z 㿀  @((`@h`h''$  ΐ* ʐ , ' `P#\  쀠`[$(` @ `P$. (`$. @(`$.$ ?(@$ ?  Pdd&8(@@ `P$. (`$. (`$.$ ?(@&  $`  (`@ 2 @ ) (`@ 2@) @쀠`??$ 㿘$$c `  ?>`#0㿘$$  #$!" @ (`(@@$    !`$  `$ 㿘$`$  ``@?$$ `$  $ 㿘$Ȁ@w`$Y$  "ڐ   0Ր   А  ˖ 0$` ?$.?c$.$. 0 4(`@$.$. ?$. `P$.$.  0 4(` @$` $` $` $` @@>!a"#+@`) ( > b e&$ȁ $.$. ?c$.?c$. 0 4(` @$`$` @@$` c$.&$ȁ㿘$Ȁ` > 7> 7`` 㿘`$̀` 㿘cA@-@ D@/\@@ 2'&@"_@! <cL@" 8cE@  `@`? 4& 0 &&&  @& & + 㿘 0;7a  $@[ &d.@[ &dP.@[ &d @[ &d @Z>&dĒch@D (```T>̯"8>a($@`?&$̂ & 8>@D^`#& 0>@DX` 0& 4* & <& @>̒ ` @>a` @ *@ZŒ $$$ǐ4($$H $<$L \8 (`"$T, : $<  ?@$$$@$d@>!al$༃: 0`@8`$`>!a$>!`$>!`X$>!a$>!` $$̀`?q ? &$  $3> /-`㿘>;cP`?#>800``3f##0`@* 2 #>8# ```  %8@" % #"`㿘``;e   `2  \^@ @ 8@ 㿘>8``"#  8 \@##8?@ # `@#`8 @@1 " N㿘 >`b`;>ch;>b;4`1>ղ˥!`?`?>˜#0&c  @YӖ &c` 1 > `D`D`  @ D`&(>8><&"@&#&#  Dch@C* %6"  >8`` "   "  @U?c   >.#># 6"&#$4&#`8 (>=`4`: ! <@ @   >=`4`:   $ Bِ"><a4&"&"><a&"&"><a&">#c&">#c&">%b>8&"`>$>%a&">$`&">%b&">#c؀` &" > /&"x&"x`2  #" &"> /`|&"x> /&"&"&">:c&#H>8`` #`>%c&#H#H  @Xe&#Lف㿘? c%##`8@ <#`8@@? 㿘 #%#`8@ %#`8@@? 㿘#``8"@ ``>{#``>q#ˁ>8``#`"````@@㿘"` /```">8 >8``2 -#`" - 0``2 -#`2  ->8``2 #` f 㿘#> / 8@`  ` 0 ?? #`8@` Ho&(@gHp@ t@@0@@?c0@ th@0h@ t@ (@@(@ t( @  `  `  `   `  `@`? *`@g(`* 0`2 * 2  ! "` *  @ @?*`@20@# "  *@ `  ` b *`(`0`*@2@`  *@㿐# #"@##<@3 " &> ' !,$!,& &"+`&@  &  @ c (  b@`c@[ l* # @(`0`0`@4 @ ,`(`@c `0c&  &db@ gĤ (  b@`g@) l* 'Ă @(`0`0`@4 @ ,`(`@gĈ%`0 `&`&``&`` &  && aĂ ` 0 h #'Ę!((( ) # l&#&?&& (002 l'# @(`0`0`@0x#'4 ``$""""@ܔ>&Ra>8`ܒ @ȑ* (`0``p"@ (``   >'b 㿘6@#6`! ?"6`"*`* @  (( @(`0`0`@6` l#&@(`0`0`@ 0   @(`0``   >  8 # @(`0` @>'b 㿘%6`?6@6` l#&@(`0`0`@06` r  !@@(`0`` `(`0`Ԓ !@ @ 1>  h   5?1>    5?1>   1>  ˁ㿘#  l#$(`0`0`@44"4 ?4  ",  ,  @,  ., ,  `, , ?, @ , , , ,   2> (`0`` >  "! l $(`0`0`@44!4 4 " @"Ȑ  > (`0``  !(r 0#` S  l##@ @6 ܃(`0`0`@1   ΐ= "耠`" @ 㿘N  @@, d d`6 d``l xB* (`0`c$" d(`0``A`@`ʐ d6 dP l x 4 `d(`0``@" @ 㿘"؀`4 " b $&  ` (`(``"@@  `  ba6 ܐ x   5` &  &"㿘Ҡ > ɐ!X ܔ { x6 % u `/ "> Ƴ!h  `" " > Ʀ! ܐ`6 T 㿐"# @"# @"# @, h$@',, ,  ,@ l$, 4 4 4` h l @',`,`,`"@"@ d @` k ?d 㿘 t d,?,㿘 t? d4(@4(@㿐 Ā   (c`(`0`* 2*WK2!   (`#@@`?#`0(`@@` 0` h(`@@@ '` ( ( ((`@@`0`(`@@`$0(`@@`0@ l( @ (`0`0`@3` l(`@@`# @(`0`0`@0A & 6 ځ㿘 d) 0``@w  `$c ` >  a` 0d\  (@`"`` $`" (`@@`&"  (; "@    @ ,0`@ey̐,0`;8 " < <@"@,(`@@`000`@&`& ` ` 㿘 ` ܃(`#@c@`6 چ6 @(`0` ` > /!  !!  /@>!0`@C >! 2 ! 2 ! 2! !@ >!" "! !@`>! C >!"`  (`@@`&"  ` & `&& " x㿘 b*@g(`0``@>   ņa, `04 (`@g0@@~ &(`@g0@~  &㿘 > ]`!@ <a?@١, @4 ` @~ޢ`?",aЄ "bc1a2@  怈`: "Ȁ 4 0*"Ȁ . 怈`* b | `, "@ @ s`  ,  怈`2 c"  C!?@>!  &@6?` " " '%>N`  =  2 X0$ a(  ( (`0``" h($ @: `2 $ `@@8$  @$ $  $@&@`̢   cШ c!` " @(``",@@`@@$@2 $,@ "@ , @@ ,@gĐ0gIJ `0@}&(`@gĦ0@} & 㿈 '> 1Вc.`@c!@0@c##`0,(`@c40 b @}&@}` & " !@>!`  xf㿘#c3> / b.@c@(`0``C`Ȃ`7&`    !(+ 0(3 0 *(20 (0(`) 0`1 +`@3`(`*0`2@@ @+` 3`@ @@>!66  6  6$&`q@}!(`0`@ l'# @(`0`0`@0 l#3 @(`0`0`@ 6< 㿘#"@>  t(@(`0`b> (D(D(F**+ 22 3 >  ©"(Da4(D>  b@,`0` P a  O " #Ž!@>!#@,`0``,` 㿐`x`> `"l>)&b>)b&b>&`&b>&`&b>^cd&b>^`&b@ &`p  @P0`p&`t!?'>є >ˀ  c> ."X`p Ȗ &`l> $"``p#>a  @_;0@ `la @"`p> "pb@&`h`l`&c&c>a؟@ 2 > ">aВ8   @ ?&c`la`p@&c a G&cc&b>&`&b>&`&b>&b4&b>&a&b@0  (H&`p&b@P/&`t4(@`p?*2 *@P"&`h&`lhD a ?4hD(4@4gb`l@`p`p`l|&c&c&c &c&cb9% 8> " `0>*a $T>(c$X>+a|$`?`"4det$gfb> /(`@> "`">-`48 &`4a$&`4&`0`0@O&  8>-a$&`0`0 5>`8 > 0ؒb耢 ` "$ 㿘`0` `" `   8@  Ho$(@eHp@` @ `?> /a? 2  2 * 2༂ (@( ༂ (@( ༐ @ \`" " 0"  " " " $" (" " " " ," 㿘@/c&@@@0(c&@@8`` >b` .` .`  ``02 .` `|.` `.``.` .`  `6`  `.`  ``02 .` `|.` .` .`  .`  .` "6` .` .``?@&` ``0  `|``x(@&` $6` ` `2`6` .` ` .`  (@yؐ.`  @y5 @yТ.`  @y-`6`  ( &`` $(` @@@?`0` .` D> aDz> > `x9> > cЀ> >  c > > cX2> > c2> > ` > > c耠2> > `H> ߐ``> 1ڐaX1> > Ӑ`Ѐ > > ̐`2> > Đa > `02> > @a@ > > 2ah32> > Ba> Ba> c@> > abxa> > Ib0I > > EbH2f> v> KbX> Kb@`2Z> l> dwbd > > bpbc2K> _> hb> dbp2?> U> \`8> > Uc > > Nc(2)> A> Fc> Bc2> 7> :` > > 3`X2> *> +c > 'c@"> c0cpc``0`a@aabbhbbЁcP``h> `㿘  `` `># 0`> `G ` `a@ @@@@@@> @@@>c> `` ` ` *> 2 ǐ > Da Dz> > `x 9> > cЀ > > c  > > cX 2> > c 2> > `  > > c耤 2> > `H> ޒ``> 1ْaX 1> > Ғ`Ѐ  > > ˒` 2> > Òa > ` 02> > @a @ > > 2ah 32> > Ba> Ba> c @> > abx a> > Ib0 I > > Eb H2h> x> KbX> K~b@ `2\> n> dvb d > > bob c2M> a> gb> cb p2A> W> [`8 > > Tc  > > Mc( 2+> C> Ec> Ac 2> 9> 9`  > > 2`X 2> ,> *c > &c@> "`> c0cpc``0`a@aa b bh bbcP``h>#$ > DaDz> > `x9> > cЀ> > c > > cX2> > c2> > ` > > c耠2> > `H> ޒ``> 1ْaX1> > Ғ`Ѐ > > ˒`2> > Òa > `02> > @a@ > > 2ah32> > Ba> Ba> c@> > abxa> > Ib0I > > EbH2h> x> KbX> K~b@`2\> n> dvbd > > bobc2M> a> gb> cbp2A> W> [`8> > Tc > > Mc(2+> C> Ec> Ac2> 9> 9` > > 2`X2> ,> *c > &c@> "`> c0cpc``0`a@aa b bh bbcP``h>  21> > !x1>v#㿘 > /!`? 6 2@ !(` > `a`!  㿘 8" D"> /a ? 0`@0`(` H`+ 8 @`& < 0 d& @& 0 0a& 0x +   +e   DaDz> > `x9> > cЀ> > c > > cX2> > c2> > ` > > c耠2> > `H> ޔ``> 1ٔaX1> > Ҕ`Ѐ > > ˔`2> > Ôa > `02> > @a@ > > 2ah32> > Ba> Ba> c@> > abxa> > Ib0I > > EbH2h> x> KbX> K ~b@`2\> n> dvbd > > bobc2M> a> gb> cbp2A> W> [`8> > Tc > > Mc(2+> C> Ec> Ac2> 9> 9` > > 2`X2> ,> *c > &c@> "`> c0cpc``0`a@aa b bh bbcP``h>  ֐!H h ( вb@ h` `2  U `2 h> !`(  ) 㿐 > !p` /`. 8`-`-` @@ (`E 2 D> !{?` x@ 0`@`0`(`@`l`Ѓ(@` H 8@D  > !  ``. (`  ` F$  8#\8`#` 3`@Z;`  0 @  `B`0 @a 㿘 hB 8a `B ˠ? `?`` ` ? @ט ? ``?  @ɘ 2!. @[" `8!# @ !`Ƞ `ć.` .` (@` C   `E 㿘 h ` .``.` @@(`)@P_ !`@t(`!.!` .!0L> L!  A @> !a@@@`@@+` h0`( h0`( h0`( h =(  h (  `. 40P>     @> !a@@@`< !a 㿘`  @s`߂.!, .!<  P "> G!` !` h` `"!㿘` >  S" h (` вb@ h ` `  `2 h? /  ``0` `2f` . "R!'  .`@ 0`(`  @``` 4`04`2F` 0  @ 00d 0 $ 0(` < 0 ,`8@B`H `0`0<8 0"@K   0  ``. (`  `2`s`o!`.! `@ ' ` !`.!(.!`` 4E >  `"L  > / c + ) z "㿘a  `"4``@" 4   @` `4L  > "  ? + F>8`ܰ!(`@㿘` ``?` ?`@&`! `.!`?&`!.!?`b`````$(`0`@" `` `(#@&`$&` ) &`(``  *`@p2`@p @rw @rs@=?4``&`c&/c0(&0``. 6```@6 ```, 4 ?$@rF. `@p[`. `(@&!. ` `````` ``&``@-``)`&`c&/c0(& 0``.&`!`2!`.!.!(ߒ H  㿘 h `@7 > Da  Dz> > `x 9> > cЀ > > c  > > cX 2> > c 2> > `  > > c耤 2> > `H> ޖ``> 1ٖaX 1> > Җ`Ѐ  > > ˖` 2> > Öa > ` 02> > @a @ > > 2ah 32> > Ba> Ba> c @> > abx a> > Ib0 I > > Eb H2h> x> KbX> K ~b@ `2\> n> dvb d > > bob c2M> a> gb> cb p2A> W> [`8 > > Tc  > > Mc( 2+> C> Ec> Ac 2> 9> 9`  > > 2`X 2> ,> *c > &c@> "`> c0cpc``0`a@aa b bh bbcP``h> "8 ?7 > "X> e"p `"/ * / @``"Ŧ``@, @ . 0`0 ` $` "`$```" ```"`U ` "O` 2L`?`8H`` `$`(`$` ?$`($`:$`$,$`$`@$0`(`$`$$`4`` `*`@nq2`4 `` `@nk@pO, `` @pJ`, `( @$!`2!`.!(.! H`` 20:2?  `0 0 d$ @$ 0`$(` $ <$ <`, H@?i 8 8` 0 < 0 @ 3   ``. (`  `]`@$`!`Q.! `@$`!`.!`45  c /c;  *9 㿐` ` `0>  b > !*b H  V `"   I ` !  < !` `2 2 > A"` , (`8` . .  @@(`@@.@`l\#\A#`LP 㿘v   t   `@N   >>F >a! >>F >a!㿘`$n` `  O ? . вb@ `  z` 㿘 $!"&(`ނ(`0``8` &8&0`&,`, 4 &4`(`0`&H &8@k' &<6p 6r6&& aW&&6`?(00` @0`(``>3b>Fa6 `(`?#* @: `ނ(`0``H4@6`46`H6`0.`,.`86`㿘> /a` ?0`@1 pa, `k `h@"4`  eee@'r@2^ f@ X g@) `n@O"M `"# B W < `В#!6 &`Ѕ(&+ `ВJ $`ރ(`0``@ 4`>F``Ђ`$`6 `(`,   ?c a* @9``@$` 㿐 `0 #.`&`L`"6`6`&`&` (`@ `l` `>  b U  `ރ(`0```>"Β` #\#`6`ސ     *!.!``2 I!  ,`,` @@(` . (!  ` B4 B > " Ă &> Da Dz> > `x 9> > cЀ > >  c  > > cX 2> > c 2> > `  > > c耤 2> > `H> ``> 1۔aX 1> > Ԕ`Ѐ  > > ͔` 2> > Ŕa > ` 02> > @a @ > > 2ah 32> > Ba> Ba> c @> > abx a> > Ib0 I > > Eb H2f> z> KbX> Kb@ `2Z> p> dxb d > > bqb c2K> c> ib> eb p2?> Y> ]`8 > > Vc  > > Oc( 2)> E> Gc> Cc 2> ;> ;`  > > 4`X 2> .> ,c  > &`> #c0 > c@cpc``0`a@aa b bh bbcP``h> Z"> o#`#\#`   Ú "!.!``2 !  ,`,` @@(` . (!  ` א %> Da Dz> > `x 9> > cЀ > >  c  > > cX 2> > c 2> > `  > > c耤 2> > `H> ߔ``> 1ڔaX 1> > Ӕ`Ѐ  > > ̔` 2> > Ĕa > ` 02> > @a @ > > 2ah 32> > Ba> Ba> c @> > abx a> > Ib0 I > > Eb H2f> y> KbX> Kb@ `2Z> o> dwb d > > bpb c2K> b> hb> db p2?> X> \`8 > > Uc  > > Nc( 2)> D> Fc> Bc 2> :> :`  > > 3`X 2> -> +c  > %`> "c0> c@cpc``0`a@aa b bh bbcP``h> #`#\#`   s ' !* @`.!2 ~!  ,`,` @@(` . (!  ` ~ & > Da Dz> > `x 9> > cЀ > >  c  > > cX 2> > c 2> > `  > > c耤 2> > `H> ߔ``> 1ڔaX 1> > Ӕ`Ѐ  > > ̔` 2> > Ĕa > ` 02> > @a @ > > 2ah 32> > Ba> Ba> c @> > abx a> > Ib0 I > > Eb H2f> y> KbX> Kb@ `2Z> o> dwb d > > bpb c2K> b> hb> db p2?> X> \`8 > > Uc  > > Nc( 2)> D> Fc> Bc 2> :> :`  > > 3`X 2> -> +c  > %`> "c0> c@cpc``0`a@aa b bh bbcP``h> #@6`6`6`6`.`.` ?00~`#\#`    "!.!``2 }8!  ,`,` @@(` . (!  ` }# %> Da Dz> > `x 9> > cЀ > >  c  > > cX 2> > c 2> > `  > > c耤 2> > `H> ߔ``> 1ڔaX 1> > Ӕ`Ѐ  > > ̔` 2> > Ĕa > ` 02> > @a @ > > 2ah 32> > Ba> Ba> c @> > abx a> > Ib0 I > > Eb H2f> y> KbX> Kb@ `2Z> o> dwb d > > bpb c2K> b> hb> db p2?> X> \`8 > > Uc  > > Nc( 2)> D> Fc> Bc 2> :> :`  > > 3`X 2> -> +c  > %`> "c0> c@cpc``0`a@aa b bh bbcP``h> R#h`#`#\     "!.!``2 {!  ,`,` @@(` . (!  ` {Ґ (> Da Dz> > `x 9> > cЀ > >  c  > > cX 2> > c 2> > `  > > c耤 2> > `H> ߔ``> 1ڔaX 1> > Ӕ`Ѐ  > > ̔` 2> > Ĕa > ` 02> > @a @ > > 2ah 32> > Ba> Ba> c @> > abx a> > Ib0 I > > Eb H2f> y> KbX> Kb@ `2Z> o> dwb d > > bpb c2K> b> hb> db p2?> X> \`8 > > Uc  > > Nc( 2)> D> Fc> Bc 2> :> :`  > > 3`X 2> -> +c  > %`> "c0> c@cpc``0`a@aa b bh bbcP``h> #B  >.```&`* ? c  *  "> #& `*> 2#```, 4 75": #\2> : ܐ#`#\#`   0 "!.!``2 zY!  ,`,` @@(` . (!  ` zD '> Da Dz> > `x 9> > cЀ > >  c  > > cX 2> > c 2> > `  > > c耤 2> > `H> ߔ``> 1ڔaX 1> > Ӕ`Ѐ  > > ̔` 2> > Ĕa > ` 02> > @a @ > > 2ah 32> > Ba> Ba> c @> > abx a> > Ib0 I > > Eb H2f> y> KbX> Kb@ `2Z> o> dwb d > > bpb c2K> b> hb> db p2?> X> \`8 > > Uc  > > Nc( 2)> D> Fc> Bc 2> :> :`  > > 3`X 2> -> +c  > %`> "c0> c@cpc``0`a@aa b bh bbcP``h>  0 ``ђ``(`0`*`2`@ȒĐ`#\#`  ʚ  #!.!``2 x!  ,`,` @@(` . (!  ` xސ "(> Da Dz> > `x 9> > cЀ > >  c  > > cX 2> > c 2> > `  > > c耤 2> > `H> ߔ``> 1ڔaX 1> > Ӕ`Ѐ  > > ̔` 2> > Ĕa > ` 02> > @a @ > > 2ah 32> > Ba> Ba> c @> > abx a> > Ib0 I > > Eb H2f> y> KbX> Kb@ `2Z> o> dwb d > > bpb c2K> b> hb> db p2?> X> \`8 > > Uc  > > Nc( 2)> D> Fc> Bc 2> :> :`  > > 3`X 2> -> +c  > %`> "c0> c@cpc``0`a@aa b bh bbcP``h> % `N ?c c (`(`0`@ 0 (`0`@ "``(`0``~ `(`0` 0```@ `~``~   `~>  `"`  @!  > G  ` "$  6``wb`蒑㿀> / Da`?@0`@0`@6P a(``2`H (``2`` ' @4 " '''`ؒ@3Ғ"`ރ(``+ `ރ(`0``"` G``  `? `آ 5:;Đ  `4 & @ 8 0& <d& 0!&㿀 > /!`? 6 4@L!(``"H `ރ(`` `' @3" '''`ؒ;@3j"`ރ(``+   `(`0`. @``2``` (@$` (@$```@$`  㿘> /a`?0` @1 @7a(``1 ` (@@2 `А  $?`Ѓ, @࠰?`? (2 (`0`    @@_0B    瞖 ??x   @60& &`h> *`b@>&`|#&``  &`l&`p&`t&`x@3#&` &` QZ&L&`    > q ``) @ `@(` @ ` =(```( `4.` .`.a.a.a.a4` 0#\#`    Ś > b `* `SK* `*  (@`"%> > DaDz> > `x9> > cЀ> > c > > cX2> > c2> > ` > > c耠2> > `H> ޒ``> 1ْaX1> > Ғ`Ѐ > > ˒`2> > Òa > `02> > @a@ > > 2ah32> > Ba> Ba> c@> > abxa> > Ib0I > > EbH2h> x> KbX> K~b@`2\> n> dvbd > > bobc2M> a> gb> cbp2A> W> [`8> > Tc > > Mc(2+> C> Ec> Ac2> 9> 9` > > 2`X2> ,> *c > &c@> "`> c0cpc``0`a@aa b bh bbcP``h> - > * a.a``2`ta````.`@(` ``t` *` 2`> !a.a``2`ta````@.`(`, ,  @@(` ``2#\t|`#\#`    > "a.a``2`tga``,`,` @@@(` .`(! `` tR` '> Da Dz> > `x 9> > cЀ > >  c  > > cX 2> > c 2> > `  > > c耤 2> > `H> ߔ``> 1ڔaX 1> > Ӕ`Ѐ  > > ̔` 2> > Ĕa > ` 02> > @a @ > > 2ah 32> > Ba> Ba> c @> > abx a> > Ib0 I > > Eb H2f> y> KbX> Kb@ `2Z> o> dwb d > > bpb c2K> b> hb> db p2?> X> \`8 > > Uc  > > Nc( 2)> D> Fc> Bc 2> :> :`  > > 3`X 2> -> +c > %`> "c0> c@cpc``0`a@aa b bh bbcP``h`> !H&`4>:cT&`0`0 T`" @/ 8 ''`'`2 '``2'` @ '  ˖ `'䀠`$@/" @ a>7}3a>8`ܐ(`~y@Ho$(@eHp@` @ `?> /aX? 2  2 * 2༂ (@( ༂ (@( ༐ @ \`" " 0"  " " " $" (" " " " ," 㿘 @``0@ (`6@@@6@.``6``6` ````(`6` ``c(6`  `|6``c6` ` `2`6`.``.` $@^V.` @] @^N.` @]`6` $6`  ( 6` 6`06` ?@0`6`.` > cЀ=> > cp> > a > > xcX2f> f> pa> la_> ga > > `a 2N> R> Xb8> Tb2B> H> Lb> > Ebh > > >aȀ2,> 4> 6bp> 2b-> !-b!> > &b> "bЀ2> > ax> c@> %b> c0aa؁a؁bbXbАb '      @  0  !  2  ` %  0 @ ` 0㿘  `` `>Ԑ# 0`> `G ` ˒`a@``@``> @``>c> ````*> 2  > cЀ => > cp > > a  > > xcX 2f> f> pa> la_> ga  > > `a 2N> R> Xb8> Tb 2B> H> Lb > > Ebh  > > >aȀ 2,> 4> 6bp> 2b-> !-b !> > &b> "bЀ 2> > ax> c@> %b> c0 a a abbXbВb># > cЀ=> > cp> > a > > xcX2f> f> pa> la_> ga > > `a 2N> R> Xb8> Tb2B> H> Lb> > Ebh > > >aȀ2,> 4> 6bp> 2b-> !-b!> > &b> "bЀ2> > ax> c@> %b> c0 a a abbXbВb>  21> > !1>#㿘 > /!X`? 6 2@ !X(` > `ai!  㿘 8" D"> /aX ? 0`@0`(` H`  8 @`& < 0 d& @& 0 0a& 0㿘  (`` Ų``` ? 㿀   0(`0``0`߃(`0 0 Рb@`0 ``(`0  h@( h0`( h0`( h0`( h?( h(``6  x ?"   h``  `> cЀ=> > cp> > a > > xcX2f> f> pa> la_> ga > > `a 2N> R> Xb8> Tb2B> H> Lb> > Ebh > > >aȀ2,> 4> 6bp> 2b-> !-b!> > &b> "bЀ2> > ax> c@> %b> c0 a a abbXbДb > O!H h b@ 2 > ""(   㿘  k `2&  |`h``0` 2  `2`2 "  & @0@  @[P  &  |, ,  (  ``2",` @, ,  @`2#` `0"  `@` 00  ` ` @[ Р`Ű @㿐`􀦠> "Gx`` `Ѓ(`@` H8@*  >  !8@#\8`#` 3`@;` 0 @  B`0 㿘` `l`+ ``` `+̐`@~ P㿘`2 h>  w" h b@/  ? X9U  |@ ``0` `2D`4"?`4'  `0(`0``0 `` %`0%`2(`4 0  @ 00d 0 $ 0(` < 0 ,`8@)`H |@`0`0<8 0"@} H 0' m `@' `4`  |  %  n㿘  |`"4``@" 4   |@` `4 | > "  ? f >8`ܰ (`x@㿘``0 ` ````' @``0` `!``  ` `%`" 0   @`` ?`@ &`?* `&``c``a``$ (`0`@" `` `(#@&`$&` ) &`(``  *`@Wړ2`@W֐ @Y!,@Y@$?4 ``&`6(`0``6`. 6 ```@6```, 4 ?$@Y.`@W`.`(@6 ?@0`6`` ````Y `&`@```&` 6(`0``6`.&` 㿘 h`  >  # ?  ǒ> "X> ې# `@ @(`"  ( ````" ``@" @`" (`0``  $` " `$```" ```"` ` "C` 2@``8<`` `$`(`$` ?$`($`.$`$,$`$`4`(`4`$$`4 `` `*`@V2`4`` `@Vܒ@X,`` @X`,`(@4 @0`44 `` $0)2+   `0 0 d$ @$ 0`$(` $ <$ <`, H@' 8 0` 8 < 0 @  z$`  `@k$` `@$`  V`/ +P-? 㿘#B)  h  $   ?   ?   2@ @``2@r@a```h 㿘 h (``*Pf 0> ]#  lf @> cH@``` b@ 2> > A#P Ր#p 2  h9> P2# ( h0`( h0`( h0`( h?( "> 40P>   l @cH@````#u  㿐` `  > c `  k "   ` "@> $ #p  .@`l\#\R#`]U 㿘>   >>W >a# >>W >a#㿘` ` `  {? b@ @  㿘  J!"&(`ނ(`0``8` &8&0`&,`, 4 &4`(`0`K&H &8@SY &<6p 6r6&& aW&~&6`?(00` @0`(``>Mb>Wc6 `(`?#* @#) `ނ(`0``H4@6`46`H6`0.`,.`86`㿘> /aX` ?0`@1 paX, `k `h@"4`  eee@'r@2^ f@ X g@) `n@O"M -a," F1B W < `В 8!6 &`Ѕ(&+ `В| $`ރ(`0``@ 4`>W``Ђ`$`6 `(`,   ?c c* @!Đ``@$` 㿐 `0  ``&`L`"6`6`&`ؐ`(`  |(( @@(`&`&` (`@ `l` `>  ` j{ `ރ(`0```>"`#\#` 6`ޒ   Y   ` is`  > ڐ" > cЀ => > cp > > a  > > xcX 2f> f> pa> la_> ga  > > `a 2N> R> Xb8> Tb 2B> H> Lb > > Ebh  > > >aȀ 2,> 4> 6bp> 2b-> !-b !> > &b> "bЀ 2> > ax> c@> %b> c0 a a abbXbДb> ǐ"> @ 6`6`6`6`.`.` ?0406~&``#`#\     2 ` ` h` "```&``䀠`$ "`> cЀ => > cp > > a  > > xcX 2f> f> pa> la_> ga  > > `a 2N> R> Xb8> Tb 2B> H> Lb > > Ebh  > > >aȀ 2,> 4> 6bp> 2b-> !-b !> > &b> "bЀ 2> > ax> c@> %b> c0 a a abbXbДb>  (}F > x P.```&`* ? c  * L "> _#( `*> 2V h```, 4 ӚӘ": 2#\: > ?# l" p`䀠2 p` 񀠀/ `((`00`'` # p%"$``䀠2`` 񀠀2 `((`00`2 ` " ` >  > ؐ ``A``*`2`;?6#\#`  P  >  ` gj` > cЀ => > cp > > a  > > xcX 2f> f> pa> la_> ga  > > `a 2N> R> Xb8> Tb 2B> H> Lb > > Ebh  > > >aȀ 2,> 4> 6bp> 2b-> !-b !> > &b> "bЀ 2> > ax> c@> %b> c0 a a abbXbДb> C   ``҈``(`0`*`2`@{`#\#`     >  ` f` "> cЀ => > cp > > a  > > xcX 2f> f> pa> la_> ga  > > `a 2N> R> Xb8> Tb 2B> H> Lb > > Ebh  > > >aȀ 2,> 4> 6bp> 2b-> !-b !> > &b> "bЀ 2> > ax> c@> %b> c0 a a abbXbДb>  `O ?c c (`0`@ ( ` (`0`@ "``((`00``~ `(`0` 0```@ `~``~   `~> R a,"`  @{  >  耢  ` "$  6``e`㿀> / DaX`?@0`@0`@6A aX(``2`9 (``2`` ' @"m" '''`ؒє@"2"`ރ(`` `ރ(`0``"` G`` `zP?#``B 0 & @ 8 0& <d& 0㿀 > /!X`? 6 4@L!X(``"H `ރ(`` `' @"" '''`ؒy@!ڒ"`ރ(``+   `(`0`. @``2``` (@$` (@$```@$`  㿘> /aX`?0` @1 @7aX(``1 ` (@@2 `А  $?`Ѓ, @࠰?`? (2 (`0`    @@MB     ??p   @%g0& &`h> *`b@>&`t#&`x&`&`l&`p H @!w %?'  H@  @!i H H@!5  H@`>   $ H&`&`  ? &`|> !  ``|! @ ``4 h0``d0`|b0``0``@0``02``|``h0&`&`&`#\ 0#`     `` (`0``` ``d.` `` > > cЀ => > cp > > a  > > xcX 2f> f> pa> la_> ga  > > `a 2N> R> Xb8> Tb 2B> H> Lb > > Ebh  > > >aȀ 2,> 4> 6bp> 2b-> !-b !> > &b> "bЀ 2> > ax> c@> %b> c0 a a abbXbВb>  > !(> !P``">> !h># "`h> cЀ => > cp > > a  > > xcX 2f> f> pa> la_> ga  > > `a 2N> R> Xb8> Tb 2B> H> Lb > > Ebh  > > >aȀ 2,> 4> 6bp> 2b-> !-b !> > &b> "bЀ 2> > ax> c@> %b> c0 a a abbXbДb`> ^!x```2&`4 > S!> P!> !L>Rb&`0`0  " @ 8''耢`'`2 '``2'ܒ` @ ` ' ܒ v ܂`'܀`$@M" @ K `>Pl`>8`ܐ(`n.@&0&0`00` 000 0 00 0㿘& `4 & &   㿘!`  `&> "!$&&L0`0``0`` 02`00 80 00 0` (  @ ( ` (  Ԃ (  @( ` ( (@`0!`&!㿘!`  `&> T"!$&&L````$` `<@ $` $` ` ( "  >  L"8  @ ( ` ( Ԃ ( "  n>  /"X  @( ` ( (@``$`!`&!㿘!!`&0cPc&@``@`(`0`@ ?  > "x`$ͅ d&@㿘&@`&`2" ܐ 4 w  4 r4 4 4 4 4 &D4 4  ܐ $ d$ $ $ _  `$  @㿘!!` `r&&! $  "! > "@  (!`&!!`P   4 !$> "!`C&!$! > w"؂ @@&!$&! `5```+> /0! ?0`+@ > /@0`+  ?c0+ `  ?0`+@ > /@0`+ Ă`  > /0`+@Ȃ` ̂` $ $  @(@ (@㿘!!` `&&! 4  (`0`@"! > *`";2`@  (!`=&!!`a (`0`&L&&L @4!$!`L&!$! > "؄ @&!$&! `> (`0``8 (`0``  )(` (`0`````@$0 ?(`0`@8`( ( (`0` ?(`0`@8`(  ( (`?0`@8`(4 4 4 4 4 4  @(@ (@㿐` `` ``@0&fP  @  ( 6`P> /a&`` 6`> &`Ă &`Ȃ &`̂ &`Ђ &`Ԃ &`؂ fP&`>Sa&`d&`&`>Ra &` >^c&`>^b&`>[c&```+> fP"*fP>[`0&`>[`&`>\b耈&`>[`&a>[`fP` >^>[`&`>[b0&`>\a&`>^c&a>[`&a4#fP`&a &afP`` a`&a &f&a!@&f@ : &fH  > #@fH @@2fH&f&f &f@>^`&f``2` ``f @` ``f ݘ` `a&fD`> #`Lː a4`0@e `0 `0``0 @ $ `0' >sC @   88@4" 8 Ɛ#p`> @#` , !`!`&!, 0`c 㿘`` A>8``; 2 &``/ > c *>b`2  > c >b`   ʐ ?> ``cװ    ȼ(8`? 㿘!!` > 7#`" $   @ && $ 㿘!&P`/! +`)`4&H> #آ @` `a@2@>  # $ &$ $ o &@K  $   > &$ &` ` ` ` ` `(4㿈@`3`> !`@ @3`& & `(3`89 8` ` p   ?  * - $.` F R ڔ03 2   \ ϒ d 24 3 1 4Ô @.`@ .`@c,$@ $`  @n@Qu@h ,@c@3i @Z ,@U 0`& 0@M ,@H0B @C ,@>@E @6 ,@1  @, ,@' @  ` @""?c 9@$` L @  ,@ @!   @@  : ">`H(?8c @@$` ($`, $@(`  $@ ` `     !\``:```A>(`>_@>!;>>`!>h(`>' Ss(>``$>>!8>!H ,!" >oa` ,>!' ? SS&`!>!'`h> `90; /~-h+j1@@@"'>Ȑ!'   ">`'`(` '   S!Р `& &`㿘  ,  ,@2 `2 `"|@K 0` `@@m$``i  `$LL$T$X6  $T `@ @ $X  $P` @ `&  `@&  `@&  `@c8$\@p T`1$T`  ` ` ``c8 $P @@2$h$L`?$P @ @@`@$h$d$`c$\@ ` , `:  7" 2 2  ` 0`+ `&      <  @ $ D ( H`   @@@ `?`  ( s" 㿘  ,  , , 2  @p 0 @& & 2   & }&   $ ( < @ H D@a    4 @ '   7 @7' @A@a `&6  6 '   @A@a `@  2'    @A@a `@  2' $   @A@a `@  2' (@@'  㿘c?c6`@@@6.`@6..@ 7 / @ # & ?`& & & @o&     & & & &  ?& ?`& & & &  㿘6`gc6@.`.6`  <& & & & @=&  '  & & & &  ?<& & & & @&  㿘6``c@6`.``  ?& & & & @&    ` & & & &  ??& & & & &  㿘` >`@  & & & & @&  㿘.&` 2`&` >"2> Ր??q ?/?!2 &@`@@&`? & &@㿘````` 00@1 (6() /  `0& #""&`2 ` `2 ```  &```2&` @ C&`&`&`&` &`&`&`&` 㿘@`(`@ ]c@2`&c " @"@ "  `@2 &@& F& 1  -& | `@d?c$`  ` 0& 0`?&& &?&& &c@`, &`&`& `?c@㿘@`(` >@'W`@2`U& 4  < =@"@! "  `2 &?@ .  *& @m '`"'$`  ` 0& 0`?&?&c @`, &`c@㿘@`(` [@0 N GO `4  Y Z@ "@ "    2 9@ " &  ,@@ ` @"`$   ` 0& 0`?"܂c,`@@@㿘@`` `2```4` r@Ȓ"@ "```$`` :`   c$`㿘 >2>0&[&&l&!㿘 ,   ,` ` @`2`@` @' `2  `@'`` ```             .`6 @.6`6@@+3@ @ ƀ C *`      .`6 @.6`6@@+3@ @ ƀ C  *`      .`6 @.6`6@@+3@ @ ƀ C  *`   @.`6 @.6`6@ +3@ @ ƀ C .  ` c(  @.`6 @.6`6@+3@ `'`@'` '`'`'`'`'`㿘   `@I   `  $ (G@8`&?@@@53   ) @@@  1 & `` `@@ 5   ``.@@@  6& 9  `` `@@ 5   ``.@@  6&$9 @ `@@`6  5   @ ``.@@  6@@&(& 㿘`r `` ` #`#`#`#`#`  _ `  @  ?     "#`0 @(.66@6..@@#`#`#`#`#` 㿘  `?  ? "9#? 6c 806@6 @...@c8#. (..@.& @7/6@6@#####? ` L h d " P  Lc \Hp@ `9(<@"@`F`f` $"@@ "@ >4b b㿘>5a(``@㿘>5a(``@㿘>5a(`@@㿘>5a(``@8@ 㿘>8``>5a(`x @>5a(`t@㿘>5a(`l@㿘!>5!(` > z"@ !(`@㿘>8``>b"0 >5a(` @ >O"X  @㿈 հ "㿘!>4"Pɖ 8"P` ,㿘`" 4 >#" 4  0`>b>b>" 㿘>8``>5a(`x @>5a(`d@>ߐ"㿘>4b 2 bG >4>А" b㿘>ɐ"㿘 >b8>D"   >>"c8>֠b8>b>Ѥc0, "    {  Ē  ے㿘```?㿘> c8Y  ِ 㿘>8``2>5 e`d && > /b$`b$`@V& a(`` ``>02``@ @: && &  ` />>E#E>a >#@>ch>cl@@+ .`.` @ 4>>#x>`# 㿘>5a( `8  |ǐ |@@0>5a(` >`> d&@&ؐ` @`?㿘#@?/#@?, 1>4%>"pP@A#蠒 "p#"pP "@ .,@"p㿘> /b`G>8``8>4>5a(``2>4>c>q`( ">a >4>> 8`( >4 "|( @("| !"| b|((`8`Ѐ`    b|( @( > / b. >4b|@x>G c>6P >4 hؔ ɔ     2 p>8``#>8    <@><8I '>a ''Ѐ @#>8``8>_``!>}`@ > P”?P ( " >Ҩa >բЦb8>`ȐW 2  㾘 !>!kc?#>&b8  b8>,b` @?[  >> h    >>! h  & &@>&  ,k> `. ? &   : >>!Ph : >& (a  @? 6 %> - ./  (>8`> /4 a> / b4 `(@  ) *  -ǔ   " < >!> <h< >8&!0`*`` > ,!2@`"@<` P>8`` !>>b!0>  >>Ԓc8 !0>>̐!a0>8`;> !H,D '>ӂcؒ'#>gfJc !HD''>̂`$'>҂`@'cf8 >c bX>"' f' `2' b$>a؀ >b*>֪b8>Ӥcؠ>gcq  !HԐD'''''e  >5`>5 !HD>g'>ӂc''''eӖ >5a(`L@(``>H@(``> a(> b> a(>b>ˀ  c>" ,>̂`$'>gc ><"8'W  e 2`ܐ@ (``>Ұa >gc>+>8b8>Ӯc?'> /``i  Ӑp +>Ѡʒc8e   ` U (`$((`$'+'e9 *‚`` !HD>g'>a''e 㿘>"X>̠`$>bp>bh>b     ` `a (``>#>a, `  (`>̂`$2hD@#0>̒ `$!>5a(`8@@ >5''' (`8``(>8  (`8``,>8 x (`8``,>8 o>8`` (8``xL`i >̃(`$8` `d#>>Ґ`8>Ґ`0ؔ a,$ `$a,$ ?$   *:> >Ð D%>,!>̂`$,ܠ $$ 4$ 8?$ 0  *+ :; > @ ,$ P$ X$ TQ$,`l2. (`8``e2( !>̔  $>`@%>, $`$,$ $ ?$    + *; :> w ,$ 0$ 8`$,!$ 4(`8``s>5 (`8``d `t`r>5>b`!>``?> (`9>!>̔  $>J`0#>a, $`$a,?> $ $ $  *c $>9`@#>a, $`$a,?> $ $ $  c!>̔  $>&`@#>a, $`$a,?>$ $ $  c0b>" a,$ 0$ 8$ 4> /b$$a,`L@(`8``188  *+ :; >'>̔  d>,` ,>̂`$ `X `P `T(8``f2 (`8``d2 !>>Ր $cҔ  $>,$ ܄$ $ w ,(`8``l2$ (`8``e2 !>̔  $>b#>a, $`$a,?$ $ $  > cha,$ 0$ 8$ 4P$a,(`8``sL>5 (`8``d `t`rA>5!>̔  $>b#>a, $`$a,?$ $ $  > {c0a,$ 0$ 8$ 4$a, (`8` r> x  >*: >̒ d[ >,` ,>̂`$ `X `P `T>5a(`@` >8 (`8``-2>8^>#>?@  (8``@`/`2(( (`8``@%?   (`8``,2    (`8``:a,  (`8`$  (`8``" a,`/2 a,$ a, `$a,  >5 (`8``/" >5a(,`@ 2 0>8-  (`8``-`>#>8b  (`8``c"a8 `d`">8`a2 a8 `s2  a8 `d& `$a8>8a8d>8C>8``:>8>8c> c> ax2 @"  @`@ 2` (`8``(` `怠@ >J"؂ '>a''G>ˀ  `x>:">8`` >֢b8>Ӡ5c؀ "!>8>#(!>8 `` ` > 7>5a(`x>h`| > 7`'>'ؐ#PbI'  >#X`   `ِ Ho@H/` />8`ؒ ﻔ" @>8 `ԁX#>8``>8 >'pF_ >8 $`>8 `(>8c ,>8``+!>!>˒ #!> /b$>5 a(($ H,$ L$ T\$ `$ X$ $ P`$ d$ l$! $ $ t`>Ђa !>" d $! !!@,N!>8``x>8>#  >0a8 > #>Ґ/a8 >#>`#` #?P'> 0pҀ@` ``>͐ h`@ݠ @&, @~ȂpҀ@`> ``Ӑ `@?p- ?p`> @K  >ߒa0 >!>Ґޒa0 >!8(`@~> c> c>8```>c:`=@`?P ?P(@㿘>4b`K> `!(`  >8> x ;>8` $``` (`8``s>8 ` 0T  >8@` (``>8  >8``8 @ (`8``s2@@` (`0`@` (`0`@"$`>̂aX` >"( ` " > 8@  "0" ",8@   >̆X>8` * * 8`>b0b b,8¢  >̆X>8` *`(`(`8`>(`"0 >8@¢  ,8@¢ >aX >"( aX ¢"0>",8¢ 㿘%>`!>aa>`X` @` 0@7(`,@ >¦? 0,$,¦ c@ @04`4``?|;>>0X ,`9   `? >̆X>8` * * 8`>b0b b,8¢@  >̆X>8` *`(`(`8`>b0b b,8¢  >>0aX,>a8@#aX¢  @㿘>aa>`X`%>`  @@@6b0@0,$,.  c @@0``?4 4 `?c@ 04 {f  ĠF  ĠFĠF>b0b b,8>`>4`2>cop o@ @"p ¢㿘+:>>b a`> aP?(@> aT> 7 ` €@a {b,    >b`" Ơ@ >> b$>`0"x㿘>bpb\bD@5bX@5Ɛ*>a`(@> aP> aT ƀ@  ĠF  F  ĠF  F Ġ@>Ԃ  $ `t` pbĘ@@ĸ@@>☄ ` x 1>}9"x>8`x<> aT@>b b, > aP @  ˆ@`¨@ >> b$>`0"x㿘>b b, Ȁ@>a`> aP(@> aT> 7 `!  0  0 €`  D :>b`!% Ġ@>(  $>}" `1>|ڑ"x㿘>bpb\bD@5%bX@5!*>a`(@> aP> aT Ā@ F  F Ġ@> `1> $ `|"x㿘1>"p"\"D@4"X@4*>a`?(@> aP> aT Ā@ "L>  >b\bd   0 €`    Ġ@&€@@ >|g" >1> $|a"x㿘>bpb\bD@4bX@4*>a`(@> aP> aT Ā@Ġ@>bDbL     >b\bd    0 €`   >1> $|"x> 6bd2 `@  ? 0`@`  ``> 6bd2 `@  ? 0`@` `?> 6bg*  H/` /Hp@ " " 㿐>5(``a(``@  a(ސҠ >8``> /b$`$@(@>5a(`P>8``> /b$`$(@ " 㿐`/>5a(` @ 0T@>5a(> 7`!>@"Ѐ ( >{x"A?"Аx@@  @ 2>{a#*?>ը @a $>>b8>긒a ? (``2  ?(`8``: ? (`8```?`z?>xc0>c@2@ >{$"K? @@  @ 2#>֒{0Ւb8>qch > a(- b8ɐ>ea "?(``2(`8``:(`8```?`z ?LH@(`(8`8? >zӐ#p?`(      ?>z#4   >̢` l > `p- > 7>z# >>z#Ё `>˂` , !> 7$ ( @@  @**`     ((`0` & ?~ ?㿘)(" D('Hb H,`" 0`"  "閐 躐4H@6!46!H6!06!,* 6!@*`&!D2 &! 2` : %%  (`0` @   (`0`B@2o t@2c% %ۨ ?b 6!?`% %  (`0` @ "  (`0`B`@2@ E@24% % ڨ   ( ( 6 gG c!&  *& 6!  6!`0?߂b%`x%`|(%`0`0`%`8%`0H@^ `  `0h%`0P >G cԁ㿘[  X`&X>` @V  A(" Dh 0?߂b" x" |(" 0 0" 80`" 0@! "H_@6ab(02:p  (``K  aW&&  &X簐&(a(`0`&,a(`0`&0a(`0`&4aa* *`2 2`p<(`&80` @ c 26ra(`0`<@/ &<6p 6ra&@a &Da (60>&&&H`  U $ 4 ($ 4 0` @ 2@ , `,  ,  4 ``   (` 0` `0` `gGꀠ`` *`2L`> `(`2C``a *` $ 4 ($4 0` @ 2@ , `,  ,  4 `@ `gGc뀠2P6 `Ȅ. `؀.  `6  A  `ȃ(`0``8;6`2.``.`-`"((`0`` `(``"(  ``: ` `2(  2 (    (  (  0( `46ZIp<(`0`6   @ aC <(`0`  @`@C  a c ڔ  0h$0ɴ >G cԁH/` /Hp@>a` >ǒ*|>>b㿘>aa>x 0``(>a>ǖa>>ǒ`Ȕ|2 &`'` @1> 2`8>x P#`@ @@` 㿘`,>Ѧb8 />->8ᨒ  @xe  " w &0&`,&`(㿀 >'a> 7` ` @@@ m>̠ax    @ `#`#dgf#\`''@㿐>a&`,Ț & &&&`0&`8&`4#> `2`8>x pc  @`@' @'@` &`(&`,㿈``,> Xa O>t`2`,Ȑ@`,(`(`@@ `0`,(`(`@@ `4`,`(`(`@@ `8`,`&`,>"`` @@  '@ '@ c`'&@''>̤#>в ؁㿘&`(&`,  "   " 㿘&`(&`,v 㿈@2#\  ? `? ` \ @㿘>a`>8``&@(@0@ _>̢axd >vY Y>`ȟ@㿀!> 7 `>a$ >a``@8@@3 > ax@ (` #`#\ #d?0ax @ (`   #`#\ #df 7 <@!>->̶!'>8 #>@ >vې  ('R!c`@ !@'??>`2@Ȑ@@> ch  >yc 㿐>`@.@I>Ѡ `'>@ a>v @ (TV@a > `ؒ0㿐%>`6.Ho&4> (@g> `3 T > `'>!%>В   V >Ѵ `'>̤43>a H` 8`@ a  &@> ch  >޴ @ a>v!@ TUa > `ؒ0E 㿐>8`?`#\` @>̒ p?>̆> at!   e >̀  ax>u!(``"*`@` " H ?>&c  㿈  `0@ @Z2`ؒ ` O@*`8`K'c@C `Ɣ쀢 B b @ ` 0  쀢`? @- ''而 -@?c$&@ "0`0(`@ `H P@   0``? ;2ǂ *>0````߀`㿘? c`"  @@@ ?&6  @`.@   0`?`-`?(` 0`%          $ ( , 0 4 8 < @`?܀``         ``     ` `   ``  ` 6` @(` 0`` .  2d 6?c(?66   >{bL 㿀`%   /7  ' '    ` @ & 4 H/` /Hp@`2`0""`0㿘 8` & 8>8`` <Ð 0ۑ㿘@2`0`2`0@ > t+!P &`0㿘 @(`>̐!@  㿈>8`0>8``.  >"ah>"a)8`c@' '(R ' *`@:`  2 >4 (@(.  >4b @㿈>8u`0>4b8@`. > 7`@` >̂a@`6` g  @' q8c(R''>4b. ! @ .  @*`@:` 2>4b ( b? 㿐!>''"@ 2!! > >ԙ3 !r!Ȁ`?p@>!>r  >a|`"@ >si"H㿘   >>"Prb> a>4b@c 4>  >4`  > >4``  >sE"a>48b >4 b㿘.&` `&``` ` >4b8@`>4b. @` ". >s". > 7`Ԅ`2`0 &`0㿘>8``          H  ԰ +,$ <$ $$ $ @>4b8@`>4b,`@` ",`>rՐ",`>̂a`2`0 $ 0gH/` />4 cD 㿘>r!㿘>r#@㿘>r!㿘>r#h㿘 >4#8`2 ?x!#8 `> a`@8@ `#88 !#8?>#>8>#rv``>a`. `.)>'>#@ ᨶ&@@>a` >ǒ*|>>b㿘`>rC#` S  ܕ   >b$ 㿘``? "..    0 >"" " " a" $" " (" " ,\ @㿐`  >a`?`   @   $$ #`#\@ *?  S \' ' ''   @㿘#>`0``>8`aX` c$` Hp@㿈>`0``">`,>p#!>p#!>!      >#\pא >pѐ @ >(@ `pʒ>`p`0`<` `$`(`,#\`4#``8p#d`8`" 1>@(@1>p 㿘@(`8```t21>0 > 21>1>qu  p  p㿈>p!>p!(>a>a@ <  $ ( ,#\ 4#` 8pq#d 8 4@4@" 0㿘> 8a0?(2 `(`(` > /b@`>a ,@)>!@\,,*$@@!$@> 7 a8> 7 a4㿘>8`h1> 8!0> 7a4`'> 78!0? 2>  `2!p!0> /b2 `(`(` @> p!!01>!80``(`(` 8>o!ؒ@ @%>`*8>@o!>c>c9 >/>4>`  ᨃ< < @E>o̐!) @ᨰ>4`o D@ > 8Da0@D @ @ 6 @E @ ֆ @ `"`1> `1>`"8`21>1> `21>1>!o1>"""(ox"H㿘>8`Ԁ`"% 0#T>8  a8> 7,`  ,(>,0oW"X tNQk >8! `Q ">>o>">(">o6">o3">o."   s>4 c@(` @ d>4c@(@>4 -(@@(@(@>4#@x@! "@. @ !!\@` <?c!?! ! ! ! 0! H?b&!>`0`@a\` H`0'aL`-7   (@@"aDaHH8  'L'P'8'< 'T  'X('\ '` 0'd 0'4'<h.4l@  M  F  . `ad$ H$ $ $ 㿘` @    -7> 7$7:$ $`B >8`>cȰ 6t 㿘ۙ!X$ !X @'  ?   2 !` ?``$!` @%>.$ * &!` X P $@a$$`$` ,``$`$`$`H&㿀#>8``>>  `>aؔ>>џ@ !>!@x>! @ @Z?H`?L` 0`>8`>9`> aXm >̠!a >*@"m2`> ch ,'#\ , `> 7 a> 7 a  >*@#mĕ2`  | T         p ? 2  8   (`   ? -㿘? 6 Ű #>4>c( cH` H!; cH`!>! $cH> ch>*a$!!>`#0%>  ` &@`&`>#(n<>8@ ` @ 2` !Ѐ, @  `!`@ !@  3P!@ @ l`` ?Gc@ >?H@@>Ѐ&$c\@ >ct@  ``"@8``?&*  '`` &`>8`) Q%``2a&` `2   %a @aĒ2 %>>ѭ,`+>9@;5>)>̮`` "T@ !>4#H`#H:G$#H*`"" "  ` " Hp@  H@" @` "  H@" @` " H/` /Hp@>8`` ?  㿘>5a(` @  @  㿘c  ?   &,㿐c@2>c& >5'>4L>c>5 $L>5a(''0`@"8 0 c@?@ 0@@Z  2l@l @`w u&   V' @VGplt X m 2Q5 @2 2? >KGO 23@C 4& 8$  !@>4 cL&   ٔ   Ӕ   `tLHo&(@gHp@㿘>bܰ? 2`(( @ 2``?(` :` `?(` 㿘 0 `> z>ш `@> 'b@@   "                             փ) >a">a"@>c> c*   ?< 㿘>8`'D    >?? c\>Ъ ct?` D>?? c\>Ъ ctD@@1>55>/>7>9>;>р` Ĕ@`> 7H@`>aܐa@? !( 4`@(`(`! `( 4`?(0Ȃ@(`„@@¤@@4@ >8D&@ 㿘>8`` , 0>` @#@ 8`, ܂@@ ? ? `>  >aa,` b>8`@  ,&04#@&& >8``H` @@>8>b؟@>8 `>b  , 8`,#.@@* $ ?( ( @  @  (`0`°`  (`0`¨`??뀢@ ?Ӄ3`0!>"@! (,`8``x"@ >b؟@ "Ġ@`i㿘>a#>А@@@ c  `" 㿘>8``@"@0 @@7)>8>Ѥ`%+>`6 `6 `? (**(8`**  @(  @` `"cT@ ܂ ` "@@@>̄ ` * &2`(`(`  2``?(` :` `?(``>8``>a`c @ o0(@ " >a` :```88>aP @>8```>>c  >Ġ@㿘>c>8`(` `  >a>b * &`>a`:㽀>8` "Ġ@"  Ĩ@@"c'>a`>c>8`*'? '`''  >b `>c ` ( > cL'> 8&!  0" `D "!   0" ~`D 5> 8 2'  ;>/>Ш-> 8"` ?` ?!  0" R`D 2` c@>8`9 9>;>̦-> 8%+>``2 @`a@`aȤ „'! *0"  `D a`" @ۂ `2 İ@`Ĩ@` > 8a0"㿘 #>@`0``2b0 @>8`` "Р@0 Ш@@㿘 f6` (( @^6``?(`>̤b (`0`@6! @` ` @ ¬@Ȇ@# ">8} ¬@>8`(` 0`°` >` (` 0`¨`>` `?>` `>a`(Ȁ@ @@ >8``4>` >` ``?(` >a``@c (@@&  㿘;.>a>`>`@ (`>т`@.@ .`"@ Ġ@<`` 0>b̟@ 0 Ġ@`"@@>̄` @~@㿘 F>т`>cT>a>8``2 "@0@@)>8$`6``6``? (**(8`**  @(  @` `"Ā@ ݂ ` "@@@㿘 D->8`` "@ @@@ @'>8%># ` `"Ġ@Ĭ@@̟@  >8 `` "@0@@m㿘u\ `5"@;>8(``n` "  b̟@   ` @8``& |` `$` "@` $` @`2`"@.㿈>a` ,@* 08' "D#\#` ?7?㿘  @@/c1>>9c;}/>`6`6` `?` ((((8`>f#X8(( ` `"^* `"W> (`0`2@>`  `>` `?(`@ !@@&<@` `¬@@@ $` $ $ (̂`$ (¦@!@@@0¬@ 2 ư@`>` ƨ@`>` `?>` `>!(€@ @@@0@ >8t @@㿘y` `e  @@ >5>̲a79>8;@I/> 2 (( @2 >fa#x`?(` `(`0`"2`  ¬@̟@ ¬@ 2 ư@`: ƨ@`: `?: ``(„@@" `6 ??@8``Ĥ@2%  @@㿘 L`  @2  㿘 @ L`$ L㿘 L` y @ 㿘s @ L`$ L㿐 ` @@-@8'+>8` 2 (( @ >>#2 b ?(`(`0``>#e`4: : ``?(`@@S$@`2 `?(`?(D`­@>̟@  ­@`2 İ@`: Ĩ@`: `?: `>(@  < `& @@ ``4<` <` ``?(`$` `$ " $ 2 @@@㿘`2&>eO#>8``! "%>@ "2"@؟@ "Ġ@`Ġ@>Č@%>` "@؟@ ¬@ >> ¬@>$@ 㿘>Ѱ?`.  ȀD `>*`>`@`.` x`4`#`4# d㿘 ?#?. @І `*! `2>    @`) *`) @x@  @2 `  "d H"װ 㿘 ?+. %?7#4 ` @І `'*,` `2&>   +  +  `+`) +`@x@``@2   @2@ ` `  d~ x`  !ɀ 㿘!ƀ@>` (Ԁ`(   (ЀD >  >!>a> @ dQ>`Ԁ` @㿘0Ā@`#€@`2 /(`$Ġ@`0Ā@``2 (Ā@`` ?(c @Ā@``(`@>d!H㿘 "Ġ@"` @ $Ġ@`!!2  ?Р@ $Ġ@`㿐B8 ?* *  >b(((@㿘>8``7 "@ Ġ@>+<`)>&'>֑͐4     @   <  ?" ?  0 `|@"̟@ᨰے"@@@ Ĩ@@'c#;+>c')> >c!x      " Ц!b̟@! @@>8``>b 0Ā@`>b`  >cX>a`"@2@>`0 㿘>cp.`.` @@`(`0` >8```(,,(8`@```( 0`°` ( 0`¨` >-#a+ )>c@@2 (@ >` `" !```  ` & ` `, , @@2`>b!> (`0` 0`>т`@` `>c|``>̂b ``@ $`$@>̂b`$`` `㿐>b'P &b   ` . $ .$    @& $ ` $ `P @` &`@ +`@0`$ 4 >b>b ! >>!b>`!`  `  > $ $   @&   (`0`(`(` ߐ" >(`0` ' Ր"@# @@`!`@" Y¬@@  >bБ* *`2 @2`>8` ` ((((8`@>8< ¬@@>8`` ( 0`°` ( 0`¨` >a;#c/ ??->c@@ 2 " > `" %@ `>8`` >  ((`8`@ İ@` `  ((((8`@Ȩ@`>b 0 `  ` $   @@$ ` $ `. @` &`.P @ ) @0`$ 4 4 㿘 0@? 6`.. @>6``?,` 8`> (`0`@ †@@@'? ?@>Ȑ">8 `(`0Ķ@`>Į@`>a>a¦@ @k  㿘!>"` 8`8"`>a`>aa6`c(Ĥ>a`c4<Ĥ@>a>b̟@ ¤¤@㿘 8>a>a`4c <@>a֐ ¤@㿘 @ (`>̄`  `?& (`& @&<& >̒ W:" >>a"hc` ` ``2  >aT`" @">c c  ` o&  2 &$$ `?$ (`$ 㿘 @ `(> c(`  & & & 8&`  2!>aT`2!@">c c&  !2 >>̒ VƐ" 2>`"&"" @ " (`" 㿘 @& @#>̄c``  @& `` ``&@ & & *& `" `  & & >̂c` `>̂c> ` `]"`@2 `@>̆ @c ` @ >XE"  `> aT @  `2>̂c` `&   㿘6` - -  @`@" "  "2"$@, $`2>5 V, @ ""$  x  $- 2  |6``?,$>5 V  @  ̰ $-   `,  x ,2  |A >` `?(`6` `2/  ?2<n 8`& 8 2 42  ` " 4>b̟@ 4 & 4`-  8`& 8  7` V/@`" Ġ@ pĠ@`>` `?(`@x@ 4`& 4W 㿘 6`(`(` B6` ?, >` `?(` `)  <96  2 4P0 "  4 "Ġ@>b̟@ 4& 4 `,   7` /@p  `x@ 4`& 4 㿘>a```?@?4, `"脀 , `x>ѳ.` `@@@褀㿘x`?.(`@`< >a`4@>a >` @ (`.>т`@4@("@ W     `$ " `$ "@㿘 @& @#>̄c``  @& `` ``&@ & & *& `" `  $ $ >̂c` `>̂c> ` ^s"`@2 `@>̆ @c ` @ >V["  ``> aT @ `2>̂c` ` 5$ P 㿐 .. @@ @x'L/  r 7 Ĩ@@>La` 0@` >bА@ 45b`.@ @ (a c̟@c < ` `` @$` Jؐ ¦@ 4& 4a@5+>;/>L@ ΀#,>8`/ `..8`>a>b  Ʃ@`°`¨`(`n2` - 㿈` @`'5 ' D` ҰĈ@@' L9>8 6-- @6`?(`@ ` >̄`,`" (`0`@ `4E> A>  " &@ `-  " y$`   ¨@>̟@ ¨@ 2 Ȱ@`> Ȩ@`> `?> `>(€8```  @ Z `48 8 ``?(`P" >ш 2> >a  " ĩ@¶`®` `>ѓ*` ʓ2` 0- `  ` >> °`@" ¨`@ " `$@*`2` `-  " % `4  4 ,"$ , 0"$ 0 4$ 4>̒Tِ" 2@& L& D& @ ƨ@@㿘 ..  `\>"/  2>"\> (`0`@E>8``4>` >` ``?(`;+>c a2$  " $mq$ 4& 4a@@*- " % `-  "  %`  Ĩ@@>a`&0@` >bА@ [b`@ U  ¨@>8` @`>` @`>` `?>` `>a` =( 6>2! ` c>̟@c,  < ` @$` k ¤>8`4< < ``?(`% 4& 4>@@ Ā->8`/ ..8`@` >b ²@`b ª@` "} % `k-  "p >8%``a ,"& , 0"Y& 0㿘>8`` >` "`  `>#[R   "> >8```"  $ `">; $>4S#h& (& $㿘   `"  " 㿘j>a`.@>т`@?0@@ (`@ 6`*`*` @` `>#0`>>#XZq0r6`` >̆?b (@`(`0` >8``@>` `>` `?(`@L'c@E!∀@`  ¨@@@ @@7>@(>b̟@"¨@>8` Ȱ@`>` Ȩ@`>` `?>` `>a`(Ā@' @@ >'c@¦@ @@>̄` Á㿘ˡ6` , ,  @@>8`` , 0!0@8`@& & 0 &@ & ,`2" "  "!K" $, >" 0`6``?(` >aȒ "(` q 2s ( $, `y, > (`0`2>8``4>` >` ``?(`&`   Ĩ@@Ć@>b`@   ¨@>8` ư@`>` ƨ@`>` `?>` `>a`(@ 6 4`c@ @2" 8`& 8 2 4#1  x`"  42 4>b̟@ 4 & 4 `, 8`& 8 @ $@> (`0`!>8`  Ĩ@@0  ¨@>8` ư@`>` ƨ@`>` `?>` `>a`*@>8``4>` >` ``?(`% 4`& 4 㿘 6`,, @@6`@?,헢@`> (`0`@2@ 6/ `c@ @ 6(  2 4#  2  4  Ĩ@@>b̟@ 4& 4 ``,` @ @`> (`0`@,>В#|  4` `- >a>8`ĩ@`(`0`¶@`(`0`®@`>a>a?@  @ 4`&& 4 㿘(`(`@ >a`46@! @>a`c6@  @  >R @㿘>a`>```3 (` @ >a`4>a`4c @@>т`    @@㿘Ȩ `촰 "@ >c0/>콒 2Wِ#" Ġ@ pĠ@` `2 `" @ < ̟@ p  `<  ?`|2% "@t㿘 L`  @ 㿘 @ L`$ L㿘 L`  @2  㿘 @ L`$ L㿐>#\"     >Qc>8``$$  !> 7>4!<#h#\>Q֚c>5>#\ @cȒ!! Q̘ 㿘 > `< >!> cL >5$> a>b P>>a h>>` >>c >>c@ >>a >>a >>cX >>a, >>c< x>>bd >>b >>a T>>ct ̂ >ф  ` ( $ #>΢` :k!>̒ #L4k.!($@$`@ @ `>>a`)>!ܰ(@>%! ``,  $`!ܠ,> b;>5a$(?@ɐE%! #>̔$# <$b$'>̐$ܒ ((%>А$ $`ab,! %(8`> cX>%$$  c!x@ %"(>`<$ ܂(`(` @* 0``x ! *  `) @ 0``x+   !aلՐ>a>̄ aa `>? a> a&>    &܀& >5&a? >>` > >`!)>8'>%>#>8>81 (`(`  1 `?`(`@@9 `9 `?☇(`! 0` `*cX 00*-  x@ ``+`4!`"4* !>"`>b>cX%ǔ"ɐ㿐 > `< >'L cL'P'H>ƀ>a`>8`c>5( ` a>b`P > aP>̂ 'P> 7 H>c> P>cl> h>a> >c`> >`> >c> >c<> >b> >`> >c> x>b> >a> >b> T>`p> ̂ >ф  >΂`  k!>КaLr) #@  @` 0???~L껒PP (`(`$>Д cpė>aa`>5a> bb `> bb `> c|c| > `! #>$aH*@ >̴(@  &>А c ! ^ >? a> a&$a &܀&&>5a(>8` ? > ' `> `?  >a>т`` >@`> 7H@>@`>Ѕ- cp-  @?@c@@0`>кc|>Ѵ`>̶+c  `? +>? 5`@ H  @H$@``$`` @'`$`$`  @`0&`&`04`$`4`4`(@0`>@(`4&4 `. `@>>aȂa`(@¢@@& >8`>b  ? cȫ@@  ư` ƨ`   H>̆ b>>cp(( @ @@0`` ``  ,#`# ,P쀠>a>8`>b  #> !8#@ت@@   9 ``(   @ư@`@ƨ@`@``怢 a܀  Ĩ@@>aa`>8`0>`(@;>c€@   +c€@  >a;c€@   㿘#>Р # ? $cu>̃*  *  @>&ac`> a!0@  @#!< 㿐>8`(!>6M$!! 8@> >т`'>8``j>`>> a ->+>)>5'>(%>!@``$ @ ` 1 4 7[ @* `61 7J ` c㿘>b` | I㿘I >b` >a4 b 㿘 "  < Š <>`< "(`(` $ $ $ $>8``$$ >4J<#h$$ $($ x@2$ >"$@cx 2" $0㿘>a`>bȤ.@ >8`` "@ Ġ@>ђ `+ 0 ƈ@@ Ĩ@@  `z . `z>8`` >Ą¤.Ĥ>bȐ@ >8`` "@0@@皑㿘%>4\ 8``8!>!>4 cT#>硐`! >4$\ cP癐`>4 cX!>"``ؐ"`>a`А`"4(```>4cT 0Ġ@`>45\(``x>4cP pĠ@`>4cXx@>a!>4>b̟@#T#T pĠ@`>4c\x@>4cPpĠ@`>4cX x㿘!>4#``  8>a>4> cdE $#`!>"`""념">`4@(>4cd 0Ġ@`>4c`x@>a>4cd pĠ@`>4c` x㿘>т`>ф@?`@$@"@/>>̪c9<Y;>6``?6`` `((((8`>R#X8(( ` `":+` `"3@`"`Ġ@$>a`&8@@$$>` ?(@@(`$(@`  b̟@ pĠ@`x@ᨲ@@&@@ >8捐"@㿈` @`  p' D`"{Ā@' Lj`` 6- - ' @6`?-` , @` `"Ġ@>̟@ Ġ@`> ?(' x`4&`4 2@>т`@-@@`-`- @ aĠ@`-`@x@>5J> @$ `- @` "Ġ@``$x@ "ϔ >5%J% @@@>̒J" 8``2`?`& D& L& @"Ġ@㿘 ..  ` `>"/  ` 2>"Q`"  >⌀` >a`&0@`7 А@1 `?(` `'<2 b̟@ґ4   <  ` +` pĠ@` } 4& 4@;>/>@ ΃>` +-``/ .a@ Ġ@``/ @x@!>5I @%@ ` `,` ` "Ġ@` $.x@ " `$@Iv @㿘 .. @@ @S/  `M "Ġ@>a`&0@` >>`5 П@+<2'>b`+@ @ `2#ᨀ "̟@H7   ?  `  pĠ@`x@ 4& 4@+<'>)>>` @`? ѷ(`, !X`㿘!`> 7 aL>b2!`,!`! 㿘!\ P  H/` /@ >b@?c"@!\?c 0 >ah 4 a@ @U@p>`0>``0` $\aX;` > `0`4  `2 `4`8 `@,`(`(`  ,`  (`8`0`@`$`H>P#ؔ @А \*,c@ 2L`(``4''`D@" J 2   П@ <`?L?&`?# 2`&`4$&`0`  @`?c&@&` &``@&`0&`&`&@A㿐> > 0` `>9` +  ``2 `"@@@`  `@    `` _@` > 8@U d€@```2O@#€@n@>a`?`6`` @``@2>aX@#.  >8>>Ԓ#>@`Ԁ`2*aX> cd*` > ch; 2aX$a\`  /  2 @P(@&@@"'aX``  >>Ԓ "@N>O &&  F􀌠@Ɛ㿐>a>`0`` >9` ">a`">``[ @ @. @ @"-$a\ 2 aXV>>Ԑ HNiX>`">8` >'aĀ<>8`Ԁ`29aX> cd*` > ch 2+aX`  SB & @@ @   2 @P#2 @8 ( @ aX``  >>Ԓ hN#>N '`'`@ 'B   @J㿘!X `㿘!X`  $``  @ 8 @?  ?$` 㿐>a`$@! 2 `>8`Ԁ`"`&&> >Mb> a8. > 7bT@7>0` 2$!\>9`$!\!X *"*`!   "'  2 t , 0 *'  $" >  "`  '  > > !? ? > 8```>> MRb ' ,>!"MJ '  > 8` $ $>5a, ` $H`?߂c!!P!TNn$!T`"ِ*K Ր% "`'   Ė !`  >˒ * Đ!> 7aL\!$!`>`T`2 '| `k#>b@`a`>L$b` L@@&@  k ``>``"`H M` } @ "` U `>`!r$`Ɛ  `H` e @ "`X = `X``[ @ "` 3 `>`А!?O$` >Ő! !`&!`@' > L!@'  0  '&`&` @`&`!&`L!``>!pL`'&`&`   >L!`'&`&`   3㿘!`  #>b8$b * J㿘%>0`!XaXH$`" !` "&a` * * ѐ!&a`!`۔!%% P@&a\_ d"  &  & 0&  `& 4& P$ @& H 8 $ $$ >'aP$ 㿘 02 H>L!@>a`>Ѡ@8 @$ 䣔> ch  L>& L& H` < 8ȟ @ 㿐 , H` >@& L`> ch@8 $@@ʒ>& H->̤`1>!>̐@ 2">Lk!P`!`'! @ ᨲ&@@`؁㿘`> Kp" 㿘 4#>¥`H # & @  1>K]!p @W& < 4`H  `4 `   @! `4 @@ `  @ & @  < `8 P`>Ґch>K#!H>a>a  >K!  M0 &`D  G< &`H  AH &`L  ;T &`P  5` &`T  /l &`X  )x &`\  # &``   &`d   &`h   &`l    &`p  ?&`t>~a`D&`0&`4* @` `0`D(@`8 d ;A>J#!Ha4  '>aȀ 2' ''>\+ 㿘> !Ȁ @ 'D'H'L'P'T'X @ @  * *@   *@ @ 2@@  2@ : :  : @ *@      @   @㿘   ```@ `" `  * *@   *@ @ 2@@  2@ 2   2 @ *@  㿐   ``@``?㿘?c@#6 6` .$ $ @$@$` `2 * 4 @,   @``@- 5 @@㿘  ` ` 2 "  $ & @ @& @@@ ` `88   @   ((`00`( 0@  @0 ) (`0`(@ 2X'T > 8a(@/ T ? T 6 4 T ` 8@4 4`6777777777ꀠ` 'E.`  '<6.0`@, * 0`@* @T,* 0`` @|T 8@@ג* @Ӑ* 4 @͐* @ȡ4 *  'ȠȂ  @Ԭ(``'Ԃ  @(ڂ@0@((`0`ڂ@''c('̀̀ Ȕ >̐9`ȅ(0(`'0`('Т@' ' (`(0``05@0, @h@?c , ,`0`8 `*`2`, @4 ?$$4 4` @(`0` @50``"Ȇ  `(`(0`0?@@00` @5ĺ`5 Ш `@'T+̀Ȃ  @*`((`00`0 (@@0@*`5(`0`((`0`(T8@܃(`0`(((`0`"@ @b   @   @>cH 㿐} @@@ @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @@ @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  levelchannelphytargetlunslotoffsetconsolemuxvectdriveloopbpfiltervlanOpenBSD5.8RAMDISK#23 @(#)OpenBSD 5.8 (RAMDISK) #23: Sun Aug 9 00:08:29 GMT 2015 OpenBSD 5.8 (RAMDISK) #23: Sun Aug 9 00:08:29 GMT 2015 miod@tekumel.gentiane.org:/usr/src/sys/arch/sparc/compile/RAMDISK %s: resetting SCSI bus %s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus %s: unknown revision code, assuming ESP100 ncr53c9x_rdfifo: bad flag%s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d got %ld extra bytes %s: tagged queuing rejected: target %d %s: sync transfer rejected: target %d %s: wide transfer rejected: target %d %s: wide mode %d unrecognized MESSAGE EXTENDED; sending REJECT unrecognized MESSAGE; sending REJECT %s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET ncr53c9x_sched: not IDLE (state=%d) %s: QFULL -- throttling to %d commands ncr53c9x_ecbDMA activetimed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled %s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error %s: unexpected disconnect; resetting sending REQUEST SENSE %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>%s: target didn't send tag: %d bytes in fifo [%d] %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] %s: identify failed, state %d, intr %02x ncr53c9x: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: ICCS: : [intr %x, stat %x, step %x] %s: can't get status, only %d bytes %s: STATUS_PHASE: msg %d %s: invalid state: %d ncr53c9x no nexus%s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] %s: unexpected bus phase; resetting out of memory %s: unknown variant %d, devices not attached : %s, %dMHz espESP100ESP100AESP200NCR53C94NCR53C96ESP406FAS408FAS216AM53C974FAS366/HMEmissing buffer, no_td = %d, last_td = %d %s: transmit buffer error %s: underflow %s: lost carrier %s: overflow %s: receive buffer error %s: dropping chained buffer %s: memory error %s: receiver disabled %s: transmitter disabled %s: controller failed to initialize %s: device timeout : address %s %s: %d receive buffers, %d transmit buffers %s: mii_write timeout %s: mii_read timeout %s: status=%b INTMETXEMPTYTXDONERXDONERXNOBUFRX_TAG_ERRPCSTXMACRXMACMACCONTROLMIFBERRgem: invalid Receive Descriptor ring size %d %s: cannot disable tx dma %s: cannot reset transmitter %s: cannot disable rx dma %s: cannot reset receiver %s: cannot reset device %s: can't load rx DMA map %d, error = %d gem_add_rxbuf %s: unable to allocate control data, error = %d %s: unable to map control data, error = %d %s: unable to create control data DMA map, error = %d %s: unable to load control data DMA map, error = %d %s: unable to create rx DMA map %d, error = %d %s: unable to create tx DMA map %d, error = %d , address %s gemRAM diskfictitiousrdattach: out of memoryrd%drdattach: device name too longhfsc_enqueue called on hfsc-less kernelhfsc_purge called on hfsc-less kernel%s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP %s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, no REQ %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d ncr5380_done: sense asked for sense %s: target %d, bad status=%d ncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: too much data padding ncr5380_status: none? %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... %s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... %s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_cmd_timeout: no scsi_xfer %s: cmd timeout, targ=%d, lun=%d DATA_OUTDATA_INCOMMANDSTATUSUNSPEC1UNSPEC2MSG_OUTMSG_INexpand 32-byte kexpand 16-byte k;n vAMaX ֣d° x..RRIP without PX field? SPIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect NM flags? RRIP with incorrect flags?isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] cd9660_vget: alien ino_t %lluCD001%/@%/C%/Ecd9660_mountroot: can't setup bdevvp'scd9660root_deviceTXXltag VT_ISOFS, isofs vnode cd9660_strategy: specOpenBSD#!/dev/fd/%d/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedzerothreadfork zerothreadscheduler/sbin/init/sbin/oinit/sbin/init.bakCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2015 OpenBSD. All rights reserved. http://www.OpenBSD.org bqquiesbqqueuebqwaitbqdestbufq_init: type %i unknownbufq init failbqinit` ,tL0$initclocks: unable to register softclock intrfdlockdup2: fdallocfileplfdescplkqreadkqueueplknotepl 4waitinit died (signal %d, exit %d)thrdeathcpu_exit returnedprocprocessppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d %d,malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_mapmallocarray: overflow %zu * %zu $$physiochgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplplimitpl%s/../ioctl %lx tame: pid %d %s sysctl %d: %d %d %d %d %d %d tame: pid %d %s syscall %d f_type %d v_type %d bad fd type /tmp//etc/localtime/etc/spwd.db/etc/pwd.db/etc/group/etc/resolv.conf/etc/hosts/etc/services/var/run/ypbind.lock/var/yp/binding//usr/share/zoneinfo//usr/share/nls//libc.cat/etc/malloc.conf @pp0px0r 00000 0 0000 00 cpu_switchto returnedfork idleidle%dsensorssensorsuspendpauseissignal sigwaitsigaplhashinit: bad cnt%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx%s:%s,sysctllksysctldlkthrsleep%s%s(%d)Time stepped from %lld.%09ld to %lld.%09ld Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u dummynanosleepdenied attempt to set clock forward to %lld denied attempt to set clock back %lld seconds boredunexpected %s tq state %dunable to create thread for "%s" taskq unexpected %s tq state %utqdestroysystqsystqmp4M4Msetrunnablepreempt: cpu_preempt not yet implementedfailing resume cannot be handled resume %s autoconfconfig_detach: forced detach of %s failed (%d)%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe %s at root%s at %sroot device %s not configured config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structure not configured unsupported /dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read: (default %s%cexitswap deviceb (default %s%s)root device (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx) not found%s%d%croot device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx.%c) swap on %s%d%c dump on %s%d%cdisk_unbusy: %s: dk_busy < 0 disk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)extnt%s: start 0x%lx, end 0x%lx %s: region not foundextentplextent_freeklog%s: %s: page empty%s: %s free list modified: page %p; item addr %p; offset 0x%x=0x%lx != 0x%lx%s: %s: page header missing%s: %s: incorrect page%s: %s free list modified: page %p; item addr %p; offset 0x%x=0x%lxphpool%s: too much uptimepoolspool_p_freepr_find_pageheadpool_do_getpool_initdma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d*FOUND**UNKNOWN*0%o%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at root ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- Error unknown state already enabled %3d can't enable free slot %3d %s%3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot count%3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addbasechangedisableenableqfindhelplistquitshowtimezoneverbose?pollselectpipeplpipelkpipeclpiperdpipewr@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %lld.%02ldu %lld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d m_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLmbuf prepend length too bigmbufplmtagplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersrequested tag size for pool %#x is too bigm == NULL in m_pulldown()unixsoaccept: !NOFDREFnetclssoclose: NOFDREFsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsemi-panic: sbcompressnetlcknetiosbappendaddrnetcon2netconacceptunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqinconsistent bufpage countsbiowaitbufplbiodone alreadyneedbuffernobuffersbuf_get: dup lblk vp %p bp %pgetblkbuf_needvabufinit: can't reserve VM for buffersnchplwtf? leak?vop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dotbrelvp: NULLbgetvp: not freevflushbuf: not dirtyvflushbufvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvgetvnodevfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done vnodesuvmvnodessyncer vnode syncermount: lost mountunmount: dangling vnodeNon dma reachable buffer passed to VOP_STRATEGYvn_lockspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_read typespec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode bpfattachbpf_mcopybpf: ifpromisc failedbpf_detachd: descriptor not in listbpfbpfszunhandled af %difa_update_broadaddr does not support dynamic lengthegresstoo many interfacessoftnetunable to create softnet taskq%s: can't handle af%d  ;n C&vkkMGP&"/+Ka5 d1͆< 8O     d;n &0vAkkQMaXPq< D֣ad°Ԡ x0123456789abcdeflooutput: no header mbuflo%dunable to create lo0loifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedcan't establish softnet handlersvlanvlanattach: hashinitrtmaskrn_init: radix functions require max_keylen be set rn_initrn_init 2rn_delete: inconsistent normal annotation rn_delete: inconsistent mklist refcount rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation rn_delete: couldn't find our annotation Mask for route not entered Non-unique normal route, mask not entered rn_addmask: mask impossibly already in tree %s %p at %p rn_delete: Orphaned Maskraw_usrreqactive node flags=%xrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 ifafreertfree 2rtfree: %p not freed (neg refs) rt_timer_init: already initializedrttmrrtrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 %s: wrong ifa (%p) was (%p) rtentryroute_init rtable_addrt_ifa_addroute_outputrouterevarparptfreearp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arpresolve: %s: route contains no arp information arpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo %s: %s: incorrect arp information arp%s: bad gateway value: %s %s: malloc failed arpresolvearp_rtrequest%s: no mbuf igmp_initinvalid argument to in_lifaddr_ioctlin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportIPv6 pcb passed into in_pcbconnectinpcbplinternet%u.%u.%u.%uicmp_do_exthdr: m_getptr failureicmp_redirect_timeout: bad route to timeouticmp_mtudisc_timeout: bad route to timeouticmp_erroricmp len}E#(DoKgpqrstuvwxyzipqeipqip_initaeshmac-sha1deflaterip_attachrip_detachrip_usrreqsyncachetcp_pulloutofbandm_pulldown malfunctiontcp_output REXMTtcp_outputtcpcbtcpqetcp_init4tcp_usrrequdp_usrreqipip_input: should never reach here˻]b)*6|YZ0p/Y9g3&g 1JhX . dGHOB/("q7D#e͵M;/ۥۼ9V[H8Y?O^mB[Epo$1N䲌U }r]t{oޱ;%5ti&iJG8O%Ƌյ$ we-,oY+uJtn\ܽAvڃS>QRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGXj ggʧ;l٫Ak[~!yB/q7Dۥ9V[Y?^[$1U }r]tޱtiG$ -,oJt\vژ>QR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqxj gg[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*Fbind failed krpc_call: sosend: %d RPC timeout for server %s (0x%x) prog %u rpc denied, error=%d rpc denied, status=%d Process killed due to text file modification nfs_doio: type %x unexpectednfs_bufqnfsvinvalnfsbioreadnfsbioread: type %x unexpectednfs_boot: bootparam_getfile: bad reply nfs_boot: bootparam get %s: %d nfs_boot: mountd %s, error=%d nfs_boot: portmap NFS, error=%d nfs_boot: no suitable interfacenfs_boot: using interface %s, with revarp & bootparams nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%dreverse arp not answered by rarpd(8) or dhcpd(8)nfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: address not configured on %snfs_boot: bootparam_whoami: bad reply nfs_boot: bootparam whoami, error=%dnfs_boot: server_addr=%s hostname=%s nfs_commitlknfshshlknfskqpollnfskqdetnfskqpwnfskqlk0nfs server %s: %s nfs_realign_fixup: no memory to pad tonfs rcvunlocknfs sndunlocknfsrcvlknfsndlcknot respondingnfsconnfscon sotypenfsreconshort receive (%zu/%zu) from nfs server %s %s (%u) from nfs server %s impossible packet lengthshort receive (%zu/%u) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfsretrybuild > MLENnfs S too bignfsnodeplnfsreqpl4b,4b04b<4bV4bj4bv4b4b4b4b4b4c4c$4c:4cX4c4c4c4c4c4c4c ?BEFnfsionfsidlnfs_args: retrying connect nfsnfs_mount_diskless: vfs_rootmountalloc failednfs_mountroot: mount %s failed: %drootnfs_mountroot: root/root on %s nfs_mountroot: getattr for rootnfs_mountroot: can't setup swap vpswap on device 0x%x swap/swapnfs_mountroot: getattr for swap swap on %s WARNING: no swap dtag VT_NFS, fileid %lld fsid 0x%lxnfs physio/asyncbwrite: buffer is not busy???nfsfsyncnfs_fsync: not dirtynfs_fsync.nfs%08X%08XEEK! readdirrpc resid > 0 EEK! readdirplusrpc resid > 0 start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapffs_clusteralloc: lost blockmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free dev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimfile system full %s: write failed, file system is full ffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: newspaceffs_update: bad link cntsoftdep_flushfiles called?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@ffsinodino1plffs_vget: alien ino_t %lluinodeupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffs D 0 d 8  X ׬ ؄ !0 ffs_fsync: not dirtyffs_fsyncffs_write: nonsync dir writeffs_write: typecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_strategy: specufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotauvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lxuaddruaddrhintuaddrbestuaddrpivotuaddrrnduaddr_rnduaddr_hintuaddr_kbootstrap P N N O| T Od N Namap_unadd: offset out of rangeamap_unadd: nothing thereamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_wipeout: corrupt amapamapplanonpl%s: can't allocate entryuao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_getpageuao_getuao_detuaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_find_swhash_eltudv_faultudv_detachudv_attachuvm_fault_unwire_locked: address not in mapanonget1anonget2flt_noram1fltamapcopyflt_noram2flt_noram3flt_pmfail1fltagain2flt_noram4flt_noram5flt_pmfail2uvm_init: page size not setkm_free: unmanaged page 0x%lx getpagekm_allocvauvm_km_pgremove_intrsafe: no pagekmallockmthreadvallocwaitkm_alloc1wkm_pgrmuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kernel4gh4H4gl4444gl:`uvm_map_clean: weird flagsuvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)vmspplvmmpeplvmmpekpluvm_map_splitentry: split address 0x%lx not on page boundary!uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries vmmaplkuvm_map_setup: rw_enter failed on new mapuvm_map_protect: kernel map W^X violation requesteduvmspace_fork: no space in map for entry in empty mapuvm_map_teardown: rw_enter failed on free mapuvm_map: kernel map W^X violation requestedfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)vmmapbsy\uvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of twouvm_pglistallocuvm_pglistalloc: Upper boundary 0x%lx not on pagemask. size 0 uvm_pagereallocuvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in initpagersegpgdaemonuvm_wait emergency bufbackoff pagedaemon: deadlock detected! pgzeropagedaemon: wait_pla deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx Flags: 0x%x, will panic now. uvm_pmr_split: lost one pmr warning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel reserve/dev/%s%d%cblkdev0x%xuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplksbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_getpageuvn_getuvn_cluster: offset out of rangeuvn_flshuvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressin6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_unlink_ifa: interface address %s has no prefix in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) prefix ioctls are now invalidated. please use ifconfig. cannot add prefix invalid argument to in6_lifaddr_ioctlin6_ifawithscope: output interface is not specified %s: got interface identifier from itself %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_redirect_timeout: bad route to timeouticmp6_mtudisc_timeout: bad route to timeout(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on inteface %u cannot forward src %s, dst %s, nxt %d, rcvif %u, outif %u assumption failed: hdr not splitscope error in prefix list (%s) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspecnd6_lookup: failed to lookup %s (if = %s) nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_init called more than once(ignored) ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_storelladdr: something odd happens %s: %s: incorrect nd6 information ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s %s: failed to join %s (errno=%d) nd6_storelladdrnd6_rtrequest%s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_ns_inputnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_dad_timer: called with null parameter ???nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_timer: DAD structure not found nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p nd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) rip6_attachrip6_detachrip6_usrreq _bus_dmamem_mmap: not implemented_bus_dmamap_load_uio: not implementediommu_dmamem_map: nsegs = %diommu_dmamem_map: size botchwarning: %ld of DVMA space lost iommu_dmamap_load_raw: size botchcache-coherence?page-sizeiommu_attach: can't allocate memory for pagetablesbad iommu range: %d: version 0x%x/0x%x, page-size %d, range %dMB iommunamevmebus: no rangesvmeintr_establish: interrupt vector not allocatedvmeintr_establish: uninitialized vecvme_addirqvme: spurious interruptvme: spurious interrupt addr %p vec 0x%xvmesvmelobiorangesvme: PROM ranges too large: %d: version 0x%x vmevmelattach: can't allocate intrhandvmesattach: can't allocate intrhandobio: PROM ranges too large: %dcould not find %s amongst obio devices zseepromcounterinterruptI(I0JI8auxiliary-ioauxioauxio2TadpoleauxregWARNING: preposterous time in file system WARNING: bad date in battery clock -- CHECK AND RESET THE DATE! oldclk statintroclock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz statclock; using 100 Hz delay calibration: delay constant %d, frequency %llu Hz clockprof [TOO SMALL?]: delay constant %d%s oclock: calibration failing; clamped at %d counter-timermk48t02model: %s (eeprom) mk48t08oclockpowerversion 0x%xpsr-implementationpsr-versionimplementationversionclock-frequencymmu-npmgmmu-nctx[viking: turn on PCR_TC][viking: PCR_TC is off]%s: physical %s%dK instruction (%d b/l), %s%dK data (%d b/l)physical %dK combined cache (%d bytes/line)throughback%dK byte write-%s, %d bytes/line, %cw flush%s%dK external (%d b/l)vac-sizevac_hwflushvac-hwflushvac-linesizebad cache line size %dbuserr-typeUnknown CPU type: cpu: impl %d, vers %d; mmu: impl %d, vers %dcache chip bug - trap page uncachedmidsun4csun4esun4m%s @ %s MHz, %s FPU: %s%s, %s; %scache-physical?ncachesicache-nlinesdcache-nlinesicache-line-sizebad icache line size %dicache-associativitydcache-line-sizebad dcache line size %ddcache-associativitycache-nlinescache-line-sizecache-associativityecache-nlinesecache-line-sizebad ecache line size %decache-associativitywarning: couldn't identify cache sun4cpuMB86900/1A or L64801L64811CY7C601W8601/8701 or MB86903MB86904MB86907CY7C601/604CY7C601/605 (v.b)CY7C601/605 (v.c)CY7C601/605 (v.f)CY7C611RT620/625TMS390Z50 v0 or TMS390Z55TMS390Z50 v1TMS390S10TI_MS2TI_4_3TI_4_4UnknownMB86910 or WTL1164/5MB86911 or WTL1164/5L64802 or ACT8847WTL3170/2on-chipL64804L64812 or ACT8847L64814TMS390C602ART602 or WTL3171B5010 or B5110/20 or B5210d`| $ DDdmemory error:sfsr=%b sfva=0x%xCSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWafsr=%b afva=0x%xSYSERR UNCORR TIMEOUT BUSERRAFOhard memory errorstore buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. HyperSPARC async cache memory failure at phys 0x%x%x %ssync mem err: ser=%b sva=0x%x WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGaer=%b ava=0x%x WBINVALTIMEOUTDVMAERRparity error register = %b ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3memory errormemregattachmemory-errormemregmemory error: EFSR: %08x MBus transaction: %08x address: 0x%x%x : version 0x%x/0x%x eccmemctl4 t%s: channel %dstopping on keyboard abort zsattach: expected 1 interrupt, got %d pri %d, softpri %d serialkeyboardmouseport-a-ignore-cdport-b-ignore-cdbroken zs interrupt schemepwr-on-auxio2slavefloppy diskfdc%s: %s: state %d (st0 %b cyl %d) invldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) end_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_amctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam drive %dfdcresult: overrun fdcresult: timeout %s: read-only medium %s: no medium? fdhard errorcontroller statustimeoutsoft errorstray interruptfdc: ierror status: state %d fdc: spurious interrupt: state %d %s: timeout but no I/O pending: statu %d, istatus=%d : %s %d cyl, %d head, %d sec : density unknown pri %d, softpri %d: unable to register fast trap handler %s: no drives attached CFGLOCK: unexpected responsechip 8207%c SUNW,fdtwo1.44MB720KB360KB/x1.2MB/NEC%s: dma card found in non-dma sbus slot %d: not supported %s: relative sbus addressing not supported "%s" at %sdevice_type class %s slot %d offset 0x%x: %s MHz burst-sizessbus: PROM ranges too large: %dsbusvmslave-onlyZ%s: reset: invalid keyboard type 0x%02x  '&     1!2@ 3#!4$"5%#6^$7&%8*&9('0)(-_)=+*`~+,-=.//*12.345 6q7w8e9r:t;y<u=i>o?p@[{A]}BC D7E8F9G-HIJLM aNsOdPfQgRhSjTkUlV;:W'"X\|Y Z [4\5]6^0_`ab cdzexfcgvhbinjmk,m/?no p1q2r3vwxy z{}+ ]}&12 "3!'4"(5#6$7%!8&9\'0()~)-_#**|6a7z@A`$@M qVmMW%X[{dwj,?k;.l:/m=+w |<> &12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@()])=+}*6a7z@A$M qVmW%X*dwj,?k;.l:/m!|<> ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?)|*'*`@AC LVWXk,;l.:m-_w|<>\ 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}(+?)|**`@AVWX\*`k,;l.:m-_|<>\ ]} 2" 3#6&$7/%8(`&9)''0=|(?\)*#^@;z@A+*~LVWX[{dyjmMk,;l.:m-_w|<> 2" 3#6&$7/{%8([&9)]'0=}(?\)*^6qQ@;z@A+*~VWX#'`dyjmMk,;l.:m-_|<>| ]}2" 3#6&$7/%8(&9)\'0=|('?`)^*@A+*~LV@W#X[{k,;l.:m-_w|<> 2" 3#6&$7/%8({&9)}'0=('?`)^*\|@[A+*]V@W#X~k,;l.:m-_|<> \|1!2" 3#!4$"5%#6&$7_%8({&9)}'0'`(/?) *<>@A*~NsSV+WX@dzZexXfcCjmMk,;l.:m-=w }][ 1!2" 3#!4$"5%#6&$7_%8({&9)}'0'`(/?\) *@@A*|~NsSV+WX<>^dzZexXfcCjmMk,;l.:m-=}][ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?)\*'*`@ALVWX|k,;l.:m-_w}<> 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}(+?)\*|@AVWX'*`k,;l.:m-_}<> ]}2"@ 3#!4$#6&$7/%8(&9)\'0=|('?`)*^@*+A~LVWX[{k,;l.:m-_w}<> 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}('?`)*\|@+*AVWXk,;l.:m-_}<> ]}2"@ 3#"5%#6&$7/%8(&9)\'0=|('?`)*>oO@^A+*~LMaAVWX[{k,;l.:m-_w}<> 1!|2"@ 3#!4$^"5%~#6&$7/%8(&9)'0=('?`)*\@[A+*]VW{X}k,;l.:m-_}<> ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*'*`@AC LVWXk,;l.:m-_w|<>|)'`A^~ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*@AC LVWX'*`k,;l.:m-_w|<>| >}1+!2"@ 3*#!4"5%~#6&$7/|%8(&9)\'0=^('?`)*$;z@AC LVWX<{dyjmMk,;l.:m-_w|][\ 1+|2"@ 3*#!4^"5%~#6&$7/%8(&9)'0=`('?)*$;z@[A!]VW{X$}dyk,;l.:m-_|<>\ >}1+!2"@ 3*#!4"5%~#6&$7/|%8(&9)\'0=^('?`)*$;z@AC LVWX<{dyjmMk,;l.:m-_w|][\ 1+|2"@ 3*#!4^"5%~#6&$7/%8(&9)'0=`('?)*$;z@[A!]VW{X$}dyk,;l.:m-_|<>\1!|!3#(-_C 2" 3*`W'@X#~|\|2"#6&$7'%8(&9)'0(-=)^~*|@@`A[{V;+W:*X]}|\_Z `]T_O^ Vf0`]Majb( LcPdbhbj2 Ogz  hkZN`lL_, OfZ]Ca,kib JdfKeUiUj Oh&  hk       %s: %d silo overflow%s, %d ibuf flood%s flags 0x%x input output: console%s%s: device enable failed zstty Xx: failed to set baudrate : failed to set modes : no keyboard , flags 0x%xkeyboard-click?true: keyboard, type 5, layout 0x%x: keyboard, type %d, layout 0x%xzskbdOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmedia: MASTER on wrong media!A  !@@@@: %s, rev. %d nsphyDP83840 10/100 PHYK|I Krh: Generic ten-bit interface, rev. %d gentbiONDAdqsphyQS6612 10/100 PHYSQSd`QrluphyLU6612 10/100 PHYUFhAd` s(: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphyWFhAdDiagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): DEFERRED %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Setoff INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %usyncxspendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredParameters ChangedMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated Devicewpwwwwwwwwxxx(x8xHxXxpxxxxxy y8yPyxyyy|z z8zXzxzzzz{{0{H{`{{{|0|`||| }( }X } } ~~P~~~Hx8x@h      0 H P     8 h      H p      @ `     0 X  (@h(@Xx 0 @ X  0Pp Hh0Pp0X8h 0`0X0Pp 8 X x    ( 8 h     8!h!!!"$($@$($($X$x$$$%&& &8&P&x&&&&& (& X& x& & && &P&x&'w''''0'P'h'((((0)`))))))0)P*h********P* h* * * * **0*h**+,H,`,,,,,,8,P, p, , , -.(/H/p/0000@0`00000 00 X0x0001112H2p345555 5H6p788889(:H:`:::;; ;P;x;;;;;; (; @; `; ; ;;;; ;8;X;p;;;;;; =@>h>>>>??H?`??????(? H? X? x? ? ?????0?H?h@ABCDDq E@F`GxGGGGG@G`GHIJKK(KXKpKKKKLNP P8PXQQRSSSS0ShSSSSTU0UHU`UUUUUU U XU U WXYZ(ZPZxZ[[[[\\0\H]h]]]]0]h]]]]H]]]]]P]]] ]!0]"h]#]$]%]&H]'](])]*(]+`],]0]1]2X]3]4]5]68]7x]8]9]: ];X]<]@]A]B@]Cx]D]E]F]GP]H]I]J]K]L@]Px]Q]R]S ]TX]U]V]W]X(]YX]ZÐ][]\]`(]a`]bĘ]c]d]e@]fx]gŰ]h]i]jH]kƀ]lư]^ ^8^`^Lj^ǰ^^^(^P^ x^ Ƞ^A^B^C^E0^GP`xaɈaɠaɸbccd@d`exfʈfʰffg8gPgˀg˘gggg(gHg `g ̀g ̨hiii(j@k`k̀k͠lmno o`oΘooo@qxrϨrrrrHrxrРrssѐsss(sPspsшsѸsttttHthtҘtҰttt (t Pt xt Әt ttt0t!Ht0pt@Ԙta԰tbtctd@tnptoՠtqtyXS_SHORTSENSE scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial. wwn._~ offlineunknown: %d targets, initiator %d, WWPN %016llx, WWNN %016llxscsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14JJ08HJP`JhpJPxJPJJJJJJJhJ(@HXpHxHJJJJJ J(0JHPJ `J pJJJJ JJJJJJJJJJJJJJATAPI CD-ROMSCSI CD-ROMcdNEC CD-ROM DRIVE:260SCSI opticalSCSI disk%s %s(unknown)%s: %lluMB, %lu bytes/sector, %llu sectors, thin, readonlysdJJJJJJJJJJJJJJJJJJ%s: error: csr=%lb INTERRDR1DR2IENSLVERRRST WRITE ENDMAENCNTTCDSBL_CSR_DRNDSBL_SCSI_DRNTWOCYCLEFASTERTCIDISENNXTDMAONALOADEDNALOADED%s: line %d: CSR = 0x%lx ../../../../arch/sparc/dev/dma.cR_PENDdmaintr: DMA wasn't activeDRAININGdma: cannot allocate DVMA addressledmacable-selectiontpeaui: rev esc1+fasunknown (0x%x)espdmadma: %dK memory lebuffer%s: reset failed. : PROM ranges too large: %d reg: unexpected "reg" property layout #channels: no channels : invalid number of channels: %d : %dK memory %d channel%sqec%s: invalid tcvr type %s: bmcr reset failed %s: bmcr unisolate failed %s: rev %d PAL not supported. %s: no internal or external transceiver found. %s: invalid packet size %d; dropping unexpected%s:%s stat=%b RXRCNTACNTCCNTLCNTRFIFOCVCNT TX TFIFO TMAXPKT NCNT ECNTLCCNTECNTDTIME%s: resetting %s:%s qstat=%b RXSRXPRXLRXSMALLRXDROPRXTXSTXPTXLTXDTX BEboard-versionchannel# pri %d: rev %x address %s be%s: excessive tx defers. %s: excessive tx retries %s: late tx transmission %s: tx fifo underflow %s: jabber seen %s: babble seen %s: tx descriptor is bad %s: tx late error %s: tx dma parity error %s: tx dma sbus error ack %s: rx fifo overflow %s: rx late collision %s: rx packet dropped %s: rx buffer too small %s: rx late error %s: rx dma parity error %s: rx dma sbus error ack %s: unexpected interrupt error: %08x %s: resetting... : no interrupt found on parent mace-versionqe: no interrupt : only %d register sets : can't map registers local-mac-addressnetwork%s: link status changed %s: reset rx failed %s: reset tx failed %s: stop failed %s: burst size unknown %s: setting rxreg->cfg failed. %s: stat=%b, resetting. RXRCNTACNTCCNTLCNTRFIFOCVCNTSTST TX TFIFO MAXPKT NCNT ECNTLCCNTFCNTDTIMERXHOSTNORXDRXEEXLATERXPRXTEOPMIFTXHOSTTXALLTXETXLTXPTXTSLV SLVP: expected 5 registers, got %d hm-rev pri %d: address %s rev %d qfeSUNW,hmeSUNW,qfe%s: mii_read failed %s: mii_write failed hme pri %dinitiator-idSUNW,fas: expected 2 register spaces, found %d : could not allocate dma softc : can't map DMA registers : can't map SCSI core registers espattach: no dma foundptscII' char-height >body >user %lx ! ' char-width >body >user %lx !stdout @ is my-self addr char-height %lx ! addr char-width %lx !stdout @ is my-self addr window-top %lx ! addr window-left %lx !screen-#rowsscreen-#columnsstddepthwidthheightlinebyteswswaitwswait2wsdisplay at %s%s: screen %d-%d added (%s, %s emulation) wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsrestorewsdisplaytty() on ctl device%s: screen %d deleted : console (%s, %s emulation), using %swsdisplaywsevent_read%s: connecting to %s %s: disconnecting from %s wskbd at %s%s: event queue overflow wskdetwskbd_detach: %s didn't detach cannot load keymap: console keyboardwskbdABCDEFGHIJKLMNOPQRSTUVWXYZwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry㡱sunD  (08@HPX`hpxwsemul_sun_output_lowchars: ESC in kernel output ignored rasops_init: fontwidth assumptions botched!rasops_init: font table is empty rasops_init: couldn't lock font 888????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? wsfont_unlock: font not locked: model %si128_fb_physaddri128_fb_sizep9100_reg_physaddrffb_depthffb_widthffb_height, %dx%d, depth %d PFU,agaagtenp4%s, %dx%d bwtwo: p4, %dx%dcgeight: p4cgfour pri %d: expected %x bytes of control registers, got %x expected %d registers, got %d expected 1 interrupt, got %d %dMB, rev %d.%dcgfourteen%dx%d, rev %d SUNW,cgsixcgsixcgRDIcgthreedev_id (%s)%s: %dx%ducoderev, microcode rev. %scgtwelve: %dx%d cgtwoSMSI,mgxmgx %s: expected %d registers, got %d fb_size %s: expected at least %d bytes of vram, but card only provides %d %s: unexpected engine id %04x : bt445 did not attach previously : rev %x, %dx%d p9000pninek: id 0x%x, revision 0x%x bt445btchamstdout @ is my-self addr char-height %lx ! addr char-width %lx ! addr font-base %lx ! addr fontbytes %lx !p9100_romfontp9100pnozz %s: no SBus registers! configuration, unknown %d bytes conf. structure, revision %dRasterFLEXRasterFLEX-TVrfxstip-ropblit-widthstipple-aligntcx-8-bit%dx%dx%d SUNW,tcxtcx trdpPrevision, revision %sfreqcodehresvresPGI,tvtwoPGI,tvthreetvtwovs10vs11vs12 %s: expected %d registers, got %dVIGRA,vs11vigra%s: zx_cross_wait: timed out SUNW,leozxbusmaster-regvalif_le: Lance buffer crosses 16MB boundary%s: lost carrier on UTP port, switching to AUI port %s: lost carrier on AUI port, switching to UTP port ie: bogus buffer calc%s: multicast address setup command failed %s: TDR command failed %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status 0x%x %s: configure command failed %s: individual address setup command failed %s: reset %s: abort commands timed out %s: disable commands timed out %s: tbuf overflow ietint: command still busy! %s: receive descriptors out of sync at %d %s: parity error (ctrl 0x%x @ 0x%02x%04x) %s: receiver not ready ie_mapie kmem_allocunaligned dvmamalloc breaksie pmap_extractunknown : RAM CONFIG FAILED! pri %d address %s, type %s iemultibus/vmeonboard3e/vmeACFAIL assertedUnknown errorSoftware fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatal VMEDMA errorVMEbus errorDrive faultedHeader error/cylinderHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test number%c: write%s %d/%d/%d: [still trying, new error=%s] [recovered in %d tries]%s%c: crash dump not supported (yet) %s: off-line: %s xdc_resetxdc_startbuf freexdc_startbuf bp%s: warning: out of DVMA space xdiorqxdc_submit_iorq addingxdc_submit_iorq wrap upxdc_start%s: soft reset RESET DONE %s: watchdog timeout %s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEADxdnfreexdsubwaitxdcmd nfreexdattach drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: no label, unknown geometry %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! xdxdc malloc: couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=0x%x.%02x.%02x %s: controller config error: %s xdcDOUBLE ERRORInterrupt pendingBusy conflictHard ECC errorIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulSector count zeroSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headxyc_resetxyc_startbuf null buf%s: DOUBLE ERROR! xyc_remove_iorq: controller DEADxyiorqxyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed!xyc_submit_iorq wrap upxyc_cmd%s: stole control iopb xyattach drive %d: ready %s: reading disk label failed: %s (drive type %d) %s: <%s>, pcyl %d %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s xy%s: can't alloc IOPB mem in 64K xyc malloc: doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled]%s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver xycsi_dma_start: bad pa=0x%lx%s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d %s: DMA timeout (while polling) sw: DMA error, csr=0x%x, reset sw: short transfer si_dma_stop: excess transfersi: DMA error, csr=0x%x, reset si_attach: impossible bus type 0x%xsi: dma handle malloc failed pri %d si_intr: DMA conflict si_intr: DMA bus error siswsi_dma_free: free while in progresssi_dma_alloc: xlen=0x%xsi: no free DMA handles.si_dma_alloc: can't remap %p/0x%x, doing PIO fpu_cleanup 1 fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=0x%x fpu errorbogus fpu queuefpu_cleanup 3fpu_explodefpu_implodeWARNING: opennode not valid on sun4! %s WARNING: getprop not valid on sun4! %s node 0x%x property %s length %d > %d io %saddr 0x%xPROM boot failedno PROM root devicePROM sync commandhierarchicalsearch_prom: null nodemakememarr: hope version %d PROM is like version 2 makememarr: cannot find "memory" nodeavailablemakememarr: cannot get propertymakememarr: no memory found' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !sd-targetsWARNING: %s map is bogus, using default config_attach: device name too longfindzs: unknown zs device %dfindzs: no obio nodeaddressfindzs: cannot find zs%d%s "reg" %s = %d (need multiple of %zu) warning: %s "reg" %s %d > %zu, excess ignored %s "address" %s = %d (need multiple of 4) intrinterrupts%s "intr" %s = %d (need multiple of 8) WARNING: %s interrupt %d has nonzero vector SUN-4/%d seriesobio missingfboptionsno options in OPENPROMcould not find %s in OPENPROM bootpath: /%s%x/%s@%x,%x:%cx%cc%c%cbootpath_fake: unknown system type %dkernel has no debugger cpu_configure: no memreg found!cpu_configure: ROM hasn't mapped memreg!PROM root device type = %s (need CPU)mainbusmainbus not configuredpagesize %lx l!/obio/interruptbootstrap: could not get interrupt node from prombootstrap: could not get interrupt propertiesbootstrap: less than 2 interrupt regs. availablebootstrap: cannot support capability of > 4 CPUsbootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt register/obio/counterbootstrap: could not find counter in OPENPROMbootstrap: could not find counter propertiesraidvndSUNW,sxvirtual-memoryaliasesopenprompackagesinterrupt-enablep2busH@JAxAAAA>ATI(KPIXJA>ATI(KPIXJAAAA>AAH8H0Qproperty lengthcache enabled cache_enable: can't handle 4M with hw-flush cacheDVMA coherent stdin-pathconsinit: increase buffer size and recompile consinit: bogus stdin path %s. stdout-pathconsinit: bogus stdout path %s. displaycninit: mismatched PROM output selector cninit: invalid inSource=%d console is %s cninit: zs not mapped. keyboard/displayttyattybttycttyddvma_dmamem_map: nsegs = %ddvma_dmamem_map: size botchdvma_dmamap_load_raw: size botchdvma_mapout: extent_free failed dvma_mapin: null page framedvma_free: pmap_extractdvmapgdvma_malloc_space: pmap_extractdvmamapunable to allocate extent for dvmaih_remove: intrhand %p (fn %p arg %p) not found from %pAsync registers (mid %d): afsr=%b; afva=0x%x%x NMI: system interrupts: %b VME0VME1VME2VME3VME4VME5VME6SBUS0 SBUS1 SBUS2 SBUS3 SBUS4 SBUS5SBUS6KSEASCTVI5MIFVMIME MAnmistray interrupt ipl 0x%x pc=0x%x npc=0x%x psr=%b EC EFSPSETcrazy interruptsintr_establish: level %d interrupt tied to unremovable fast vectorsoftintr_establish: level %d interrupt tied to unremovable fast vector_bus_dmamap_load_raw: not implemented_bus_dmamap_load_mbuf: not implementedmapiodevmapdev: zero sizebus_dmamem_free: nsegs = %dcurproc = %p, pid %d no curproc uvm: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = 0x%lx stop at 0x%lx 0x%x(0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp %p end of stack trace g0 panicw: case 4 w: unknown case %ld w: arg not allowed Frame pointer is at %p Call traceback: pc = 0x%x args = (0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp = %p dumping to dev(%d,%d), at offset %ld blocks dump area unavailable mmu memory @0x%x:device bad device not ready area improper i/o error succeeded error %d WARNING: not updating battery clock attempting to power down... power-offWARNING: powerdown failed! halted rebooting real mem = %lu (%luMB) avail mem = %lu (%luMB) mmrwmmrw: out of space in kernel_mappmap_protect: last segmentpv_syncflags: no segmentspv_changepte: no segmentspv_changepte: pte == NULLctx_freemmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry typemmu_setup4m_L2: unknown pagetable entry typemmu_setup4m_L1: unknown pagetable entry typemmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_reservemon4m: unknown pagetable entry typeVA2PA: Asked to translate unmapped VA %pkvm_uncache !pg_vme_free: no segments in pmapme_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no ptespv_link4m: allocation failedpv_link_4_4c: allocation failedpv_unlinkpmap_rmu: no segmentspmap_rmu: no pagespmap_release: segment list not emptypmap_release: releasing kernelpmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! pv_syncflags4m: no pte pmap: %p, va: 0x%x pvplL1 pagetableL2/L3 pagetablesyscall nargstext fault: pc=0x%x sfsr=%b sfva=0x%x kernel faultdata fault: pc=0x%x sfva=0x%x sfsr=%b text fault: pc=0x%x ser=%b data fault: pc=0x%x addr=0x%x ser=%b trap type 0x%x: pc=0x%x npc=0x%x psr=%b %s[%d]: unimplemented software trap 0x%x trap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_FIXALIGN T_INTOF asttext faultillegal instructionprivileged instructionfp disabledwindow overflowwindow underflowalignment faultfp exceptiondata faulttag overflowwatchpointlevel 1 intlevel 2 intlevel 3 intlevel 4 intlevel 5 intlevel 6 intlevel 7 intlevel 8 intlevel 9 intlevel 10 intlevel 11 intlevel 12 intlevel 13 intlevel 14 intlevel 15 intv8 r-reg errorv8 text errorv8 cp disabledv8 unimp flushv8 cp exceptionv8 data errorv8 idiv by zerov8 store errorv8 data access MMU missv8 insn access MMU misssyscallbreakpointzero divideflush windowsclean windowsrange checkfix aligninteger overflowsvr4 syscall4.4 syscallkgdb execsvr4 getccsvr4 setccsvr4 getpsrsvr4 setpsrsvr4 gethrtimesvr4 gethrvtimesvr4 gethrestimetrapvunmapbufvmapbuf: null page frame%s: PROM ranges too large: %d child-presentfalse: no devices write0-keySUNW,xboxxboxsun4c compatiblecr .( OpenBSD/sparc: this kernel does not support the sun4d) crd'({^~:                           `@ABCMKEHIJDSFGLVUOQT?NRlk89:;<cdef !,-.,-76 /012hi13m#)/4,4@4md4mxh4m<4mPh4m4mh4m4mh4nX4nlh4nX4nlL4o 4o h4o 4o L4o 4o d4n4nl4o44oHh4o44oHL4o44oHt4n4nd4p4p,L4pT4phh4w4wh4w4wL4w4w|U$4wh4x4x$h4x4x$L4x4x$D4x4x$h4x4x$L4x4x$T4x4x$\4x4xh4x4xL4y4yX4y4yh4y4yp4y4ytpP4z4zl4zL4z4z@4z4z@4z4{@4{4{(@4{<4{P@4{d4{x4{4{L4{4{L4{4{4{4{LF4{4{L*4|4|L*4|4|L*4|04|DLF4|04|DL*4|X4|lL*4|4|l!4|4|l!4|HL*4|4|L*4} 4} LF4} :!4} L*4} 2!4}4}p"4}4}g44L*44LF444444L*4,4@4444444(4<L*4(4<4(4<L*4|4L*44 L*4L4`xj44L*44L*440L4p4L*44L*"44TL*44L*44L*4<4PL*4d4m4d4dm4d4LF4d44d4Lm4d4Rm4d4L*4444xj44xj44xj448xj44|n44,|n44|n44|n44 r440xj440xj4D4X^z4p4 xj4444L* 0;daxHI5w@HG1vuDF@ @E-| 008@HP`pxhX@I3 $ ھ, (Uƚ_ < @Uƚ1 (@3P/mnt\ 3PUƚ_(@@<@T (Uƚ_ < @Uƚ1 (@ Uƚ_(@@<@T UUƚ@080Uƚ}zB0A Uƚ'UƚUƚ03AUƚ&CUƚ!,)Uƚ!,))XAUƚUƚ0oUƚ0o*nAUƚUƚUƚ+ڻAUƚUƚUƚ N,J>~PUƚ74pUƚ Uƚ8@HPX`hpx 0xhUƚ!,)Uƚ"]BUƚ"]B-kUƚ-Uƚ7:xUƚ7:x.KUƚ7UƚUƚ'#,1hUƚ(UƚUƚ'#,2 PیJ`Uƚ0oUƚ 5Uƚ 5PX`hKFMM VUƚ iUƚ+~2Uƚ+~2pպ.Uƚ/8AUƚ7j?Uƚ7j?7֡{=!Egfdu^.֙NQ vZ2u3Rjmou⯹(8>p‘l"~߶Z] w햖鍆Mzy0h0%- /etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT timeout=false timer_pid= if [[ ! -f /tmp/noai ]] && { ifconfig netboot >/dev/null 2>&1 || [[ -f /auto_install.conf ]] || [[ -f /auto_upgrade.conf ]]; }; then echo "Starting non-interactive mode in 5 seconds..." >/tmp/noai trap 'kill $timeout_pid 2>/dev/null' EXIT trap 'exit 1' INT trap 'timeout=true' TERM set +m exec 3<&1 4<&2 >/dev/null 2>&1 (sleep 5; kill $$) & timer_pid=$! exec 1<&3 2<&4 3<&- 4<&- set +m fi while :; do echo -n '(I)nstall, (U)pgrade, (A)utoinstall or (S)hell? ' read REPLY if $timeout; then timeout=false echo REPLY=a else [[ -n $timer_pid ]] && kill $timer_pid 2>/dev/null timer_pid= fi case $REPLY in [aA]*) /install -a && break ;; [iI]*) /install && break ;; [uU]*) /upgrade && break ;; [sS]*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi  . ..@ bin devA etc mntmnt2fyBsbinfyC tmp usrvarinstbin .profile upgrade install  install.sub install.md #!/bin/ksh MODE=upgrade . install.sub get_rootinfo while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED."; exit; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED."; exit; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!"; exit; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startcgiinfo munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!"; exit; } mount_fs feed_random install_sets rm -rf /mnt/usr/libexec/sendmail rm -f /mnt/usr/sbin/{named,rndc,nginx,openssl} finish_up #!/bin/ksh MODE=install . install.sub ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig ((NIFS != 0)) && startcgiinfo echo while :; do askpassword "Password for root account?" _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done rootkey= $AUTO && ask "Public ssh key for root account?" none && [[ $resp != none ]] && rootkey=$resp questions user_setup ask_root_sshd set_timezone /var/tzlist echo get_rootinfo DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) _fsent= rm -f /tmp/fstab* while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK || { DISK=; continue; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || { DISK=; echo "'/' must be configured!"; continue; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == none ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || { _rest=$DISK; DISK=; break; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent="$_fsent $_mp!$_pp" done >/tmp/fstab munge_fstab mount_fs "-o async" feed_random install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF $(tar cvf /dev/null [A-Za-y]*) >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(http_time) && _now=$(date +%s) && (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ if ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(http_time)")'?" yes; then date $(date -r "$(http_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $HTTP_LIST ]]; then _i= [[ -n $INSTALL ]] && _i="install=$INSTALL" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $METHOD ]] && _i="$_i&method=$METHOD" [[ -n $_i ]] && ftp -Vao - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed /tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; for _f in dhclient.leases.*; do [[ -f $_f ]] && mv $_f /mnt/var/db/. done) hostname >/tmp/myname echo "127.0.0.1\tlocalhost" >/mnt/etc/hosts echo "::1\t\tlocalhost" >>/mnt/etc/hosts if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f; rm /tmp/$_f; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) echo "done." apply if [[ -n $user ]]; then _encr=$(encr_pwd "$userpass") _home=/home/$user uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:$_home:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group echo ${user} > /mnt/root/.forward _home=/mnt$_home mkdir -p $_home (cd /mnt/etc/skel; cp -pR . $_home) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 $_home /mnt/var/mail/$user sed -i -e "s@^wheel:.:0:root\$@wheel:\*:0:root,${user}@" \ /mnt/etc/group 2>/dev/null [[ -n "$userkey" ]] && print -r -- "$userkey" >> $_home/.ssh/authorized_keys fi if [[ -n "$_rootpass" ]]; then _encr=$(encr_pwd "$_rootpass") sed -i -e "s@^root::@root:${_encr}:@" /mnt/etc/master.passwd 2>/dev/null fi pwd_mkdb -p -d /mnt/etc /etc/master.passwd [[ -n "$rootkey" ]] && ( umask 077 mkdir /mnt/root/.ssh print -r -- "$rootkey" >> /mnt/root/.ssh/authorized_keys ) finish_up MDTERM=sun MDXDM=y MDDKDEVS='/^sd[0-9] /s/ .*//p;/^x[dy][0-9] /s/ .*//p' md_installboot() { cat /mnt/usr/mdec/boot > /mnt/boot sync; sleep 3 /mnt/usr/mdec/installboot /mnt/boot /mnt/usr/mdec/bootxx /dev/r${1}c } md_prep_disklabel() { local _disk=$1 _f=/tmp/fstab.$1 disklabel_autolayout $_disk $_f || return [[ -s $_f ]] && return cat <<__EOT You will now create a Sun-style disklabel on the disk. The disklabel defines how OpenBSD splits up the disk into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. __EOT disklabel -F $_f -E $_disk } md_congrats() { } md_consoleinfo() { } ELF4{4 ($$(!(!(_|_| 4 4 \\(D(D(XX8Xt8Xt8XB9TTT00e 4 4 OpenBSDOpenBSD㿠@ @D* @ +#@㿐/0c @ 5(`8``/  ` (`8``/`c1##(`+c  " ))#(` )#  @g@ɐ@@` =0#c #㿐/`  (@2(`@@?㿐/ݮ8``@ `㿐/ʮ`   ߁ #@  #@0@㿐/l``  ` `8cЁ㿐)p a(p@``h $`h   b@   @' @`O$@` @Ւ   @`{ @| 㿐@`$ @(``@ / 2 `h``h`@& 2  @@ppah`@ 㿐 ?œ`?`Ea`# `0 ` `h `㿈 `h" ` `0 `p' cB% 7cH@.$ Wbp@ = 2 *(`` q`@4 '  @W (q` "q`Ђ@$(@  $  (  @b ((  ` (q@_!   (` qa @49 ``%DbTDb # `D!  ! (D b! (DbTqߒaX  ``2  q֒a@ bt  `0  q `h` 2 qĒa``  qaq #@ ? @4q@  $@ q ?@ #` @4 q@ `$@ qaА @3ɖ?㿘q@%a  `(  q@%b  `( `(qb@3 had@㿐 @ѐc    ` w @8Oa} (`8``b"4``k`K`M&`G0`k`m`gJ4``wD14`, ,` -@, @Y,` @T 4`, @K,` 0@F 0( @?(  :  ', ,`@1  @+  '(`8``x 4 ` `* |@P @ 8 ` 0` q @3 b  ` w @/P " 㿘] `08` 㿘U `h8` 㿐 -@ h @s" @_4?@s`"  ` w @7aN (`8``b*, `k`K`M`G0`k`m`g" ,  `w2,  81 , 8, (` @( '" '(`8``x 4 ``*  @!  ` q @2b ` w @.Œ "㿘 `(` `h `㿘 `(`r `0 `㿘j b㿘c  ? 㿘X `㿘Q `h ` `0 `㿘q'Db@Dq# `d#% @欰@$  `( `q bH " qb`@2  @$`($D`ݐ `0` `h `㿘wax@1 㿘wax@1 㿘waz@1 㿘waz@1ߐ 㿘 `  `0``   (2 `0 ```h $  $ @   $`$`㿘 `h`h`` + ``hq- c`@ 4 q`9b@r` `w @6Oa>  @ < `" ` $ `$ `$ `` `$`2`` @\%$``"$`qc0@1b ` @`$``h``h@#O"@ `h`@$` @6X X w @6a#<@@X  @a@?``@& X@0 `& 㿘y `0   $ b$ @2 8$ !  0b` 0`q`cP `h  #  $ qc#$ `(3@!@? d@ b $ `( @!@? d@b $ `$  `63  wa3 `h `(! ` 0 `h`@?$ 0q c&`h # `*@  $ 0``h`@ܐ &`hqc@5f   `0h`0 $h$&`@6` `$# @`(@@`(`` `@  @5`(b" qc@0u  @X А G@ bp G@bXF # 2 (`@@(@"  @     @"  @  z$ 6- (d2  @4 @@ `(   @ ܖ  ( @(@  `$ $`$  ( `$ $`$ @ $ @$ $ `$(`@  =&$ "  " `$ ?(( 8  ਂ@$ x# -w`+`3;@/ be%b `Dbt2D bT2D  b  `( `h`h: @ `  @" `h` ` `h``͐ @  `( @W !  ` `( @` '  ?膀Є@b@?'@\r`r HH H?0 ?0 ``` 8#\ dq@ @!'`'̀ qcqc dq@ '@! ' `` qcqc dr@ Δ,@!$?$? `(' ``@+##`@r聠 H0d#\ Ȓ dr(,#d@ #h@!}$?$?Ԕ @ȁ㿘c@ 㿘@o[@o"㿐 h```` ``@  @ w ?KW5` D `$`'  7a@ C!`h@^ 4/`  7  'a@- ?h h@w @3Ba `D @4@$@8D  @4@$@8㿘 `0`` @`  ` ``@  @  ?CA8``0 w a- 1+`0@  `"% D? (b`r%b @.`hd 2@ w @2ʒa2Hb #㿘r!@@6`@|  ra'r ` #6"4  o R e+   s j# " cȒ@ cȔ   @m#   cr @-a@U?ǀ gb&(` @  r @2Za`"' '?'''''r!@A$ @n`-ra@-| ra@25 @ 㿐qb@` @ " @(`8``"`n  `(`8``o` @M = " , @y "  `(r @ @  rbrbr;b (&   b@-  "$&@`" &@@n " @@  c2&@@m`"2&@rb@, 㿐@݂'    @1 k`@אJc$#--,,,,,-D,,,,,,,-t-|---,,,- ` ``c rځa,bc rځa,ccځa,a㿘`Xr @ac@ 㿘@ ,  @1A @5 , $ $ ($ $ @ $& 㿘 @  2  @1* @ @"@?2 r @,]cX @ސ@Z @?߂c@+b `0@[` 2@r@#p @@d Ѐ $    @ $ ?"@ @n@ " @r c@0  @ $  x@`  @l ڀ`` (`0``@l@ ``0r@l#" @@@@`&``$` "@@@נpa#` S @`&`c@`$`$`2` 㿐'' c rca b" @St? ? ) b  c̮   5`H(`I@%(``(P@@” 2, @(`8`@ ?`(``2 ,bx2,b`?ڒr r`crcr@V#@2  $@   $ 2 r#@߯c࢒ 2 @#@>b &#w @/ݒa     #` r@R?{?`b` @@``& c```Xb@ "   , b 8` F@  c`  `$`2 `  , @ b" \`??2@@U#0\@ NbP#㿘`Xs @c`@ 㿘@d @k} ` @ku@a s @>`P㿘 @ w?@!@i "  @? " @#bh)`耠`ss$``"`ps s@-s v`b   d@E?@!?@s b H?   @ @  @@9  @ @# @@  : @ @  @@  ;h ;`;p#\ #x"8@ s㿐@? s@ s@!㿘  @֐    @Β  @ǐ Փ 㿀s!@{    )`@d@E`" ҔXs`@ @ @  @@ ` @@ @ @@x ` @: @ @b #\@ې@_ #\#`s@!sb@"?@s b H?s@!()``"s ( 0f@"?@"s b H'#\s@ڐ!8 s@Ր!P 1s@ё!X㿐)`` ) sss'!`!`耠`$' 'sa@ssฐ!@)``"ss@!s @q&!  "8㿘  s(`8```ns @(a   (`8``o    ` `  @y ,  @  c  @-. " *   @@a , . $㿘c   @ʔ  2 ``?`  `@ 㿘)`쀠`c `2 )``3@oI   +)))%'` x@"` "` , ` , @"8"* @Đ  @ "@*`@-  `"8@`㿐 @o   @Ѣ` "8 @& s#)b(!)/)-+))')/%)  n h i P""$ t l % $`$ $$ $` % `s @'bc@O~?΀ k)``b)``  )`` s@Rא"8 @n ,`s  b`@@Bh&@"8 'was bps-)b+)<'P%  @,&@/  pd@ 2=@@@@2@. @. @"@*`@ 2.`+ . . @ @(`@,ے 쀠` @@@@Ru`ϐ x 2  @ @Rfx`@@`@  !   @`․@&b8` $ )``@x`?㿘 ! ` 耢  e\FaT  @ Q p e\Uaj &` 4& 0&%\FaT2'$@ (&8`& @ 8 ̠< > < (8@8` @ d@ d>  ,@ ? >( ȃ8&4 &0> 8#@ґ8`$@B> <$@@ɑ8` @ d@ d>  ,@ ? >($>0&`&d `( Z@r Z@nxs b@J ?㿘 $-($֖耢 ]; 8(cS0U L`Q$& (& ( @& D4   ?@" (@ @$@$ >  > `>  >( &` &d>0 `( Z@  Z@xs b@ ?Ua#㿘 s@ؒb耢  s@ab 8@ܒ 2 @ƒ ,s@b s@bЀ 2 s @Q#s@c8 2 s@bЀ  s @P#@ 㿘s#h@`@2 㿐@q'b@sc(`8``, `- &@ =  , *  &&(` &@ 2&@㿘  @(``@@ @  @*' s@0@@_㿘  c,"   @(`` `㿘  s(`8```ns @%8a ) (`8``o)   a a ` @  ,  @G  c$ t @)Ԓ`" *   @@ , . $㿘c$  @p  2)a`?` )a@ 㿐  @xq'b@ @j@L`?@P  @ʐ㿐 @kܐ `@    @ "8& hw !@)a` x Z!<@  xĒ@  xt   @)a`?c2  t#` r @n( c,ca t` "` ``2@U, "%)`뀌`t`` a ?@a(`(t@9 (%)`" p?@t/@) @s@b耢 C`t ` a !bt`Pt`X@#!  @m  t`` a t`` a !`t``t`h@~#!`)`t`` a t#pa`"!`t`` a t#x@~!`@"!`t`` a t#@~!`"!`t`` a t#@~!@)`t`` a t#@~)a`2`!)`t`` a !tt @~)a`2`!)`t`` a !tt @~r)a`2`!)`t`` a !tt @~[)a`2`!Ā` )`t`` a !tt @~E)a`2`!Ȁ` )`t`` a !tt @~/)a`2`!̀`)`t`` a !tt @~)a`2`!Ѐ`)`t`` a !tt @~)a``t`` a !tt @}!!tt!@}a!!t@}a !t!Βa0s@ɒc8 @`t`` a @"t!@@}Ĕt@aP s`2 `"`2`"`)`t`` a ""ttt!Xh@}!p)a`2`"a"" `t`` a "tt!x@}" `"" `t`` a t#@}{" `"" `t`` a #@}k " `"" `t`` a t#@}[" `G`t`` a t#8r@3aȀ 4"```t`` a t#@}4"`""`t`` a t#@}$"``t`` a t#@}`cِbX@} X@,  r5!`( (``rb(`(@Ґyt@ђa `!r"x E f"x?> @'y t!@X 0׶@ Z@G + 0@?  2# )a` w@|! Z@- Ē@| t t!@|!   @@ʔ   t @&Y`'@' <('@(`'@')('@a`t@|t" b@ @|l, @Dِ @r@p @?  04t@"@`@^ `<tbtb($@'@@z3@bE`@Ô `2@b7`t@쵐"8@ @0@.@| t@쥐"` ` 0``) )@4ΰ @LQ 0a` @& *V 㻐sbrbxrb(qaP t bh !5)7)l36# t a"e  d A N \&c( f06 t v r& sw +)? v&5 wn0; A  >&Ӓ 2: @(``2,, 2'! $`s @ bO## 2ߒ  & 2Ԓt@HMp? ob&(` x   W qaPtbrb0r`?b( t b@+@5 c(@/ c(@) .c(`" ` `` X "0R /` ` G ,  ` `@`  "  @ 2`À@g+t b V @ x " W@ b8&Ґ c$`@  s@Xb ra@$ rbx 4' tUb t@bȀ  @b` (@  t`@$t `x" `"S@&` /`@E 2`@Y 2 `@T 2`tbq@qaP "`r@jb( "`t@cb "`tb@{ )` a `@c$`2 s@ْb sb@R 2   D  '@)6 "t# @\` @Ւa  @vU ? @`/t`wc8@@Wa#㿘)a`u` `u` x@|M@ 㿘 @ƒ`(`Xu@`)`? aau ` s a @F? kb@   !u @|  @JU .!u @|   @JM @N Wb؜#㿘@e˰ ^cȜ#had@㿈@'u ` !W@⇘# 2@#u a @| ^@$@ 2 w@IҐ H@, 8``uw@c`p `< w@Z`x @?4((`, @N  w  @I@@(``" w@I @@8``^@ * 8``? `-? @(`((`(  &` 㿘  w@5ahw@2a㿐 :'H@( 'HH`'Hwawawawawawau`wau@ҐaȠ  (``{@ = 2.@ǐ.@`wa@  .`8``c `i@ђ '.`X& `l@ƒ 2M&@ <.`@A& $ .`@ -.`6& 8``o&.`@ 2)& @ .`@Ĕ& ((`8`@2` @ 2 ` `(`8`@`2 @@`H[HH`~㿘   w@xy!u`wb @xo``@@r1w@xb"  $w"  * + * - * 0C " $"  * + * - "   ` $  " ?c" ?c ` " " @" $ "   ` " " "  "  `c $ c"  b$ " "  " $"  `" @  $`" b " $" " 㿐 `' ' @<`` & 㿘@3`o w @!b0㿘@&`n w @!b@㿐' @` w @!bP㿘@qѐ 1@w" F D**`w22`сa"`㿐    ?@T#`6 D w @!abh & 㿐    ?@>#`6 F w @!Kbp & 㿘 `X@!%  ?@c&  & 㿐    ?@`  w@!$bx@t  & 㿐    ?@`  w@!b@sg  &    [aD`D   [aD`D㿈@ @(`8``- `&`&`' `H Z @" % ````"  w@GU"@~ `" `$``&`w@GD H@m @ had@㿘@ua@  2   ` (@&`   &` C&` `ucD@  2   `(@&`  &` -&``v`@  2   `$(@&`$  &` &`$`vcL@  2   `(@&`  &` &` ` m|mmmm㿘!)! `)@> $! ) a$㿘 ` !) !!@( w``x )`! M`)! -( ^( ? (4(@( ^()(a㿘#)a  )a$@v7 $a @ ϐ H y@v+ w@v'! @v""$a Ȓ! `y(`Z@y  y  y (y 8y H@v@u X@悐@py@u hy@u  y`@**`22`@uݐ  " @>J  yP x! x!bxbx $x bxbux$ x$bxbfx  x aixahWx  x axxayHx  x axa9    x!.@x  @x b xb!x @ x @b0xb1x "x b`xbax" x"axa  4 ` x`xbxb xxbxb  xxbxb xxbxb xxc xc!y( y(`y`@" xxcXxcYy8 Ȁx  x `x`lx! x!`x`]x @ x @`x`Nx  x `x`? xx`x`/x" x"`x` x$ x$axa x( x(a)xa( xxaQxaP   x P@`x  x `ax``x  x `x`x  x `px`qx "  x `x` ye Т   x#h@`x  x cxcx  x cxcx @ x @cxcqx  x cxcbx  x cxcSx  x cxcDx "  x cxc5 y ؀w(2 #w(cwc" #awbw`#Pc w#Xw#`#hwcwc wwcwc wwcwc  xx`x`w$ w$cxwcy@ xx`(x`)" uxx`@x`Au `yT y`Y`  d@@ 2`> 9 y `#(.`@"  d$@e-`@[` 2 @`@`  ݀`@`@`(㿘`Xy @{^a@  H by'Ha0'y a8)'"  f a2*  g$   "@އ  '"@H(`@@m[@ @?%?Ԁ ebH(@'H@ y @=a@@ف`y aP@w`h y@⬐!` H8y@`2yyy'ap'yHaxD̒ =HI 7H 1H@ Ѐ`    @ǐ#` H@w @a@@m  @J    '@B 4H`'HH@``  @] ya@n `  @`g y@&! `bx#㿘`Xy a@ze @ 㺘)a4`2))a0`l`a @x *x<@@ ) w@ya a,`l`a @x "x<@@@ q$!y"@#( "@y̐ ? @ x 2))a4`2-))a0`l`a @ yE"|)) )a(`25 y@AP" a(`)@y  )@V`)a4`)@. a0?`??+ @k @ `" w!@b y')b@%)#)!)  n L PG$!0 s h?  $, $( $,$!0 $a4@=?߀ fb&(` @  * 0@ `@   0@x@_ xwa@L <@@   @@kc#`@(4TtP@㿐('`chH@?`` J(`a@cp8 '`chHcxcc Hc H㿘.`8``*Z p < ) 1 (`0`   @(`0`` @  8 @ @@ @ 2  ( 0` ( @' K @( `@  M@(` @ 8  G T@` G` c. @`(`8`. > 㿘! @q# @q# @q 0 @qސ h @qڐ  c @xla a0@xfp @qː! @qǐ! b@xX8@ p!d@2Д!@-А'dT'X!7\'`' '7$'@ 7㿘 (` "H ,`"X 0`2  4"p @? `  "@?  8`2 p 0@ ,& 8 p <(`0` @ 2   4 8  @] & <6 p  @?`"  @U  ( " @?V"  @?N"  @U ( " @?D# (`0``8chcc``H `p @?,#0 (`0``a @    (`0` @ " X*`@?:` X`" X`" X   8(`0`  @ B @_ " ,@>:` @>:` X`" `2   (`0` @   (`0` @ " @>Ґ   p <(`0`) 1   @ @ C 8 ,2  @( ,:`@>     (`0`@ p  <) 1 B*`2`  B @C 8 ,2 `(`,:`@>`  (`0`@&Z ,```%`?(`0` @  ?(`0` @ "`?(`0``a *` :`@@>ZC ` `$ < @0`  8(`0`  @ B @ "T XN,㿘`(`"&`(&` @ @s!  `@(`` @`㿐@m ' '' 1 @8`Є``   ```` (` +& D& @ ?㿘b` ,`` `"  `" ,@>, 㿘#@a(`` . a@h (`` 㿘@hva(`` 㻐&`&`  6`r@ 'D  @\bp3`l@ * @@W$ 3`l a ڸa|@u` 2*@: #  *   (`8``/2  D@$ : 2 * @=c!D a0@ 8` a8@<a@ #aH "  @0 2 $8`a2   ?=#`'`!P@=$p6`@bЀ +'Dax@  `@a `' !@<` @(``@&`X@a (    ?`'!@<ٔ$ \ `D @(``"@aЀ ``(6`@<!  6`#`(@Fb 2 `@=a 2`@$Ҕ D@1b  n "Dc@#b(    ?`Q'aO&`(@ b8    ?s`;'&`,@bH    ?``('&`8@b`    ?M`'&`0@Ԓbp    ?:` ' @<""pDm&`4@b hD@b aD@b ZD@b SD@b LD@bȀ ED@b >D@b 7D@c 0D ``8$ (``2`((`80` `  #6``   ?š`  @;#H - @ `0`  @;#00ɐ  ?`  @;#h`- @ `0``2-  @9(` "  @^ 2 $- 8'@b2 @Ѐ`       e''`` @;H#'- @(`- @```2}4yb   ?8`k"V Q  ?) ' @쁒@-  - @k?@k|, - @H(`"5 0   ?`9"$   ? ' @N@  - @kM?@kI, - @ ,` @:͐#0   ?Θ#4` D@- & #@:D$@0 " 3@ 2 l@< &6 㿀 y@bH@N# " (``2 @C#耢  (``c?@:%`?K '@ɐ  @Ő  @  @ҽ @_?! @g @ʐ @P`2?@i ?`0``@O? "?@O@Ғ @ҏ @Ҍ @҉ @@O"㿘@O   21w1 1  0@:1 1 1w@E!` "` `* 8`` 2@:@ (@` 㿀. @   (.08`  @=B ?  (`0` @  `  `( `  `(`r ` 0`` ( `  `(@ r`a  (` 0`) 1  @ @ D  #\`@r0  (`0` @;`.8``B#\@ a@r `  (`a( a0@q `@r + 3 a8@qߐ.aH(@qؐ.3`l@@qΒaP``6 @9֑ 㿀.͓:`3`@qaX`(`0`ap*|a`@q `@qa `@qa`D`E`F`G`@`A`B`C#\#`#d#h@qa@j!`X``@j!`X`@j!``2 ߐ `(@9}`(@qga`,@qbb`0@q]b(`8@qXb@`4@qSbX`p`<(`0`  bh@qGB`p`<, (08`  @B r` ?B@ b@q(@8Ӑ `L`P(`0`  b@qB`N`T(`0`  b@q B@jr" l`2l  b X@p  @8`*2@pbؐb @pܖ(`\`(`0`@㿘`(``" `c0 @p``(``" c0 @p`@j#8`(`0`ch*|c`@p`(@pcx`,@pc`0@pc`4@pc`8@pc`p`<(`0`  c@p}Bc  \ @pq``2 \cccc`c`a dc(`0` @ "Y@i ) 1 a(` @8`  @p<  (`0` @  @p. " *@p  `2% ` 0` ` (@p "  (`" 2  @(@o `(`0`& @7 @㿀+`X` @X`s `ax` +```3`h`ee*`r@@ !+`  @*`e@4 `8!+ d a@6Ӓ`P?*b`G`@`A`B`C`D`E`F#\#`#d#h@6``? ג @3`l d@P a* @J,?@m @h " @B .  @  d@@@3`h`*@c"㿘 aW6&&@36`` e@˒`g  3  3`` e*`e@ͷ  @'`8@Y )@]!`'H?@_b   !`w@Ր! @a Y@h @h{ @`d39ސ!`?!`@E` 2H`w@֩!e@h`r  @ؒ` (`ԇ0`)  1  @* 2@C  @'''77 !7Ԑs  @Sh"x@`!@H+N`h  @`@n̰ @@eǐ"@̐ ```%@  0@`' 0@``%@  0@`' 0@̐ ?` n N2h @n!`㿘@DV b@  !@= @ `@ 㿘 %'/353-++*9+7+;3;x p R"+` c E9 F@ A{ {'`h$ c%  Tr=E p v h1 n` fe$%b] w. t] &+"    T' XR&`` } J$x`" u A%\%\ <%b *9-7 T6x`" _  ",`@:` " (`` `"@g7` 8-((`8` -ଂ & * 2@1耢?o e b!x(`@& !!x +`\` !x` `3`h`% %x@`+@ *` `d !3@j  b x@>x` (`ah@ *1" r@R g+`T*` ~b *3` *b:} * "m?`G!*)+"_ h!"@ `@i` `w @aܒ& @& D  h e@`e  @ `8@"@2+```3`h`?!*` f!* %+` `*|!*%+"h"!@ hi@|  (`0` `` *(2 @``(`0`) 1   @ @ C  ? @ 㿐 ?a.@`(`8`k mg. 0 t) $    0( ( @ 3`+ +` @0( @* ( 2 2` @3@  @c ?@Q >?㿐?@  (`8``%",    d@􀢠 &@?@3 @c 㿘   @Z  @2@U㿘@or` H>@@ ` @(``& ? 㿀 -''''''@! "&, &&˔?D  (`8``"`*?? >?"-?``"%?'@4?r` ?@%? ?@>@ٰ ?㿘 !@ &@@` b`` ! !@&@@`"  b`` @̐  @ W @r`@ @ `?@f@㿘  `` @W   @2  㿐@`  wa@  @   cЮ  Ԭ  cpOТ`@vq  $ @  А@l@ "$  (`8``/"@ \  ? Q "  ?2`(  `2    ( `H@ @ 'd`p@ cА@ ` L P(`0`* @8b N T(`0`* @8b*b`   сa 㿐.>gr` 1@a!? B1@ @a"㿘.`:`@a!%* ؖ@* -!*" і@a!(" ,``<`Ŕ@a}!8!Hc@aq( ` ͖ (`0`㿘3 `l,    @ @@` $@ ` p <(`0` @& 6 x@ ?a @p!  @<bpe@Ȁ`r 6&@` @  㿘 @-$ "  @ $ @bp  @㿘@N!1@N!+`\`x @ 3`l  ) @  `2 #@#   `*b`#3 *b`G`C`D`E`F#h#l#\#`#d`@`A@j`B ?(`8`#px$@} .x #bX@;   (`8``r bX x@f$x@Y / M (`8``rG3, `x$ @Q, x@-@  ({xn@<+`\@b )ybbx b``(@`a`(`@iH`@  @ `@i;#\``@` "` `* 8`` 2@1L@ (@` 㿘 !) H"X@Ɛ  `"` "  (`0` @ " *`*```$  (`0`& `) "Xm@HL "1) @ Βb1)"X㿘`**b)8a8a88` ` ` ` ```(`0` @8 )  ) *b)ka89!8!8`` (`0` @9  (`  0`@ ) @1 C @C 8   @    8  2@ (   `  ``(`0` @8  @   8       .  2  (.  <@8`2. )a8@   1)!8㿘.`@`W.```(`0`.` @8  2  8   8 @ 2  @ ( @ f 耠   2   㿘 &   ` @F 2   2 㻘Ԑ  `   (`0`@   ) 1 B*`2`  B @C 2[(X $#00`a`a@^ؐ""c@^є(! 0  + b`0@^/$@} ```Z ( `@/ # (`(8`8  "(`@@ؒ(`@(` 2`2 㿘)(b`(c"%`0@^n$@}; +`,"` (`0``@@ ```0 0 @d0``` , `@// ' @ِ  "?(`8`` ". "(`8``?@K "` "@$ "(`8``?㿘2 #c8؀ 2 1x#(`8``U"(`d`D2m1 ``u2g1`"1`p`,`<`(`0`4`8& ,(`0`& (& 0& 4 & 8 @& <6 p2p1H#,<(048& ,(`0`& (& 0& 4 & 8 @& <`6 p(`(1,`,,0`0'4`4"8`8p<`p`<(`0`) 1   @ @ C 1@#0 03@_ԓ`㿘+`\`f.`@` a _ ] [3`lqac `X.```"  #`@_ @  @d$, @`"  " @6    , @ a @f` (`8``/.`!3 l@<@ϐ  $ @1bp@_j 㿈 E @ A B C D F G#\#`#d@] ba8ax`  "1 (``13#@_>`$ @_7 㿘@K  c(`8``raf@My.cP  @ 2, @ `, @` c (`0``@JD@JA!@\!yca a `, @@\ 8 @^  , ```F `@- aaa@ycb b@`%aa  "@   6 .@@ 26 .@\a@^ .@@\Y 8@^.` ɐ@-4 Ő㿘`2 "Xbp 2 13#@^v`(`8`*ʁ `"   (`0`@ ,` 3.16 `b@` (`0` @   13 b@d݁ ,` @ ,`!3 l@$㿘`2 #c g 2 13#@^&`(`8` `"   (`0`@ .` 3.16 `b@` 2 ``(`0` @  13 b@d`( .`` ` `.`@`y(bX@13 cPp`'X'D?X 8'ܸc/`0;@[$@zP ,``/` (`0``@֐@ ```0 0 @b0``` ?`@,D ??@  ?(`8`` ((`8``?@H(8``?`* ((``  (`" h  ` ?@ ; ga(@`(`8`gKgmb"D c%Q& o,;2  D2t:k2 D 8,;(,; `s  (d` :8 0 @ 0 (8 @    @$ @({D ( D (D!(  @ ,;Φ ,;,`8``+`-2 @g  sD $?p<(`0` @  ,`8``+`-2 @f s Ȑ$?@3     ?, 8``+`-2@@l'"@fƐ@@f??`"2?@(``@@Y '"  (@G @@B` 葠 H?@Hd, 8``+ @F`-h eh`L?DGX`܀Ѐ=Ж@ D `8@  F@붶 +@릒`B @8@b8 @G?@&3`h@b`#@Yٖ㿈.`@`8%(`!y"X#ȒcF  1 @ 2`.`@7(`D 2`20`````  #`#d#h#\?.` #`@[Ӱ .`@[̒ @(` @Y| p.` @(` 㿈.`'H@ ` 1 *b`   (  2  @(w: ?#`#d#h#\?b8?  #`@[ @[{ `߂?@<:  @1`@a˂?@@@" a0@aݖ?@ꠒ @2  H@Y ?@Y, H(@(` < @5`5`- - @- 5` -`-`-`w`㿈*b`|.`@ `w   (  2  @E( : <    axa`a``?#`#d#h?#\?  #`@Zʰ 2 (@ZÒ? ( 8@ @aF͂?2@E"@曠  .`@Y ?@Y, .`@(`  㿈.`@` ````  #h(0`) 1   @ @ B #\;`cH? #  `@ZU` .`"@``) 1 *b @@ B  @  @ d  @`ƒb 8 .`@ @ @`cp @ `0`㿘`2 #cE 2 13#@Z`(`8` `"   (`0`@ .` 3.16 `b@``(`0` @213 b@`s9 @W#B㿈.`@```) 1 `  `#`@#d#h#\c(ҔX  -#) `*b8**bb2*`@ `*b @`` ` .` !@Y{`  /, 7, 85 2 8/  @8 .`@2(  @($ .`@ `0`` `,0` ) @1 c@c  @8.` .`@ `0` ɀ  2 !H`@Y. 㿈`2 !pa[ 2 13#@Y`(`8` "   (`0` ,  3.16 `b@` (`0` @ 2 , 13 b@_, @@yc`  , R ,  ,  ,  ,   ,  @y: 㿐M X`   8@  -! '"2* /   (`0` @  a/2 /"@bP 2 #@X`(`8`   ,  b p@`" (`0` @ "  bx@^@ `6   (` 0`(`@  , ``@퉐    ` 8  2 (      2   2  ` ``, )  ! ! 1 1 1 @ Zy 2T (( , @`` (`0`  @ @B 8 ,  ` , 8 ,  ` ,  *   @VI?*  , @(`    5 @ 㿈3*bbb p <(`0` #`@#d#h#\ "91 p <(`0` @8 2bb+*b)*c"b p < (`` 0` @@#`d#d#h#\}?2  <2 <13#@WQ` p (` 0`B@c 8" @@ "@*B8b& T6 N*8b& P6 L!@wd3`@T#Pyca@b b@``aa  (`0`@#xKc 13#@W `@ 2    D 2`q@ 2`c6  "# 2(@T 8 ` 2` 8`@VՒ`D `2`,  @%j  @  b8`8``` ,  #`#d#h#\ɒ? 2b`@V ,b```& ,``` 0  #`#d#h#\?2 @Vz 0bH`& 0``` 8  #`#d#h#\? d2`ؐ@VW 8``& 8``` 4  #`#d#h#\`?2 A@V4 4ba `'*a& 4⨪`` p < 8 4(`0`  @ @ 8 2#\@(#\ #\#`#d#h"?  #@U`d@vk!2 p@U p p <(`0` @ 8 * @ *b 7b`@ 24*@A !P/* ⨀**@(b⨀@ #* @ *I p <(`0` @@c8 2 * ( * @\6z p*b b2 & <`@(& <*8b& T6 N& <6 p@S@@U  !d@u`2 !ؒc  "E .`8`? "   (`0` , *2b`@[  (`0` @! ``"Ґ #\#`#d#hb0SP  # 8 D?@@䂐B@ *(`"0` @@ C @ "@  d @ :$h"$4 C- z.`8` b \)*"Y ``2S (`0` @ "H    (`0`@ "@) 1 C @C 8  2#@ (  (`0`$  @@ C 4 2@ (@ b $4 @[7"@T`ې @``d@u!㿀 ' ' '  @o ?2 @9bȐH'D*Db* b* b(`0` @ 5 "3 (`0` @8  @8 8 2  (  @  2  ( 8  2  (  * b  !3D 8: ?H8C?0?(  0 @(@ 8  3`+ +`  'T'XX`'T'X!3 l@$3 ଀D!@tld T#Ђ + 7 'P@eӔ  Z'<cP@((@tT"T #d#c@ <<c<8 8`@8`< H`@8`dE<<    2  @  = 2  @  = 2 @8@  @d` P@ '4 @ dP?@'\'8?(`0` @ ```  \@/<XԀ_T8  4   2( `  @@D8` D   2( ((  (H@@◐CH@-  ed   ` 8  2  (     2   2 `H@r(H@ d@b@@H  2 ( E`@.` @ .`@~<XԀT@  0 0(  @Ĕ 8 ,`  ` ,` 8 ,` \``,`\`,`  @Q%?*  .`@(  0 @(`8``/ ( ( ېd.`3 l@~X @ 3`l $  @Kbp\ `'\\P @~@<Dd@r!0!*b@r '@Z   @T    @N  3 bp`cƐ% * c@@(`0`` ^T(`0`  @C @=n#p*(`0`` 7*܃(`0`7\ 'X /`@7bC /a'T7^` ,3`h`,@=K#,`0',0`'0#3`l!@rr\!@rn@=0 Hcd`l'``@*bX@Q $@ng `` 8  q@ v q//!@ x  x@ (`8``u`U!Ȓ@r/4!@r+FC * 8``h_4`q`X+*`c`M"̒ `R`A"T`D` 2`?+* 0G2(* iV`U"* \`c`e`aN`b* 0Or`el`g2* oҀ`q`u`mr `n`ii`l* `k`p* r``u `x`r6`s* V``z䀠`w* 3Ȑe@L`r  !3 h`$ h h$ hȒrΠʠȒŠe@,`r   + ``@|$ "0@V ԐȖΐ+`\`ΐ  @(`8`u ~ @(`8`婖 s@1 '@ˎ ࢒ "# @(``#`@r`?@Kb   y@#@J0@!@|k@ A3``+@;֐! M ```3`h`*"@!  @;!H75 a`!ax c䀹 "'  !((`8``y  n!((`8`n2  ya* @`(`8` y2 +s`h *b@p! @>! 3`h` *b`Ƞ!@P" ِ@ ` #\#` @Va 2   2  @Vb"8bH-  @(``@Œb r@)#pȔ 䲖 @VzȤ\@C!  4 24!@p?!@p;!@p7ȐROL"p4!@p%!@p !@p741"@:5``! +湒`h 3@!"Ȑ `h+ ``@o!`? `bb "Ð:`"@MȐ@̔! wꙒ "q4!@oɐh鰐鮐鬐 @{b#''T'T'L'T#x#x$$%㿘c܀` 3 ?@:c؁aH` sasb8 ?@:`㿘& & > `;c䀠`6c܀`1 c  @q  @3``PB 4 @ 2 > (>@ c>  c@V 6  @2 @:P? c?㿐3``k%䀠`gc` 3 T`  3 `c܀>$3:3 ! 5$c7  'a@ 6)$(``` ! !"!#  @  #> @j  d@   c3 `c䀠`   `@9? @9`??cc䀠 c܀`D`   2 `(  Ȓa   `c  @˭  6@@1Hb  c `  axc@ː 6 @1c ?#cc@i? 4@ :#c  7'! @! > c'!@7耢 6c@14?c?@iU @1#@@iH? 4쀢 6@1Ȃ  7'# @a  @1q@9n M?`Q c@k   "bp7@'a@ <s@1O )<@m    bp@8?7@cc' @va 6 @1' @9"? c c s  a  `ȡ<㿘c 9c܀`@h쀢 s᠈ 3( `!% 3" aH@h쀢  3 ` c䀤  3@0۰c @8ה0 c @8c ?cc܀`c䀠`?!#@hs? 4# c㿘%䀢 #c@  3 cܳ: @ $䀠V4U . !Sc  @<  Gc솢@c@} &@ 8$䀢 ; @0q`.@0k`(@0e `E( @0^`  @8cH6 c@0R`@0L` @0F`2 c       c؄ 3 `c؀`  )cx c @7c #  @0c @8c``"@j  c `@7㿘c c1#  @ɦ   #@  @/? @7ޔH 㿀c쀠`6 s a3 `3 `s@c,sà`1c܀`#sb`c0bX`(sb8@/`h1#`c!3@O Ȁ  <@ @  `T`P@s@Ra&#c`sb` !# @E ?$#@cc @I_ ` 0``s s bsà`3c܀` 3c0 @[`s b3`? c3``Ls31# 3` ` sà`;s!s"`" #c0ٔ @1bX$"# sb8c0sa@桒`sb8p@! sc0csasasa#\#`#d#h?@惒`s a㿐@  a@6  ca(@  "@@@@" @5 @2  `@- @* a8@@@G a@@} x!#쀢?@c?$#3 aH3 `3 ` c csv a(@ !saX$#  @!  $#@.`@6 c쀢?Ssa`+ N  ! s$#a &@!  $#@.e @6a  cc쀢?*sa`& U#  ! s$#a  @`! $#@.: @66sa| c쀠`?!" "!@( " !@." @6؁#13@ Ȁ   @. sa @6#<@@sa @5b#@ ??$# c@#@/a@?`` ܀@ #  @ǎ ?2 c@-`  c cc܀  cc` sas a c  c d") @\?` 3sa3s a```>cs as a` ?sa< c`3sa 3``P@>  3s a' c``P?s a> @>  s a  s a`sa?s    c㳐 s@˿a؀  @-4 @51@W  @˯  3@-$ @5!`3``c؀`sa`sb8p@! @4"sa@a @ܒaX yc܀`"t`p` c@4א" "c@4ϐ##(@4c`#Xِ"X@4#scccc``01s`Pb8@4@4@4@4@4, [b8@ݑ Sb8(`8` (``Y sS2 y! v! @4x p@4rb8c@4k ```aaa@1sa`"8@4V@4T@4, @? "8 3 `? c@4? s1 b(``@( @40"8@А, 1#耠`s@t2a&#@Đs  a 3 `? c@3a`? &# @4"8? x@ư @@ `U  :` `0 H     P`8Q `@M   H`@ X    ``H    ` (` `` `@ X     ``H   `0 H     P`8ٰ  հ 2Ұ  (ϰ ` "` `* 8`` 2@@ (@` ?bX?@*"'!s"h@M,, , hg(`8``/"@")a@ (`8``/ /,@`-@!s",p @@c  p@+H" @3D<@@"a@2 @( @  @'I sb`@( @A/s?b1s)s;'`5s 3s@#:' s `a`$ `(`8``/@Ւe(h @2b0@ߪp  -@@sa іp @b@(  @3  Rh@ Lsa Ԁ` Ԕ d̀`!,@ %"!s`&!@  @ ;d`` `@  @V 6+@&|'Ȓ @  '@* @28@&i0$@ @ C0@/@ @ 9̀`"` ``,ϐ %"@@ %"@̐ J?  s@֒ax @)  @% @㿈!#?'`@' @ #``, #s`0@'  @'s 5s%s7#κ @"@ sb ? '@*/ &ŀ`@0@`@'А `` ` ` @  '@) @1ڔ80@3  @ @%`s,`@  ̒@ @%0s`"`c,@dc,@ $`& @ j\`̀`` `c, $@m $@ R> @Ð@ H̀` ` `c,ܐ $@M $ )耢  ``@i `@   `@Y   @ 1`  c`4@u  s@ǸaZ sa܀`@$ @sb `@) @ c`< ? #PŐ@㿘"b `L@`"4 (`` @ g3aPbX b̒" `L+ "@ 4@@+ E @ ?2 c`@ @0 " ``@ &. (`@!P @ .  (@2 c` @0\ `@ُ"@ @ ?@0Lb?㿐'`3aPccP  /@(c`?`?@#   b` b@0?0E@0  ׬ `$@ #c` 8@ #  ` ڒc(@/ @ `"s8  @ sF? ` #c   c   @/c!#`< #`  sb `s@( sà`$c,sb8@Jc s b@  b `@' 蒀 @ @  0?#scP* c`(@#r @ sà`!s"` c,@C͐ $"? #PE@@&2} +!#`< $#`  @# sb`@$ @֐ ?cH 1s+s)s3'`7s9s`  @ @8 @% @j s @@0b !` ! @ @z $!@#؀ Ԁ` aԔ à`T`,@T,@2 %"T   `@  @&T` @.쀠`,` *`@ C@ ؠ @@ a@"à`CT"`?T``,' 6%"@ 2%"@ <   @@@"%T@@ à`"```, %"@o %"T @Ӑ@T```s@b  @&r @.o c`(  s@a @% @!̐ @L s!#`< l#`  fsà` @ ]@b X@ ?H@ 9`` @ @8 , @h@0&@ (@< @ @` ؐ@ @E@ j c`(  s@ga  @J4aPs P? cs a㿘sa4 s, * sa a2! `@(  @-w` u s f csaP @ s` T&   %s)+s/s-s#P#a:  @ =a  P@b<TP#@>%X$P9%X $!%aaP &9 @ @!s$!X=a@bP@$!X`"@_ސ  %a  #P@ %T&&# s? b 㿘's#s%aX  aXe aX? @aߔaX&@@$aX`T sX @  X@a˞@㿘``( 1s#!sc!P !P s!s aXs:  aT @ 9!  6$!   `$!s? b㿘's%sX  X X&@   @aX@@&$X T`h )s%s('X   :  : >?X  @\V X: @@$Xd !T  `X  @$`X`*`p@x  @$j`@,d > H`  P" >``@,  > `p`h ` 'H'( 0 @ (   2  `@  @Ғp Ѐ4 ' "@$" @,'   's3 Pc@[H P@ #\@: @E`!@#` @+;  h@ `@ )aH@|p   H@#  @+Ŕ@ `  P `aX @+j 􀢠`h ``@. '``h ,@1p Ѐ4 ' "@#y" @+u'&& 9s%s71sX  : Q 6: X (#\ #\@ ",>`XX@: @$Xd !T `X􀢠 `h@  @`` @ 4   s` b,@?sb,`  `@@  @*a㿘)s%s!'X  8 8?X @ZX<`@@$Xf !T `X 㿘#ssaXaP !s!T @>"!Tc$aX㿐nsaXsaT @8`2 @  )s@ fW%!Xsa8`@@ ''ﰐ C@sa@ b @ @8aB's(T @8` ` P: ! X(@ X@ @ d$X X `T ?㿘1#`Kc` ?@)a   7s a aĨ a!s%#s!P #!P s!s aXs:  aT @ 9!     @)0m  $a$aְ ?㿘sb` s b!s`!! ~saTsaX c88`@@@ @ @D Q@d  s /aP`-saPcs aX)ss aT ! 5X@$XXaT %sP h:  $Pc$X %aTcs Ts aX s!cs a`s9! al a    c  bH@)??㿘cs4aP Psas?  b s b"@(?sya s? saPsa s aTs aXs a aā㿘s4sP` Pc`"?  b  c"@(?b s cPas a5 c s? saPsas a as aTs aX㿘#`` ! `?!=@k   $`  `$ @(c 㿘@K ^(``Y! `2  P @Д * !  @z 2! ;#$! `@fԐ  `$ ` @ (@m, $@  @h    @G@h    $?$  $$&@?㿘#` ` ! `?!=@kx   $`   `$ @(c؁ 㿘@ʐ ^(``Y! `2  P @O!=* !  @ 2! ;#$! `@h  `$ ` !=@) (@m(, $@  @i    @Ɛ@is   $?$  $$&@?㿘#`` ! $`? @j   $` $ `$ $@'` 㿘`` F`(@ `* @`!@ `$@  `.`(` ``@eؐ  `$ ``@l (&@g ``( $`$$@` @$(``2$`$ @A` $@`㿘#`` ! (`?!=@j   $` ( `$ (@'`H 㿘`` F`(@;!=`* @`!@ `$@  `.`(` ``@g  `$ ``@l< (&@g ``( $`$$@` @(``2$`$ @ɐ` $@`qHrr$rrlrXrD?c``& `x 8? c  @V  :   @D%h@`@ &`@Qx  H@*`P ` `@&C?0  @3 @v@&q ?`& 㿘??@  @Z5  @W`0 @N5@&L 㿘\c` '& @&`#@ @(``"`@2'< @Ԗ  68@ ,.2s/b@@ƒa @k3  $@ @%aX?@Z@(@@" @ @%?&2&sbD@`ϐ 㿘@BX  @˶5 @%ȕh㿘?o@+   @5 @%h㿘@ ޶ ! sb8p@Ά! @` sà`@>?  @? @%㿘? @  sb8p@Z! @s` sà`@?  @d? @%`x????耧 c `?'c$`?'@1r؀  @<@%8 㿘@`sa܀` 8 H ɔ @7@?&@ c `2 (c$`  (@-?  ?@ ( @%@᧒x?2 c?@ ( @$0Y    ,| 2J? ( @$b8C? `xo (`2 c ` 2$ ( 2 ( 2 (`2 c$`  2  ( 2 ( "   ( :  @ԧ㿘`Bsb0`  `0`, ϒsaЀ s& ` c `c$`  8H   @k  @P 5 @$Mpx`@???耦?c `?'c$`??'?@֖   @&@$" x @֐ !sa䀠` |  2 `2   @#b ?(`8``/x's`?@ / 2,@О ) /!@n 0 /?",` F @  /@Ё   /x b?a@  / ,x@j " sa䀠`?x<@@@>  |` @ @4 @>y 6 @ @#{?㿘#` c*@ &`  ?`0)s`,&@| @V!Ȁ` ] & @#G?   ଦ, 43<x,`l(`L@sb8p@! %s(`"%(@w#? @ @# ?({@x x@@@ō < ] @@@ . @)   cH, (`8``/ @% @  `@S   c@"?"# @ ``~saȀ` 0 6r @"?sb0`  `0`,saЀ s& %` `%`Qsb8@L# I@"x  @_ @"[9 @#s ax b?aaЀ`|x&|&  > ` c `|c$`|  &   > @Zc `c$` `8  `Hɒ  vs@Ēx <sa䀠`[|`x`x`  x @!c?<@@ @ą |@#s@<̐ #s2/ @а? @!̔0%#s? @-? " @aȀ` ``Đ 2   @!(? `` `` a  x, @K  x@  @!H?<@@  @!6`h? e  @ @ & !& <, `@6, 6@ <` @W&,(l   &! < `@,,&,& <``& ?㿘sa܀`@`@`ע aa`4  `4  `2 `2 @H @:V  2 `D (08@HPX`hpx08@HPX`hpx (08@HPX`hpx08@HPX`hpx (08@HPX Ud < @ Udb   Ud @@<@T UUd Ud fwGOeN]L^O8x{iw'_mکV9n;oPmN3~Zz 8!M7DLNHM|٩,hFb+](.S((OuA e7OقR PM C<^ $kҍ8jSI+FflW땗y;EXNAaTY h [7a+:c;y nCU4*N.i_߭wD&ݭ4u5ΧH.sW8V#-0%Ep;x_AI&\6ؗ[8s`w~(/^S% 81j> =#0KPeHb+ȦoS"0W - ^Sa~p5:5  sb`s s alsa쀠``` `<``8bl 㿘 (`` a@d|  a@?@Ր?  (`8``/".@$$ $ $ $ ` H @ H H ` 㿘sb(s  `   `sb4`ss`` `sb$`s``@ ``@`@d1,s  ad @b?  sa܀` @h ?     (`8`` `0*    ?(8`ЂЂ`` (8`Ƀ(8```* ``8   ?@ *  @ :  (`8``/*`7$А @   ` 8`W`0*2  @ *2     `0*  0`       (`8`` `0 = - (8`ЂЂ`` 2`* *` 9 (8`(8```82`8``2`9 ` * C @*`@C@ * * 2`@ 8*`@C   (`8``/ `7Ё + `  `0 W0*W) * 2`2 @? @  *2`* 2 @  ` `0 *  0 ` 8      (`2* **㿐```(`8`@N@:   *@:@1  (`8`` @1ޒ@@ `H<&@ C  bX @ bHbX%H@Z @@= "/@V @U"h` "` `* 8`` 2@Q@ (@` 0sasà@?`   @1x! @ H<&@ C bX4 @bHbX%H@ @@א "/,( 0I  #` #h#d#\bx @7ƚ `h4? 22 b@7@7b@1``2 k  @ ``" "@0, ``H0@@㿘st cȀ 4?` t@(`8``- sp`(p bsap(`` s@U!t(`8``!!t!!t?@p  :2 @ b@79 ?(`8``: "6 @(@!" cȁ b@7 ?TTht,@T|  4H\|@HdxlhDLX`l|X| (8 (4|$4L    㿘`(`8``B (`8``Z (`8``h  b0@9 j@` ?㿘`(`8`` (`8`  pb@ z@` ?㿘`(`8`` (`8`  b8@ Z@`Ɛ ?㿘`  @cH @cP@` ?㿘  (``  cp@) '5c@ڰ?07@ , 2,@@  =  c@`8 2 .c@ð?@[    ` `#`$%# `$  (``ϐ@Z 㿘#@/`@`\ 㿘 @/ `@`S tax)<'@'Ɛ@' ,@J x@`!@B ,` w@ha?@@ ,`w  @?`"  /,㿐 @cF?[ 8V "R (`8``k"6``m`b(6``w"6`. .` @. .`  @6` . .`@. .`@4,  @&  ' (`8``x 4 ``*2  @l4  @ 8    㿐@ `` (`0``@@ s ax (`8`` '@_2  s ax@N@(㿐@@S /s 8  @ 8!s"8p@Đ! ,p  c(c`c@ c8 p b  %s`J(`@@ #c1!s` $!cȐ @yc(!(` $!/  cc(`8``-2 $(``2$$  sc0  c$ s { b<s  su 0 sq b m c@cȀ h0cc cŝ`^ ̄ sZ b  T $sQ a c"` H!" sD b4   @?x @c} cȄ-  b(  s$ b( s a c( s b$s a$ cP$pc$$7n?A?%b!s!`"@(``'@#Ȁ $! (`8```-c@$! (``$! c`2`` ,c` ,`2 @ 2@ @^L@`xb`0 `;s'c^-`? `>@@ 29@` U`@ @`  @Uc0@  d @c ax@5ax`"  @5`0@Q  `$`` %@`  | 2@@  baLab t c  6p]l`? `D@@ 2?@` r ` " ɒ  ?@ @-   @ϔ0 ( @ߒ x@x`"8  @0@ΐ ` /  bb``$b ~` 6  c`b``#c's`0 2@@  ca$"8qa`pb `LQb`JL(`@c C #c s`; ac c( s 1 a s , acȠ s& a s ! bs0 a s @ a s  a s! bc2" 0c+s)s'%%``8*(`@$  $$%"0%a$ $$  %"0  %aЕ* :@` ]` @*`ڂԠ$Ҡ(@~cȀ 0Ȃ s  s  s  @,` "`@ ``  ,`  @`8` P@+, @@1`@b2@ @+`0s a#Kcs 8a cȀ` acȐ @`psa"h "@~`_ s Zc@% ?Q$   @~I#􀢠E$ @X0=@ cȀ 606 s 40 s (+  s+ as b(#@@ cȀ 0@ @cȀ 0 s $ s   s  s @(Ȁ??B  c` ,s!b〡(2  cq` @2`   c a>  cb @`9sb8 `@0 c a 4*:@0ݒ@( 2```0``"``@ 0 ` (@`"` @В`@ c`a c`(`@@@ ""`$"!"@(`b@&? @ya(?. @s b@U ""`$"!"@(` c㿘` @SaP`ax# $#@0W# 㿘&`( 8``?`? `[`" `*2gc*(`(`8``esa쀠`d?`/a\&(`K`(`8``*" `ˠ  I (``?8`@ (`8``!`?  "6?(`8``-)  (`8``" ) `] 4  $  ) 8`@" ) 8`]ް @  2?((`88`"? ?㿘@(`8``/  ,$ &@ ?@a( :( :. 㿘 Җ `` ,Ő, ? 㿘a"  ?(`8``/2   (`8``/`  @ 뀢 㿘c `ע aa`2 `2 @B @/P  2 c?cP'L,@FPXxP @괘 k\,@`@* @2  `\2,@ (8``/$ (`94 (Ѐ@-(`  `",@ ,@`@@` "%@ޘ@ @ @ (8``ɀ`&@ d"e  @Ȓa \@ @Z(`` ` P  P  E  `P@ (`2,@@,@ (`` ". P @b P `P(`` b(@.  P b@@.PP(``"  @PL @ 㳐!bP  (`` . . @(@&#(` `  $#(@G#(`$ (`8``/" (`` . ., @@i,&,#(``  $#(@# #(!`, , bP#(`G, (`8``/ `(,  a "  ?(`8``/2   (`8``/ `2  @ ꀢ    $@b@@& @ .. .  &c`  ,  ``` s, ,, qsb`lsb8@ڐ"bcc8acpcH?@ɐ@ǐ@Ő@ , <@ @\,@0(`8```.@#5  (``2@# @# @ϐ,@|,&,&6 ?,, @H,  ```, 㿘c _   Zsb` Q$ Psa쀠`8 `2(@ `/@y   $ @c  /()$   /($ @ې$ ? (`8``/ *$ $ `&` c 2  @`?@R) `&  㿘`&c   sb`6sa耠`2? `"  `(`8``/2 @t  {   "s `s&a耠` c & ? a耠`?㿘 (``  `8@V  2 $ `P@?$ @M $ $ $ $ `    `  㻘  (`8``2  ` @    (`8```\=@V  2, `@@?0q` @ "$@G @,`@Ql? , 2(`8`"$@ (`8`򀠠\@@QR $`,$`&"``g`G ``p ````@@Q1, a(@?$`(`8``؀`P$``    ` H aPax@ޔ P@@ ! @ @g sa܀`@G@ 㿈 @W쀢  ?쀠` @L x@@ s  b@@Ɛ!  @(``a@M@?   (`8``/ @U%s $ @eas @ER /,s` ؐ @9   ?@ @.   ?@ @#   ?@ג @ 2?@̐ `s`` ؀c,`(`8`@Ac, c0  @Ӑsa''a '\ ( V " P  J  D   '@  @ 8@@ ,sc``` 0 `0{sssa` @b  stssb@. 6s llÈl8llt㿘c@ `,!=@А* @ 2 c< `0!=@* @ 2 c4 `X`H    ` `7` R ``` @&  @` @` @&` @`@*Y `"\   @4  @2T  @(P  @4F @2I =@`` 48 ` 80 `"3   4( 2+ `` 4 `  8 `"   4  2   (    2   㿘@ Ѐ` (  .2?2?(8` @@ 2?  (`(8`8(`(`@@}$@`=?"` 8?(`p@ (`8`(8((((($`  (`(8`8(` (`@@}@ (`8`(`(`@(8@$``D T$` (8(`8`(`(`@@} A$`"??} $` (`(8`8(`(`@@}`-$` `"+?  (`(8`8(`(`@@}`$`  (`(8`8((; $`@R?>@"? ?㿘 (``2 6b@@G /  ,@`  `` ( , `.`.(    @ bX (8``@SQ  ` b@ ۰?0  @(``2$  "$ " cC  m  ` ` @ b00$ ` @(`8`•M@` <(``< ɒ 6 b؂`$ 2 (``.4  6  b@  @Mɐ, ``$      4 @ nc@M?4$ ` 8 4 8 ` 8 ?@ Wc@㿘 "[?(``U!#<`2 !=@P  $#< Cc(`8``#`\  (`8``# @M 2  @ %c?  @ @K@`!=c<* @@2 @Rx   c<"" $  c@ ??㿘 "[?(``U!#@`2 !=@PS  $#@ C`(`8``#`\  (`8``# @N 2  @ ƒ`@?  @P @L@!=c@* @@2 @R   c@"" $  ``@ ??㿐`@@ @` 6`   (   `  ' (*@㿘L` L@     {  0`dL㿘D`1cH,`,`'s @#D  (` 0`*2 2(`@ R 2@Ll (Ȣ  @LacD cD cHcD  cH ,@ 28@ 2 8@ 28a (82(㿘`` c #` " $ @L& @L$`#`㿘c`0) (`* `&`# )@ *   @2   @2   `   @K @K㿘1#D` @s | @@2 8  &#D ?@ ` 㻐cD`Ab`(`8``/ @&Ԓ 2,`%scH|@'D@1Д p @$ |$D(`$| @ 'cDH(`(`@s& @  ! (`@ F `09 `89 ` 9 `( 9 `<@`! ,@1 2o@1 0H` $H@ 㿐cL <@e!=* `5@@2 `0`@2`0`,@"`(`0`%`0` @"     ?'@ `0$ @ `(@K, @K*?㿐cL :@#!=* ?@20@20,@30' @@P/ 8 @r $ (` @cL< < $ ,<< < @$ 0$@ @j @J @b  @ a㿘cP    @ aH"* `@@ 2``@ .@J@rI '&` ax@Oא @r; &@@r6  &`cP@&`$@ @J@@J a@ L? 㿘1#L`!=@M   &#L ?@ 8a 㿘1#P`"@M   &#P ?@ $a 㿘1#``)@M   &#` ?@ b0 㿘cP @n"*  @ 2  @ &@&@㿘c``k?) `d (`` )@* @ 4@ @2   @2  "  `" , @ה,l&,,& `2  &  `.$  $@@I @I& @O    @qp  $ `(`` c`<$ $ @ $  %@@IŐ @ b`? 㿘@<@ @\`P`TW ``!=>`@@KcT*`H@ @2E@2A@2=@N   @? @ 0(b`(`8``/@$ $@v @ r0 @q $@h @ e@Ie?$ $ 2 㿘!=@L  cT   @I? @ FT` 3 9s7; "` x@8  x<@@{ ̀v @@q `@l `|@g @$  @ ` 2d`@ @0X  ??@ F @`@& s 2D`@( @ה000` `F 2 3!Ѐ`  `c$`o : 64-2 2 `0@H` @H` `  $`  j$`@Hg`  T@H@H`@HT-``2V``a<(T 2%T@H%T 2` 0НBb@!??@x?@#[@{?@wb`(`8``/@#q @O@K @#;l?@oܐ  @> @;0@oϐ 2 @1 @. @#=| !=> @ȐcT*`@@2``@2``@2`@H`@H` `@H  @H  2$&``2@@M, @ @8@"@G@G?:|" cT" $&`&` &`&` 㳐cX   1G*  \1 @2, #\@s @ @ "#\@ H@7g" @`@ ?@    *   H     P          D `H< `<  @L +%\  @  <\@_`HcX< < $ @$ %@ @Hx@B @c?@8 @G7?㿘!#X`) 1 @JV!G $#X @c?sb  @;ϒ`1s@"  c\@" @  ?"@! ,44X444 $  (`` ?   ``" `@  2 (((  ( )?(2    `0 (  0 ?    2 ((( (  ()2`* 2 @?  ` `0 )?  0 ?  !   *㽠 `H sb<`m `8 ,`d(,  `p `da@ (`8```/2 ` $` `  2 ` @!'  ,Y ,, /, , $  d! @ `8B (`@# 5 3 4,`4I2     ? Q  2   | 6 , 2 1, d, , |   $   7 0,! h a " ` |>       `@W @:Fa`, 0l,,   !s!`!B Ѐ?s@  `@/ !   `0t   !s!`!ܚ Ѐ?ls@  a@ ! r  Z`H      L#`d Z  Bsa `)`,ݒ  @ϖ`0]   !@ϊ ( (@φ ! 1  ׼! ?  ``` `?`? ` KaX?㾐``85(`@sb<`܄ (` ta` ma` fa` _a,`d(,  Vbd? d  Jb8 !@ d洖,#`` `  // (`  2 d, ,/朐 l`l 1 d, ,/提    k!`h/   " ` bX@]  a" ` >! d l C H      6#`,l U ,`0t L #! A  ̒! ?  ``` `?`? ` bx? b$㿘` @ @C&㿘a$?!Y(``!(``"? @<a 2?  ؐ "I 2?㽀"ې &`| ''`,@'  &(&`(`8``x`g2 䨔 " ! @ , $%@@ %@@v$@%@ 8`@փ: @d%@ @  @Ѐ`  Mb@N" @曐@(`8``  @@`" ?  0b @b$ V@8Q?p Jd4 =`@  @ (`8`` " , c @Š?2g* @ےc @Д, &@ϒcH @Ĕ,&, `` `Z@@ T` ? D E C"">" :?`(`8``x`g`2",aY(``   ,aYΖ  ` /,``` ,s"@@ d&,` `(`8``K `L s, ,`D d&,  㘐`d! /  & `| h >`  H >`H>! H 8> X>.aHsa` `t 0a)ٙ 6 .a(`t g  0&.a(sa` `la `,  `l S `,& 4 & `(8``4 `6`30`1 O( `6&`w _ h &oH&  (  & & & (8/q &n*`4  &  &@ &  aI  aQ?c , * `4&8``2 `` &(&< ``(` &  && (8``K  "> @ ` a&  ` > h    & a " >` > & ?㿘a(``! @a   ⍐ " s a ?㿘"ސ ̄?! @ޔ   &  (&```, ds_@,&s, D`W d&,  U`d  / & N`l , & H`t 0 & Ⳑ`| h >`⭒  H >`H> H 8> X>    `@* 8``5/ 4 `1`221., `8,.,    &(M&  &  (& B& h* 8``K  >@ ` +&   (&&&, (`8``/ ``(` && &  h   >  & &  a " ` > (`8``/ *&㿘2 ?ص &?㿘, ?צ &?㿘%Xch)*'s@N 2   @G #  @cpX c h`   c@ ?$< 2㿐L'L'P'T'X ' s bsà`!s"` s@&c, @⦒`$"sb8! @c@YQ  @◐ 㿐!#hH'H'L'P'T'X' @Y=@#h㿐P'P'T'X ' s bsà`s;sb` s@c, @f`'bsb8;`@c@Y`` `@6Ĕa@``@M 㿘cd @0 @k#bX. ?㿘@ @}ђ` !@lb  $#h@l`  cd@kV#h@sb`  `R? ȁc̜# 4@LXdp|PPPPL\(4@$%(((%X((&x((((('4%X(('(((((((((((($$%%$((%((&(&(''(('@'((8(D" 0" 4 @ ` ` `(((`@@@" 8 ` ` ` `(`((@@@" <'P'D'H'p 't 'x '| ' ' ' ' ' $' (' ,' 0' 4' 8' <''P? H(P ''H'dptx|'h'l 'l@ (`0`' (` 0` (0d(0@ @/ 7  @(` 0`) 1 @(0h.6@@@(` 0`/`7`@@@(0+@3(` 0` . 6 @@(`0`@. 6@@ (0@@@(`0`@ (+ 03 'l /` 7`@@/ 7 (`0`@ *2 ) 1 @@ @+`3`(0(`0` 'd@ 'h*` 2`@ @@+3@(`0`@`Vptx|@@@0- 0- 1 - 7`- 7 - 6- 6- 6`- 0- 0- 1 - 7`-- - - - - - - - 00- - 1 - - 7 7`- - 6- 6- 6`7 - - 66- - 6`- hd@@` l'2  @2 001 7`7 66- !- $0- (- ,- 0- #- '- +- /- 3- 7- ;- ?- 4- %0- )1 - -7`- 17 0- 56- 8- <- 9- &06- *- =2 1 - "- .7`7 - 2- 666- :- >P`@'?(   )  'P@D `4 `0P @?w'P (` 0``4` 8 3f+ff(`0`8?#c@8`8* 2 㿘 $   @g@B: 0 @0(8@ @c@8  2  (     <@ `0`(`(`@  `(`0`@`? 㿘 0@2`@Bx (b`  `D @`(`#\#`#d#h#l#p#t#x#|###`@EΚĠ ?c  @(@ (  `\`@!( a8@`@&@@ 㿈`\` ' @1i  @ 'ws!@,"H1s'@Řs("H@!1s"H` "` `* 8`` 2@U@ (@` 㿐@ǐ!@   2+ +`3 3`2 @3! *`2` @ !@)2`    *!@!2 '@!@! @'@!Ф , a8 @4``3` `@ 㿘 `(` .`.1@!؀.`.1@"@ ԁ㿐``81(`@1k"8 ` X*`@w"Ht"hq"n" (`0``u"d"a#^#([#8X#HU#XR#O#L#I#F C @@  `"   ` `2  @ m    @ d! @',!(1!8@ށ@ې!H  .16@ N!h1! `!`!!@İ 0 `  `" `"P@ 0 81Ӱ"x1а"1Ͱ"1ʰ"1ǰ" 1"1`#@ ?c?`(``` `@ @  c @~ )`X!?@(@?@@~) ?@H?@}%d@h@}``  @{@} `"2?d( '@j ?`chH'chHs J ?@K??@@}@?ٮbX@}`h]c8@ c@ @@ ,dcc  #@  #@c  #@  #@cz #\#@z #`#@cn #d#@n #h#@cb-?#l@ؐ@}@@@|' 㿘 @t   `d@u͐`?`d@?`?0 @p?2 @Ē` `(`@6`\a @'@5 @&@`Mc(0cd`` d   Ȓ@.@`8  @   @   @    @  @C@  @# h`HԂ`H` ` h!膣@ @c?"h  '膀沄@b?'@# 2#**@ 3`+ +`@ ` 0((@ @c@ C 3`+`: @+ @B@E9#@%c@B< c2 `@(8cc c2 `@8ccp* @+2 : c  (8`8@`   ` d` `! d  (@@)/\`.`"  c|@{ @'*2@   @  ` #@,  @b # @  %@  %t@\@ א \cx t` ! t ct$ @ "`@  y `# a`@@ @ @ (ct* $@ @*ۂ@ `\a `(``@z @ }!a8aH`aPsc`ah aa0`* `4`@ ]  *` )     (`@(`@(`@@ G@ @`|^ `ِ  @     @ "csc ' @ '@Δ  '`\` '@ E@ s c@,Ô c *!x@ % ` ` `` @(`@(`@(`@@ b@ ?@@ ۦ `x  `@ڿ  `!@ ʐ ?$ 4W `\````V `@ڜ @ `\ a@y ?c@+cx ,,4`44cp* @*2 : `ؐ  (@)`X( @耢? @=` `H`H` @ ?І@ 8`@ ?ؐ@$`8В   @;  @5   @/    @(  @ݐcx @+ `\`'t`cx# `t `ct Ȓ4`\d  !s#4 4 `В | @w  &`X@ !`X?c@@@x `\`` c}@x ` 㿘@  @"㿘@- @qnb`Ԁ"`@:  c@ `d``0(` А@@ޓ(`" cŐ @qCa`@`c`d `\#c a@x @" /'? /  @`!$    b8@`@w?a@+ cx'l` 'p#`7!/?;9+`3(`T@cȔ   @]# `ca \ d'p \`@$ \ \ \@@ \ \` @$ \Аc@ޒ  \@+ccȀ 2 cb@  @@*Ɛ \Ղbc@g 8cr`  cah cb8ap  @ " @,ِ ӒbPcx )8c \``/`%`@ "c@, wa   @]o#܀cj'lbx@  \` \cȂ`$ \\ \u` \r` cȔ   ?@]L#܀I'#tcߒb \cȂh $ \   @]:܀7/c͒bcȔ    @]+܀'cbВ`!@w ?b \1acȔ   @] #܀&cb]@'??b&`" M @P H @L 8  !#@#c@&% @w+< c r , |H J$ @@ ,| ,@ؒ  `X@*[ 2`c0,`` @@)x@@wߔ! `X`\`#cH !#t@3#p!#t`#t  `#t @:''ht s``\`s#t`p@ ) 'd*d'`(- `'\*`(`--@@@* * `! ++ , ,`+`,@,@-`@! ! ! ! ! $\(/`/ ! ((`((@@ @! ,\`e"` `n! Xa2! at! @`\?c $ c`|`<@8@#܂` ܒ `l @ϐ`$  ,`l  @Y,  Вc! \`@  \`? c@vc  \#`|`<@8@܂` $ \#`\ d >c,`В  @v? !s#c?. `` (`0``@א@ ``w@s!`  ` 6 @ ```0`d(`0``@貐 @ `q @c㿘b `0b`w)a' @ "@ZӒ 2 @s8  $ '`@  `` 4` @ G@\T`2㿘 @2N`(a!b+)`#')%`8(`@ $ $ $` %! %`@   $ `X @ 2a7 @.?Ԃ?b`(`@````a` `耠``䀠`a@[ q @c`@5`#㿘a a`  ` c b\a 8 ` @2`㿘a ` @ 㿘a ` @ 㿘a `  @ `a@d@d@ d R `R((`88`@?@   `P 2ah ` ``@ 2 2ax㿘a ``@   ć `  `` * (`* 0`"  `  (   ;@`   ;@`;@`  &  㿘a`!c#a85@(@d$# @r$a(#ad30&a5@h㿐@a   @> /@1V !@h!! "d@qa( "d,    @, a @hVa @q!㿀 @qܒa(a/ Z@hAa @qw!ȁ㿀 @qǒa(a/ Z@h,a @qb!؁x @L"da0a@h 6@qL! @qa((`8` ? @ ba7 @ga @q.!㿘!1"?@O㿘 `X@`2@   2! ""@3p Ԕ $@ @qQa(#a0 @ga  ba' @ga b(@ x @̐"da0@ga b@ @q"a((`8` ? @ a a7 @gza bP@ 㿘! "d@pa(a"d @geay? @֒b`㿘` C@"pbx`(F@#" c܄@ `@2 @2@ܐ"`2c?ccb`( b q!b@`"@2 @@" @2 ` @ @@@  `26 `1@"㿘  aD`( (cq b@1q@!" ?@ 2㿘``0  xa(@`(`8`x  b ` `(`` @`(`8``@& `211""@=@;" a8@4 & p Ԕ $@ @p a('%0 @fr?@#`B@`< bȒ @0C4` 'b@ΐ @fS?ba bb@ے " 2@@  `@J @,㿘`@"@2Z㿘a$`a`    a㿀 `a$`a` ِ   a$?c   !@TP􀢠 @#X @osa(a7 @eؒa?@o#p㿐.``, '@   @T% c@s  `, ,  `2   @  @  , `4?`   (@,㿐.`` '@   @S c@5 `, , ` ` 2$   @   ( `4?`   (@(pa`"В  (@ @nݒa(a0 @eCa6  @` @c ccȀ`c(@ 㿐'a`c` c@А #cȒ   @Sq `@ *` ?c $cȁ㿐! '"d@na(   @SM#"d"`0@ a @dݒa @n @㿘a `(`8``21.` P @~`X㿘(`8``0 +)  xa(@`(`8`x2   `, 8``f` @nP ] @ b``D   `D@     @s ',  Ѐ`  (`!((`8`(` Є`Ѐ`  !((`8` ,@8``\2`  *`@m:`   ,@$@ 6&"@o &p`Ӓ @d ! '  '] !/Ӕ "d@ma(aӠ"d0$ @d a怢 @mB Ё㿀` @: @,ݐ @  @[ @m|a(a @ca?@m 㿘a`a``6 aa ` ` ` @3` a`  \ cā \h.``,@ @  '؂ `'ܐ@mZ / Ȓ@m3!!  /@mN *ǐ  c̐Ԓc@$   @k`@: `"a@1 @  ` ``  (`` `4 $ @U` "` `* 8`` 2@@ (@` 㿘`F. `0` %`:#>`2`"*@`ѐ ,"@@Đ ,@` * a`(`8` ` * a`(`8`@̨`@  @` 8`@`Ƃ㿘 `2 @! @! L`` ` < `0!`@r < (@@"" `k ,@^ , `_@R  ` 8Մ```D >`@8 >  8@a @̔ @  ', @@   @' , `a(@,  @la(a @bia  @ڒaHP  H@ @ka( @ka @bLa  @aXP  H@z @k͒a( @kɐa @b/a  @ap㿀  @]%0bda$ @b?a  @L7 @b a?a@{ 㿀 '  /@PZ*`0` @ a@   `<  @ #a0bda& @a۔? aa7 @aђa?a@B 㿀  @a0da@a"?*``(``(``a*`2`@P!㿀  @ؐ b$@Ґ '@k$a(a0@aa׀ "@j!؁!b@&b(`` 'b@@(``"'*@2@(`0`b"@  ` -@ -`  @բ`x.`'''' `%, `!, @! /  @y ? @| +bP ! @ "@    @@n@ܐ    #@@p$ a@  8`@O8  H@  @@! !(@jg!( @jcH%0@`ɒa`?!( @jV)'8'0@`a   (`Ȁ(bh@M"x 8@F"```6 `@( ` b\c 8`O'@)@N 2 @b@)(`0`#d((`00`#`#h#l- ,5 4,,`44`, 4 "@#\@', @`@ @* 2 ` ܐ  @ϒ `H, a`@Y#8 cX@̐  8 @#p㿀  @Iabd0a `@`?/a@i `<`(``@R a   /@NG`"7 @c`@7a @_֒a?a@G 㿐 '  К@N%"@  c@q @ a `(`8`` c@a @=c  Da@ `x8`h@/c Da@ `|8`p؁cԐ#؁cԐ#㿘`  @2 @Q\   ?㿘#? K`@ 㿘a`% @` Ȓ ސ?4 `H@  (?c $ȁ㿘 ? ``@ِ 㿘  !!`   $!a```"`@ ``!#Ȓ `4`ǣ,`@@$#ȁ㿘 a@, @@PѠ  2 @`,  p 2a@   $@  @h^a(!!0 @^Ēa  b!' @^a b(@+ 㿘@L  qb@ c?c @b? a0@I  @ek @%B㿘,a`aP`a@, c  ć㿘a`a`a@ c  a8p@L 1bq b@@e&T 2@b@ @e  @$Ԓ  $@j @ga(!!0 @^#a !b@ ' @^a b(p@L] <bqb@@db0 b8@O  `@Oޒ `b@@  @dɒ @$Ԓ  $@ @goa(!!0 @]Ւa !b@E ' @]ɒa b(p@L <bqb@@db` bh@O  `@O `bp@X  @d{ @$QԒ  $@ΐ @g!a(!!0 @]a !b@ ' @]{a b(㿐 `2   ^(`0``"'  @"   ```  >`@  >*`"@2`@&Ð @" `2  S@& @" S(`8`  R'*`8`'ad a` ) 7(' ('@"ȓ*`:`"@ d`" B@" B`" ^`B `"@2````  ^`@Ǝ  ^6 ^(`0` "6 b ^(`0``  x``# ``#`#@ |` #@````a  `@S  ` 3 v(`0` .. 6 gc?cXa ` ݒ !   @Ӑ '@f&()! @\aҀ " @=`2T`@Ⲑ#O`  @?c#B @( ''@e!0@\faր "@e#/``2@⊐ ?c `'`ϔ @ x?@А` ` @Ӓ` 耤@`? 㽸  !"d@_o%$ ( @e#a0@\aܪ  8@L( @ea0@\a  4@<(@e a0 @[a  @-(@e a'0@[ؒ  @(@er a0@[ْa’  @(@ec a0@[ʒa  @(@eT a@[H  $@(@eF a0 @[a`?`? `2" "" "  # (@}` o`@u 8  p2'(`0``" '?c@"'@ @'V7Ҕ @oŐ O @ǐ@$ѐ@ P  @(@y  @dڒa(a0!@[@aӀ -j(`8``'k(`8`` h''ad a` ) 7(' ('@ `@p쀠`k p@`   a0@Za逢?2  x@`M &`#`   ` Ѐ` `:  @Lʐ 2ۦ  @n    `\ ,@O ,`@   $` ! @ $`2( @ x  B X`> ! @r \``( @i"`qb@\`"@ ! @[ ```( @R"0qb@``!@ ! @D cd @> ]h  `@!`a(`(*`:`@ڐ!0a0@Z(a؀ `(````` `@ï bd`* a@ȑ2 ``` `@Ú a$`Xa` I `))`P#@a(ba *`@Xڐ"a`@x"bX`@p" aĀ`@h"0```X ``@J `````` ``@#@F"@#')0 В  (@ː @ca(@Y!6 6" `@&"P a(@l"` @#R   bx'!6@Yd 6c@Ԑ @"  ,``` `@ ``` (`@Ԑ ( ڔ ```ѐ )`@Ð )```Đ ``@¶ `6@"Pa`' `  b`@2`@- @  @ .` `  @ a `2`c bd@    ,` $`2  "//@ @bTa(a0@XaK kр`ҐЂ #\Д! @"4 b@b4!р`c`(р`` ﱐЂ #\Д! @" b@b!@$", 0``@"a0bda@Xh   `@ "a0@XYa  `@"@m p Ԕ $@ @aՒa((`` @ ?Ѐ`  b@aÔ  c(@ a @X#a? @cPp Ԕ $@Q @aa((`` @R ?Ѐ`  c`@a  c@ a @Wa? @֣` @]c x@ 4U  !"d@Ӕ $ @ada(a0@Wʒa Qc@ ' B(`8``0 (`8``x '  `  cЂ`7c@T `(#\Ԙ@RP  `@ ''x 1@a!(3a @W|a `h@   $@!( @aa0 @Wha ba' @W]a b(  8@x @ @ '̀'z'@I*  ?'''''!k' @I2  2! 'Ѐ` 8*' (`8``:2$'(8`А '̠qb@ 'L .$ $`@  (``  3@E 8 (@ `   @`?   @  'x@ ''Р @`\a(a @V’a耢?@_ 㿐a `(`8`` @fcВ 1r!(  (@ka` *`@B3 " @a!( `2 @& 2 `2  ``2?2   2 a(@.  ` `@A 㿘! D@@/a @   a?$ D$ Dp %`  @`+P  @b8a   (#\! @š `(@_”!@֐!Pa `"Dؠؒ ! @\ @_a( @0H@Va" @`1"@_@!` @=  / / #\! @| "`(@_|!@!xؒ ! @ @_na(  @Ca0H@UВa%   @ԁ`1"@^! @h!ؒ ! @ @_Fa(  @a0H@UaI  @Y`1"8@^א!3`@@!耈`@9!耈`@2!耈`@+!耈`@$"耈`@@"耈`@" @"8cЀ`fؒ ! @ @^a(  @a0H@UKaQ  @`1J@^{"H0F􀐀쀐?@_  @ܐ"`  2@@ @c0bw@ǐ!@"p@"x耒  2@@ @cbw@!0@"p@ a#㿀 %` !@ӝ`+  @Wb8# a(@^o"d bt@B@o'@y"a( @^]"d"d0@TÒa% 6@t`1@]" @ ` `a `0bt @a0@Ta"  @O`12 @͔  @]Ȑ" "d@^a(bt`@n'@)"``@#"a `1bt @ِa0@Tfa# @`12 @ @]""da(@] `" '@n@"``` `@Ґ 㿈  @k #a'0@T'x? b@  c@ ax''@T?c8@4'hd@Ŕ ` w)a  `  @` @에@퀤```` 0`@v @㿘i ! "d@]ba(a"d @SȒaz? @9cXp QД $ @@]G `    @B 􀢠  @Zch  @(`8``- `@-c 'i a @Sa? @cp Ԕ $ @ @]a0 @Sna?2 @ޒc@#`@ #@} 㿘c%`!  @ƒb8!(@ ?Ѐ` R#0@SBa 6 @`F @S5az @?"a@S* 3 #?a(`8`@!0 @S! &6  a(`8`! @S   X  Xa0@Sa~  ā   ā ?㿐c؀`  @A8 b@, Ѐ`  @ɒ?@  @>c "a@>  bd  cж" Ѐ` 8   @I 2 @\ה 2Ѐ` 8z `` ! @Ԑ @` @ 1#Д @Ɛ @` 1"t@ "d  @\!( @\   ` `  &C  ` `:  ` @ 23` `a "*a 1# (`8`2 @   `(8@2 $ @  $` ````  j@=􀤠`@ؐ`I c@(@N p Ԕ $ @F @[%10 @R!?@б`4@Ы`.@Х`( c @˒ 'c@V !@Q۔?2c   ܒ `@?㿘 4`  c@ ? @(`8``-8`    +-" `a`A  %`g  %c q @(`8``倠`C`?  a  @[!( (?  !(@[   ``@' ?   c  @@ 2 $?` a  a `bd(` cȀ  c؀`  @y "  !(0!(t0"da(@Z ?a@ `x  `|@@b  E ?`c؀`  @@`(@ "d ~cȀ`2l? !(f?@@ "` `@` ` ` `@ra4`` 2```"B?`@@`  @b  ``@`@ @H`0Ā `!?` `@`2`@4`H@?`!Ā@`!@@%!? `a7)- a` c؀` c"d09cȀ` c̀`ʒ z Xb\`` @Ya(`a@PY` @ `1a``hcĀ` ` @YՒa(` a@P<` `x@  Ā ?cD# P`P@@ L`L`PP  ?@ @`L L @`@ @  2 H  H`HĞ@? `L L `  @  2 (  (`(@? `L L 0`0 @  2 8  8`8@?  Phad`P L`L`PP   @?@`L L @`@ @  2 H  H`Hƞ@ ?`L L `  @  2 (  (`(@ ?`L L 0`0 @  2 8  8`8@ ?d,8@L` pX$H㿘 D(`0`"0 @`D(`0`&  2  2!  2?  @` a`2"   a̟@ ?'H`\'Db4`  b<`2 'b@ ''H'X'\'`'d    'h'l'p't'x'|' D(`0` D@ P@j  $  `2 P2(`2($ (`8``.2 (`2( $ 'TL`X8  2`@(`  `h8 ?h2`l(`?h`d*'d`PX4 ?X2\(?X<@ F `v`(`` @iw`ؒ @io0@  `@Œ @~E@~B0` @w`d (``9"@~1t't @Ő  @P   $@Wh @@Wb$ @<@@@ 'p0`|@@WK$ (`8``-|@i|&'|x@&'x$`T*'``'2DR`H''9'p' !?!@h@}ːtxlh''! '@h@}d '@hה(@}b` 'X\ @hɔ@}' '|'aȟ@b<  aH@```㿘b$`c @   @  a`~a`] Z'X (`0``AP``ZP;`T8P(`8``. a@`a!`EaЀ`@姐 @堐 $aВ@\@ˣFa`)` $@ 0@Ր0P(``P@ v@Ȑ %ax`-ap#+ah)@ 2D@m` a@&@㿈 @v'H &@bY!      @:#` @L`h  (`0``  `H   @ !@b2 a      @:Ә#` `H@    )5397'-/;#% a`G(`t@  a b< b8 b@/ a  b@ b( b<1 b8 "D  b<!"D  b<? bD a a b8j b@  a b< b8 b@ a\ b(  b8 b( b< b@ aN a  b< b( $bD$ $@$b ='b,;  ?8` 5$ %$  /% $+& ('" $ 4$   &b0 &           % L@pH@A?\?bD& Db<`#`b4`b`b,`b``L`" b,`" @yb80`@8` b `#L` ` `2<b\bx3b`"cda쀠`$b!cL` ` `2`l`b`"؂ala쀠``a a`"chb8`"`b<`"a a耠`abD  H,`@ `P ba`qb`r`~F@` "` `* 8`` 2@@ (@` 㿘<(7 I0/ I!```/ /`  /```% |` |``` @`  @``` =` =@0 0  ``` * ` *@ 㿘b4 L`  @ !аb` Xb: ?: @@_JB @ !ذ@`Pb,` b` <@@u㿘b4`  (`b` `b, '@`5)`1`*` ,4 , (@ ( H`@ ` "  @  `   (@ ( {@  2 ``3` `@ 㿘%``"  (^ `   @m  2 㿘b4`  (@`b` `@b,`2`b```H``*` @&@@ސ㿐͐ b`@`"b<`b`" b :@: @sϐB @"! `.+`*& (`` w  @  ( ې``b   @ ```2` ```M `@ϐ 㿐d # ``@!!@  2 @!$!& ? @RR$``.$!$``a `-!2 @@@2`@@`b<`b` b :@: @s4B @ᇐ! `- 5-9 (@O `@`Ԑ   @V 6  `  `@E`@@-`Ң P! d`?@Ő 8a $ db ` aa?ن@?B @(bX   @ bHbX@Q @@? "/@"p㷀`@`b<`b` b :@: @rB @!b`ybwaXb a؀`b4``L (@Ԑ!b`"Xb  :@: @\B @ྒ@ ,`@೐"bD`2 $ 4@ઐ $ @ঐb0`"  @"<@"2  ? ` @ 22`" ` 0`P "@"0@y(b`@@ɔ? "@@e@^b` a쀠`"0@`P@cb,` b` <@@2<@(@/`@`$@b ``$@b@P#?2@%@bH@ @(w@ "@`` j `@``2` 㿘`X @ΒbX@} 㿘` )'%<`& `(`8``(` ?(8` `$ ` p  X(@`$ X@ǒ  `(`8``(` ?(8`@ (` cH#㿘! `P $"H"@֒` @i? nb"(`)@%`h`l`@`@2@ @%"L @vT  2  , , " @` 2`2@ 㿐   '  @s ?bH`@;" @6"㿐    @se ?@_   @sW ?bH`2@"@̔  bȜ#@LXdpx݄ݐݜݨ(4@``p````H``````D`````````< (``(0`X`H`0   >06|` |̂` ́6` >c  ``    6\(``? `    `)  `/2 2   @`@ 2? `    `)  `.2 $2   @`@ 2 㿘#0@`@Ȑ  .@O< "@u̐"`?O x@@(~"``"  (a`(`8`)  `(``뀠x  X@u@N @/@@А @2ڒ`  'ܠx @w!  @3㿘` `     & @@ƒ `"4 ``" 4 4 ` 2 4 4 `4 ``` (@@   2@@ݝ@@4`ɀ 㿐@ݑ (>cЮa   c 9@X ` H `@z` %@`#-`@l p``@# (`0`(`@((`-`0`0@(`-`  4@ `m @ ,`4 a  .``(`0` * (b`  `D @"`(`#\#`#d#h#l#p#t#x#|###`@Ġ c  @(@ (  >cЀ`@Ր!( a8@β`@&@@< `  )  ) 0(@(c x@9     #\2` `+  @ܥ Ȑ  @2 . c@ .@ܓ   @! . c@ .@ ` "` `* 8`` 2@z@ (@` 㿘&@`'@c p1` `` (`\`Ѐ`,#`3`"8 ``G1:`+2C1`3`:`22:1 1`<241@,/ @' `((`@  `!(` 1  $!  .`.1@!@    .`.1@"@! :1&`4`1!8@vh>cвa  ``2  !@!H@ `@Ӑ!X```J ``@ `4@F!h@В caxaa`?Ȧ`1) `  @5 . @# .@ۘ  ?@ې @ی `  @p `Ѐ㿐>cА``!#\!"P  @ K"P c㻐.@m`'ab @ @ @LlW Q ``$@ ?@"H 'Ϙ$ "< @LL 1  ?1&@  ``(`8``$@]ː$@L)?@* @ :  @2 `$ X ````e ``"F 8P `2f& `R#`2\z` ``E#8`A#Psv` :#``2B`U"*`@$!!!!"h"   ((`*`@@"@4 `!`,"`!@ ) @ڀ" ` ` "`2 "@p "@j"    ((`*`@@" @\ Ӑ!8А"8ΐ#̐#(ɐ#h@ΐ#  @Ֆ . c@” .@6#  @Ė . 2c@ .#@"#@!   (``!H(`@ # #   @>cЀa  `&@` `o*   .@{ 2+ ` H@\ X h@ْ`x' n$ R"F C  .@S ": (`@ٴ 0@ٰ @٭!   (``!H(`@ # #   @ُ>cЀa `(` @ق$ @y `@t ȁ?cx>#?cȂ(?@\@J~'>@\H@Js#>c@\h@Jh>c؀ @[@JZ`"(?c܀$ '@[?' sbȔ J ?@[Ԙ??@@J1@?٤@bX@J)>c܀???``:?>c؂'a0a8̑ ̕NʁH @??c@@?w8@?a a('?;h;`#\!?@0@[@I?@p_@H̐  @h 㿘D @AZ @u@ؒ  >c܀@Bj`?c܀@ 1`?㿘 ` D B C `)2`,2/ 02, > @T=c > " >c``" >cЀa"  @k!p  d   ?@`@ 2 㿘  >@Tc`?h   !@@*@Af @8! @3! @/!b ca@A] @  .@   .@@  㿈 `(`"@b` bb8@t?"` ` @tٖ   @tі *`2`@ݔ@ٔ㿘 ` . , `)2 `2 `3`# `1220@ר @עX   `@  bbb 2  '@s? @F` > c`> `>ca"0`cЀa  @ @͐?"@ 2#`!6 \ (`\ >#  ?`'`!#'d(`l@  @p>@c  @   @    @   @@lq  >@ą hĉc` !` ؈ @@'c  ?؆沄@b?؂'@Far H a08 L @@?` 8a0L88 !8 `a(-8a(`-0`@F6: c  (8`8@`  > >#܂` !#  (@@)#>cЀ`E`"   a@F >@֌#@@ֈ#`cЀa?  @n / / ' @6 @n#p?````d@d#x`c@^#c @`` '$cta8@#@A"@``  cX` "@- :>`'􀠀*@2>` >̐ >!># ``* $#@2 6: c  (8`8@` >$#܂` ؃(@@)>cЀ` ~@! `" * `2 ##@>@ڐ#> (`  2  @ɐ#>2&@>Ԓ&@> 뀠@E' '!ab "@`(`8``@ե`'@*@4 4$ @Ց p' `@`h(`` @m'@*;o@y c h`(@ ѐ >cЀat>t@b  ``  !@!H@T &@`B` @ , `   6  0@9 `"@ ,  8 '􀠠@ , H@"` @ " @ , @ P``` )>`@ )>cЀa @!>cЀ````g >`@Ґ >cЀa"@d 0>c耠 >c@?  #cX@lV>` . .  @G6: >cА  +)@ (?. . . ,cX.   @ h. . . ?,cX.  *. >c. (`0`0`. . ?. ,cX  . > @Ec 6 > @?c c `@ 6. . . . ?. ,cX> c@, 6  O `#\?(`0, . 0. ?,cX00. . . `9#\ @p؀? @~` >cc` @ ?@ 8`@ ?Ȑ>@c   @  @     @ Д @  @ݔ ``>c'>c6 ` `  cX' '' @ & >c@D h>c@ p>cЂ``  a@C x  ">c܄ ` a(Ha ?@?  ?'''' @'H c   b8@@BД?6a@}o  #`@k0  cPcP; `+??y3 c     a`2(`@>c!>@h8 ".#`g`C"##`G`A)#`@"`L##``g `l`a `c# ` `s#`#`` 4##``#`  ` @(`8``ƀ`SnH@H#"cȒ @'@?'`c@(`` @(``耠@"QH+`!#Ȕ   @(̘#>? c#;a>`@>c.>c*@  >@ "`@x c c@} Hc>c @!#Ȕ    @( a#`@wߐ >cи !#@0#?0 (``,@(``'0ap  @ @ ΒbP@0 @B?a0r` J@'%c` > >@ؐ!c%>Ђ` @v  !@ "a8#Ȕ   @(##쀢# bx>?ۂ@>c>c`#x* |H>Ȃ`h  @iՐcȂ 'h 'l 'p :'t ?@ `@APaX>``@#`6 @+& cX>@J !#Ȕ   @'ɘ#< `#8ax>c.>a!#Ȕ    @'쀢'#b>c?c!@B) ?2H?b>c>c cH@?@?b&     ?@:ǐ  ƒa `>HcЃ,  . @v 2 hhh@h  @i. 'h 'l 'p :'t !?@`   `> ?```2`a>@;#>c >c6cX>@̒c Œc 4H  @h 'L 'P :'T @' " @@za`` >cЀa@">c )@Az 0 b@@*7>cЀa>#>c  )' '@Ae  }b`c ) (@A[  sb>c`b >>@U#p>c`?   >cЀa )0`a0?)0 `( @" @b>cЀ`  cX(`@m6?c6   c\>@R#>cЂ @ '>c @@ >c` @ '>c ) @@ ? b>  >c )' *@@ߘ ?b!>c )' +@@Ҙ ?c!>#ЀaH @h #X'X @h !># : H@@  ɒc8>cЀa #  )' &@@  cX 2(a2 @ a@ Tcx6c` ` `  ` @g̔  $$@ )$` .$`6c````8@`(  @"Đ $Bc $@ )$` /$``($`6c```@`  @ ? @9 `$@ )$` 3`$`@9   h&c @  @?^wa@t ` ``"`cА@8`  גc@(@2>cf  ' @  ` #>!>c#,`` @n  $` cu 4` ) .@?  `(aa ) @?Ҙ  `Ha a ) @?Ę  ܒ`p   ) + @? 3 Β`>c@l Ē`@ `@m~耠#@3>@ 3>c!?##`@?  ac#`@?  a #>>@ >c0?'c@?f #>c ' ) $@?\  6c@?!8c ) %@?P   @?!X >@Q# >@Q#XV (?@!x >}#@! >u#@q! @7" @7">cЀ`>"@7 aa`???? @ >c`>> 6 c|)6 c%>'>8H9>7> #|`&#|0c̀` &c0c`+ %c0逈`? '؂  @l7܀ ڂ'H 'L 'T$'''''P'X'\@  @|`@>!@>P 0Ɛ Ѐa@\!0Ґ#耠>!>#܀@> c! @Ђ@@!! @ʒ`0ː #܀@Ɛ`?a#L@㿘! X#`@b@e X bP`@(@ 㿘@]"h @Β`(b'b' b !+?'?@%?"# u d j a3 3$  z+ t+# @#Ȁ@ %' "$$@OQ =`(@J ?,b  %@#y '# @rǒb#@? r쀠`b` ` @~쀢 `b@wh . ?@ (?. 2@wa@@'@b @(`8``+2@`?@ @Ѐ` ( `.[` @(8`?@=K (?" ,@d D(`(8`8(`(`@=$@30"@dܐ?` (`@  ? ?(8(`(8`((` (`@ (`@(?ʂbT $``@n d* * * $`  ?` ?(8(`8`(`(`@$`  ? ?(`(8`8}((@` $``2``$`  ? ?(`(8`8}((@`$` `2   ? ?(`(8`8}((@`$` (`(8`8(`(`@;$`@;? 8`(Uc?`$`21`?` `"?ؒ @Ԑ?c(?`( ` '?@?6cH0'@} @J `p %@ےcP`?@`"  @(`8``+2`? c` "@I} ?@  ;@ .@"@   ` . " @u .@@ &0 @(``" @"ߒ @!P@` ꀤ 0@ڐ!@K S$!0@0%# Wb䀢`"''#@0 6Ebh`㿘!"x @4ٔ! 6 "x @rqax @f  2  b"b"㿘 @  !@$ 0 @K9"t!`?@4*` 6 @x"t@d $@0@K  0@o  @H 6."t@@Vbt@B $@ 0@JP<@/ "9   @G bt@0 @@$ 0@` @8# 6 @bt@ @$ 0`@J0@[ @ @f㺘cp' 'c|'$` " w b!@@,`02#8$/c ''  A   2'cР 'A`0'  /    w b!@@`0#@` 2'㺈c'܂ 'c|'  ~((`00`(`0`1b` cb|`c`(@ b`b|` ) (00`@*A) (00`@3`03`0A0`0c'܂ '  2񀠀򀠀b` cb|`c`(@w (b`b|`C cp'܂ 'ܒ$ " w b!@@W`0@S#` ]$ @ b` cb|`c`(@6 Hb` b|`  bb|`8`h' 'c|' @^R P`:@(``"/ /@7 P OG P   "w@!@`0 P     0w@!@ڒ`0# P  w@!@ʒ`0  w@!@`0#@` `ah`x@W p Д (@]ߐ`@71 ( '% (  "#w@!@`0# ( "w@!@s`0#@n` @ 㿐` b"@\ "   l)/ p  "4w@!@?`0# ` bw@!@,`0#@'`  @"  ` @ @ſ 㿐` b"@\ "   )/   "4w@!@`0#   bw@!@֒`0#@`  @"  ` @ @i 㿐` c"@\J "   )/ Ė  "4w@!@`0#  cw@!@`0#@{`  @"  ` @h @ 㿈`y@\?`8^`(`8``(2X(`8``)2Q@``8K```D//` (`;Ђ ` +@ ``1+@ Ђ`` 8 @ (`+@  Ђ``8  @ (`+@ @+@ (`8``,`)` `  ``` %   "w@!@`0#   w@!@ْ`0#@` #\@v 㿐`,/@\  Ѐ`  @@F Ȓ)/ ʖ  #w@!@`0#  w@!@`0#@` aa @#! 㿐`.7@[ Ѐ`  @@?cs)7 u  #w@!@D`0# d w@!@3`0#@.` *2@Ӑ!0㿐`,/@[h Ѐ`  @@࣐ %)/ '  "#w@!@`0#  "w@!@`0#@` @Ç!0b0#㿘`X @VcP@ 㿐@ "K @`2G ```2A   `&` @ @` 2 ` `?8.@` ' @    @` `@d?@  ` P`` P&@  㿘$'H@WHX?A' 8@3 [ Z @h`@4 @   :@4   @K  *#A@m`耢 @B 2 @8 H  @@夐`c `   A`A`wa`;A`p`ta '`c , o4,``` `a` b @\,`` c`-~Ac  4'耠`?` ` ab @  a??Ȓb@Ș  c`2VA@QA@} $'%`?Ȅ   ?%`? #\ 4 @#耢 (  2c`2 A `` } &`@`@c`2A@ג`@A `@ `@A `A`! !#`@o$# ?2% t @kb@AG@`5 @`3 @`1 @F #`$#@1 <A``=A` `c`" @@ʊ` A`0`&` &`&`  &`A`8&`D0A c'D'' c@ X@)%1 -97+@5t#( o L"D T 3G D 2Gc Iy D T U P~ R v a< z o t g"L i cC duAhg lo;@# t w r sd0`+ x^: c` F c`` }': c   @쀢"`'@`'%#`#'    @쀢 `@fN @z@ '`   @#쀢"a'ڂ@ׂ`@#'!;/@.Ā(\ }`@ @ 5 6 2v,#D @ 2m,#>h`G >'2[3 F2R;B2LD`F%#B`?h` a(@eې 7$cc` $#.}+@) c&`' #%0'؂@''''@'@ '@''@'`2ueD  @A#쀢"ABaHT `Ȗ   @/#쀢"0a`'`  '; cȖ   @#쀢"ax'`Ȗ   @#쀢"a'`  @#쀢"a'` cD@ ?^ bDb `(@ @@@  ra  s@x"耢 @ `-ra@e wa@i @㿐qb@` @q " @(`8``"`n  `(`8``o` @0֒ = " , @ "  `(r @ @  rbrbr;b (&   b@d  "$&@`" &@@" @r@  c2&@@`"2&@rb@dy 㿐@ '    @i( k`@`b#㻘 @Ǵ ?$ @  @Pϒ @Ȱ@  㿘`2@ @6 @d1`㿘`2 @ @d%`㿘 ` `2 Á @d` 㿘$Aw!@A@q " "@ $ @ 㿘 A$@A!0!$@A@Q "@Pd& @ & @ݰ OXOXOXOXOXOXOXOXOXOXS$S$S$S$S$S$S$OOPS$PPPPRS$S$PS$S$S$S$S$QS$S$RQ(S$S$S$S$S$S$S$S$S$S$QLQXQhS$QxQS$QQS$S$RS$R0R@S$RPQR`S$S,RpRRQS$S$S$S$S$S$RS$S,S㿘`X @O`@ 㿈Ba `B` BcD`B B cDBa$<@ `!B#L*` `@ <$#L` B(`8`` FBc`QBc``N%B (`8``^`?` `(`8``$`?BcT`%B@?#BLa$``@, $a$L(` ah`(BcT`apaxcaa`(&@#`#\#d#@@@B%B#BLa$@]`, $La$(`@ࡔa$L(`(@B$` $㿘 `c"@ @.Ԑ @UdY㿐`XB ct(`8``e`f   B cTB c` c      ')Ѐ`S(`@ BЀ` B aa33̀@@B(`(`@BЂ@  Ȓ@i Ȁ,(``ƒa #!`A#B aȀ B  B @J Ȁ (``a Ba aB aB  c`B cTB  cTB c`B c`B cT B cB cXB  c8B c B c4 aȔ @   w%# Bs cP Bo c@@ ȃ-`` @Wȃ-` %_`@s B"t " U t BQ c\B(` ( BI chB cB  c8BA cX B= cd B9 a B5 c8 B1 c B- a B)  B% @S! %#@S!耢  @S!  b @a B l-b@ @p@n ?b &(`@ , @꒐Bct+2``@   w(`8``  @ 2 `` (`0``@6@ `wa@f @@[`2@     @ B@f?Bc4`?`B@z" BcT`BB(` (``B(` (`` Bc`!B ebH!B!$@s$B c|!$@m B c !B +B|,`@@ "`#L#@a(,`@J@ " `#!B@ !0@\Ŗ"w!0a@` a$@#LBcl`    @. Bc4` Bc` B c\B@: "`?c4`  @ѐ @-??2  Bcp`  Bc8`?(`cp @@%B aB aB  Ba a` B a@鋞@㿘0 㿘0@R  -  㿘@Ґ "    $  < @$  B$$ `B  @B B`@ ?` "` `* 8`` 2@,@ (@` 㿘Bc\`   @Y`Bcd`B " ``ϐ @  @! BcP` " `` @Ӑ  @ݐ# ``@  "@@7 `` @ 㿘@  @dsc㿘@W  @dg`㿘@ϒ  @d[bx㿘@Ő t @dP`h  ` ``p`Bc B'̀ cpw@*!'L  Bc`B)r'aB? a ?B''' cH  ?'̮)B9B-B'B5B3B'؄@C ? 'Ѐ Ԃ(`8`` Ԃ'#H`'Ѐ`B @_"`D `V H B#|, , @ @(`` @ C ?@ ?Bcc ??,  @~L 2# B `쀐2 І`2 @   􀠀B  B!$  `cB``? #H #``_#H@ B#@`; B#8`6)`x`a!  a`"%#H@  0a!%#H &x % ` W :  O -#H%#H` BD`O!`   `% ̈'̀`BX` B#8`Ba`Bc@`BBc\`@)#`@%!BcX̀@ `B@Bc` ̀ @ &Bc@`"BcX`Bc`c`2̀`"Bc8`2̒@ 8́`' ́㿘 @ w a%B#B & (`0```` 0c  $p  @U0< @ 2 D@` a@bx@aԜ#㿘 `Ph@x@' 㿘 3#Bc /@Ȓ )@) . " *c@  @ . @){ "  *@c    c  㿘  s(`8```ns @]^a B (`8``oB   c c  @)F ,  @q  c  @a " *   @@). , . $㿘c  @)  2Bc`?` Bc@ 㿐 @$ 4, t @("``@)r Z a<@)l Z 2)}Ȁ`x@ڡ `2}Ȑ@)Y Z 2}Ȁx@ڎ `, @ @(`}Ȥ@ȤȠ?ǀ`  @]  h@Ԡ @{h h<@  蠒 ) 耠# Ф  2  2 y 2r 2  @ 0AH "< s @(b耢 B@(` @ ".@ڤ   @@(V :  @ښ.  :. Bc`B @7Bc@UC w@'!  㿐 @I  , , @ @(` }ta @`ߒ  Z@(` "`x " M 2 Ƞ?㿘@  a-B!+)B'B'%# t a f $ v %#  %c`s @[ےbo#'@?ր hb&@ B`cBc` c``sK"耤`,   @| 2 `@ `T#㿐 (``s@c?  @`F`@'􀦠"@䁐㿘@ @$@$ $   $   @& 㷐C c@'ٔ  2   2`(s@M4b  dsbД @А $@8B$c `    : @ 4 q'b@ ds&c& `2 @ (`8```--  $@'  =  - *  $$(` $@ ؂-  $- $Bc` a `(@ݐ!( b@ @Ր, @~C @?  B0Ht@&S"@А@ΐ c`@|ca@aPtb(@$@8g@@` `@&+`@&&`@`2@@` `t@&"(0@&!P@ @㌐@㊐  '@i t@%"` `0``  @n( @ p @J Ѐ @ ؆????А @OЀ  C!X!@%C ccC `  -/ / )+B/'B耠lG#tb/# dNTJ#f0mt vnp2 y c`㰂`$㰂`$c/e %c@a?2c @^`U %c@x   @ #Bk c# @Yْa @(``b@%͒ : 2*#aC @&;  2  # H$  2C9#?C`#sb@Y '(`8```nsa2%(`8``o2 %' %C(#q@b@ #Ȅ  c`X @Ia@ @DX?=b (`@bXqaPr b(tVbBcBcd@)H@%Ŕ  " @@  @@ 2 ,@@!@ 2 @!@ 2  @bh @K @J  @J t@b@Y @b@  `2@㿐  @ q'b@ @K@%h`?@ l  @㿘 `"G  q@JaP r@Jb(  t@Jb 0c`" `C rb0  C rb0 C  c@%"  2 c `? 2c@ `  c c cccН㿘@   @]?b㿘` @ǝ @q @]*b㿘 @  @]`㿘 /@  $!B,@@$)# /$,@#@$[b`#$@$V# /@ @x x<@@ (`8``r   @J @J㿘 cԀ`c؀c@"c@#@# cԀ`@{b c؀c@"c@#`X@ې"@h 㿐 H'H'L'P'T'X'@Y 㿐 H'H'L'P'T'X'㿐 H'H'L'P'T'X'㿘@@ף1Ŵ"(!t cВx@t!  +<) '!@#@` @#|Ђ` *x@J x #@@# @b`? `&ɠ@ €`㿐H'H'L'P'T'X'@ @ʐ 㿘  #@"    @ c䀠` `$c㿈CC c ЂcȄ'D ` 'LDD `  '@V #@@Rc` @ W쀠#p@ @&```|   ƀ q   @c0dc  @I` Ѐ` 8  @@: :CcȒ@#, 2@ (``"'` @`2`@ $`*` $` $`$@$`$` @&`  ` @Hp 2@̐#0 2  $ $ $ $ $`$ ` @$`@A bL` OD`Cccbp@M` @I  @y @`2` `cc@4Cc  t oD@ @`2`@g#0k  3 ``    @ `` `"     c@ئ `  `$`  $`$ ` @%`@ @ @$`%` #%#0#"#c" `"`2  Ccи;Cc/)@ ?cȀ -CcЀ +`` `( `(@pP٦bXa `p`   @^ @1`#*  Eb @㿘`X @@`@ 㿘ccEa`EaccEaEaZ "W l9 E0! L-J 0GX-D l sdf" up`(  (Ѕ(&$ " !    `X c cE a`E a c cE aE a @Ւ` (`8`2c c cE a`E a c cE aE a㿘#E%"!E#ap@` E` Ebآ0 `-E+E)E1'E \!!2),@ 耠`2#,@b!(`$ `$$@:?@  (8``%`!2,@,@`(8`̀%,@@В0㿘! ``v @|ǒ ` `& @& @`&@ ``"``ap`㻈E)Ea'% @YQ _%!\ ` ``@ $ @  @*$ @!@" @ @  @(!( @耢 4  Eax ' ax`h@!  @o!0$ @k!8 `(`0``$ @`!0$ !(`0``$ @U!8$ ! ` E@=!@ " Ea $  a@1!H E` ` P `X@BaP EEa`2 @!X "E` @ !` ` @!hF bCcؠ'@̐ E b@Ɛ!pE a@!xE aXx@"E a@!E  a a@ې!  @Ր!  c!@#E $al`($al!@%E  $@"E  aal@(``2EaX`$EaE aE`($ EaE a@!E  a a@]!  (c!@S#E $a (``2@G!E  ah @ !E ("@]"$a@4!E a@.!E  a @##  @!   `(@'[!E  ` @;Ґ E`?!E a!@W @V!! E0```$@ E E ,a @Ea\` , !~$  , 㿘 Y EbEaE  Ead`E` E`  !@A`Ea`` Eb% @  `(bEEb(`@"Ea`` Eb% @```g E`@z E 㿘Ea``" EEb% @Ҕ Eb`EEa`zEaX!E  $"Ea쀠`  %@"Ea(`@$"Ea`` Eb% @"(@̒` !E" "8Ea耠` EEapFb؃0((@ 3`+ +`@@!EC3`"+ +`@@ @%C"H@]$"Ea` E"P@`E`' EaX` Ea쀢  %@]Ea``" Ea% @R@9; E `=@: E` 㿈'?'@9' m 0@ @e  2?  @  @bx@ܖ C 7E'   &⠒@,y  @,u Ea|` &@,l  @,h  @,d @ E c  ' @,V  @,R Ea|` @,J  @,F  @,B 0 b@͔ (`(`"@`㿘Ea``E```: E`@y Ea %@ b`@8 0 bX@ @G 㿐E%Eb ?`-E3+7E5E9E')E, @`" '@ "@   c 2  &  1  2~ X`!``  @y4``"h E`b `2` `"\   @=b"$`Q%"$`$ @+  @+  @+ j@Dy@A c$$` @+  @+  @+ o&R ' ! h@N 2 (`0` 8&``%c %c&(`0``" 耠`"   !i, 㿐 @Ŗ   ?0@`;? 㿐Ea`<.`8>`  %E9+@&* 8`\  `?8`"6 @* $    @ @(`8```` 2`$@ $  @p $@Eb`?$ W T E```` ݐ `@x.``Ӓ5@x$1` ǐ `@x``E@xE`  `  @  $ $@7 L$@ ,  8` ,  `   @, ,@8`\`@?   /, 8``2/? @?  @֒`0`$/, 8`` `  @Ȕ `$$@@,Eb`E b N ="Ё```0 !!`@w !!@6 Dc#E $b E@ʐ"0 Ɛ !˰? &1E$F"؀ " c"@k"$b@6o   @pbXEaE  bEE a"0 㿘Ea x, ?Ѐ 8 `, @" ,㻐EapEaPE?8aa #8` @(``D1D @4ِ#܀  D ؒ#ܖ$@G@6#  ;D 7cDc`";DE=p   @j]   2   #Ea耠` E``` E`@vА Ea`` Eb% @ #@`Ea耠`,  E !P8`@Ec8ap9!P@ Ea`eEa``!%Ea @ ɔ"Eb"@ Ē TVPEa`Ea``Ea!% @ "Eb"@  :`!@ʒ ``  (@vg $ cܖ$@FP?`` (`0```@`?`O``` (`0``@@ `ڰ Ea耠`2E8aPE8ap@  #@v`?Ð#0㿘`ND n2 c n p Qu f !2t dA qn 0i5EEa耠`EEEb(`P@#H &P@#X&@4 ? EbEa 2```r 0`@uÐ v Ea耠`  `=@Ԕ ?```W 0`@u [ "   ?   `=@?@E`Ґ ``=+Ec9E%7Ebİ  0D (`8``.Dc / :DcDc Ea`) 8`D cD c?"E'h "̀ /"Ԁ  2EECE] 2?EbE/ :!Ҁ'24EhE&=.E0~рhsb&E4dQfE svnrqE0ŀzE *`:` 2 / a耠`   `=@?" ``  0@t ``  E@tҒEa``"Eb @ @Ր#p @#E`` _ E@tEa``Eb @ Ӕ``2 I #E@t#Ea@8 EaEPE$ D?  ap at@g88`%aP %aTa ) Ea8``z2 E  cc " (`8``fEa@7Ӑ``  0@tN ``  E@t@Ea``"Eb @ c@C# @#E`` ͐ E@tEa``Eb @ A`` )#E@t  %#EapH @`@㷘! g'@?c`@F @(xӐ@e(@:А㿘 א @a`X @|cp@+ 㿘 @ c  c@ @ cȀ   *c@A ϐ# *  `     6!"5 q c"0 e V(`0 m## q s p# x# "        @i?ǀ nb ~ `@3 b xo x$@є@?# @A`H`^W X|x=А JV`?@2.J'!u@ ?2`p@E &@`@Ԑ@9  J@ɼ     |`0`" |@(` (`" `0`!! ``   2 | | `0`(@`0`0``  #@" |x? @ x @"  (  @ |`" | x@ː (@( (㾘 x@ @  2     @ 2 x@א{   "(  @ @``2 @ @ 2 M@@`|aڄ#`#܆ `@`ax  `  @ 2 5c #㾘  @``C  @@/-@ @$@ ` 5,  @ `(((@@@#@``| x & | |`0`& |@(` (`& `0`!! ``     |,@ 6bt 㺘xxxܒِ֒ӐВxzȒò   xb   L   xx4} yv  2xje a^  dTO KH``2x>;852ݔxx'x# ʔxŐ    x   x   ٤ Ւ  xx{Ȧ Ē  2xj   d[ ``2xLB x@ːx|0`0` x 2 @``2 @xx aH  ` @ ) 0    `  @ @@  #x㽈  @`a2 @  @``"_ @`$  |@-@@$@ ` !!N,hd 0l0'h@t'l!  "B 4 `@@,@$`@ `` 3,`p `0`""  2  t   0(@!  2 xv `Ī,@  aHl,`㾘 (  @x @`@2 @p  ( @㾘 (@ @ Y @2  @ `@ (@ ( ( ` 2  (@` (  `|@`|   @ 2   `0`!! `` ڞ@  @ @` 0``㾘  @`a$  @@, @ @$@` , `0`!!   2Đ, ܢxbɔ㿘    P`(0``(0( (``( 0``( 0``( 0( (``( 0``( 0``(Ո `x `. P`x 0``.P`x 0. R`|(``. R`|0``.P`|0``+P )@(`8`@/@ ``0`( @)  T T. T   0`(0( (``( 0``( 0( (``( 0( (``( 0``( 0( (``( 0``( ˈ `x `* 0`x 0* 1`| (``* 1`|0``*0 ) @(`8`@+@ ``0`( @)  2 2* 2 `(`@( 0`0`(`@)  0`0`(`@)  0`0`(`@) |܈ |`|`(`@* ||`|0`0`(`@* }|`|0`0`(`@* ~    @@ ` |0`| |@@ " | ? ښc @ @@ ` |0` || @@ " |  ` |0` | |0``(" |(@ @ ` |0`@!㿘 `$ , @@@*x   @*l * * @ @(` `%`  ۤ 㿘   @, @@*L %@ (`` , @@@*= * * @ @(`, ``- 5`(`@@@@*(((@* $, @-`& ̨ r? @    2  'D( 2؆ /X``@/(  @ ؆X 2 'X\ @`@2 @ '؂ @`@2 @ ضظغXخXتXX؄؃<0`@8` 8@`'TؐXXؒܔXXXKHXؒƔXՒ5XΔ  (( @ @(` @(` @!  |0Ԉ (( @ @(` @(` @0'T((@ @`!  |0`TX@'Tؒ̔XȒؒXؤXTؒؔ)vؔ؄  2XؐӒؒϐ̒Xz   ؠؒb   Lup li  ؠؒ4]X TQ  2ؠؒE@ <9  d/* &#  2 ؒܔXXXג a X~Ԇ 0`؂`   @$ X D(  8??>@n? ?(l@Β c @ `C (@` 2 @@  `C (@`@2@  `(C  2@2@%a ?@H@t@  D D`@) 2>@8`@>@`8(@2 8(@?㽘xǐ`’xa==5;7 %.!!*x`!x6)x$aHa!ސ !ڔ㿘aa `!㿘!a?a;?a@"@jx\ސ֐@U"{ɐs’l2$^""xOxHx@x9x2xx*` @"@@ }^ ` c *   IT㿘! İ @ xax)`$ Ԑ * . !֐ `}x[ȔАxIExx ߔ۔הӐ ˔S H@? f 0`  ~ 㿘 @` Ƞ(@@@ @bx#㿘! 1 X  ` X @"` X `@@ː 㿘w  a@T 6 @   㿐 @(`8``c @`b@`  @bm (``" a@6 @b\  (`` a8(` ?c (`2`@ ? 0`@@"ْaX@d w @:a 㿘 @`(`X@'ax`?a  )@/#Ȣ  @5a@/!@Y@]?耢 mb. @@I `%` ``@(`8``p&` `4 `!@ @0R@Ca̜#p * `  @Ja` @` @<a`$ @ `$` @`#`#\a@ 㿘`@ / 2 Fy"$@㿘!@m`@ó 㻘#b``b$@Ҕ@b`bb̐"$@ @b`b"($@ @㿐H''H'L'P'T@`S'X@n 㿐L''L'P'T@'X@^ 㿐H''H'L'P'T@s'X@N 㿘@. "8㿘  @א  @ϒ*G bwА!@ @V@ 4"8@-@-㿘!(@K"耢 -b " b("耠@' ? (`8`` @_"H*& @'"耢  b@_"Xbw Opa \'?`?܇(`'D 'H@͜p?c'' '? c؂@ @? Ԇ ? (Ю 3   ```7@(`8`+`?`-` H` ` `@_F"h`2 H `2H@_:"H|?"%`2@%ɐ `"   3` /@ ' @  `2 /`3`12@&L@% '@%  ',(``  ,(``  @%?؆ @% ?cԂ@@ @%   ,(``  ,(``  ,(``  $,(`` ?Є @%\ @%X  ? @'耢? s*@% @%Ԡ`@` *`,`, "@%+ ` @'?c܂@@耢?`'D ```  &```"Ё'c(    !*#"(  u c d#0  v s  @%w$b# b#@%n  c@2֐ @Z?Ӏ pb&`  " ! (`8``+`-!!@U#8 #8c@` ' @* @ ,`@ (`8``/ b`cx@2 bF!@% $" @7G @坒` `"  20``(`8`@@8(?xbw! 2d2**+`@ 3`@+ @C 4 0 0@0`H ` `H`:80  @ 0(8 @  @  `H ` :! "(  @Ř  1<"(?0(/ @@$'ܐ ' ܔ@ ? @(``` @(```@ '@3b#b?c0@  %bb!H H*!@q  M` @@_? " ` #b@88@@5! #@*b` / 1"3Qb(?c0@B  %"Ab(͔!H H*!@'  ?c0@` 􀥠 b?c0@*@! &@ab ` #` 1#\#` 3#\#\#` 2b`"%` 2"`c'܂ '''`ܲ@ ?  @ ?2`2 `@ )# @   @嬐? ``(`8`@@i!@嘐  (%#b(?c0 @{}b(%!u"?c0@f h"b@VW 0֐bN @͐ @RcX# (T<<-P-P,--ACpB CpCpBCpC0CpB\CpC0AB$AB@@@(@<ACpB@ACpAACpC$@\@hC0BBCpACp@A8CCPABA\C0ACpC0C0@LC0CpC0BAxB `  '    ? @ (* ??* c??* c ? ?? ??"`(aa `(``(``8Ḃ @( @*@ @(``  @ *@ b& `8 @(`8` (@` @  @@( @` @ @@(  .a t'cq #aa2(a(8$2 0 a8a(`(aa㿐   @4#`a@/ *` ` aa a ` ( !(p    @  b @/[a ''Ԃ '؂ ''''Ԓ   @x ?@pB㿘 "*" "* @   @/0bd 㿘@@@! E`c   Ђ`` (8`Ђ``(8` ``(9 ɀ 2```8(+`@(  +   (  ( ʰ  .@㿐c   @.Ӓb " `!"  @pb8@. c  2*# a $@!3  ,a ?, (@$  (aa `(`@!! <  @!?c8@,`?㾐 ` ``2  @"P@ ' "`  @!"p@Y@^ 㿘`h : H @5!x 2 㿐 "-  1 ' ?   8 '?    (?  ?@Ӛ􀢠 b@.!  0 had@` "` `* 8`` 2@Z@ (@` 㿘 `/!>@`#  ` <ג@Y͒ `˴@Y(`8`  (`8`` 4(`8``2т`` >@Y >㿘`P@"! ``  @Y    "`2   2` ```` )  b  ". @ @l` ```` , ```M 1`@YB 1@X 㿘@K" 8#%`R@B" $`J  . 6 㿐`/e `5``"` B" `5`7΀`84   ?@ǚb `' bȐ  @ݵ# b@-    @Zn @B b8` @,cp pc` `2 㿐@ !@Ő#8 `1@X #P(`0`@$ @X# "  @ 1@W#         G (` 0`        "5`" 2!  2  `2 `2` ```` ɇ(@ @ ` , @ b@D#Ѐ ! #@ U$#@7#$#  ` @ G@)  @" ` @ 7@ 0 "  @ z @ +@  H  ` .a t'cq #aa2(a(8$2 0 a8a(`(aa `@֐ `@Ӑ x  ڔ@O> ``@Ő  0  @Y< @ d@t?  8 ( <@?@?Ԃ`L #` ?#\ L@ bt`" PH@  3```` @Wx 㿘 `X@`2@   2! ##@ *㿀bt` `@V#P `` *`@w!@M*`!@G2` ``8W (`E@ *`!@52` * @U2  " @(!(  @!!8   p @!P    * 2 [ *`!h2`@  (`0``!`2!@0@"`@Na @!    *`2`@!  bt`  0 @XM @ d 8 ( <@?@?Ԃ`L ?Ԕ #\#` L@!i㿘@k  ""`@;# a c  g b `    `)    +bc#b cc  & . & & . &  (b@B 8bpbb<& $. 6  `. 6 !ay b` `a` ``!a#@bt`Ӓbb`b ` ``b @bt`bb`a` ``a@bt`b b`b` ``b@ƒbt`b(b` bH` ``bH@bt`cb0bdb耠` ``b@bt`Gb8baa܀` ``aܔ@rbt`+bHbt5 $`6 4a`2 3a@ b|`?@"P 57a@C"`  `a  D2@"p #  x '܂ '  ''''ܤ  @   b &@| 2 t`@.  @p  b @*`2`(`0`*@.㿀`( `2  `2  `2  `2  `c `` ?   @ @  6ʲ`X@ܒbЀ , `     @ٕ b8@(   @ 8``(`   (@@( @!#`@ :  $#  $#  8b  bc    2  2a b  a bbآbHb8,`,@@ga(    2  ,@`  Ԑ Ґ t    w $ !2n@7 2 1+@Q / ,  @А 'Ԃ ''ܨ!#@  'Ԑ#Ȕ@ `"a`"b @א@ ``2` ` ` ` ` ``` ``"4` $`Ԁ`f  c ג@Ս 4` @z`U c@' ,@L 2& * b`&` @  9  `@    a & a`" c0@י`  @  2&  @@ $`cHcX@'  㿘 @Rڐ#p`X! @bc @ǐ#@  㿘  @Ob?2@ @,9`@B@w@!@hp `f 㷈 '#0@ (`8``-  " 4   2@'? ? 4`  @;'!$! ?:b8  @n ?1`a`!   @^?!`8a  bt@ #``a@͔(? @h `"a`X@+Đ @Tu ?@@a㿘  =5@ (`8``-3  "?   2%@ # + 2@   ?& " @`@??2`@ m@ !? ò`ba.>@`㿈bl'`L`@ (`8``g `(( /5#+/)a@N @ @(`8``-!`?`7ޒ(`E@? $c  $c %"8 $c  $c $ !c```@&V `@ + c`!"``@ c`!"b<`耠`2`ޒa@ ? c`!" Вa(%b<c`!" ǒa@c`!" aX`  7$    `|&z N uIq!o"m(R `@_ K `@X "E@`@  U@";@`@  @J"0@`@C?"(@`@  `5 "@`@-*"@`i@#?"@`R@/@ ``  ̔   İ?  ? 4`b`2 a`ap  c`"` b$)@fc" * :  "( @fV`3#@fP`#`2 (``" ` ` ``` @0 (`8``g@ @f)b|`Iarb0@# (`` @!` c`b `@'@ 0@Ha ` a`7a`a@ؐs@ې X b`n j@ xbl` @$ђ`a @M-  A!@ (`8``-8c  "?    2)@? + 2!@ $#$# !"@`@1@ 2?@ @$aа?2`@ @@? 4`b'' '؂ '''  'ذ   @ ?2b` @ 2`  @ ? @eR` ېa@)  bt` @l"c` @`@-"8  b )597;/`2{@"t`"`@*`2``l"n@@2j@`(`0`@@2_@ `(`0`@2V@"` @2O@`J!`2H@ &`.`@6`a*@2@(`0` @d"P@~ѐ"h04|`*`"t`"`\"@`(`0`@@Ր@b @~` ``@Đ@~@l*"@(`0`@@*`@㿘 3@K  b/-b+)'1'!  t T d $! v q  %%"|  %bt  %x Ȃ &! @K>?ր n@b@L bD.  bl@ |@$@a` @dI"b @(b O Ғ_ bx`# @Q"$a  @7 $aa ?b8a`     @K? `8@'ϐ     2'@   2@ 62@ ?j`0 blC0 bl    B @^c`  "!   ` Q ( `  .(`0` # ) ) ` )   ``O2 )?# b bbxcb㿘   2 ؒ!@9 1 @2!1 㿘  (``"  ``@,@* 2!@p @܀`z @`4 `   F " `" :`"& ``"! ``%#`2 ```2  `2     2+ @++   ܢ@(` `耠` 쀠``&a(@M!"c܀@ #\ܔ! @ @z!!!  @q㿐`" @`" `c`   @@  " @`a( @}Q ! @ !@p 01  6 !@9 $1  6 6   6 6  6 #\  ` #` #\  `@!1 㿘  ```` `! 0́{  !@㿐c@?``#\1!  @  `@4! 㿐'D a(c` D @   @ .  @a ". D'@! @Ґx0`" 0!!@!  .@ߐ! ! `@칔!(a `2  ! a(@쫔!_ `@ ``C`"`H0 `!C05 ܔ  @6@c /݀/䀠`2`````` `/(`/0`'U܁  ! @Y    !! @" p`"(` (@{KЁ㿘 `!1 !@{9"  !@{1"@{*"b bbxcb1@{#㿘 ``! `2` ` ` ``` 2 (`0`" 0 ```1w@zۑ!c`"11@zӑ"#@zϕ   2 !   c  c0c@#Hc`!h@z@` "` `* 8`` 2@K@ (@` x  !21c#\#hc㠚c `X#\``#``h#d`p#h`x#l#` 0@ H`P@zbc` ! J !M   !  " @  B  `  `  `H#\`P#``X#d``#h`h#l`p#p`#t @z&bt`"@z```3`i `@K  " "   ʘ Ę X (`0` `   ; `" ! ! ` ````  c ` b `(``" 䀢  @`  4@" 41  zc ` ` "`!  c܀`  ` "`!  Y ` c@?   /` @ (@y  <`  b@y~``  8@?` ?Ɛ L  @?` ?@JV L  * @I2 @y\ bt` 䀢``@yP"``` `@J2 x '؂ .'ܷ> '''쀦'  '   @ _ ?2"b`  @̐   @" @ D ? @_` "ؐa @f~!  `2(`0`*@qb # ) 8`b@``" ?Ђ`@?` `7!? ((`88b@``" ?Ђ`@?` `7"?Б* : 㿐P'P'T'X'  @  )c    04` 㿘a@ה   @Вa  @ɒa  @˒a@  㿘 ? @@  b `+ @" a`+`% .2. (`8`` `D".`(`8` ` `D".Y ..   (8``ׄ@,@ 㿘@ @Ր *  @S  bp@?a@ @㿘? b`` 2"  2 @!   % ``b``D"   " `D`? ` "` `* 8`` 2@H̞@ (@` 㽀?''b@V `' b @a쀢 `  @a쀢   @a   5' @b@@莒 /  (``2*@聒 m' 2O"` ' (`` 2 2="@G9''0@ ?(`8``/'0@'耠` @(`` 2ِ"2'`'q'@ϐ 'b@1 @Ɛ'`c @la  ` @aa 20``+ @(``'(`` /(@ / " (``2*@ @ ")' (``"$',@ :  ?@G'#(''' @, :@Ԑ  *  (`8``@ * '" @@ '#@@!e???X8cha4`&@ɔ!'܀`#X```0`f(`8`@̐ '''@#,  ؀`@" '`b?@ ]'a@b'5?&&#@c@ d' c`@< '-+'B# : @ <@S? @͐#@ '? ̠ @'̀(`c`0`cP #@G #Ѕ8`@F@ @@c@ '@ޮ c(`;c`6c 4  .̀`,`cЅ8` 4 2@ ``c  #c@Fǐ #``c c@F @c̀`" @P#?@ b耠`@ ؐ @[ 0(`8``[@] ]   (`8`` `:2*`@L : ,  @  `x ' 'b@P? b  P@/ @=  !@@E s'"耠` ?c  @o ?'a8ccc +Jb8 #\! @ @!耠`"c@~ @. '")@ 6@['`@[!@3@["?' #\   @ 2 02@` w!@'ܰ?@cb耠`'c@}c@ y Ӑ 2 @  `(  @`    @s, 䀠`+,b耠` c@}|`0cX#`@`( #\ cX#\`( 0S ͘ `w 0@t : @  >`@i % 2* @dw @ 5aX   cX x(b耠`c@D @: @.?2?@䮐!'̒  ']'(̀ (`8`` ` @    @  Ȗ !@ɧЀ`a/ a3a- ` b   b@D&!P?!0@%??8chapa?аa +  '`!'(̀ (`8`` ` _@   `@  2,  @CЀ`B=hk>@ה 8 a@א Ra@ La@w # 2*b耠` c@|?a@0@s@Z2@Va4`'&@g!'܀`@#X?```0`f(`8`@g '''@ۓ#,  ؀`@۽ Ԁ`"?0?a@۵bP'%?$$#@<c@@9 'Ԓch '̐ c`@ۙ< -'+'H# H : '̄@ <ܒ@? @`#@w ?(&(`"c`"̀`c #@C #Ѕ8`@F@ @@c̀`@E c(`;c`6c 4  .̀`,`cЅ8` 4 2@ ``c #c@C^ #``c c@CQ @gc̀` !@?=@ ch?̀"`2c c`@ b耠`"!?c@t|"?b耠`@ ؐ @Ұ @Bt"('?''"h@Bj?@0 @-0 @@@@@ x'D'H'L'@j#  cx` @o `q @ڎa q@ڊ``@"  (`` @ߐ"  @(`` @bcb'ظc' ƶc0 :(`@ @@H(`@P 2 @b @a  L @a  L bؒ'؀?'0 @ݒa   Lƒ?C'@'ܲ /@ :@{ @@w > <:;'؀:6'*, @ @e  @@` 2 `@A!80 `@(``H(`@A"'ذ`8'ϐ'ː'''@(`8``[@- ]  " * (`8``:. *` & :@ /@@ `` * ``@,@  :@ ''ܢ `@(``ހ .(`` @ / 2*  cx` @F `X''` ' @(``" ''  ؀`b؄  c b c@^cx b؀ `؀ܐ@  @@ې0@ b `!  (`` @xc@  (``  @xc   (`` ` a''' @c؀`J  (``  ⠘ @  ; b耠``c(@y c`" 'y$@ޔ'' '!"'$" @K $"L '' @c8`c`@ `'D@9Hcx`? @o 㿘@ !#@r)#8@# @g#,㿘@  !#@r#P@# @X#,㿘@U``c`(`8`@c .@ƒch@U "@<!㿘  `<b@Rc  Ԁ`  b cԀ` ԰cbx&@c$` x @o!`. `  c$!!  @<a @8  !! X@2a@. `!0&!<&!@ &!DaD"a<a@ &!HaH!"&!LaL " &!PaPp!"&!TaT  p&!XaX\#!0! #`&!\a\! \# @#!`#a`@ ! "`@!q"`aq@ !&!a# Ȕ$@ !#a@$!$#X@%e$@#X @׽<` <Ā 㿘 /@ 2,ta `@V   /,`@|# !$@ϐ""@"`  .*) 1d2 .c@q#  ., 8``9  0@% , 8``02 ??`(`8``.2.? 1.??`ג b㿘@ې <` <㿘@Ґ !# c  `<@pߐ#@# @ 㿘@T@ ```(`8`@ @މ`<`@T <"`@` @ t` "` `* 8`` 2@?b@ (@` 㿘@ ``ߐ @?2 @Hc`  `< t@ֿ 㿘@T:c c``@ @T)"p`Xb'`#'`8`8@  @ޗ @ &`8? $`8@ `8Հ`$`8 '  @4  @} `8@㻐 $@r 'D'b@օcxb    -9'+;%  Ŧ "?@&   0 @& a0 `8  @% a0 `8 @v@a00 D @H   c @ Cb耠` !!#@oՐ @@#! c 2`耠4* 5)``&``!`0`"``2  cc$@v>c``c`@>D` ?Ѐ`  (`(`@Ђ@% `` " d` ?Ѐ` ( dd  ) ⧀  - - ` (" ` - 2% ",@%R :耠`4  5````c0@=c@c` $8$@Ð!0 "%` 1, b @qca!@ j`<` bcx  ?`㻈0`'D@!  a0 "@^@< ``? c@ :a@3b$8  @> ``a0`(`8`@a0 @*  !@ !!0 @uC`@k!0````(`8`@`D '7쀠 ``(`8`@D '7  @ ? D @Ð ``? c@ D`(`0``1 `D(`8`@YD@ڔ$  ( cb(  @ԩ 㿘! P`/%X`X@+@>n X P@b8`  #@ ``!!0`h@E #h``2#`8  ' @W  #`8  )' @I  #@ؑ#``8@c  6`8 # '@rs䀢 6`8 @x!0@鏒  @o#`@ ``2- 'b䀠`"& c`2! `@ ` #\!@ 2 # I  c `` @  ```  #\*#  ```````` ` ` ` ` ` ``  #h#l#p#\#`#d#t#x#|#######       @ "    ``8  ' @׎  @ؐ   !@c 8?$ 8  c  j'H'c''8`b? ` c c??8chc'D'(bX'',@``?''L'P`%'Xb耠`! cH`` H@(`8``-Hc@oΒ`PL`Lc@oŒ``cԀ` ܀`HDUL''` '` ܀@ '@> ܀ !& "` ! 8 @?$ 8䀠`@W 耠`(@P (, c9 bXb@Fc,c'`@A X'耠`H@{b jH@(`8``|cH@  Q@L`@L` H@#@ @ ? cH@ / 2,Hta `H@簒   /, cp`@LO` H@oT! cp`@L?` 0cp` H!'HH`܀` b܀` @  0bb܀@"L@  L@ 8ch @y ܀ (܀`L`H" L1 p LD'  w"! 0Ð '`X0H@b `'5 bXH@(`8``| @i 'H @b^b'`Hw`!`"  bXbH@P'` +H#@)L(`'```(`8`@@>0 `#$'#a$@0!@! @ $! t@ $a$$a$0<@ @`"  bXL@ ?`P`@7ѐ 8`Xb܀``| `H`H`$```(`8`@z`H @ H@չ#( c,( bX@K);" 73-+)c9%L1 ``(`8`@Ga @ ?2?$ @cc(@<`C`'?c#`#h` `` #w#0#@5ː #І@ 8`@ ?c@@@#``(`8`@a @$    @J'$c(`@`c`ch`6`c 4  .``+`cЅ8` 4 2@ ``c #c@5g #``c c@5Z @pc` $` @l`??8c  H@4  `H`H # @l / " @ ? `` ` (`0```@J`?`@J+"d? @l  6#@J`H@Ԙ#(H@4R#( ,` X@ ] Ԃ`'[`` #{#0#@4ϐ #@#І@ 8`@ ?(`c`h`cc@& c@` @`c@@ '''?? @  @@"㿐@@``c`(`8`@yc@`h? P(`0``2@@ `4"b耖Ȓ @'bHbH` ` @ВB?b@@ʆ'cr`rJ?x H?p ?p@pp ?@Ha ``(a(  c` @$cLax #\?h@J;`h#p ʖ d@;h Wc 4 r 2[ `(X rx`Zch U`H@C4F 2@ 8@ @ @b !@?`x` ʒ. ʑH'@z@.@ d@$ <@ <@zv@ܟH ```(`8`@y@n@ې p?! @&"H"H"H`H 8b0b08`8b(@& c`6ch2`Hc@C  d5`-`- @ 3`+ +`@@C3`+ +`@@ @ːC8 8` @d db8`?` @ߐ @ `b耠`'/ad`#@  `(   $ !a8  `(#\"`@ `" @ b耠`)`&@ؐ   `( `(`a8 @Ɛ#\#`""@p@ژ@`"@і`4 @@t@ d@""@`($#\@۵!ab 4 < @``耤`,@{a@+`;`` ` `"` #\""@@ۇ b0b0`@b<РD?b@b( b(2"`@8b0b08` 8b( 2 `(  "H"H`@D#`9"H  bHbH`@bВB?b@@Ȋ'r `  ʁH9?@.'@ @ "@ @ @#0 .@"@ @ @8.@x@ <@"$@ <@xՐ@c4 r2耤(r`;ch4 耥 @ @""@P4 耤 `(`H@ﮐ""@`@J`H蒠 @` !@?؁ ʒ. ʑH'@ @"@ @ @ڡ0 .@}"@ @ @ږ8.@xa@o <@"$@a <@xSp@}``c`(`8`@vc@M@Ǻ z @N`<Ԑ '%ΐ ``c``"`@(  !@ (@`"@c@(t ! @$ @c㿐!  @Ƴ$  `w@ ? @`?㿘@=g c  @=Y"㷘$@.@$@,`  @``   @#(`8``/2 @Ő@ȥ @x(`8``/`?`?hb` Ȓ  0@@, @ Ȁ` @@'E#@ J @@ $@ @ @ = 㻘c `b`2> b@ Ơ @&b`2@`" @@ @ " @`2@!  (``a@I (`8``/@ @{ ?@&# $@|@(`8``/ /`($"@lc@ԋ @ #l @` ( 耦` (bccacԀ汐`? $   c8`c`a0&`cԀ提`? b c(@X`&@_/`2 c@Xl# ` &!$@t"H 2"H@|&ِ@bX, zb, `[c`V !!@툐 !@턐@  !@@ `H!@! @ؙX2`H@  @@ "  @^@^ P@t @(*?(``@:````p%`0٦bX`````` ` p b'Œ  @鹒   2`@`鬒 2 ` 顒  @%㔤 `ΐcԀ` ? cx 㿘cx`cc$@^`Є? cbb` 4`cĀ " (`` @'a` b``K!0 b耠` cc@]ݒa@  cx"@ޒah b"x@֒ax ct#@Β` cȐ @ƒbȄ  c 8@Žab b b` Ĕ ?b b! & $3 @a4 2 ?a4 @Ź   ?(`8``.D? ,ca@]}4 2,!0a@  cԀ`  ` b "c`@]^8 cԀ` ` b b㿐?b b觐! ` @j!0 ! @ @(`8`b@``"?" ?!#@V!0#@$̐ ?? b Hc? k!Ȁ lb`a0  (`8```"  (`8```2  @ŌaЀ c@VH!؂ , 2,  0, #\#`#a0@ b  ,@y'''''x'Ȃ?@'԰? ؀  8`ca0@\b8؅8`@F`? ?!#@U!0#@$@ ? b耦 c}c#TD\hL㿘ah``X``( @\ebX@ ``X! p(`8``-$!hb?@bb    bp } c( )% $!h` (`@@  a`  !h`@ @ (??b@   @x0 wa@> @!p Cb-@F  @@  `pah` p"@%2 "`" bx b "p@%$"b@%[ ' "8@(( @? @O ?  b@@  @ % @<Ѐ?X?@&?R >!@"؀?@["@?2"@S""@ ?@J" @ @@  $@͐Đ @QȔ` '@U Ж8p ch@R @\ @R ah`?`2 ?0```2?o@? '@ ?@N ? @8`@#' @T  @>~ @L ?@N ?2  @8h`2 0 @"#0@6?@? @Nt ?c@`(@M `#㿘 @@T|`@ (  c b`p'#cX cȒ@Ԕ@? ob&(` @[,'  r @Ȓa"' '?s'"В@  @7`- `x`@7@v `@@a 㿐qb@` @R " @(`8``"`n  `(`8``o` @· = " , @ "  `(r @ @  rbrbr;b (&   b@  "$&@`" &@@7t" @nS@  c2&@@7b`"2&@rb@Z 㿐@'    @  k`@A`#?@BD > b`&  `  " 8  (@@ " `` 2  ` ``  (?`   ` ``  ( 㿈@#\?@#c !Р ? *`> !Ԑ@s  ;>   <>  @4 > @2  @( >  "83  @C3`+ ; @ > " @sc    >  2 @ ( >  "0((@ @c; 8 0 @ 0(8@ > "@s<    >  2 @ ( >   @& > @ @: >     B > @ @ > B > 㿘B`B "A  ` 2<  4`40@@24  (`(  ,`"+ @ 2&  ,`,    `" @     8`8@ <`<@ʠ  ! `  㿈@ `'''' #@#)(( 㿈@'''' @#)㿀@ :  @@ @8``4@0?(@ @rz @' # @ro  ''''''' '@"Ϛ( ņ㿀 ''@> ' (  @''''@"㿘\@? @5p@t]1@ I"8@l? @5c@tP@ ;"P : @ 1"x@Yג?2 @5J@t7@ !"@"p? @59@t&@ "@D㿐 (`0``8 1@ '"#\"'!  㿘 c . 1' .+`..(`` ??(`` `` _ - _  @ ` 2 @  㿐 (`0``1@ґ#`@    (`0`#\#&! C 㿐b.`6` #\  @?? 1@4@s@#@ #㿐b.`6` #\  @m?? 1@4@s}@#@#㾘 !@'DDa @b8 ,(``% . @@    . @ @: @2`(@̒ 2 # ⤐"@@p!㿘 4` (@|5 @|3 ,@|1 0`<@|- (@|(㿘 (8@L W   <<< 440(c$4 4/0c($4  $ ($ $$ @ +$( , " 0@ "$`, 0 @ $`04 8`"  $ 8@    $ < <@p 8   84c$4 㿘 !@ 0!"%`@` "@{ ,"@E@& ,"d@` "@{ ("@9@& ("l`2& "l`2& $@@2 `,@{ <$ 8$ <"@"@&j,@h`" , K,``2],@@{p <" @$ 8"@~@ S$ <"@G@`<@{^"8@ @@~$`8 A$`<"@@@p`"`<@8<`<@{F"8@ @@~j$`8 )$`<<@o8"`<@8@``8`2`"$`8" @~N@  $`<"@@`@oͦ "  4c& 4 @- H b )uc㿀'''耠` @ `h@ߐ?"'@| ('`2@@ x@`) @ c`'``@H " (``"  @?2 @ސ  @?  @8@ 2`bc\  @(@Ő@z b@{`Ȁ?@ @  @} @!@@zr @@zk@`@w@zb@`` 2@bc\`Ŕ@gp#@+a0 pŐ  @' ?@e!8Ԓ  $@㽐a0 @0 @xa?@2)`@K!H@2 @q @C!p @}E '@9!0 @Ua?2 @2@p@)!p  a@?   `b @ǐ   @1@p@!@y@b @  @!㿘b`6`2    `@^ ?!@ߐ!! Ԁ?"!@   @  @ @ Ԃ?$ ! @@! ! @= ! @: ! @7 ! @4  @1 㿈@? t@"t@χ!?@"b`@" @醐3@@~`( 2@"0@Vc` bX33bH'  7@K?? @1N`#@1H@p5(`0``@}? @15@p"@3&b0@#b`"@H@7(`` @U ?2 !@1@o@"x!"`bԐ@ '"`!b`@`   "@@" @ !"@I@"@0@@o@ "c @@֐"@~U 㿈 !p@O`4b`(` b'@E #\!!p@b耢?c!p`$' @ @+@M?`,$`'@@>0?@`,&@@] ?&@@$(?~|@$`(`z@@?om@`(&@@4 ?`^&@@(?U@ T$ =@"m`8`,8@ @Z@ݖ?75@&@`@h %&@@ސ`@Ք $@Ґ`@ɔ  $@@̫? ap  b8 )cP?cb(``=? @@]#В  @c #ؐ @ ( ?@͐@c ? 8 h@?@8㿐!!t`2!t@ !t@ْ!t@P' @b``@@ `@2   2  􀠀(  @K!t @n `@ 2 4!@_!t``!t`(`8`@h!t#@Oeat @N``at`(`8`@hzat@㷐b  /(@๐& @ൔ%!b! '' '- '''-''@]?f`@7 ☄ kȀa+!, Ȃ ,& ,& ,& ,& 4&`$4&$& $&$&$&$& b$&$4&(㷐 !"/ (@jf @f%b"' '''``!!''```   #k' 'b l   `2 `"`! #@ `h@?f`@Ő ☄ kȀa+ !, Ȃ ,f ,f ,f ,f 4f`$`$f `4f $f$f$f$f$f b$f$4f(㷐 #b/ (@& @%b' ''  ' b ' 'b kb l   `2 `"`! #@ `h@z?f`@T!(☄ kȀa+!, Ȃ ,& ,& ,& ,& 4&`$4&$& $&$&$&$& b$&$4&(㿐b`@!Xa(a,''@㿘 @y#(8 @!p` b8 a )a`3@ ؀`@P   @Ԑ! @ (``􀠠8 (@@"  @ ` 8@jf $$`aɠ b   @(`@`8`J !"!X`& \& $!@`2"!t(``"!@z A & (*!" @@j/`t ((`@^ ( 2 ! (@q"@uo (& (!؀`!!@`"`(``@z  & ," @V " @j` ,(`x!"`@uC`0"` `0"x`N"`8`"`8`"`8`" `"-! `2)! 2$!"@0 0"@ `0" " `"@` @Ȗ'"@ @y`@ d@ܐ"Ht!"h`$`0" "@ `@@`2@ //7(`0` C@ސ"p@@@` D@#b@` ''@`"b@ `" Pb@` ')!ŀ`(@T? @b@?'' 'b@` ''@` !b@@` z'!"@K@" `%% "2  耠4   쀠  @2   $ !  "    4@ "4`!ŀ`2"` "@` `"  @` !"  "@@ +`㿈@@"@b`+ @"  ) @Ǚ'"@4  @2 @( @LJ'"@ `   2 4@ǐ"b  bc0@ f㿈@Ibb 4c @<@ 2  @ `@: @ Dc 9 @@%b2 @4` , ,`@є@ @B<@bbcH@@D@@bcH2 @ < 3 @ 3`C+ ; @@B<@bbc 0 @B@ B 4 2 ?@(? `@9 @?cb0fb?0!"#(0("@b@(`a('a,@'"`@@ Ŕ㿘#@ƨb$ $b@b? b  b@ < 0b `@ `DLx@b 4 #@2bc@@= &   @`@ @ ! 0" @@  @ 2 @ @ : @ @'b   Dbc 9 @@Ib2 @4` , ,`@@ @B<@bbcH@@D@@(b2  @@ؐ <3 @ 3`C+ ; @@B< @b ` @`B 4 `  ŀ ( b`C ` 9 @b'''' `"` 4?@?bc@= @& ?@2 `@: ?' `"  (` ?c$1&? 1&b'@Ґ @ #P''@ ǐb`@@ `㿘!@Ţ"$`$"@@"耠`2?@$ @ < 0 `@ `D  㿘b` (@`$w@!b4`!` ` @@` @@!"@ @"  㿐b`` ```'֐ 1@#hw@!b@ `z㿘@ b` '@`` ` `@ `  `  ` `' `2af`/? ☐ @v` $!Ԃ $!Вa@f0  @v` $"  $"a@f#  @v` $" $"a @f    ☂  @ǐ < 0☐ `@b `D*㿐b``[` `X@  R  ': 2a1@#h` 4@" 4bc8 0 @C2+" `  @2 ""` ` `☂` " ` " ` @ ` w@Ր!@h 4 5@ 851@ 㿐@  b@ bb-`-` @t   $- *-b @e~  $-@7b`"`4 ŀ2!` 􀠀!b `#4@b@ 4 @ 2 @ ( 2#b`" `4 N$ @$ $b@b? b@ < 0b `@S `D㿘`X @K<c@u 㿐@֐b%`< @ @$ 8`Ѐ`Aŀ`?b!!p`8`  @KcЂ $!pap`'b`8`#bc(@<`& 2@`@: #@DZ` .@`@ b`8` b L bc(@<` 2 ł@`@-b `P @ y h @s( #@  #`ܒ@_(? @'`` (`0` `~ ``8fŃ(` @@ [+b`4((`00`P * 2 y G * 2  P  9'#b)"$b@` @'"@ @`@ d@Y"H" ` "` `ŀ'@ @@b@'b w`@'@ސbz`Xb`4((`00` * 2   * 2 0   'b# bb `b`"`` '̠@™@ h'''@גb  łc #Ț̌'@} @ːb@s'b `@?'@eb`@?#b`4((`00`k`2`@`]`Ȁ`!Ŕ @cl@b@\  " !@ b@` @  b0X"@Ґ "8? 8"`8`b`2 (@- )b(``"$Œ  (@(`0``b4((`00` ”`@S?b@  0  ` `@@nL@j!@f"ȁ`Xƒ b@J @4 ¸ a!%Ŧb#5/h+<) M7"K# q c d L@#"$1 u8 l8##5&`Ѐ`  $+$`@ڼ%̀?&h@@"@ @ڮ?h@@@`2$`p$`$&i@ 8? ib&` Y  D@p#ŀ $b@!H, n@b@K 4 4b`4(```@֐!X@b@ $ <b@ ``8``@ "X0` @(`8``0`A @  @(`8``A2 @ ,2 @ @ 5 @(`8``A ,@u "?@,@n@ $ @ " @^o&@?㿐@ >`R(`@`4@R&`4@ À!A"b@u  B`4`:@ "06` @ 5`$@ -@ː&`,@Ɛ&`(@(>`@#>`@>`|`8Ð"@  ;@ڐ@㿘 @  { @ ǐ# ;@ā @lh(8 @ \# @ j ? }@ #80$t@  " ƀb`"ŀ " @"$  Œ"  @4 =@ #X́bc0`@2 $  ` 4@ 4"  4  4.`@@& 4` &&  @ ``& `  ``& 㾘 @ >`&ޠ(`T@bǒl!"?"* @ h!"?"*   !"?"*   !"?"*  b@Y!ޒ?È# !!!Β?#  !?# ⤐"@@\!b%c(bcbc0bc8b c@bcHbc @@ @B @E@P#b! #`@H#b!#d@g@b @blbl@ @@ Z# ;@W㿐@ )À!"b@Р  @  { Ð#@ 8 ;@5@ ? }@ '#@ 㿘!@  @` @  ? ! "@ #03 @2㿘!@ "  c(8" c <9"c8 "c@8"c0 !,9"cH  9" c  9"cP  "ca ( "@` @@ (@ "@ @@ (@ "@ @@ y(@ " `(@ "  ( "@ @@ (@ "@ @@ (@ @) Ȱ  @ D ?L@8bb ` b bb `x  @Ԕ ? @@]@  ؔ  @e @0 @a?2@P  @ ?@  ؔ  @D @0@a? @@]@ Ґ 0(`0``A`A(%`@` ( @ @r0 @ْa6?@` @``@֔ @֐ 㿘@  ƒ@B8bb `x  @M ?@  ؔ  @ @70@a? @O@]<$ P1 7@!? @=@]* !`7@{? @,@]Đ @ @9x#Š@$?b@b@] @  b0` 0b`0``@ +!  `0'ܑ* 2 @+܁㿐@ϐ "@ !H %'ł``2! @` 2 ``  ``2 ``2  `` @Z@@` @ 2 b’`@!X@xcİa1@-Ʋ`%)Ŵa`9 " < "@`$b0w`'?@ @2@@%%@$0`c4 1*(1*(@@ +`" `b'' '777@` 7@M ?@P`#/@J`)@D@\1@C0(`0``(`0``D(`0``@!(`0``$`|`b@ @@@! c @@"Ȑ @j㿀 #Ŧb(,$@T rb `(b  ,",( `8 _ ( @Y "(,(`0`@@ M (G ( ("`(@ ` "(@ (""'`(@ `  ""`(( `(`( `( @% '"(`@ (!" %@ Hb"`(` @@Y< Hb(@` (쀤b  @'Ђ '/'܂ C'7  @ [  ''bc@Z+@a"b"y`@}  b@.@Z@Q"b`bf@l쀢  b@@Z @@# b $b@hA $$ b `b$@0#@b D `(b `,a<b'`' `D! @>"g  @@Y@#paa@ <'c'c! <b"w`@   b@@Y@#b`bv@ @#㿘b &!8@<Đc@Wh !`;  a,&4& @2,& `"%5! @$`* !7& `` -- @ @W<$@@``ئ!7 ?- ΰ?p`( a Ĩܮcئ:8` 93@@W '@'ܔ @($ #@V`@'ܖ#\@? ?@ &@`2㿐   waĶc.c@”耢?32&@  @    `@@?&@*  @耢??`@`!x @V 'L@͐ 1L@? y`, b8. b `?   Ȕ >!xc4_?2a1Z2 (. 8Ŕ _ (`SR``S`f`B"Z``I`AK. `A`LE. M`?`f `l`X `e:. C0`t4. *+ (5 . 8* X`  (`8``&2` t?(  :+?`` `8Ŕ  @91!x  (8``@ . 8Ŕ% @6( . 8Ŕ @ԗ@d . 8Ő!@1!x, ,8`axwa a1 b(`8``S"A@ `f`I" `L"0`B2\@@I`f`l`X2S<@"`t2LLH @Ur'@A`3 @Uh   @U_$`/`/`*2(`` @``h`@1@~!0361?-&: @`6 ?&&z  61@6 ? &   !x@ 1!x㿘b8Ŧ@aca`_@:) `@@ ) @)!P 8@!!x `@(`8``t)  @#@`) `2 @c.` @"`@T$&. `@c@ 2@@T`@T@&@_.$`@@ @  㷈b J`@b d@m   $ LbcT@2 (@-!4Ĕ @OcЀ # !8^$Ѐ ``"@`  M  @` tA @` @```2bha`aab  H``b bh'@ܐ@b@;b ?@j"0'Ā@_; @`@_6 (@*b@㿘`` `& @k @`"@;@`2 @ ? Ƅ@a !" !"0Ƃ` 0  b,) ",P b(b(@!",㿘  Q#a@]  Q!!@W "H@R%  b0 b, b@ b< b8 b4 bD b b b b b b bЁ㿘b@)'% ,"0 @y? #? ` # h?耢  0 bƀ "@ bÒ  (%ܦ@  "2,@,@`  \`?e??Â`(@(Ð"H`(@)%܀?%"PŐ"h@bH D! -r?nb @``h @``D @ (bHbH? - _?``@C %$ b@ŀ?" ,``D@, %@"bHeۃ(`8` b@``D2%bH*bH D(`8``-! !a0 !@!0 @ ! @ ! (axax(` D㿘'<`%#b!3$"8&b4"8$<b bbb4$$b&b4$"8 bD&b<㿘"< b8b̀@b bb4#b#"< bb b bD&hbb̚#Ē$b`@# !wb`@!1"!@ %PŐ c@ ^`Ѐ`2 b`@'" '''!ِ"X@''?P Ą  b(`8`` 2 (&'Ăb'łcؔ ' ' @RȄ  bЁ㿐H'X';Ē$'H'L'P'T@VԐb` wb`@ca`Ѐ` @Ɯb`b`@  ِ bX@ 㿐H'X';Ē$'H'L'P'T@Vb` wb`@>a`Ѐ` @wb`b`@ ِ bX@ߔ 㿐H'T''X;Ē$'H'L'P@Vb` wb`@a9 Ѐ`"@Rb`b`@ ِ bX@  Ѐ`@ @b3 ` (` 0`@` 8@`   `" ``   㿘@!Ţ`'`@ #"@`#!`c @x` @r`@l@SY1Ŵj#"`ؐ㿘 .`b`<6``&`` `@*@Q2?2@@H`@B1@S/# (`0`1Ʋ ]㿘 ( ƒ  0 @       @ɘ#` @p  @*3 ? @  ` 㿘  "@Ň . @T. Ɛ @@? @ @R P  ư  p  @ ? @ְ @RԐ  "`@@O /B /C `7@(@3'Pb'\`<'7H@` 7@''؂ ''܂ `'Ԃ 'L / ''''/@ʔ ?@`F @@R 0<@@KD"`? @@Ro !By!`C`X@\@` " @RO `!(0 @&  2 @g㿈 "' 'b  #\  ?@?2 @:@R'8!H!h㿈b@ b ''#\   ?@?2 @@R!p!㿈b '#\   ?@ښ?2 @@Q!e!ȁ㿈b b '#\   ?@?2 @@Qܐ!F"x@b ''''?#\   ?@?2 @@Q"""8㿈b '  #\  ?@z?2 @@Q"H"hP`  bc   @g ? @}@Qj"x  @@b `@ '̂ //ɂ '//Ȑ @a?@'@U@QBR"@b bԁP  @' ? @=@Q*`"x  @@øb `@䪐'̂ /ɂ / @ka?@`1@'@@Q"@ x ؔ @Èb `@ڐ ' @۔ ? @@P"x @0a  @@Pސ"@㿈@~ " @@P"'``2 ``2 @™  2`'' 2 @~㾠  @䇔 ? @@P# @ `b  / /< 7'd `'/ ' 'h7 '''l / / p'7'  'p `` '''`7 /؂ /ق', ؠ  l  p `"  '''Ђ`7 /Ȃ /ɂ'ԅ, Ƞ  l  p ` " '''`7 / /'ą,   l  p  , d'  `"7 " l pư c0d@4 ?@`@`3 @@O@ΐ  @8b '''Ԃ 'Ă ''< 'ܦĠ    @?cP`"&@\r  ch  @?l @` ۔ Ơc@@O#@X@@O#@?-ŀ`29Y "-  6  )2'`"#* @#2  "`2  <(`0`@2  @A 2(`0`* @f @0 ?0㿐'Z '? c  (`0`"*   @(`@?c8"?c(@㿈 @Lʐ @LŰ 㿘  @b @L (6 㿘#bx`(`$bx ?c" 5t `l&ti@l d#&tW$bx'&h`$h(`0`  `@(`5d `E&dB@E = $h0&d`(` 0`*6`2ok g#bp `$bp-!"l `$"l@ c H$"l$bp?@6?㿘  } { ?   ;  2    ?㿘  ; Ґ"(Ѱ H ؔ @Ơw ;% > / :2`8˒ @=  `;"@"X? ڒ  ,@ːbp@k " (``˔@_b " (``@Sb " (`` "@d? ː"c   㿐5@"@ @(``@(``@`" ? .@  㿈.>L" SB2  l,  ?     ?         ?  @~,` ?  "@@K,@  㿐 L  " >@㿘 ` B    .``  / .` /# ː#( | B "@`  #8 㿐 y! #X ;20(  :2      _ :  `: @J " m mg g㿐  . B&      , .  &@ `." @#p? 9#8 㿐 ! )# ; &@}3 #= @U ,P㿀˶c̸`c̮`̬`h̪`P̨`8̠` #̤`@{^? @ f@LST`J(`@@(`0``  0?(`0``H0502(`0``O0)(`0``(0 (`0`` 0(`0``ېb@` @  b0 ?00@zAÁb#Ƃc(@ (@ (`4㿘b @@/ڐ!@Zi㿘1" @  @)S!̰?@ &"@/! b c c 㿘Ɔb  2   Ƃb̰?@!㿘 ` !  `D!@a@!? @a( b   0 @)!̰?@!0@ğ㿘 ǐ 0@ ɒ`H  Ɔc ` (@`a2(@㿘a؂` 9 `L8` !&&Ƃb`#a#!܄4 !4#a؂b #!& a ab bb`b`@l b `@ a܁㿘! &" `& L ` L$ 㿘 @Y* @(r @"p0<(`8`` 2 &c,"H)"`#b @.>  @(R !H@+b%"8cb @ @"!Ƅ??Ɛ @(98c̐!`@ư @S#<$#<`@ @ <# 㿘Ƃb   # @#`@" b9#@,U 6 @( Z!H' E!"%`$""@@W @'@z"p"$""`2C b`@ b `"7 @D  "$$""`$b`@ b `@, !b! @}  @' ̐!x@; c!䆂 : @ 8c. 㿘ǚ73dž(@ ' `4  & 4 &   ` ``   @ (`  `# 㿘!"#ǂ`$" ` ` ` `@R `"$`$""`b`@ b `@ 㿘'``@ @!"%`b$" @8Ւ @'"@"p"$""`1b`@ b `& @{?"$$""`$b`@͐ b `@c  ` (` `!  ?㿐'H  `<@BbX̀ a@ ɐ?@o;`0)3/'#97-'`  "%<@^H  ?`` 5` @*א@  ' ,(`8`` ` &? !  ,@bX 0z ,@a   V̐!@q?@0 k`Ab`$b"@@U @&a@"pb$bb`2M?b`@# b `"A?@ =?b%$bb`$"`@   `"@ @Fh%<@ 2 &@ k  `@ &<@(`` L?㿘#`<@(`8`  ̰?@!Ё@ 5`<(`8`@$`<! 0+ 0)   D`` X    @穐`?@2@  @`X ?` "` `* 8`` 2@.@ (@` 㿘 w̢ @#!r b$`@$@%P `RX* `P0U` \Ð \@, 8```@  `"2 7 ` 2  02 @Ð 0`  8:  0 8: @ 0`  0` @ 0`* : z * : @ `̦b̶b%+a```Y  `@x  ``^(8` \}`㿘-  +0/)7'9;```$@| 0@`%0@|WP A ,`$ ,"@@S @$@X"p$`2s?b`@ b `"g?@" ?%P$`% ,"`@u b ` ,@   ,,`(@  &D`   ,` (: ,`` (`0``@Ґ@ ``@$v"@" ``0 0 @(0 `<?` 4 @(d `,(@`, `<㿘`< (`8`` " ` @@v ?%`<)%!@'!"'`$"b"@@SM "%!$""`$b`@ b `@v !`<!@D:! @`(/1)9; ` ,@(`8`` !@r! @0a"`%"a"@@R  @#@Y"p"%""M`"&!%""`%a"`@ b `a@ a,@C`a @@ߒ  a @`()!E!"%`$""@@R @#@ "p"$""`D b`@A b `"8 @א  "%!$""`$b`@) b `@ a.% 㿘* `@C:  6 @#9 ̰?@Ɛ"82@ 㿘'ǨB %Ǡ#  L@  `D` ` `2  *  Ȑ &?`@?㿘(`8``! @b @ @x 2@""P *?(`8``!@2 @z2  " @"ΐ̐"h@[?a`b`(@)  &`㿘+-ǰ #)9;;/ǰ 0 b"`$b "@@Qʒ  @"@%"pb$bbu`b%$$bb`% "`@S b ` @  ,@( %D```$@z9 @`$@z  `` (`0`` @w, `` (`0``@@ $ $+`$ E !")ǂ`$" "@@QV @"#@"p"$""`2?b`@ b `?@{ "%`$$""`% b`@͐ b ` @c  `(@# `` (`0``@4@ ` @!ِ ?@f" ` ( ǰ  ` `(@`D`` ` ?㿘А D`LǤ D `  !9;@/" `$"#  $ @# "$""`hb`@T b `] @?"$""`2b`@>  `"@Ր  `>@`?    ǀ ` ̀`"` `ǀ `D̐"@ ``D ` ` `? `  ` `   D?㿘(`8``!! @2  @,@v  2@! "N (?(`8``!@2 @x22  " @ ̐"@}?a`b`(@'6 ` @`\ ``@  ǀ $ǁ `\㿘(`8``\`? 㿐@3`h @w (`0``( b (`0`` b$@"㿘b`@ǐ  b  @?㿘@b`  b 0@"$(BaT"P㿘 b`@``̰?#(`dž```2 \` \  㿘`4` `0 `X`0`X`L ̰?!㻘b`% %L b%## b `` @(`8``/$@l# ̔$@c #Lb @8 㿘@zb`  b0@m"㿘'(c=!"1",`d$"@O @a"p"$""`@b` b `5 , "$($""`&",b`~ b `    (8``\", .(`2 .# 㿘@P9  2  @"p  9 ! 㿘?b @``" ̅. ǂ``|#̰?#㿘 ̰?!`L`4 g#Ǡd# `$`  @@ ?㿘% `$@ '$`Eb` b `: ?L`4 $?!`@`e$`$L @@$L$ ` ǀ `(b` b ` O ? 㿘`X`L4 `0 `?` "  אԐ`XR@E  `L 4  @: b bb`]b`j b `R ?`0 @$@ `$ @$$`0 `X` @ ``@`@’ DŽ  `(b` b `  ? 㿘!S 0 0`X ` @6    @@  1+;/L-"`&"  `%  @ "&""`4b`ϐ b `) e?"&"" '`(`  `"O `  ` ?㿘`L`4 ߦ /Ɛ%)9B;  @1"0"0`$ b&"@@LӒ  @."p$x`%؂$`%"0"`\ b `"0 "0 @= )"؀2!"%`$"0"@@L  @b"p"$"":`"%"؂$""`$0b` b `! !"0 ,(`  B3b"0?`!&b$   @ b&bb`*b` b ` ?b &bbǀ `(b`Ӑ b ` i ? 㿘Ǥ `9;'#/-+ @` < }  `,(`8`` ! ``0 0 @ 0` (``" <(`8`` $<  (`8``. (`8`` " b`$b(   $ @' b bb`*b`W b `"? ?b$bb %(`= b `" @Ԑ  @?㿐 ' `< %4`)!"#`$"b8"@@Ko F"$4$""`$b8b` b ` b85 ! (+97-#;/=`%4%`<b`$b"8"@@K3 b%4$bb`%"8b`ǐ  ``<^ `<"8@)`<(`8``\%`<)%`<Š.4%`<b"`$b"8"@@J b%4$bb`%"8b`  `"`<" `<"8@`( 8``(``T̐!0?4% 8b`$b"8"@@J Eb%4$bb`%"8b`O  ` 8  8"8`)? 8T@  L`<(``#(w@p46'b`$b"8"@@Jx  @EӐ"pb$bbN`b%4$bb`%"8b`  `"  "8 (@'`<%`<`<(`8`` `!) C!"#ǂ`$"`8"@@J+ @"p"$""`<b` b `1Q 0B"% $""`$`8b` b `: !b8 8@: 8 `T( (`8``!`%`?`??㿐<@(`8`` Bb` <@`(8`" ( @` 2# <̃(8`` $#@B ǀ v < (`8``! ! < j`8'@t `8c%̐#X 0U%`X`   <(`8``n`p`l2   <  <  < <`<(8 e `<`@`@v`0`X &L?`؀ `~ z  <(`8``n`p`l2   <  <  < <`<(8 % `<`@`@6`0b`X F`L`@`> `(`a`?`4`b``   <(`8``n`p`l2   <  <  < <`<(8  `<`L   &?@  &?  6 ?(`8``" `!"@$ (``(`` &?@  `(? b b`[&b``!E   (`8``!#<(`8``n`p`l2   <  <  < <`<(8 K `< (``"$@"Ӑ"0O`@̀`u `Ld  &? G g`?`? U V`?)  <(`8``n`p`l2   <  <  < <`<(8  `<̰ @` @x `4`  <(`8``n`p`l2   <  <  < <`<(8 4 `<`4`  <(`8``n`p`l2   <  <  < <`<(8  `<  @` P(``Pא @[aX`    X<(`8``n`p`l2   <  <  < <`<(8 Z `<`@`@ k`X?~  z  <(`8``n`p`l2   <  <  < <`<(8 % `<`@`@ 6`0`X H `X ``4$`<  <(`8``n`p`l2   <  <  < <`<(8  `<x`X h `    <(`8``n`p`l2  < < < <`<(8  `<`0`XԔ`ݒ ?'#0'`X `4`"`X `L@&$0$`X̀ː 8  <(`8``n`p`l2   <  <  < <`<(8 g `<`@`@ x䀢 `   <(`8``n`p`l2  < < < <`<(8 1 `<`0`XP`X T  <(`8``n`p`l2  < < < <`<(8  `<`0`X`4 ` <(`8``n`p`l2   <  <  < <`<(8  `<``  cȀb ``4 `<(`8``n`p`l2  < <`<(8  `<`(`a` q?? `3b@``.`4``L `XJ   <(`8``n`p`l2   <  <  < <`<(8 X `<`@`@ i(``  (`8``!@$ (``(``4`X &'?%`L!  `( c <'% < (`8``g"  `p` ".`(`Ѐ` $` `r`  `$ < `$ <`$ <@-ܔ H#2$D$D$H`" `̀` <@(`8`` 2 <bL̀` P ` bD`<(`8`` "!(`8`` 2!̐!?"``$"bL`"!@O 2!"$""`2?b` b `"? 0"L  @@>"L $"L bb bb``b`ː b ``a ` "H@ CbD `@`H`H HH` H` H` H  <(`8``n`p`l2`HH`! <`! < HH`! <` <`` \  <(`8``n`p`l2   <  <  < <`<(8  `<`@`@ bLbH@QbD `% ?)! 0o X `4`2 X  `L@6$ X!% 0  <(`8``n`p`l2   <  <  < <`<(8  `<`@`@. `4`u  <(`8``n`p`l2   <  <  < <`<(8 } `<@ ?,`8``q`Q ǰ? `<`<@b``#$ `4` `L` `X `0`Lx  &:? <(`8``n`p`l2   <  <  < <`<(8  `<(``  (`8``!@$ (`` (``A#(,8``Wab`0`Xs "`L ((`a`ك,`8``q?`4` <(`8``n`p`l2  < <`< `<(8  p` ǒ` `0  `< ς`` @+ c!#$" 0$"   <(`8``n`p`l2  < < < <`<(8 u `<`X`L @@ @   <(`8``n`p`l2 " < " < " < <`<(8 B `<`4``X`L@)"`4`j#G W   <(`8``n`p`l2 " < " < " < <`<(8  `<=# `8@r `8@( a`͐ @f` ǒ` `0  װ?`X  ?  ?'D'H@ǐ  `ͪ`#`-%`! x p % $a@0 H@ @w`@A& DH@s?〢 sH"(@'HD @'DD`" H@@(`8``- D `$a$"H`'HD'D @3 &b@x x<@@   @    &b   @ @ؐ "   @ua  @uc @u  @ua@u Ȳ   @v`D H  D`$H@@(``H @ b`*H@@(`8``!"%H@$@}"D` @=`H@@(``#@b` `bP͸`?`(?Pͦa` 7a` ;אa@7;/-+) @@ƐC ?2`,(`+`(@Ð b`a`a@y崐 `` 4 @@Dz? `(壐 0(`8`` !`` ?4 @$?%`@ 7  `   ? 2) ǒ `(@c  b`a`a@  a׀`a@ @sb`Q`a`a@ 4A` (`8``^b? (`8``]2& # 2!  (`8`. :=2 (`8`   (`8] 􀠠   (`8``]` ـ`[`]@? 㿘`<`\  2 !(`8`` 2͐!8ذ 0d(`8`@` †`[1`<"x&`E!!"5`$"|"@@=V @#"p"$""`28 b` b `", {  "&"x$""`&|b`͐ b `!c !#"|`<@.'"|.`D`$`< d 㿘<(`8`  3!  <(`8`` @ 1"`2"S!P"] b  b`@1"@>_   b@ "p3 01" b@Ĕ """$(@P@9"&" 㿘a'P-+#;/(`8``&=`\@` &@#b`$ba"@@< b%$bb` %ab`)  `  켐 a (  @ N  (`8``0H `9FPЀ@@(`@@` &@#b`$ba"@@ ` a@ 6wba@E x<@@+w⤐ @Ē a `@`? a `@ے`?   -w@ a0@"@ 2 @z 2D@M` a@@㾘 @3`(Ǻ a  ͢ b@%!+6'&  i L P H)  i p f  $, r $4       %  $!$@ $!$$, %a8@@͔?ǀ Rb& @a4` a ̀`bP@ ͒b@ې a `" `2 ,  `, @@ a(@Ԑ ǰ? a0@ϧ. @#b@t$#(b͔b@ @C$?? .( ( $?? &@@!lx? @` wa@S x<@@0  @1( a4`2 @a `@@!A@@.<@@2 a `  a4` Ӑ@6㿘#`X!͐ @ #b`X @ c @6͐ 㿘  1@" @<`"Ͱ @s#` x 8  ( 0????o&`@P  ? @l’b@ ` #pb@s `  @8@"@ ``@`#b@sv q&`@ q  ? @Nb@ `#b@s\ @"` d@ϐ  ? @b@ `@`- d`#b@s8 㿘`" 3@ b "͒b # 3@b  ͒b#@s a8` a?㿘` 3@ zb "͒b #3@b  ͒b#@r a8` ΐ @G```0 `" @Y 0@` 0@Y0#%`0` `$ @Y `0@`$`0@Yl ? y`?x ah`a`a`" @7 8@ a@0m@K& "@`ђ@o ps&@  "dђ@o d`" 8@ "8ђ@ox 8 (0????@؀ ђ@og 㿘Ѱ @  㿐 @ 2  `2 ( (`2  ?ba`@o"  @jϒ  ad`H?w@o'!at`@  ad`ђ  2/Xad`ђ!@@?X` @  ad`w@n!@| ax`X(``Ȑ@& / * @oh$Ȑ@o*$ aha?`R ah`@n $ @X atX<@ @`? & @7  &@j; &ad`w@n!$  @  @n"ad`3 w@n{!.$?c`@ 〤 ad`@`a @@"@ @` ``$ؔ @ Ȁ   ad`w@! x` ah` ؀" x' ( ' 8? 0? a @  * ad`%w@n !   a`` ؀` 4'ؒ؁ad`ΐ "@Vx`X'? ax(`8``g  '΂`%` $|#Ȑ$al@#a0 2  $| $al #'܃(`8``u2 (`8``n2 ' $al$|ѐ@a8 " 'ܐ@c8р ڒa@'΂`` @m@z !X :'@R Gc` @j  '   @  1,  $@@jؔ'`2 ``@$@ (`@@  ``al #57'!9/a|# n S# a 1&  9$??Ѐ L N e < a b V2  8 c ' R n r g"? h f 5tz ly 8!`o r t o= qn E?Y vh [df'ܒ@mR a@̴!`\#Ȓ@M @(``"Q#ѐ @`a`I%t @m5 Da|`'!`$a| ;&9&x7&x#Ȑ@m#$#. a@? )$d'@(`8``. .'/#Ȑ @ @m"#'a| &ᄂ`$a|` $dq p` p *Θ @ܖh?H db(` @ @-/  @ b"` ap`2р $aahрa@ @@ ax a|`? x@|  ѴbҰbdѮbѸb8`(Ф b b @}  h  @(`8``-2 D`(``2  D  `ec h(`0`` 8B L(`@ap`ܒ@ؐ"@г 0 `% @#1 . '@d $@~*# L@=  < L@@ @"%@ T   L@< (ah`ah`ђ"H@ˋa|``a` `i "``2ah`" qc@l$&a|`$m ap`X@T"Q$@}#ђ"ad`a` a`` @a|Ҁ` LΖ Ȁ  ah`a`a`@  ad`@kD0" @ a`` P @@.0㿘 H`? `2 @ L"@U &  ? & H&   `& @& 㿘ސ ېא . Ѡ , * 㿘 Π `     @T? O"ɐ`P`L& `&* ``??&?2```  c `&@.@``Pr?2`2.@`` ` &0`P_?2`"  HWUP`& H` @? O"㿘%& &  L TOP`@"@ &  & H& @A ?? 2  @P" &:@߹  0 $"@߯ "?` &7 & H@  @' &2   H`2  `2  ! T@" &&㿘 3? ,``X(`8``w `r2 @L  `LT&@P&`&` >` >`  @i@e@'Qx ` @(`8``r`w `(``  @2 ~"!@*[ ` x L$@ P$`0$@$`4$`8$`$`$`$` $@$`H  @  T$@@ X,@(`8``w `?і @@@ `L@'R $`@$`" @(`8``w8$@@ (`  `?(`/7 / /?/ /7 /7 / // /''`P $@'@d $@ '@ @gB?2 P "    5  㿘?6  @?`(?`(@ (V@@2 ?c@?`@@ރc* @![          @@?@@@ @ @ @ @ @@@@@@@@Ϻ@H##@B&1?aa6I/`          @@@@@ @ @ @ @ @@@@@@@@8 @@2 !?@##@/`@㿘 ?@O!? # @1@ڒ##6`6 @#@&$8$c…8&?c8&. `( `     (@@Lj a` 0@ )  ! @  b⤀`㿘b`1!`㿘`Y b`ǰ8;a`@``(``@(0`(``0`(``0`(``0`(``0`(``0`(`0`ƛ6 "8dža`@6 `(``8 2` ``㿘 $  2㾘8;n c ' x$ (`ߒܒ.ʐ.6>@`, , 4`< @tuuv<vLw$wxx{|X}~ $xt耢  $  " " 8" " " " 0 L l P  ( , 0 8 <  ?   $ ` < `   8" < (@@ (@ " 8 ?㿘;?(`8``15?@2 0? (`& & 0`h& ( ,`2 (`X& , ( 0  @0 ?`& $"` >``"``("`$ ,@ 0?& $"`4  ہ`< 㿘  $` ,``4`" 0@ 0 , 0@ $& $ ?  $   `" "`0 ? @ `  `?   ( !㿐 "K?$"G?`2<`??` <8$< ($$8 8*8<0`$8$<<` $hhh @$@<$h`?  << $   ? $  `   <`?㿘 \`'?`$ W`(S`,` `0 ?0 G 4`  $`(`0 *@  `0`,@  @@3 @a0 L%0* la,8 l P  @e0$`P$`L l%0 @e0@$`l $ 4 @ڕ*$`4$$ ?㿘 $ 4`  $ ( 0  *@$ 4 >  (`2  $ $ 0(@$ ,$ ( (&@@ *  0 4@"@  ($ 0"@   4@"@@@"  0 4"@@ ($ 0$ ,  (@@$ 0$ 0 , ( @ $ ,㿘 "8?`$ "4? `` -?` 2`    ?` " ( $?  4@@V"@  ($ ,"@N$ , $  㿀 'H $`ú? `"`2@ `2@` 2  $@  ' `8`<b`p`T`X` e0`l''''@`8?(`ڄ@??``  "8&  @?(@` 4  * @G  &  $@`2& `$4 ` & (@ $` v $` & 8 @? `` $@"&  @?(@` 4,4 ?# (`$`& 8  $@ ` `  & & & &$`<$`8+  @ $`& 8 $@H"& ``  4 "&  @?(@` $`4`" * ``20& aN$`L $`T $`X΂ $`P  $@0Q   4"&  @?(@` ?4# @2a&  $`@$@  `@`"Y   o@9`@% @@$`@%"c&  @?(@`  4 a4 $``$`d$`\a4'8%&  $`h$@"B&  @?(@` (Ζ(`$`h0` @0`p4`h`\* Ά(`$`h0`@0`p`h($`l$`L $`T  @_ 2&  $`h$@`L (@ (`` ` "&  @?(@`) 0`` ) "&  @?(@`  4$`h$+ @_0`p0`` "&  @?(@` 4 ;$+ `n@(`0` 4-``   "&  @?(@` 4$0```"&  @?(@` 4$0```  @ ( &  $@`(`$`h@0`p2`h`h`d`` *n`T@`$ $`l$`L``$`T @ 2>& `l``$`P`d $`X*` `p@@ 2-&  $@`L`T * (`  `  "=&  @?(@` "#(`2 (`(` 0* 0@ @ (`  `  "&  @?(@`$ 4 (`0`$`@ `$4 `  `@ 2& `$`H $@`H   "&  @?(@` `@`H $( 4@$`@ $@`P`X * (`    "&  @?(@` ``2 (@ 0* 0@ @ (`    "&  @?(@`$ 4 `$@~4(0`$`D$`H $@`H  `,"&  @?(@` `D`H $( 4@$`D`,`D @8V&  $@s&`D(`@`0 `4`(  @ @`@(%@8`@% @$`@ @(``@`?$ "C& `@- `` 4 "5&  @?(@`  & @> ``@ $`` % $`& 84`4 ?# (`, & $@   $@ & & && `($`8` $`<@`8  "   "  $@7?   "&@@> C > ``@ $` " ` `"@5$`& 8`@`<` @ (`?(`& 4H` `"??X 'H'T0@`` 20@  H@ (0`0(T @؃*`@(```*`@  @0` (`(`(@`(0`$T  ؃+`@(``ښ``+`ڄ ((`0` 2$7 `7@0  H@(`0`(```0(`0`7@ )     ?Шa aN  Ђb !}ЂaΪ}@ @  `? (@   ?& . 0`@  @  `(`@ & (2 ( $(`.@@(`0`` (@20 @@.@(`  2\ H(`0`(`0`.@0 `" & ص(@@ ( (`0`&` `(` * (@;. (@,@(`@@&@8`0  @ @2   @2 (`.@@(`0` (@20" @@ ‣`*@$T#@ ? с#@  Є bL(@a 㿘@ @" b#Hdpp㿘a a``Xbbѐ ca``X`aҐ `@a``XҐ @`H@" 㿐(``?@     ?@D􀢠 Җ`@ 㿐(``@r "    ?@D􀢠 `2?Җ`@ϐ ?x @`(`X@T 8 Ҩ `  'n (`8``oȄ`? a (`8``gȄ`? a (`8``mȄ`? a (`8``fȄ`? a`g4`u`P"'  `X`H`LL #`f`RD  `rȀ`h,`o8a0`4a !   'a`"'─,@@ ?(`8`@ $┺ @?b&``Ґ @5` `? ` @  `   a(`2@@'@Ђ``@"@b @`<`@(``"?'H`@~ >a 8.'a`7@@Ђ``%@" @. @ ""@`Ҕa@ @(``' ?3?@Ő'܀  Ҕa@ a` @@^ : "*  .@^?   ?,  ?@5 w `a `p3Ȑ z (`0`` 8+`(`@a@ a``0T  @ `a `  @E ``?`a @@ (`a`Ȁ  L@@@? ` ?@qS 䀠`  L`d@?@  @] @: 2 D@ ` a@@?@ b$#㿘`XҐ @ǒa0@ v P'ap # uc c'@(``@?퀢 gb&`    q b@+@N Ҕax@d` qҔa(``" Ґ @a@I 2 Ҕa@ .  @ @F 2  @a 9b@ېÀ `1  `@dҀ?'a,@@\@ t@pw! `6@" @\@@k?@j&@@T` " Ғb@   @ @iI!蠒  (``` @wa@ bH#a@  8 aȀ H `@ D`(`0`= a@" @3 0 .  ```& ` !  @* 8 `   @ (`8`` `/  2 (``? 㿘@"@,  ,`8`@,  * `"  @,` (`8`@"  @2  @   2@ 㿘!"( @0$"(㿘 @  b̂b̦ ` @  ˂a`\FaT (8` p4 `@  @+b bˢab"@  ` 4@  /  @I6 `  @+  2  @@+ (`8``@+ (`8``@ %  @@{: : @+j@+f ,@+a (`8``2@+X2 @+S `2 @  `2 ˂a`e\FaT2  t p @@˂a`e\FaT2" " p˂a`e\FaT2" " t@P H @` /`??''@'@ H ˀ # ` aȀ 2 (  2 (     H@% /cl?''?'@˂a`e\FaT    `$FaT2  @(0 @( 0 $ ( 0$ @(0 @( 0 $ ( 0$ @I@   @*$@A˂a`e\FaT  @`P `  F aT ,,@`(`2   @`t`p@2 z   t @.`8 m ˂a`e\FaT ,,@`((`@ `(@`p(`@8`p˂a`e\FaT2,,@ `(@8`p˂a`F\aT0 8`@C<  8`@C< ˂a`F\aT0 h9 @$ h 9 9 @ < ˂a`Fe\aT(`@`(8`(`@`pD 4(`0 F` 8"`0FaT2  `P@D F2`0@aT `0aT2  `Le<eD Ԓ ` "@ ,˸a `0Ē `w @ "bb"@  ``0@  . e\FaT-`-`@`(8`@`p 4(`0 F` 8"`0FaT2  `P@D F2`0@aT `0aT2  `Le<eD o `"  @ ǒb@ ڐ a`"@ր  @*!  ˂ @,` @ W ˂a`e\FaT -`-`@`(,@ `(@`p,@8`p˂a`e\FaT2-`-`@ `(@ `p `t˂a`F\aT0 8`@c<  8`@c< ˂a`F\aT0 h9 @$ h 9 9 ` < ˂a``8@) 㿘 0@- ,` ``  ) 0 ` 4 `$!$4 ` @( , , `0 @ ,㿘 , 0  @d    $$@(  , 㿘@Q  (`8`.`8`   @^ Y3Ӵ @ a bX bX` 2b<(`0`@@`?`aӒa @!( @1Ӄ(`!88`@"@!` .``X(``˃.``!@z @!P!`@Ճ!ha`2 @)!x  @6@P H @v@<(`0`@@`?Ӏ aӒa @!@ja  `X(``˂a`e\FaT2    @  C "@/!!@)H! 7!˂"X`"X@b˒ @ % '  /b?'@ D<"X@\!#a` @)!Ȁ 7b    ,<"X    " "Xa`" @!ˀ  `" @S  @G2 @ Fa bX b\@ bXbX`Ӏ!@8bX<(`0`@@@ `<@"@(ː"0 " b%ː  X     $"@@ /c ?'@'K `*`:`@'B2 @X@'<bX (`8``Ӑ"p@Ͱ 0|a @x 2 ,?? @x`0 , @xw   #bX #, 2 Ӑ"@ @;"X0I@&  E2 bX!є!  ˀbX!ܒ@bX `@2 @&bX `2 @^" ˔@|"ؐ@&Ò `2 a`  @   㻐@;"p@@ѐ $@& ˀ.Ӏ,aȀ %aȀ`@*Ӓ@=@'g <(`0`@@`?`aӒa @  Ӓ@"  `㿘˂a` 4`4@zzn 88 ` `22` `(.`6+` ג 2$``<`t@(4c@J`8  @ @. ". 6 .  * ``8b@$`8<```4 `8` ` `M`8  ` (`0`@$`8 (`0`@c !<`   ؀`.  `8a`"`< @@ <$`8c <`@'Ԓc@   6  *  㽘 @(`8``" @ʐ#   aaКaC ; 8 0 @ (0 @ +` 8 & + 3`& ˢa` 4`4@y@ < @ c6> & 8 (`0`@ (& ,@  8 @" , -`  2  `4  `  ` b  ( 㿘``b$(@@?`$:!@ @`$$`$$ 㿘!! "$!@$!㿘Ӗ@#H@G @% (`8``"4`2`@% @% *@$ ӓ*`#X@:`㿘b8`@vU`*` @ @2@ 2Ӓ@#p㿘ǀ ˀ €`( bH4 @`8` 4 2ˀ@ ˂a``8@4˄?@;`9 8E  2`(`ah`?8@F# 8`@`w` `8(@x: @ro`@ D@8`C4 `<@:`E@8`C4 ˀ2R (O ah`I@#˂a`@r=8`@8`B@x\.@: D@#Ё @r$: E ˀ2 ( ah`@͐#˂a``@Đ  㿘 ,  0@z   Ș `@ >   㿘 , `@ $@" `  0`@T 㿘a a a8bh8bˀ@ bt˂a`8%< H@@ bp%\FaT6 6  x bx@ˢ b@ b`FaT* *   d` b b` bd@Ȁ  a@ 8㿘˂a`%\FaT   0: ? : @tԐ@`   ` 8,``0@Z x `b8`@tŒ`*`@$"@$  $ 2$   < $ $ ˂a`< $ $ $\FaT2  $ $ (FaT  @ 2`p (8`; 0  ``  *\` #\FaT" X І8`< \FaT" \ ؆8`< \FaT2  `8`< %b@#`$`d @ޒ 2$`$Ԑ @$ `$"(` `!"㿐bh@8bh@ aȀ aȀ )`@ " Ԓ @ѐ "8bˀˀ\ta`` t 8`@t˲ b d'@     x `bdb`bpbx@8`˄@="9 ` @p}<`8@ ; B @ @pr=`@ D@sے@sϕ? @'ᨒ@ @D @&0 a˂a`e\FaTᘂ ᘁ! ᘁ㿘  ˀ Ԁ`aȀ aȀ2 `@Ԓ@A a ˀ2aЀ@a˂a``x@ 8`@ RˀaЀMa˴a 8`@si7       x ` 8@o< 8@ ; B @o=`@ D@sL@s@?`@" 0@ @&D& `x8`@s0@oƖ8a˂a`F\aTx  8`@s$ *`@ 8`@s *`@㿐Ԓ!@_ ˀ j`haȀ daȀ`@ ]H@F!˂a`e\FaT2``p@;  "pa`e\FaT2``pԐ!@&@ԃ(`! @ 0`a` @7@#˂a`e\FaT2``@!0˂a`e\FaT2`(`8`?@P `@!@㷐 @(`8``c (@   P 4  !ˠ! `0@&+ `0 8`@o<  `tF@@\B<  @( ( (`T6QF-aT->@2@`? `@   2)` $@c?X`"w@^!`@" "`˄e\@ @@  , ` ˂a`t@&\a|@#@F`aT   te\@2@@  `@   " @@@8`@`>@ 6 "CJ(`8``2<4  26(3   @ $@!@!! 2# ˂a`e\FaT2  `: `: @p!ˆ  bPb (   $F`  $㺈`<`&`<&`&`˂a`e\FaT2``˂a>``@<(`0`@X%\T(%FaT2``%(8` H  `@ C`FaT2``h`25 `2 / aT@D @@! 0 : ?:  @q@ˮ a'F'aTh \@<"@LT9  @ 8`@[&`4`8&`4e\2`?   9`@(`8``2I` &F``  @˒$@ !@ Ȑ! 26``\@ 0@s: $ $ 0@sy: $ $ @̑!b ˂  P( 28``@(`8``>@`(@ x 2` `  ˆa`8F&`4aT\@0(`(`8`Ԅ aԅ8adPȨ `e\2@@    "`@2@8`>@ "=`(`8``26`4 `20`(-``  @1$@t@ 0 2``˂a`e\FaT2  `: `: @!b   bP(  `t`   @l8`  d 㿘T <(`0`@@`?`aӔa @  5`@ڐ!؀ *`@˴!a@V8a˂a`e\FaT2ʐc ``!@@[  * ( P H @u /c '?(˂a`e\FaT2ʐc ``!@ b (` @)*a@8a㿐ˀa`   @ (`8``2 ! !@  (`8``˲`F !Ȑ@@`@aȀa`@" ˂a``<@oB-`*`@ @oA< >ˀ2,  9aС,  & 4@   `, ԰ !@K `@tr*`@( ( #a`@ g`a`@ `a`@ @˂a`=`@k8` @8`B@q-@: @ D@!! @bU"  #Ԁ@Ԓ@"  @bU" \˂a``@nɕ8`@bU2`"ԃ* @ \ ` (@@,@  % < @(@@2 @? * `% @6 * ˂a(` ˂a`e\FaT@!j $ (@!f < p˂a`e\FaT2 p (`? t  " 4@  * ˂a`e\FaT@]$ p@Y$ ˂a`e\FaT@^$ t@^$ ˂a`e\FaT2$ X$ d@˂a`e\FaT$ < ˂a`e\FaT2$ D$ ˂a`e\FaT$ < (˂a`e\FaT2$ @$ ˂a`e\FaT$ < 0˂a`e\FaT2$ H$ $˂a`F\aT48$ $ 8$ $ ˂a`F\aT48 $ h8$ 8 $  !b  @9!+` @b<` *  a` !ˀ! @Dc!!@ ah`!`@ΐ"@@>? a`!@͐"P! ?"!@z?$ !!|?@y ?$!|a  cˀ(`˂a`Ԓ`@Ő"p@ "@C"@@"@8ad`a``X(``"@"@*"@d!!`@!#@"!`@#0@ i!`@#P@ *!`@#x@ 7˪a`ap8Ḓ8`@i@B#\@?#`-d@3`+`5@- + @3`C+ +`@@ @WC<  3 -@2`*`- C* +  @`@0((@; 3`@ @WmD @2d ;`#\Ԓ#@&ah``daȆ @ @ ` >Ԓ@#ah`f˂a`+   ,ap8`@9  ;`@i;`@B=ap @8`D=ap  4@|?bH: e@ D=ap 8@i8` DD =ap @ѐ !!d`"!@ɐ (!d`P @ @. !#`@ڴ X#` @ڬ @  c ad b$b@` !ˠ! @ `(ˬ aЮ 4'8`@f @lא-: @B@8`B 8`@ B, 4`@  ` `(@D @ +02, E`,˨4H@@yӐ?˒: @ B, 4`@  ` `(@D @ +02@,  @o H /`' ap at a a a a`P' 'a@lo: s@f=8` 8`@B@l[(@: @ D@V!U\aˆ8`x8`2 ˀ@˨8a`<`X(``7!˂a`@bU\E?(0@  " E?  @ + 3`E?@;  @  E?2@!!`( @!`@ -` 'Ւ "!`@ `'F'aT 8aӒΒ<e\(`0`@ ]U (ʔ 0@Sc 21Xʔ @Sc 2)(``2$ a29 p˔ `@R`Ѐ 2˔ @Ra0 2 (``2@"@"@!؀ e\@2ʔ c!``@@K .*@k8b8`06 @k: 2`* *`@ B?8`(0`(@@%\22ˀ@-ah2%0@*$ˀ@%4@ &ˀ2 `8ˀ`2  `8 ˀ``ah`2 "a`2!<2@6" 2e\`48" " 8" " ?ar4e\2`0: ? : @h@  ? ``6`?ah`f2 @R"[((>*2e(8``@`,*2h`" #*" *2@0(@0(@   *@jv? 4`t *`( *`p+2@@ `   `ah`+ + @`(8`@`p Ր#@  ր @wf  4`t, `X, `(2@@    ` ah`, , @`X8`@`Д Ɛ#   ـ@Ɛ a@@8a2 @(`0``@  @ d#@@"0 2@w!`(@ c c":  e\@2   @ @ * @ *@7 *  a aȒ a a?h 48 8@cr ?%\2h8`  Q2h8`#\ ՘ #`@ a`"@‘#@# 5e\@'" h%: @ ؐ#@: *@!؀ @/*ߐe\@2ʔ c!``@@?EW@Sb8@8b8 :`8Q@KF@i: 2@(@  d%` @`@@``@( `@#@轔   @ e#@    ˀ@ a`,`-` @k a`@ `@?',&Yu c 㿐˂a`a,8`@b8#\@W: &6 P  H@kʐad /bd' aa  ˨ aЪ +/Ȁ =Ѐ 2``(`@]? (`8``; `D `$@@ܒ`, c 㿐˂a`a,8`@b%8#\@V: &6 㿘 4հ b@).-˒>  2 !Ȁ@$ @$`ۘ!`@<8`%!$$2$ !@ `D Ӑ xPD4@`00@c  ?  ` H @  ``8W (`X@@ K 0@ H 4 @ @ x@"0 2 @"0 2A 0!@ 0 @"0 ֐ :     笘!퀢 2ր`( @  X@Ԑ 2  @`w!`(# o2@2   @b ֓*` :`@ i @X  !*# $b @㈐ @j Hb $(` /cD' aȤ%@8 ab ˨aFaTӮbӰaxִaֲ`֬`غ``  `"` a 쭔"-$ A  $@] `X(``  @ "#˔@ "#a`" @*!h a~$ a`@=   e\@   :   : } @j!7 e\@    ?    ?e\@2 0 4#@: ` (`  * ` (  e\@2  !;@   ` ? p?Ф e`$c ܨ ֦`֮aPaJa@!܂`%!  "C` `"?`  72  <  맘@ "'`  H@L  2   딘@ "`@=  `2 @8  2   < `@*@`$b(` @  "` ` `"`` " $ @*@  㿘aaؐ@Tqp: &6 㿘aaؒ@Tb @i= 㶀   , ". @h{` 2'   ր  d $ @  "  `e SЂ ,@ "Z`Y F ' / /`@BA!`@h<a " @ .!8  ```(0`,`@ "0) 'ր7@ఔ@7 $@= @j   2 @h4@  "   `8`2  `8 Y  ' //!!@A!  `%` ``(0`@&} 74 @= @#  0 *@h_24`"-!@g  < `S ꛔ`,@X "I`H@g` "  >!@@"x?(`0`@  /!@@w"??< " <   !@7@A@  "` @= `";`@  32 `0` 8.  (`8``.2(  ` `2!  `( 2   (`8``.2  ֔#$@ "`` ˆ@= !`  ! @ 2#ֲc8ִc0ֶcˢ a/F1˺aT-<'@[ ``8(`p@ `8 `Ѐ` `̀`  ֔ # @# `8 `` ``@( (`8`` က` X(``  e @l  @ (`0`@@`?` `? @*@  2    3 `8  `. `()    @-$    @$$֐#P@V`a`"@#I$@# C `8  `2  `( < @ (`8`  # @ ,@ "`@  2 @   *`֔ :`@#``$` 㿘b$(@-b/ W+˂`%` 2``"M?`` @R (`8``2@?@J` (`8``7 ``@< (`8`` ☀4` `< `  "bX<`<` @"bX 2 )` $`" @@` ,?`$ c 㿘ab@Qoȱ: &6 P (  ( 㿘 4 -);+˒  "00 . 6`@ `(`8`8@`%!d@2 @29 !d@%!d 2`0 2 0  @(@(,@ap@=ap`F ƐP  H@e /c 'b ˺acֲcFaT֤ c9+ra@b, e: 8 ?Ȁ 2^``([`?Ȑ@y ``8F(`@@l (`8``cƐ@`@2 @2 9 c@%c 2 *``e\@2    @    `@- *`֖:`@3#` D !`@ `,& c 㿐ab8  #\@Px: &6 dXXXd?bXˢa`ࠂa`?b @e/`\?Ԅ` X`!?$`!!`@` !`2 $$@$ @  ?$$  ?,` Ԇ ?bԂ@ @X$` `X@6|L`4yLӨa4 $$P  `(9`8`08` 8`4 80`@8`< @a0 -`* !˒@  `E$$!` @͐ x "=L!`"$ג@ $ഀP  `(9`8`08D`80`@8`  80`@8`@afL,`*   $ˆ a(` ?Ԅ L`)@bU$P ?"Ȉ!80`@?8`І ?Ĉ   $P T?!b?@ @[ a`e\Ua  $\$Tഡ,  $XP@a഑* $\\80`@?8`̄ $`༄80`@?8`Є $d$`$h$`(`$l`༅880`@8`$dd\? Ć @bU$ ??bȂ@ @ @   @c   @// @c/h88  B?; 8 @ B * 2`@  ` `(@B @ +0Ȁ *  a, aa ? "@bU!! ܄? a༆@ZY8` @8`B@`x/ࠒ: @ D@s!`@" cԀ@ ?"܈@ݐ" ?؄8`@Z/8@F 2`(```$<$ ,2@^44%$$`$$@m]8$p$$$$`($ $($(`,&$,6$,$,$0\FT@24``04$x฀&$04`x฀($x$x`0`$t@&$04 ?"! @c @\?Ć@c  L"$@_ݐ ?"܈)  ?Ԉ"9!@  ``8! (`@`$ $ \=`\@ ` (@@+@( @  *`֖:`@# ` ?`"@@=    \;` \@ ` (@@+ ``$  9i؃+ 3`@  `(`8`8@`2``:`@  (@@*@`C 8#@@"0`$$`$588@lfl:   (@@'($&8$@ $$`=  0`@8`88@   @:@ ?⸆@< 88`@D 2 $($ `3 lh `   $(@ `#@ `+    p怋 " $$(@`#@$Ѕ8`@C? ?@8`C? "ܚ@8`C?@8`C?L) @@E  ?@ v`Ѐ  ?@  ˄( ?Ԇ ?ࠐ@ے  ˈ!) b@@@Eƒ ːp@ N` ?@쿒 ˆ( `X(``" AbԀ@\`@`\@@@@/-  8` (@@`@`\@8@`2` ?"؈8`@X@ D@B @!`E ݂ `ۃ(@?b̂@@& cA؀@``@@`@@@/-  8` (@@@`8@`2`?؄8`@W@ D@B @H!8`E ݂ `ۃ(@?І&`@\`@b`\@ ?"Ĉ@E ?(@ a` ?`@b`\@@\?bĂ@@`:@ ˄( ?؄ ?"؄@9,?܆? c L ?"Ȉ$P@DŔ @ N`Ѐ  @Ô ,,҄ ˂a(` 㿘aa@K: &6  c c ccb㿘@~  @rb㿘` @ @Ґ @rb㿘 @  @r}`㿘 /@_  $!,@@9! /$,@!@9b`!$@9! /@D @ax x<@@ (`8``r   @` @_{㿘 c`cc@b"c@\#@8} c`@Ð cc@G"c@A#`X@<"@ɐ 㿐 H'H'L'P'T'X'@ 㿐 H'H'L'P'T'X'㿐 H'H'L'P'T'X'㿘@@1Ŵ"(!t bx@Ր!  +<) '!@w#@ @#|` *x@嫠 x #@@# @`? `&ɠ@5_ €`㿐H'H'L'P'T'X'@ @+ 㿘!ɐ!e@.`e   @@^!גڐ!㿘 @8  ?``  ?Ѐ` גO!Ё ͐ ? Ѐ` * 8`` a8(҂b@ג1"  @^֔%h` "  (`" 2  @h̑(&4&4` ` ` (4&8@[&0`4(`0`&(?@H֒@[4 &|` (@(`2 0`    @@UNB @X< >80&,(@[k2 &8(@[f2 4&c@H@H@@[X&?8(`&@"|(`&|8@hl??@hh@@[9&@[5@h`&` @(`0`8  @@XeB ?8@< @X[B&d&,<`&d4d$P  `(9`8`08` 8`4 80`@8`< @Z0 ,`*   88`&& 㿘 a`1@h#K"0㿘ax ҨbˮaF9ˬaT;@UFa` ˤa8@ ` 2 e\FaT7Ua3אCbH <4@8` 8`@ C 2q %\@@2@@"#耠@2#쀠@ ֨ N˄a8a ,4אb` 4\אbxFaT2hఐ@ZT ג@ZN&hאb$0אb@@$4אԒbȂ@  ׃80`@8`אÒbax`༤8`@S<@8`B@Z ,: @ %ˠD0@ 0`a`u pkfa\,,W00R44M88HHHCLL>PP9TT4``/dd*hh%tt xxഀ฀ ༀ\\)ah`" @#˄˂`0` h c0 ` $ @:` *@אcX 0;ˈa F\aT)  48` 0 $ <8` 8 ( D8` @  L8` H  8`   8`   8`  `̅88d (`(  װ FbH㹠(`(˄? a|#b,$`   @!m  $` @@@ĝ# @6$ "` !$@5s#a#` @o:p  p@@u@w#0<@@R#@ "0 @b`  a`@Z#@5ٔ$ Ē@O a(`` ː  @! ˀ  a|a?ˀ a|#@3 a`@ ˄?? b@! bXɾ 6̾"1{|K"#"<jȃ 140X''~%\p&SW|Tdv=qS@ . ..arch48 catchmod8chgrp8 cpxdate48 ddx dfx edxhostname/O ksh shx lnx lsx mtxsha2568sha5128mkdir8eject8 mvx pax tar rmxsleep8stty48sync48A . ..firmwareKTsignifyFgroupxG protocolsdJpasswd tmpHspwd.dbK servicesasswd.origxIpwd.db ] fstab^ resolv.conf_$ hostsB . ..chown8 disklabelOdhclient/Odmesg8fsck48fsck_ffs/Oifconfig/Oinit48mknod8mount8 mount_cd9660 mount_ffsO mount_nfsOnewfs8ping48ping68reboot8halt48route8sysctl8umount8C ...D . ..L tmpE ...wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _unbound:*:53: _dpb:*:54: _pbuild:*:55: _pfetch:*:56: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: _iscsid:*:102: _smtpq:*:103: _file:*:104: _radiusd:*:105: dialer:*:117: nogroup:*:32766: nobody:*:32767: ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP <@8`  @L˒6 P˂a` e$`eP` ```(9`8`08eD`80`@8`  80`@8`@U`L,*  $`!!`@"X!` @Ɛ 2 ˄Ђ ( ˄0( ˂a`Ue\a`00`0``x@ߐ hˤa# `xa`@"Xa`  @ 2˄ , `0(` ˂a`Ue\a`00`0``t@ ˤa# `ta`@T"Xa`  @j ˄ , `0(` ˠ`0 (``ax` ˂a` @o`ha|@ˢa` @ $#L`L` ٪`Ь զ b0 31  8@T$H d: @@B 0$@  @ "`2`Y@   @w!`(` `0` &#LbH `C ; 8 0 @ 0(8@ `C ; 0 @ 0(@ +`@|ˀ  b0ْJ ` @p`,ˀ  a```,!<*``c& ˀ  ˄ bː b#˒ @P$bˀ  `$bٓ*`!8"@D ˀ  `"ٓ*`!`@W˂a`e`˂ (X(X @@#   x@c `'ؒ$@   @, c@Wo'a' '''@WfقbX' 'ؔ '@.@]ݐ@"㿘aȀ aȀ2 `@ْ!a``8`@QDa`*`@QE@c*`@㿘@@/i  @()  @(& @"㻘$ِ@B.@W @/y  ˒ b@( Pc  `ctac`2 (`8`` (`8`` c@0  c @V H /.#'쀦#1 ?Ђb'a'?G 'c,?''?8 @V$@ῐ /,??  Ȁ 퀧`тb  c`"$? ?,$@ᢔ"P?'5㿘<(`0`@ (  0 ˁ ah` ك(`!@0`㿘ˢa` b( b @0 ,`??8aa ` `(` ˠa$ $  0@`$(  # @ (`@`0  2  @쇐@셐ɐ"$ $ ??$  ` $ % , <˂a `㿘a`";" @U>b0 @`? a(``a|`6˒@<"@La(``  a(`` ْ@*"P 'b`%`?@@N$```$`@j 0@`$0@: F  @(a`` (`0``@Z@ `(` ```$`@: 0@` $0 y@ y Y n N@: y Yˁ  (`㿘 <`0`*  @`&`&ف (`8``2w׈ ˒y!a`"@"p  8"   & < & < " 㿘a`@ \""0 ǐ"㿘 6. . @@g  b@А"@Q"ժ `P-,cl@E@fl5 b@9s8`9 9 @@ @. l9 9 @@@#l@@=`@Ӑ@ 㿘` (``D`"```(80`@8` ْc @#0`@`.` &`ˤ aШ @+0! 8@QU#L$H d: @@rBa| 0 $n``0`  㿐 ' @AVa|` !@Z ?$  Ő a F\aT #@4  #< $ D ( L          ӂ`()!|'w`((``"(#Ѕ< 80 0 @Й8 ( @  @ "#a`2##X " #!| <ВL, #a|!G!! @g˂a`   ;@\ @Y`!|˂a`@ْ"@#x b(ˀ ! b ˂a``р`a`"#Ɛ#  ˒a` (`a|*` ah`!bb, , * @]@#! @Z%|?@Z$  $| @@㿘" @% 㿘6'D. . @@z FS# @Sc@А#ժ `P--cl@E@_l5 b@78`9 9 @@ @  9 9 @@@ l@@=`@D@  㿘˂a``d@@  @ a|j`  ` & & >㿘˺ a`˂a`8@bHb09 !`   9 @. 6`@  (` 8`8@`2 ` F 3`@ `(C 8`82+ 8`@7g @Ii=` @8`B@O-@: @ D!@bU Ԁ@Ԓ" ˂a``@48`@bU %˔0, 4`@   (@@ + ` (@ `* 2` @` `(@ D `B +@ !pa`@ ?`@ 9!p`8@2$$ @$$ b @ B 4  @    㿘˄a`@(@2  @  2`d a`  2 ڐ `   !   ` $  $ ` $ 㿘 8(c@@ (` `ҳ.`b#b6`>`" / @ @ @2 (@ (&)()  8  8݂@ 8   "* @ `*2@ @   (*2@  @ ((@@` @`?2@ @ )@`@`? 8   **@ *2@ @   (*2@ @  ((@)*@ 2@ @ *)*@ 8   ?*@ *2@ @   (*2@ @  ((@@*@ *2@ @ *@*@ 8```* @ *2@ @   (*2@  @ ((@ `?2@ @ 8@```#㿘c@* *      2          cp cpb` ,2  ˁ b  ctct  ct㿘 @N  " @H@F  @@@> $@<㿘@Pǐ  2  @\  !@'M P &@#  P @'@$   㿀bD' 'D'  @ @۵ 㿘 `@  3`(@㿀 'H'L'P'T'X@ۙ`TH'@ݼ 㿐b ' ' @  @ @ݷא h㿈b ''D'D' ' @  D@`@ݙ x㿘b "  @ "  @@݂     @4  b   @ @o 㿈 ' ' '  @L ?2 @g?@Tu ȁ㿐'DD@ ' '   D@L| ? @FD@3R 㿘@pI!(@( @!cx cx@㿐H'H'L'P'T'X' (@@ "(@&@`'㿈'XH''H'L'P'T''' 耠?'`?(`'@;d @`'  㿐 H''H'L'P'T@'X@㿘  "`@@ `@ @`? @ab@   &  Ԑ!@@ "& ``"!  @@ C` & !` k  & $ !x@ &   㿘 `7`3`/ 0@豐  bx" "  c@gX?’b@@a-    & , b& (& ($ , 㿘b ,2ڤ a@':a"  @N`  , 2 ' `& D& `"  `  F&   0  ` @1& 0}@Y Ő@Y ⤀`2 , ` @&  , 2  㿘 b`"`,`,`2`ˠ b?   J 2@Y `@Y[ 㿐 H''H'L'P'T@'X@@& 㿐@?  !ȁ '@;, @5 6 $! $@@ $ @͐"@ M 㿈@   ` @ C耢? @?"H @T@*  @T~?@Tz(`8``1$"0@Tj @"q!?@K`@E`@?`  @&;c@TK0= @&3`@TC@TA@& 4 @ 2 @ ( @ d 4 2`8  *"p@%  ` R@%  '@: @@@0"@ ?㿘!"`+ -   @L  `&  (` , `,$" , ( (:?2&   cp@4 > 㿘@) b` ,2 "`8@ϔ(ڰ `8!@??2 $"@`%$"@4   @~??""`@`  @`    2"Ё 㿘cp`    b cp `2 ,ː   cp1@& >  , 2  1 @1??N#p` #p㿘@@% @!Q ? #@?ڒ#Y@ِ 㿈 b ` @4$  , 2 @~ # `8"@-(1 @6V"Ѐ?4@@?. 2& ' ''@8b  @8^ "ؒ @9j !"Ж`8  p@Gch "Ж`8#H@ @ `0`#ˠ`D3 ``ct ct@ސ??2 $b@`%$b@3 ? @ ?bb`@` ?@ `  2"ct@8w p@ 4  @L ' ''@7  @7 <"cl`ch 'pch 'Ԓ'! "@8'#@G``#x@ #`_А? @4  ?@$  c`bА?@# ? @? @*`"?#`26@: ?`cp` ۂ?'@5n0` ې `Ё 0`   cl"pb(@ @ ဠ`Ҁ0㷈$%@$$'p@$p^ v @ '"ؒ '@8J  ''ې X@0ʒ``@#Ȑ`p''@`@# K  Ȑ? @  ?  cpۦa0?@} ?  `@` $ 2 1@ #p`?1#p`"#p` ۀ`  !x{!X@#;  @t   clX@b<  @: ۔a@ 0 @O ې!@x`@澐   @K"@2X 6F!@0! 6=!ۀfs  $#p  $cl-#b(!ۤb@ޔ?b@ "0  !$  #d#`#\          #`#\  ې#  ֐ p #\ #l #p #t #|  #  #d#x '#`##h   @7B ''' @6'  @6# @PĐ @P @P cp0k `#  (`0` `` *(2 㿐qb@` @  " @(`8``"`n  `(`8``o` @#l = " , @  "  `(r @ @  rbrbr;b (&   b@W4  "$&@`" &@@)" @@  c2&@@`"2&@rb@W 㿐@'    @[ k`@Xl X8dt 㿘`X`Xې bPXې b@@: 㿐H'H'L'P'T'X' @Vݒ  `X @ @ @0@@ 㿘`t`66 e@В`g ܐ @"1ˑ 㿘ːbe`e@ ! x t`@+ t  x 0@! Hܒ X8`X''s@"c8   `d `\ `X@ ܒ `X``ܢ`ܺbXݸawa@c|``'b <a`&M(`$@ 1 `\!#Ȓ    @ `<쀠` "'#O  'c!@ P? P4   cȄ"c!c `x!#Ȓ  @@ `D#ܒ!!#Ȓ   @n# `H#ܒ!0Ԑ!#Ȓ   @X#̀ `l#ܒ!X!#Ȓ " @@F `@#ܒِ!!#Ȓ   @3# `X#ܒƐ!!#Ȓ   @ # `\#ܒ!!#Ȓ   @ #̀z `p#Ȓ!#Ȓ    c@i `L#Ȓ`X`#Ȓ6[#Ȓ@G   PN T@G  `PD `Tܒ"p> 9 `dc@:? `4`䀠`cUcb ` `" (` cs@F͒bЀ "   @|?? ` b`X$ @` `X`̠ @Ds Ȓ?@J' `X,``@4@@ +s@FbЀ &̢$@2Ux%ܒ$u&@H@2K@$u@2AP@wܔb@YG `X`&̐@F_cp ̐ @F! 7N'''@' 776"'Ԃ @'؂$7'7J @/M?l?`\`T?  @  6 @O@< @`  2 @?@,""X @  "# "` @   r`,`@F   @E `b8'bXܪb`X`! x "@ 2 xC 0?   @  6 @@. @Y@  @@ `X`2@!<@@@ܒ"@@@ܒ@~" @?" ?* 8`` `$  Ѐ` (ܒ#"@ Ѐ`  :*8`` @(`0` @ 2 ` *ܕ:͐#H ` `  @*ܕ:#p ̂ P` P@ ( 9 P# `P@* @| "` D ` @(`0` @` @(`0` @8 ̀̀`P`X` @*ܖ:o#`P; 8 0 @ (0 @ @``&>` @`>@ (@( (@@` @@*@@`@`? @}3 㿘`D "  4 *@ϒ2 !(`0`$@,,@ `2`" @}㿘`X``h,`  @n`\``.` 6`. @@VEݔ`@Vb $㿘`X`6``h,`  @H@`.` . @ݔ`@VA "㿘%#  d@y8` `Ը`@bUݮ3 `ݬ  (  @# ``88`@( 0 `88`@F 8`2݀@8 ݐ! @|z  `@``bU`@y# ْ  ̂ `c@8c   ` `c@8c ` `<`u# @bUTT)  d@ym @(8`*`@ $@ `@bU  d@yY @(8`*``В ` d@yL X@'8`%P@98`*`@ `P/ d@y6@ڕ8`8` @ѐ@9ڕ8` @'̒@9ϕ8` @D@9Ǖ=@'8`*`@ 7@ #` 0O 4?@M` 8 ̂@ @ ``8d 8@C8d `$`8@ @ $` `8@ @(`@`4U `4  (@ @ # `:@0(@ @# ` @+ `8 `  d@x8` i`㿘  (@@     ݐ @PaP㿘`<`@,& l@,|& P`#  d@x8` ```@bU" ݐ )@O` ``b`\@.@bU6b`\@@#̂ (@@+`  d@xS8`  ``d@8d` `,@?: 8<݀<ݔap@O @ ''? @7 @>.d: ?`E@@w(B`H`80`@8` @8`B8@ `@2  @ :ݐ (@Na@= " 4@K?%`'@@ 8`@bU  ` ` t``x(`@ xE"@@( "@ `<`0`,0`0  ` `t0 `t `x T` T`(`@! X`X`(`@ \` \` \`80`@8`@ `` ``80`@8`@ d` d` $`ݐ %@Ma @"  @ bU \ ;`\@ ` (@@+` ` p#m@  bU d7`8@`@JGH` <`L@TT`d`@J/,* `$@ `d`@J",*  А  X  d@J,@<%P* @P` d@,@@<@I@<@@<˒@I* `5`8#``8@ܒ -@$(4` 4`@`8U @ ` ? `@  (@@+@ $` $@bU+-a;@`@I` `<`L`@TT``d`@I.@* `$@ ``d`@I.@*  А  `X  d@Iz.@@``@` (@@+@ `$` $ @&! . `@@G %`0@& `! D@:@  D``0`x@(`@`e\@@(?$l@(ݠ?$`Pa F)̦aT   @58`  @ 8`B@;. d:  @tΐD!`H D`<`8 `8'*(` @@(`$ l x@@5d8`@8`B@;.d: @ D@= @tDD0V@ `8`x```@H8 D @5'D `'T  'X @+@̀  `ybx@yg`X`(`` ( c( #\@ " b@P#\   ?@D̀? `h@U `< `̀ ```4 ݀  a# #``c$ `Pb #@K?`P!̅;  ``8 0 @ (8  0 @ ʐd   L`X d `\ `D@ ݐ  b@`@@ `Pݔ bh @Kn:4   @   ݖ b @K] @ݐ b  ݖb @KM#ݐ c(` `0`@` `4`0  H`4  L``H888e8``L888e@` 0$ P` 4$ T`0T8@ 8` 8   0 48`3 ch @K; $ `` 48`2 ޑ: $ d` d@r``<$8`  480`@8` ! |`  `X` eP` ``e` \ <`2`` 8c`00` t`00` x <`2`` e(`? < (`  ,  ` ?  d8 `$ `@  < D    `  cX  ,` @8c`00` t`00` x` x (% c`4`8@C8`: @ @!ŐC?8@< B@!@3$``4`8#@G @?@@G`@9ג$`  8@  0(`(` 89%0 0 t : @3:%0  @ <%0 t @3:%0  @ <%0 t%0 @3~:̒@B<%0`p p T8`$  x@9$8:   2 x ( x$< x$  `x````8`@F8@ ?@F@9x$` @&  ``x@F?@F@@9e$` `x````8`@F8@ ?@F@9U$` @&  ``x@Fv?@Fr@@9C$`  $P `(9`8`08` 8`04 80`@8`< @9" ,*  p4 @x&pp@t#`Hc`d8@ ԕ8` `$ 5̦ 5;<8@ ``x@F?@F@@8$``H58@ < 4082$ 8*8$P  `(<`8`08  08`4 80`@8`< @8 - * 8'̂ @$``x@E͐?@Eɐ@@8$```H@@tv#`$8 8`: @@ TB$ ,x`8@E8@ ?@E@8r8: 2 ( 8ݐ c@I8 @(:4 2@ (8@<  8$$``x@Ep?@El@@8=$` ޒ@t 0`<`#` |@8* $ ` ` `, ` $P `(;@`8`08@ 9 0`@8``L;`0`@ 8`@7,*  )$  x `  @E8@ $   `88dH ,@L(`@ @  @ԫ`̀  `ސ u` %@ Lh@ ! h h@ 4 h `L <`l `\`P ` b dP dT dX (` (` eH  (  @$ $  (` 4@DȐ?8,: @ @@7d@ : d<@ ``d@@p(`8 ?@D:  d c c d@` 8d@ 8d0`<` d0 `  d@ `( dH ` c ` c ` d ` d ``X` $8@ - 4̑ d`Pc ( J@pF?X< 8 0@(0 8 @@ X #\#`@    4' 8 , *c( J@D+?PP ?@ Ђ '؂ '܂  ' @6 ހ  a @7/Ȁ ޒa( Ѐ8 ̀``? , = @0: `\ @38`$8 `  F`0C - b(( @ B + 4`, ,`@@B@ B @ 3`B @ 3 `C + 3`@ 3`+`@ 3 + @ B 8 2 @`<2 * 2`@, 44ޖ@rX!@`<` @; 2  ',bx d%\FaT  e`$%\ 2@! 80`@8` 8`%`< `FaTUa \`d`@Q! `X` @3N    0@ eb `| @ `h?ڃ(`0``@!      @V#`̲ P``0c̃(@@( H! H@#̀ $`Dސ &a H@9 `D`@4   ;1D`&  d`2: `````d :@/@< B@5-@: @ @nސD  d@$P c c? @ @i w@7!@1; F `,`d`@i `\` `X`@Ԩ `<`TX \ހ a  c ` c ` d ` d ` ޒa @F`80`@8` 8`0 +$H d T<: @@niB 0$@4`  `0 D (  `8`4@5,  D@?@{, D( ``0@` `,`|`xސ@#^@8<@ @"3aT#˘T0H㿘`Xސ @]b@  㿘ޢ b0;%@| ?(  (`8``/"*@ / 2  (`8``.2   (`8``" ``.2  (``2 `` @p $`  㿀`` ސ @ bP6``p<@(@j@!z  e@!` _@N(`8`` (c`@J` @J ޚ#\ b`@Ԕ@/ ``0 `" @? 0@` 0@031`0``&@& `0@`&`0@ ?  y Y`?`? 㿘 @@!@@ d  `怤  `` x@:P? _ @%<@   `` `ް @oĐ"!@  ?E@J! 2A `@`@ ` @@@"@^  +"@tn?%Ȁ$*$@ҁ 2`Pޔb@I   @W  @=N@9  w@!@=B ̐ `@* wxa+<)b%#;A/̐@9Ғ .x@@ `2@oJ, ` x "$x@@`@/ `R@ݐ "`@`@_ $`  㿘`` ``  ` `   @yg ~w  (`0`` 85`(`@  w @? "3 D``"  `h @È @nڐU ``[  L L T@s  N$   ```2  D  8 L @ D(0````0 ` ``@/  `` ( 0``   L@D  ``"  @H` @Ɛ  $a0%̬cx#+̦`@w\ 2| D@/` a@G@sa㿘 @ݒ`(̪ `%#̦b#!  i P R  r f $   $ $` $`$ % e@jƔ?ڀ db&(` @``PY@`@/X ̀` `@O`4b#㿘à`ސ bސ c@@3 ` "` `* 8`` 2@n@ (@` 㿘(`8``2 @}! `@w! Y`W(``R`` `Đ < `4!`@nL < (@@$" ` ,@n8 , `@n,(`8`  (`8`` 4(`8``τ``` >`@n >㿘a(`8`.`1޳>`@ #(.`8`" *ޕ:@#H ޓ*`#hp:`  *`ޓ:`i#p```I  `@mԐ   @#x  1@ۑ#㿘a1@' ސ @Fc   8ca@@㿈@@q / Ѐ  @ `p@3cH     bx #@#ޤ c c@  t c@ik? fba(`@ &``@   0`@ p : ސ @F,ca`aX'@3``2ޔc> @ ɔ 2  a  @?u b 6 @=`"C a`"w@ !8 `0 7@  '@(`` ސ c@A '<耢  a`wa@EĐ `@E  @{5cp#㿘`Xߐ @`@k tax+<)@ސ@@? ,(``?@,^  a"@Β ?@@ x@?"@@@? " / ,@㿘 @V`(@ ߐ8 !`Ȩ`% p @:Ƞ Ґ @@a@9Œ!@~@hH?〢 mb(`@@w 0atw@ \ @@? ` (`8``/"*`h @+ے  a( `@@J 6`@@  `@ @ε?c|#4P(㿘, 8`` ߀`\`Ѐ` 2, ߒ`@ / , 2f( ["c(.@ `(`8``^ .`` (`8``]2=8((`8``['`\+`8` . : =2(( (`  8`(`8``f((`8``]2@22 (`8``n () 8```]((`8``] 2 @ ɒ.8` \( (`8``[ .@@`n`\  2(2 .@ `8`@.@ .@`8`͢a(8``k`[ Ȳ 㿘b `b `  `(8`` ` `;   `(8``".` .  ߐ @ Za(  @@&@ @ 㿘)ά`La@(`8``r"# `t`a `b2@   `{2:5 #`3%#  ,& @`, (`@2  @0` 2 $ 2  &   @ @ 2 㿘@1c@ <     (``&@@@ (  &@c@(X@ " @@ +@ߔaX@ʐ @`@ * @Ǣ㿐(`8``9 `06 `$`/2 0`\  ` 2&@ߐ @ah&@ &@ &@@jƔ &`߰ @a㻀δ c'̐ @`؀ '􀦠ߐ @za @c) ̨`a` ' "``(`8``#΀`̀`;~@ ?  c?c" @ߓ*`!@ :` T'@ $u'  ' "``(`8``,22$'` 0' "``@N $B'   '" ``  $$ )% @(``ߐ @גa!@!,*8`"  (`8`*ߕ: @a @ $  @ *b:@ ` (̃(`6<@``'' "``@$ ``'$' "``$'@(`` @$ߐ @eb@& ``'' "``(`8``;"u`" ߕ*bP:@<  ``'' "``@(`8``\ *b:@  ``'' "``@(``" ' ߕ*b:@ '   7@/]%( 8@"@  @@@ 2 (`8`` `    ( (`8``쀠`\ `@(@  @œ@Ւ`[* ``'' "``@(``ߐ @bߔ b$ c`?$& @{!?$@}U@B @p` ``'' "``ߔ Ēc$  ``'' "`` (``$ c$  ``'' "``a$ (``2 ߐ @ c   ,` ̃(`@ߨ@0@2  ` @- 2 @ 2 @/ " "" " %'(`8``߀`\ @͒cH@ $Ғ` 'ߐ @c?' ?(`8`% c% ̶` ̬ `  @.'@( 8@@"@  @@@R7@ " (`8` ߤ= @T#  \,@  (``8` ( ߐ @ec @&%  & \2  \,@` ` ,@`"@@@r'!% 2 ߐ @Dc ,@` (`8```\@ $@ @.`' ''$@?$`$` $` c'쀠`2' ``*8``g" `p`9 `;`1 `"'` 2{*'`w2u*#"$@ @`8$@o  l$` @ڒ`8@ ?@ @Β`h$@ '쀠`  '"``  @`@`,' @(`8``퀠` 耤, @`@ $`c`& @!? $` @{b@O`@}  : @v``X''􀠠 ' "``(`8``;҂'`'`(`8```\ @G`@,@     @7a 0D@,@}  ? b`aH @``2`@,@,ap@ 0@W! (@`a2(@ ` * +``2$@ؐ@֐'@Ґ@Ϣ '` ' "``(`8``;`e'"J @˒aD @`  ` @@ 2 `b2@c @ cΒ` c @  c㿘c#&`@ !`` `& @ ?@`&@? @ג@ @  ڒ 㿘``` (`0``@㬀@ ```` @ ?@` @N㬀? c` `?c@ !#`!'Hc@` c` @"ab Ά0$#X cqc   b`0bXbwa-+ͺbЦ(c(b X '`` `" @ ?@` @?!@7##@G``cA 1@c ((`` c(c@  " -( @b@#(@  c((``c @@cΐ@ c-c( c耠`2 c cc 2&  c!΀`$#@."p p@y_#` @yY@E`@s p<@ @ c("@ @d!#@(``#c$@#@I$$'c @N#@c$@֐#'c @?@?c @6@!΀ $#@c @)``#`(`8`@4#@f*```(`8`@%p@q o c@ c !q c c!#@`΀  c# @  c #` (`0``@xc@ `@xc` @x@`@ϐ 􀠠 @(`8`` 'P 2&  & H@`  㿘@ "  @"  㿘@ " " " @ 㿐`"&@'b)a#-/%̸`; `@#*c`o``%`"`.#`@c`  %#c@xC`@0 @^`c` %$  @ cbp@ c%`$ $ @魒 -c#c`$c@@* @( 8@{&@&@(c2^ (`8``#2X (`8``n2RN c#@@$c$ 2@(`8``#2 @(`8``n2@ 'c@'`@@h&@'h"&@(8``"c` 2**$ `@R$c$c*` * c$ c$ ' 㿐 cc `!)Ϊ`('%C#(# n a e E2 % n r i)# u2# $%# !$  $c ެ `"'# $㤒  @  "x@`h @^? fb(`!@;@      @ܘ# c1#`ΐ @o`h  (`0``2&#`΂ < c @`` @`2@0t`@ 0m @c@ݒ @꩐  @v@c@ c @e㿐L'X''L'P'T;# @`?` cc`@c(@``@aB @@ 㿘@`  @v@wa̐ 㿘@͔  @v@wa 㿘@  @v@ywa 㿘!@#( (@1P$#(@1H#(          x        `                  T    `      H  x       p  c?c`"@ (`8``{22㿘<`(`8``w`{1`s23 ` ?" @. "   @u`@  ?  ??@.  ?@u @ ?&  2 㿘  `@@  d& && "&  @@& & (㿘  c`2  ͒c8  c # @ `#8`Δ cc`c@S   ` c3߰ aX ?c` ? -+)'@@2! ```@  @| 2   @  @ @` tc``` (`0``@u @ `@u4c` @u.@`H  c| ct`3 ccD1c\c cx2`s  V"&`2 ` cD  E   c@`?@ `P ?@% G cx`2 `cD  "  c@`?|@ `- @2 `* cx@%` `cD   c@`?O   `? " Â``>8(`A,@#%ct@ * t!#Ԕ c$#(`$ct #,`,`  # @ `# @%k$  ' ' `Pcx`M  "UF `S   cD@Ӓ cD E'    @"@%5' #΄c,c, ٖ XbX΂,,` P"cD ΐ#,  ِ#,bXA cD #, @Hc cD +#L)& c̦ @8! ("`(`8`` (8` \c@^h-(8``  c@^_ $c @^[  @^W \ , #X@͓:` X㈂"c* @^D:  c @c` (``c!#@^2 $#@^/ ``#` (`0``@sr#@ `"@sc`Q 0Lc` ` !cD #@ ֒  `#@^ j  ]v'   bXZ 2i0K `"!b `2^cD  @!΂ cD# @ '   @ '  `"H' #@]ǐ C' cD #@   `";#@] 6c`ΠD ` D# c@ v  `c@]  @#%ct@ * t!#k c$#(`$ct ΃,`#,`   # @ `# @$$ `$tcD'c|Ā'c`" `@(   c`ch  Ē ! T & @  1΀ #@    # @##`\_.`\2 Ѐ` (8`" (8``\`&2`@* ,$˒&& c\,0` #("( `2"! "`@@ #$&& \#@`@#H@ @& ,`8```&`@ $&& \, ?` " Q # @e@@ @"@ (8``"?` 2??E?(`  ` +   Ē  @ *p    Ȁ`   Ȓ @Ԓ @'' @  \``"!cD #@  `"#@\=   8  `5 2& @̔!? $ @q`@` cD` @   ` bX@  " @q`@v ` ΄{ c||`"w |t `2p2 & @!? %@qb @O`} cD@Z  2  ٔ @QbX "K @qG@3 a`=,` ,`( ^ @  @ݒc,'' Δ @֐#, `2  "cD(??2 cc@֒bc` ` !cD #@@  `#@[l hԒ  2' aĜ#"㿘 @" `` c@K`  `&@  @㿘@  &㿘@ؐ  2@ @Kbc@&`&  @&@ 㿘 ??`@7`   @KFc "&$ `2$@  : 9 ;@ : 9 9 :㿘! c    m ?2-   @mΔ? l  (`  @) @I "*@` @)   2 ` =㿐!ܐ @m8 ?  (`#耤`   @K  (`` @@  (``"ܒ@K  a``T2  @J`@x `&  (@`2a a`  ܃(@@!v( Xa$ @mG ?@ 80``" ? ` `` +/// ?//񀠠!aa `@K "  " @= ܂a``@0@ @2@ aH(``   @! ` `?㿘 ܂aH`!܃(`!@? `@k`$!!$ 㿈  D' (`8``-? ܃((`0``  1b``, @      @ )`0   %  s ?  `@  `@J" ۤ  cP @l? l@ "(` ۑ( #@w` @I#8r`*bݰ`a@o| `'(``@I   ܂aH`(`` ݠ`<c8$cc@ @I@I#Hg '' ݠ`$   @ >4' @ 6 @&2ۘ I# @j @  ` .a(`8``% @P "$ ! @n 2@If ?@ 2 @2  "  @n` @M@IO  2  㿐ݘ``+  ` `#\#`8#`#\H@x$㿘@a܂aH`(``@I!X- ! @k8 ?$  (``?  @N   @N!p 2  ܂aH`(``2 㿘! ax  "  p ? l2   z2 ?&  @kA?〢 n  (`@L<  @ @L6 2   㿐 `  @H!  @AB  2 `?  㿐ܢ`a!ܨa ܤ a" t ? a2  2 G @j?怢 d  (`a8@x@ː 2  `" }$$  瀥@i a8`"  e$$@^ 2㿈܄ ` ܶ`aܠa̤ 'a  +'``@? p`+ p t U d ?2  x r2      ' '@j_?҂` (`(`8`-+ (``ܮ ܂â`?"`"@G!   @hL1% 0` `? ` '۸c˺?@~ۦccH%a@2!@`@rU@rR +H`@rR =0@$H =(@`$@@i @G\@ ۢ`€@s =  a$@@n`@~|`?`;`97@~Ő )`"&`" @r ! @r +`H2`@@r  =0'`H =(@`'`@@h @G#HP  @G !J @~쀠" @ ``2 "("%`!`  $2a8`< @1 @la8$ `$+`$(@`$a ` j㿈@(`8``r`t`e2   b   b `$` ܄ `     '3@5J7 ":` r U8 Z L% R& ?/  # f2) " %$ r u l p   x  t  ` ` ` "'``8  +  -@h!܀? i '@k " `'@kڒ "  `` ) (`8`-+ (`` ܺ  ܄?c瀈@F" `(``"?c P?߂c P@ @ ?߂c bR(@OCs܃4`۶cbX bH.8@|@1K !`@"h @  @a 2  @E"h!    Ҁa`תaۨcbX#bH@| ``-@"`-h  @D@Er  T  a`wabpbbbĸa@|` "`@" @`@" @\@E2b`@E+"`"@E$"d"@E"`"@E"" @E " " @E"@"@D""@D""@D""@D"ؐ@D < A`" `@Dѐ" `"   @DĐ"`-@D `-`@@D#X0@b@D@fZ@D#H "  2] ET= 4"`b= 㿘@(`8``w`? cc'ܤ   "  v ? V2     @f?耢 p (` @? ?2 ?ܲ`waFcc8䀠c(@@ c    @{_@{!x`?``@{O@{  @`0@/ ``(`"`@C``s(`@䀤f#q  @`@C#8@Cݐ#P@e` YY @CӐ#`@``@C̐#h@`"@@CŐ#x@`2 @C#``"@C#*#4 @%#@`"` @C#``2 ` @`@C#`     @C @C 2@Cz#H2  ?@㿀@(`8``e #ܬ`   bЪ`܂aH` (` `!   @L`(    `e`E(`8```n| (`8``-w(``p"!  s e"? n ?5 R925  u r2- '&@At 6!@C  0 ` (``  @B 6 @B 8 @eg? p````,` @ɒb  ܂`$ `$``(`   a `''" ''q  @cU`S `\2Q, (`8`f/ fra"D  b0\="7 7 \c3 \ rtn* \ v$ \$    ! ,  ((Ѓ8` І@   2 , \, ,  (`8``` ,  2  , ,p  ` p@;`ca `` 耠@2 @{ $ @) 6$@z@g`2߰ @|J@z Ͱ @zҐ 㿘܂aH`#܃(``8` `H P ?2   @dT? L`(``@Aΐ#` a(``  @j  @  @bj  @f@@A P @A!  aΒ`㿀܂aH`!܃(` 8` `H P ?2   @c? L܂aH`(` `3 x@ , @  `@ @c8倥@ S  2 @<b H @ c8 @  @A? `#`- @(`` @ "!@Đ@@@a `z@֔ @@ѐ@@ʢ  a$`''^$'1'!@@'!@h@h@ `2!@@А!  `@e@@@Ő"`Ba`0@+ a @(``@Ք  (`8``/2@i 䀤 " @i@ @i#8䀔`ג@@v!` a` @(`8``f`? 㿘 `#`܂aH` (``@0@(@( " @﹐@﶐ "@@S @J, 㿘# a `S@S !  @@9" @@A@b?耢 m` (`2܃, @`2     @(`8``p  ܢ  !@w  `@_@_˔@w `@?"8 @?"h㿘` `*ܢaH a. ` @(`8` $ @ (``2  $ a` @(``"  @#   aa `  x@ܒ @`L'b p :  ` (""@?@b?怢 ?܀`" )` ܀!(`$@``` `(&@㿈` `( @c#\#`!b`(  <@  < @{#\#` @֒c#d#hb@lM @K`Ȓ`@ ?@ ` $  `( `,`( ` ` `` ` @,d (`8``  @(`8` @K8@ ?@X `#h @@ '?Жb?   ?/@a?'px@C?؈ P'`HC  @` '  ?膀Є@b@?'`(`(`@C'Д?  ?膀?/@a?'px@c ?؈  '@C??'```@C'  ?؆@?/?؂a' ) К@c?   'ЄC?b@?'  5ِܘ"bX  ܚc    5۔ؐ!ْ "X #ܔ"X#  ܒ   cܔc    ٰ@gِ#܁@ @#۔c' ` Ƙ   c%ْ X@ސ?`c   cX    㿘! c0   v ?2   @`x? f (`@ [d`@=#8 @ @ݒ@ @*Y    㿐 a耠`! @c . `"`?@)  @cS$  $8`(`$` $`"` ܂aH`(`` b㿐!ܐ @`8 ?V (`  '@c I ܒ @=q!a  `2 ,`0 (`1 `9 "@ `  cH@= "`3`#cX @< @(`8``b@ @XF  㿐!ܐ @_8 ?= (` @b  ܂  ` @<͒cx `@(`8``r! a(`0``8 2!!Ȁ`2  @@ "  $!Ƞ @Wv @W 㿀! `   S" @_V? ? (` 26@s @s(8c c (  =(  (@@")   ,)  (!#@< ܃(`(`0`` 0@* ( 8ЄЀ#@s @sc8c c44z I" o a2 I u2  @   -`8` @^ ․ g" I@U V # " ` w g o X2  x u2 @ `  @@" ` - 8` @' ր r `@-`8``-`=`+ -  ,, @,- 8``,  @ "(``2(``8#@; @s 㿘!ܐ  @^X8 ?A (`@ @ݰ`$@c`` `"  @;@]c  @;  @v- "@   (`8``-2 (``" @v   ? @;#@u   㿘#ܐ` @^8 ?' @JT``(`" ܂aH`(``b ``@Vǒ `h'ܨ`   '̤4"2' s ? p2,  u&@9  0@;B@   (``  @:J 6 @;- 8+ @]?ɀ r(`?`&@:uے |@j-@ ?  `,@  `w @:o!` a `''Y '؂'a `''L '7ܐ 'b  H5 ` " "~  $ @`$@h`" `h`$` `@r ?@$`Ԅ  @[HԨ-   @[=̀` `$(`` @  "  @I  Ē @I  2,   `` `\`  `(`(`0`",耤2 `  `2 ,  ` 耤" , ?(`(`0```"?,@}d@cِ#8H(``    @ј @Q  2@c& `I@c`-p ` p@2`C @988`?㿐!ܐ @\t8 ?!   (`􀠠 @@  @?  " 㿐#ܐ`@\I8 ?? `(` 9 `< @$|  `c8@" (`@` a``@"@`@U  @^@@9  㿐a`#`@[8 ?* `(`  @2  6  @9m#x   @6 @9c   )     @$ $  o o o o o o k k k, k k k lh l< l l l qh l nX m< m` n, k m m m k k n n n o o o o o o o p p pd   ``  @@㿘`aa(``"(`8`(`8`@2 @ 2 `2  怠`(  (``2  㿘   ``?`8`  .`bP@@`?  `& 㿘` @  " `?`  @  "@`q @    X`2   @:! p  2  @   @ 2  ?48 @ 2   #(@  " @ 2  ?@`"   ?X@   @ 㿘g` @ @     @ 㿘@?@ @    @ 㿘 ` @  2  x@ ` `?@/ a``@x x?<@I"?㾈 `#8 (`Y|@%(`(`(`8``!`?@[ 'aH@ (`8`'`?'   ch@NhYh ^ h<@ Nh S h<@Ch H h<@|8h = h<@q-h 2 h<@f@h ' h<@[(h  h<@P0 h  h0` h  h 0` h  h0` ```h  `  `2 `8ނ ۂ  @\ 2'`&@r'ǒh ̐ a|S@h  @'I`@\  @ <`@\ 3@ 3@ 2 @ :  @0` @/K "  @/C  `&`&Yd(`@s`?o@ l j g e b ` ] [ @@h U @:耢 O2 G H@)耢 > @#h 82 0 1(,) @h # @耢 2 l쀠2 p t􀠀  ` @  Y@  *`@ ``"a w a!xYb'Ya '\ax'' \a', @`2 @ ʒ`8  ?, @ a  @5ΐ! , ''䀤  Z0\ @   $   @ @  @@ ܀`ϰ !%'$ @ ܂aH`(``@ raȀ "'  @ `?`? @ "'ࠄ?'uܰ㿈 @ 耎``  c2  2 @54!؁ @8`@5+!㿀a@ &! #%?  @-װ  2@܃(`(`0``2@5"8@U8` @Ē2?2?@v @Z ` *`:`"@4 @Y*`@<  @4"8㿘ȃ(`` !΢ cȨ (  H(Ȃ S( a(bd #))  `2 )"  a ?} H2  " @W(?ꀢ S (`` @4"P @U7 Φc)bd"( a ?R H `  (`8`@2  @4Jbx ` :  @V?Ԁ S܀ `bdb@4H ` `2   ` "t @ "t    c`2  @ (`8``#"     (`8``# +@  (`8`` `?&`" (`8`` c?&  ?@(`8`` 2 #+@+@?< #+@ @ "㿘 @w'#0@z c8$cP(`8`@  @ڐ "`ƀ  ?ƀƀ `?&@`@2 ` ƀ㿐\ `4'܆@b' s `((0(`8``' `"```=`:24ܢb(`8``\"ܶ2  @& @(`(`0``(8``' `"```=`:〠`\b`@&@ `2@*`#X:`@H "$@(`8``/&`?$'   `aaD``4@ @  $2$$'@㿘`@  (`8``/"(`8``/2(`8``/ @* 㿘  @@ u @  ((`88`"&  ) 㿘#ܠ   `a`@.`aߓ`㿘`D a`@Z>*c`%  ( `(```(8` *) [' ?% $# `(`8``( /@ℒ  /" ` @(8``ـ`\(`8``~ *,(` 3a!ܒ`!p@A& "" $!p@C(! $!p@2cha$!p`桐 ܄a'''@Δ$ 쀤 a$< , 条, ''' @a` ' @ 挒 . @`2  @ Ԓh & @(``ܒ A  a,` " &1 &㿘@ `@В@  ` 㿐#ܐ@i0" @W @`*a`a$< , 5, &`&@&`@a@WW`$ &@@h ܴ 㿀@G!!`' '' 'u@្ : @/@"- @@R%(`8``2 ,   , *  /,  @R@"$@ߔ <  @8`,  @ @ٔ ,`@  $@ې @@@ag` `&',& @(```S㿈P l#ܒ @a`@a j` '''%x a``T` ``<9@t#@wc8+ @8`  &a`"Ba. `.  "   @$@$  2  @@* "$  $ `   `@K   ( @&a互`(?@T  '`@d .``&䡒` `&@. .`&`(`' a$< , ơ, ''' a ' 䵒 &㿘 /@ 2 c  `. @@  @V 2P  #  @c)#!Y%#۔ cd@̐ \ ,@ǐ$cd̂~'͂~w'?//҂ & /& & & & /Ք@ cd`2 ?$cd `2 ?&  `2 ?&  `2 ?&  `2 ?&  `?& @z  " @ ɐ  \@j  㿘۰ c|`@Z~ `   p$ x?`(@$ p ?(`8` 2 xےc|`x2`pa``"`x(@`"`p㿘_ Y 2 @t   @ m , D  @(`8``/2a``㷑* ,`   , < 㺓, , ,@@ 쀠* a < , 㢡,      2@Q aL``#㿐! !`  @i   @O  @T`뀦 ?㿐``;aa@ `4`@4`h ,(`0``"`   cT!   @vj *`@tp2`(`` #  @vX *`@t_2`㿘 ܄aH(``(``"@ ( (``?@v 㿘? cdcd ` ` ` `  `#^ !@g`Ā ݄`   c`@     b@``   㿘 (`8`   Ӑ  `c ` ` `ӆ  `  `,(  И c(c2)  (8``> `?2))?*     (8`2耠^Ё#` Ӂ `D 㿘`,````   & `   ,` 㿘b ` (cc(8`` ` ", ^, @ (8`` ?@,, ,`@h@* @1΁#㿘 `?  @`c%a@<* ` ` @;@ `` %a`@<%'@ @#@$@$?ӂ"@` $q `,!@4  c2 ``   7` `@ & 1%@V  & `` Ӏ @?` *@? <@7  @3  ` # * @: `?  `㿘`` `c1 @8` #`Ӏ  ` ``H `,㿘   `!` @`   4    ӂ$ ` `` ``㿘`(`8`  `㿘  㿘   ` ( `㿐#c%G @"@'c c  $( ` `  ͐ ap`<a @8`  `@@㿘 ?1#b @``  Y ^  ? @R㿘ۂcd`   6㿘! 7!(`8`  @ 㿘% ??㿘`` b`$/     "'(8` `2 _ $2  (8` `2 _ $"2؀  `$㿘` `   ``  !$    `N$  8@㿘`` `$q  "k "( `(8``_`$2  L@ `"= 89*a1("4  `"0 8,*((`8`$* U`" 8*`"  8 *a((`8`*  " ``Ӏ U(8``_̀`$̀ U`R `$ fb Cfb Lfb U㿘D   `6 D 㿘1 c`܂aH`(``"" `2  * Ƒ:  * :  * }:  * x:  ((* :  @* j:  * e:  @(@(* :    㿘c 㿘`ڰ 㿘``@  $@4 $$Ő 㿘`c  $@4 $$  㿘`c b`$/  u   "'? ?(8` `2 ?_ $2? ??   ?(8` `2?_$"???؀ j `$㿘 㿘` \㿘Ȑc ` ` `ӆ  `  `,(?c 㿘?] 㿘a< a쀦# cӐ `<c"@cӐ@ `Ӡ `# `,$``1`㿘`(` a<ap`a`$(* " 㿘`<`$ * 㿘`<`$ *  㿘a 㿘a<  ? ਀ (`8`` ਂ@㿘%')+ #``!"$`% $@%%$%`l$$% %`$`@?  c  㿘`c``$ 2 2Ӑ O `$ (`8`@ Ӑe `$ 㿘#c`@ !Ӑ 0? "@4 @0 `@$ $` ߞ@㿘@!Ӓ'Ӑ Ӱ?  `, 1 ӄ`? `   * ˑ:  ? Ӱ `㿘a@   `(`7?@|? (`8`` ` `"`'"?  (`8`` ` `"`'2? (`8`` ` `"`'  0N  (`8``` +`$` `"`'"  (`8`` `  `  `"`'2    (`8`` ` ` `"`'" `4 Ӑ `$ . 8`` ` ` `"`'2 G,, 㿘``ӂ   ӄ`H(@  ! z#? `% `D 㿐 2/2  /1 $& $ @㿘`%@O1 (`ӢH@  C  `(`@$@& 㿘) ',@%$ِ$@ `%  `   `,(Ӑ `D' 㿘 _  D ` `@ ! D! D``  ` V`??2@@ "@`m `` @`    ! `,@* [:  @㿀`!`##\" " #` Ț찒 ## @  @ia4c@`@@q  @7 @H  @,`% 㿘`D 7  ` @&SJ  `D 㿘`8j`@ka #`Ӄ(`H  ` `@#K? @Ӡ`%" `2 (  ` 㿘c``( ``$@ $`$!<   㿘  㿘< ޒ 㿘``  $@4 $$ɒ  `c `(`H@kb㿘`c21   $@4& $ $  $  㿀c``#\" " #`Ú좒 `d   @~ ``?` cl@c @iZ4 `@(`8``/`#@ `0` a㿘   㿘   㿘   㿘   㿘  ~ 㿘  w 㿘  p 㿘@(`8``^ `@~@`` @2? 2"㿘`<a<`?(`  &? Ґ@Sc@(`8``^͐D? a `<?㿘! `( c'Ӏ`"@Ք  $@Վ ${  $ $$ 㿘 c@ (( @@  9"6 @c 4  @  2   `4`2 P@%:#Ё @ڐ & @ &c`& ` `مc " " " ` 0㷐 L'L'P'T'X'`@`'L '@`('  㿘!ӂ $ 4   kҐ#Xk " ˘  j !Ö  k "  d    d !x $ 4㿈  `0#?Ӑ  `@@| @b   @c  ܂aH(` cc `  d~ +g   xc4    rc4;h   b k`    <hd"-g   ^!g   C W!!   cQ    # eJ#    lC!    l<!    l5!!l   /!H !H  ) =!k   ##X#X    ~#\   [ 3k"#k    b    b   h b    dk"|'h   X   B X!g   L !!   l     >hې")g   Ր"   fϐ `   kɐ#     g!0    *j#%g   ܒ   C /h   f ఘ    gh!b      k!   ? l!   ? l!Ԙ    l!d!e   {"ؐ"ؒ  v    ep#!i   . i! !  c _   h]!,    iV    lP#<   qJ#    dC!`   g=!p#h   7b   A 1b!g   U *!  !   $ u!d    x x      j @   y k !   [ A b   [ B X   [ C ܒ   [ D c4b   O A X   O B ܒ   O Cۚ c4   O DԚ    [ H ͐   [ F Ɛ"   O H     O F"!r   0 !t   1 !t   2 !t   3 !t   4 !t   5 !t   6 !t   7 !t   8 !t!t   9{  A 5#`"#d#\   [ 1o ; B#`#\#d   [ 1d ; C#`#\#d   [ 1Y ; D#\#d`#`   [ 1N ;㿘 `(`0``2  l  `1@">#`a @"5  Z1 @"/㿘` c `    3@Adc㷐`0`@"&   cנa`"  (`0``2 @! 2  c 0ǐ(w@㵔`2@ c@ܒ 2 20@!ǐ# (``c T@ 20 cc{0  @ 20wj$!  # @ 2 cZ ,  @ 20, ,  c@ 0  92@!} @  㷐 c `Ҳ c ` ` ` .cT'+$a#ܠ a `,ӄ `DӒ@/ `<a 1 `)&  `% @ܒ@&@&   @!$ Ӑ `@/  `4 !&  )$ % ! @ apa`a<  8`@?( ?$ @ ` `8/? $  5-+P z$(w`(w $$ ( `'    @4 @ۛ @ 2 @ ` @ja   ``%` `w    2瀤 "'`8 @'`8`c @Z x @; @  X`/%?$$  㶈`pj`qc/k?cX9-?T R#/ /@J 2 @ 2  :@/@@@6@,@# %@*,@4 ɀ`,@F  (`8``^$@DB? N c Q? 㿘  . @V ?Ѐ .  `  ӂ  $ ( c  `$ӄ  `( ` ո L d t Մ X ( X㿘 @ސ 4$@/@ c2 @` @, `6 @ @ƒ   @ .@`&@@:` (.@`` @(`8`&@@ ܀.@@σ㾘@Y@2y   `2U @Rx k   @  (`8``/ x% &㿘@`֒ @` `a$< , Ҷ, &`&@&`@@א ^$ &@`$@$8`>`&@(`5@A㿘@'  /  (`8``{   (`8``{`} `,2"(`8``倠`$ "@$`*@`a$< , Q, %`%@%`@&$ %@$&  9;܃(`8``4  (`8``{`}+`, a% 2# 2  a?`$@@a@\@@W,k  2 㿘'#ܒ` @,Sap" "$ap@. ! @?c$apѢ`a@''''䀦 'H @)cЀ @^c ܂` ܄aH(``2 (``2(``܀2@a `''љ '''Ԃ(@ ''' ''t'x'| 7'` @=`8(`r8@ ` (`8`(r@   }'t (`t(` 'tj8` $`-@ ( -`"@@= * (``   )%'ܒ`@+ "" @Sp` `$p(`8``5 @`0 @`+ '``"   @\@#@*   @LP 0 2+7܆H (``?@?`7@ @K @א   @ @  2@ @  @#o 7 '܀'|'|@g 'Y  (`-`-` $ -@  @< * (`` ) * * "'  '/  @@3 @b` @<  -@` (``ְ   @ ,`8```#j  , `e (`8``2@ [ %,  (`8``*`@,  (`8``], @]{@_` @  `@ 2 ܃8``*`@a ` `@_e@b8@Y@  ܈!H (``   @@<. a `'@AB  R'(8`` '  (`8``:  ' (`8`` (`8`  '` ܃(`"(`0`` `@@`''(`8````(`8`@ ``'2 `,`(8``,`8` * @)`݀`8 ܄ (`2ߢa``2 @^Ԑ @7` 8  @``'ܠ `?\7@' [ s  (`8``*'`@k` (`8``]e`݀` !܄ (`2!! ^`@\@^`"` $< , [, @a$``2@$ ` (`8``@` `7 8/ * $a< , /, $' (`8``@`?7``=  `܃(`(`0`` @@^< @aW` ܃("(`0``@2 ܀` (`#8`?`+=-?2' ܈!H (``"c82 +  @Vf * @ @Y8, @|`@'|``2 `a Ο`" &`" ``6@6`%@&`6`t6` ``%"`=`#2`?2a  -@?-``'tb"(a @V  -@`` (`8`|@(8@ 't @'|(0% %=#2`  ?2`` -@ )-`-```(`8`@`@ @٤@(`8```%<`%``#N!`DG ,@> ,=  ( 6,@@> ,@,@: @&@>ߔ "a$@@@>Δ "  a$@A (``  `  (``' '|`@a'|`(`8`@@a` `ͷ{ @^r|`@@`'|`  %'(`8`@@``X@Ր \`@h  (` 8`'` |"'|?@'|' (`8`"'|'| 't '(`8`~t @?@` '܀"'|'|cPtt m  `'  'Z't `V'`KF ܀ .? " ?F'`'  $ @`$ @Fr"   @EȒ%'t@G. `#@$b`?$b'n'|j'|'t' t| ` ܃(`(`0``   ܃(`(`0``yꀧ u-@`ɒ"@x @ %@  H%Lx`"HCHx2H Ha$< ̝, H, ! !! H @`!  Ha$< ̄, H, ! !! H@@ )$H  a( `'@ 'Q ''''xs Ă ܃(`(`0```?` 23t . 쀥@2+'@n ( H @cH@` HHa$< ), H,   H ' @`!'t  ,="N],":@ -!*):A ] }?[ ~7{@x[`'xx'xx @@{x @x`'x -@`@ '`   (  a `''˕ ' '   @7ǐ *  (`8``2* (`8``/ "`:* `(`8``D  @(8`` `+ ( `(`` (8``- `(``  @Z@]@M@N!`@l   @q@㿐 @ `:`?(`8```?``(  ( (`8``2(2 (  *`b@@ؐ`?  `&   8     * * + ( ( ) )P )` )p ) *( *8 *H )p ) ) ) ) ) *X * ( ( ) )P )` *( *8 *H * +㿘!! `"" "!`" " * 㿐. `@.`<@ '耠&2(  (b)2( `@QH  @//( a̐bc c( cXcp`@  @%t 㿘 `( .`(``2@2 .`.` "a d .`.` "a̔㿘 b` (`8` "& `2&  > ((܄(`0``2 5` (`8` (`(`0``2 [2  @K, R  `"  C& @@"#a$@1@Ma& ` &Y& ܒ b aG`(`8` _ (`(`0``2 @ #" @'$@@1d & }"  `  `   @PT 2 ` '2 - -  @@@$ 2 `&   (`8``ꀤ )& & x 'L/''''@$'a'D @ ?c @#  L`2 @ #8@$v)䀠`(2  ''' @t@䀠`(  Db@Oߐ  @OL@N_D @# 㿘`(``@@b%o @O 2@ @"& `o @@@O&@  @?c&@& 㿘ɒ` `& b" @O@N"& 㿘`] ``?߀` ``# `!  8`"  `?"-  (% `|ϒ  `$ m  ` `    `84 O a̤  bP / >`;`  `   ` ` y#耠`( `` `  ` $ `8` (`@ @۝   @    @g        (  8      | z   u s   n l   @f`?  1@  ^  Z  V ` `&  `i  ` `& ܐ ` 0@  R  @  `& Ò  &  `% ] `&  (  ` `b$  @N @M!2$  `-`-` @  & x"''ܔǐ&@ / 0, / / 0 0 2 2 2 2 2 2Ӂaaa< !8`&Ӂ a(ӂ 㿘! @ֵ @D $ 㿘 @)c( @ 㿈ܐ@,a8 @ 2*! Y܀"W!@֐     @Ž) @& @D  #\  @ ?; @02!! $@P ! `@ % ?/> #/`> /> / @/`@_ @̐`  @{ ` `@C !a#!<a(`* Ӓa8!< !a<(`@*  a㿘`` ܢ a8 -I+8F(@"> =(9  (`4@ (`/@@* 2(a<  @$8` @ @4$@(` "{@+$& & )  `܂aH` (``>ӄ  a a #@I!@L 1$!@+a8`$!'Ӷc-9ܨx/ܺxa" @8! @a$@#@Տ   @Ľ ` % "!`#\   @ؖ ?  ` ` @@Ma ay   8`(@  @`" `      @`2`  `@䀠!S   `2?<2? a04?8 0/$@4&@! $b  $$@@┐@Mp0@& @@⇐a@Nؐ @M]a m@-/Haa `Ɣ`@ ! @ؒ    @  `㿘!!<` ܄!' aa8$!<? a㿘a`&!! 1@   @8!& `Da8a<a $! a a с㿘 %'#a<"@8`6. . @"@ a<. ]8, $a<$$㿘aܐ@`a<  $ 8`??㿘aa<@?`$@\8` . . ,` @2 2 &@ "&8` ꀦ?㿘aa<  2@# 㿐@) "/܀a(a ` (`a< `087@g# 1 `$Ɛ&2% (`8``?   5a< ": z?  <'#@9 * @㿘!a<!쀠@ #a %,@ !@Pa8!a $!$,עa%@    * (``  `  `@h  ,?` !!p@ : $!p܂aH`$(`` (1ܶ         J3"H n 0&D 9$4 ? e<' n r l23` s-+@ٝb "#@Ia @+Cc@” @2x H 2@&P? g (`@2 逥`2逗"@z p` @(``" `@q = a@)`@$ *`   2  `P#`    `#a@(ג`0@ѐ@ΐa `'' '' $@ @@#@dӐ@dͦ @d `耦2$` @M @ٓ  $@#@dV"@00@  2  2 2 `͐#``  7  !    @ @ %    `  ``?`A逧 `̨a!`":@/ @ @ @@/@w  @@/~@@?`ۦc;Ӷ`/׬a@ ۀ@a @+# a  @@  ` @'K @f8@9   @/F @?`תa (@0?2  @'%@f!@ES! @G2 #܀apa0@R X$ap   @1 2 `  !H@I @멒h  `a '`( G'''"` $ @ @"s"@@/ 耢 `$@e @!h@0L @0H,@"$ ? a a ` ` ` ` a a ` `?a"@㿘atc@$ @ ,"  " " @0p@~  @0Ք $`a$`$@&㿘  @0Ɣ  @0ܐ  @0|  a㿘 " 1܂ `` `1! ! @^?&!   @V?$ ܰa   @L?& 㿘ܠa  ` @<?$ 㿘ܠa    a `@*?$ 㿘!! ` @! ?$! 㿘@ @㿘Ѐ` . (``*(8` Д @  逦,a?*  '   `  `?逢 aa؃(8``p ` (```"?a&@?@Yx x<@ @  㿐a'H'L'P'T'X` H!'@+#@*#܁㿘 ap    a@`a "1a #܃(`8``-b@-{c 1!p``  `$`#@-gb!p `㿐'L'P'T'XL!ے'@+d#ܒ#@+ @)ѐ#܁㿐 'L'P'T'X!#@-Bb L'@+K#ܒ#@* @)#܀ @- 㿐a'H'L'P'T`'X ֒b8H'@++#㿐 a܄  ``'H'L'P'T(``'Xr `쀢ې#@-cH!'@+ #ܒ#@* @)u#a ܂aH`(``ܐ @ `㿐 a܄  ``'H'L'P'T(`` 'X8 H!'@*ؐ#ܒ#@* @)D#@ 㿘  @ @$`  ?ϐ"P @є 㿐@T "p&@ܠ& @ܘ㿘@ؒ  @$w` "P㿘 @(#܀` ߰@qaa2` `Ӏ`a" a"" `"" 㿐 ܔ@®aa `  @£ a$㿐 ܔ@™aa  `2@ @ P`2   D`2` @,b &  bba +@` `-(8`c8 @baݪ `c@`"``` @ (`"  : b@ @4 0``(`@`2 /G 0`` @@b!  @@-  `0 `` `` (`(/(`@`@f @` @ w b@+`a@+` ` @+zb2(``" `@+hb ``b@+X     ` `#\c@+D 2 `c @+6  ` @  @؀` 2L `$@+!cH @aa@ `2   `c(  @aD 2 aD a a @( (a@" a@  " 㿐 ܔ@NaaܤaHc܃(``"   `@"   `8 b$  2 acHb 2 @'&#ܒ @ 㿘a "   aa2 tvcX `3 =cP a  D ! a$13+c  "a" " 6  a cp a(9!(!,a㿐܂(`(`0``.   @ؘ#`a `"` @ 22D `"@  2 ` &@(8``%" `u  (`8``9 `0`+" `-`"Ӏ`%?Wa; a`?6 aLa M`G   @}#`@`a@ ? 2 4` @    @`2`@ @?a `@ 2  `   2 @ `"  &@ 㿐 ܔ@ a   ; ` @ (` ] a`! `@ ` a `@ K `  b$  ۲c acb# 2   @ 㿘aa܂aH`` a@((88  `"`"2  2  2 `"` 2 ` 逋`c`(連`c`(逋`c`( C#㿘 `& & ܂aH`(``" `@/᠀` ` " ?@5&   @& `" @4 "    & ܤ`a'ܢ` ݐ z& & ܂aH`(``6a8`1 `- %@` & x h& %!@!%!< 6 !<@ v@_cc  `   L` & @` & D `  `  d@`\  D@\ `2 D {&  D܄H(` `2 0   "  0* ݄@``" 0@5f 08`( 8`(8` 8` (`8`` ܂aH`(``" `ܐ!ے #@$# ` ܂aH`(``㿐 ܔ@ta 2` @j (`ѐ ` ` @Z  Ő#` `@c8 `c `$ $  `"  #H@$5#2$` J `"`  N` `2B`a8` `` ` @2`La8`/`h``x`@ $ #``   `ޒ @\ @ `h``x`@a @^NN ӂ`$` @" ` `E``@  ?`@C`,`$`a8` Ӏ  a8`ޒ @ؔ\a8`!# @a<  @a<@^ `H  @ @] p  a8``w$`  @{ 㿐 ܔ@ra &@a a@2 `-  2   a @   @L? @F `?(` Ҕ @0  6 @&@㿐 ܔ@!aa " `"   9`  I`Ȑ  @  } @ 㿘 @  "@4 &? 2 㿐 ܔ@a 2  @ڐ (` ? 2 Β `2  ``2 @{  @x 6  @- @]  @   @`" `"" D0`a 0́b` 㿐 ܔ@aa`  @{ 㿐`ua ܔ@kaD  @ D1a8$$ $ `$ #a` a `a @< @  @a8a "&@2`  `@?d&&8&0&4&(& &$& &a& ` &&@&H aӒ 1 a  0 @8   'ᬀ``@S,@{ @p`#` Ua( @ !8@ӱ a$ ܂aH`(``` `   & @a8`  `@` `@````q@<`lbŐ  @ @j܂aH`(``܀` aHcݢ?` *  @0?2 ܂aH`(```'@ `!܂aH`(``2  @0r X ݔ @0m xb2 @" " W @aP a( a8܂aH(` @7(`@1a aH` |aX@ @9P`8 b `܂a ` &H` ` `$܂aH` (``  !#@$ax@#c@$2 #@"Q @!#   @ `?`"$ 0㿘܄aH(``  (`` @7 ```X `   !Ӏ$!8@Ӏ  a<@L@[9a $!8a8`ݒ " @/3!@m` !<@1@[a֐  a8 cݰ `@2= 0 *  @/@2`1!8`1`3!a@!<@ *`@b  @@Za &!8a@@`  !<@@Za &!8 c0a@ a<` a8` b` 63@j`\Ӄ(` 8`cݠ`ݰ` *  @/A@2`܃(`@ ` 2` @/1 `@2@܂aH` (``@6㿘a 'ܢaH:%􀠀26 ``20 `2  ` (``"' `(``2"@2    @  `     @   2 @+ a@a􀠀 !#0`@`#0@횐 ܄aH(``(㿀a8`)#` @͔\!#0`&@` 6 #0@@Zb8@n  @ @Yb`   @̅''@k  @1  @d #a8`(c0`"!!@@C  @@Yb` !@@`  @@Yb8 u$a8@5 㿘܄ Pa aӔ a,@@ ܔ ) a"@.<`,   ܄aH (``  (  @$ ܆aHӃ(`` 4cݠ?` (``2ܒ (`@` @. `?2 ܄aH(``" (``@5 @ka a@2 `2  a00$2?@ 9ܪaH@?/a@1Ӯ?! ?@40   ?@ !@" `0 2 @`2`@@`8H@C$`8@<`0@@$`8<`0`0`8@!c$`8`<`0@@$`8<`0` P`(X@C$`(@<` @@$`(<` ` `(@!c$`(`<` @@$`(<` @V X$ `2  ``"   $ `2`@ b? `&2`D$` `2 $```0````$`` `8`@2`Hx$`H"` 2 ``$y! ``@$` `(``"< `29 `` `2 `0 `(``"- ````'a  `" `(`8``22 !!4@#x !4b @!4``2 `` `JcH `(``?`2 ` ` @ $`?$`(` (+b?@5"@U X? P \ \ d 4 < 4 d  0  $ L P d h'L(`(8`'ۺc| a  Ĭ Vc (`8``   ` Ȁ@2'̀` ` `  Ȁ'̂``@2'̀ `?''̃(8``\΃( (`8`)܄H(``dd6pHW7 A06m !Z#2$]ۀDV@2ˠ4W ]TV2wo] a[g\2la/2h,/ptjk leVh2XVfn2Rn/t vrqs2Gsv܀w2>'8 @ː@5$n (`8``{@D } АВ$! D$@@5 } 2*@@$@А@% } /т /В$@)@ .p @"$$̐@ސ @` а  a/р $؂@/Ѱ /ت a@͔$ӢР@^@Ȑ$Д @ŢР@P@ @H@ $@=@ђ`@ @" А @  Д$@@ 2*Аb@69@9T%͠@64@9O@,ta@v @6&@9A@l "0/@6@97@  (`8``/2@6 @9&(N$@5 @9@5 @9@? /6 ~@cap`$ ap``$"&Ђ``8 Ђ``*((8`8PВ$  //  / В$@@ȭ `@6q&@$@ ے@[܀"e 2b 8(8``!"(38` (`8``!ܤ* !ap` @ Ԑ@v` @&$9&@@ ے@$܀". 2+ ̀`"&@%  ` `x2`p@~`` '`x(@`'`p " 2 ̀`?@ (8``L@%#L2   a  a 㿐܀  ` /0/@5#0@8,!!@ `!''@ c ! @  c8` a* @  pȒ @` a@ ΐ @4#@@7 aā㿘a!`"  @! `㿘 @" c8" " " " " " $" <" ("?  !" 8" 4v! 4$ 0$ , , @ǜ 㿘H` H!!pc82`? (  * * " "!p" <$!pap@㿐'H'L'P'T'X pp`(< !#8M H'@#㿘`~&`a& `!t㿘ap۴cc@3ܶcH;/BaH ,$(0@+c8 (``  0   $ `     ,( @@! ,.$$ `8 "  @u%L (`` (`` `(88` C.`" aؒ  ,`$  ,) , "@@+ 2  "$ $` ?# !`" ,@*? ,(`8`` ` 0 ," @@Ȑհ?  `@  $ap`8`" 0%L@  0$$ @& 0 ` ``@ `'$"`"(`  ܃(`"(`0```"(``"     $  ^ b  @`$ $ $ X$ @` $$ O$ $$ K$  $`"   <$ap $`$ `$Pap` (``" <@ ?``"  < <$ap $`8$ $ <$ap $`$ `$ " ap $, `$ $ , $ $ap$ <$  " <a ` <$ap 2  $$ c8$ $ `"@1@@`(8 $(``" 㿘aL` apH`2 Hap  H(`8`  !!p(`8`  x \!p(`8`  i !p  aH㿈a `''j ('' +)Ӧap,`8`` `\!H`   @,,`8``[ `]D ,`8``",` ap, >"@&`? a'?' @`'''' Hӂ'' H aL K  " *' B !܂@? !p(`8`  \aH` 5  !p #!L#܂`! Lap(`8`  \!H`   apL LWap$`( $܄H(``" ! ` ( `'+ܶܺ'$'' @ڐ  ap-|@܄H(`` [ap$` [ ! [(`8`  \aH`  q o m !?k R` ? - ?_b @``0V b @``//ap(`8`  \H`     2,@,@`@ap,@2?ݐ    a<* @`@@(`8``! ap w`(@" "ap" " <r%apIap< *` \,@. "5,y !ap, ,܄ @ ,  , (``a`>ap 7`(" " "ap" <%ap @ + ? ! 'ap(`8`  \aH`  ( ,,0 ' \| "6 \$  ap, ,`2, ӂ ,L ` L א z%,  ɐ %Ԭ  \ `〦 $2,;apap(`8`  \aH`  $ $ \ "` `, @ j ap ,,, \,(`8`  \aH` X (?ap(`8`  \aH` C ( Q % %  $%  ,Uu ; % % %   ,A { ,  ,'ap,`8`` `\H` 8j,h@,`8``#q  `܃(`(`0``g `d `2a P, `܃(`(`0``V܃,`8`[2A, 2,"#H܄  @  @`, @(`` a4`ap,`8`` `\aH`   `܃(`(`0``,,`ב: ap(`8`   \0܄  @ m,g aH` l : #, ,ap(`8`   \aH` S  # %  \  h%   H  T%  <  H%܃(`(`0``5`  ,%ӂ X,܄  @ ,ap(`8`    \H`  ܃(`(`0``ܢ ,,   X, ܄ @ ϐ X,, ,,, , , $,ap  Ր % ,% ܆H(``ئ` % 2 ~ '2,?2' ӂ ,L L "ހ \?2  8> (T@ ("  ) " '2.   \2(  ` % %  % L` " \% 2   %  '2 % L L `2J,%쀦 ( ) `% 2?, `% ap(`8`  \aH`  ) ?2,P  $ @W , (,  % %  `% }逦 *쀦 } |?2u  ,퀦 (Ӏ * , ,   % ` \,2,ap(`8`  \aH`  $", \ "   ` ,`",,ap,‚ \, )# ( `#ap(`8`  \aH` z )  ,ǀ \ ' `e%  \ 'ap(`8`  \aH`~~  "  d % ,L` Li 2;, %  ,` " \ ,  V%2(,ap(`8`  \aH`  $ $4 \ " ` ", , \,,0  ) | ,?2  ( ,䀦 * , ,   % ap(`8`  \aH`   ܂ ܃(`(`0``܄ @ ܦ #X <`  >`? `?`} (`8``w ܃(`(`0``ma *` (`8`""ap(`8`  \aH` Y ' & > " & > ```/$`ap(`8`  \aH` 5 -``  @?`$` `? @$` |`@f$`$` $`! a2,2 , ( ;  &0 | ap+3ܪ`/57źap(`8`  \aH`  | ; |! &!` `+!ǀ &! Ѧ '`L`%La!`''h!''` $" ` p (`8`@!  @, p(`8`  \H`  ׀ (```` -  `4"@`9$;`p`А#p  @J, p(`8`  \H` A ݢ  @+, L%L`a܀@*e@܄Ā &aaH`(`` ap(`8`  \aH`   (!O!Ò"@`t$!A!  h*ਐ (`8` "܂`h `A@”" (hh(``Q O@Ah ܐ!x`h@    a `} aa=`  -ܐ @s`h %`!ap@<`" (  " " "p" <aa p`܁!` Ӆ:  axax `aP a8`  2 aPa8@ QܢaHx+<B) @ : ,(`8``\?@8 @ @ % 2? (`` @ ? .  " "" @CP 2 $ x@@2$ < $ P$$P`ӠaX  " a8  "a8@ a8$  $ @Cx x<@ @2< ӂaX ` `@ ӂap`ap@";apapax@baax2`@ZaP  ;ap@)# P`KaXaרxa'<% c  "9$ @BԒ 24$ x@@2/$ ̀( @ @ @4@2 @ @) @*   "L ;@'ɒ < $  2 㿘 !!􀠀2@-  2 㿘a @  㿘a耠`"   @(`8` `@¶`@2  Ò $   2 a `㿘!!`@! `@!ё 㿘a``" ` ``"` @.J` `"` ` , (`8``"   2` ` `(``"`ې @h ``; @(``- ܂aH` (```(`0`` ```` @na@ .` ݔ  @@@ G @@W``@` 9`㿘#a D``22 + a$ `$ a$ @$ $a㿘 ܂aH`(``!#܀  !ݰ` ` a`"@ܐ   a`$ @Ӑ $ @ #!a(`0`8 (@`n2 ` 0@  `2 4 $!p㿈'D'HD `$`'܂aH` '(`` H@ ap'' 쀠` aa @ʐ  A܀`3 (@a(`&0+쀠`!`ݐ#H܂aH` (``D`` `D  DD8 ` ܐ  apoܐ  pc 'ܠaH%1ܨc#ᤀ`@@ D`<` (``D$`D$ $쀠`  $`]D D@ G@(``2F ` (``'`iD / `!Ȁ`  D &!Ȅ  `H`& D`$`"@ k $``쀠`!Ȁ`2&!I0 (`` @(``0D  p``㿘a `" " " 㿀 'D' @[ 0'H''L'P <? a`''0'' a @ʐ  6L` ` ` ` `` `  (@a` 2܀` P`c```` gc L L` `H` `7 `'D ` @ג`$  ` ` ` `` ` 㿘 /@Iѐ 2 @c @c @`  @``? P@` `8@# a!a8  D@{7@+ a~@+@.@3a8 @ !̒a8 @ a8 @!@a8ܔ @@!`< ?  c?  s%ۂ`` $ @ "۠ ܐa8 @$@&: X@' a ܂aH(`(`p@wch  p@pcp  @ ?@c`    ܂aH(`cX `  @O `\ ܂aH(`! #0 `  @)   @ aܔ a@   @)# Ľ#@% @( (`8``/@? 0 @? 4  8< @ s#a (``a@ a @(``c8@'+ @{@% (@'cX`@% @'b ̐` `@!$!@% 0` !` a@( @ 2cܔ @ @a``8a( `@%^#0`a`@(p@ # ܂aH`(`` @(c@c8 `@& @ώa  @q@  ܠaH , ,  @ 6 @T  (``a G`. @"`" ᣐ @ . @R' ' (``"a *`. @ $`  @  0 $`   ``@Q` @E>y ` ܰ ) aaܒ`aH  ,`X"    @ $` @  @    , ,$`$` `$`$` $`  @Ȓ <@@ !܂aH` (``!H@Ր !ܠ!H , (`8``=@ (```. a)!`@Р %@?ܤ%@a8;* ! "  ("%@$$N a܆aH(((``  (`` g``ܠaH (``     (`` ܒ     ܄aH(``  (``@$) @'D  (``  Ԗ Z@ 2@$!@'/P 2,` ,># ܂aH(`,`܄ aH(`܄aH (`` @_(  㿘@@a  @F@@D2 3 㿐`@(`8``c `b: ` @y`(``"` (!@i ` "(``!8(` ?c (`2`@2 ? 0`@@!X @@  @@@CӰ Ԑ `܄b02"`1"@0܆b  `(``(㿘܆bڄ>4`02`02J `0Ő! "p " " " @"1!"㿘ӂa(``b@ @?,@%  " * " " " "㿘      $ ǒ` &@$$ 㿘  a$`$@( 5@Ӑ a`㿘  @d      @Z  ?㿘 @ `#@ې @ "@; 怤`㿘 @   (``"  @q&  @@ע@ * $@,@㿐a `$cT@R'  @H``  $  @@.$ $  b"c86`@bА@ `@6`@ `@性 @ D a`㿘܆b(`0`a" ۲c|֠ ah+b`(``(1w0! $@+  2`H$ `H` `0* @ :   `@&`H`(@&`@ (`8``ހ`' 1!h㿘  c`  ``)2`|??2 *`"*` *` `6  `@@ * 㿘 c  V `S  ``*J`?H`[`] 2G  `2A  `!  `8  `]4 2 ` "/ 9 *  ` `@Ð  "  ``|`) "  2   2   2?    *  `? 㿘` @(`@@,``2B`@(`  &`(8``-(`8``-(`` @``&@&`(8`-" ` `" &`+2&`,``2@&`?``&@-@ `@&``,``8 ?&` : ; , #@0 2 (`8``:2` `.`&``"`( a,`;  7b(`8` : ;: ,@) (``W&`` ;&` O&@2K&`(`8``:2` `.`&`^ :`"`( a c܋` `Jΐ#8G ? #@(`@&`@=&`;@, (`"܃(`(`0``2 &`@a 2 &`&`&` (`(`0``  @a 2 &` &`&`&@&` ?had@㿘` . @ @a   %. ? b 㿘 `@ `` `Z```?"π``[`*2r̀`2l*h`АA`8a`f`g`!c  [ `[[ 2Q `:M  :`b? @ : `27 $@ 2` (``2 ``@    @  @` " ` `[2 `:" `2 `]L  `     "  (2 `[9 ` `-  `]   ` `2` 4 @4   `2d `]2`   " ?  O ` ? 2  :? "  y ؖ 2l  gڐ _` ? 2Q  @ "   < 1ߐ ۰?  є     @ *u`?   ] "  X `* @O@L@ 2&`@a`@`?(㿐 @6s(``@(``   |c&@  㿘 c#x㿘   @ @<p `ܚaH(@ `(`"  (``) %(a)Ԓ`㿘.`@`܂aH@(````Úb8@  㿐܄aH((` 8` `C    ( ܂aH(`(`(`!(@ `ꀦ'@@m'@C a@ (΂`aa@܂aH(`$P'L(``- (@`p@V *!Ӓc(@!@M!!`((`"(`0```,@`* 2,@*Ӏ`a (`8``-  @@< /  (`8``-`?܂aH(` Ӭa ܮaH `  `0` A` ` o ?b`?䀠@?}`䀢 A '  #08 ',`@ "`@,@ ~ ~'``%,` ۔#i S #x (`` , @뀢`#P   %2 #H;  (`8`/(@`(`8`@t#X s"  (`8`2(`8`@"Ӓ % جch?U?o예`'L܃+`!L(`8`-`? 2+L(``L  `܄aH(```((#'L`    ܃(`@ L ` @(`` @͒ (`` ` ،? ܉(``"@ "ܐ*@ '܅(``܁㿘` `*@ (`8``a`/`?     (`8``/` `. .((0 (`8`  /瀡 .% (`8```/  2  /(((̆͘ Ȇ (`8``/ /(` @(8``" `/2( 㿘`c8@(`8``/`.' ~  `(8``."`(8``/`?`? #   (`8`@ "  `:2 &   (`8``/"% ""(``"@: @6@9P@(`8``/ /, $' 2  @@90(`8``/  /, @  @@9"&㻘` @i, 8``/"`c@= / $@͐` `, 8``. /N /, 8``. /(`8``. /(`8``/98?4. @ @ @8,#@_  @@`" (|(`8``/&@  2㿈@na`''( ''q 쀢2* /* * #"@㿘   [ c8@< @ !! 8$!a@8M c8a` 8 L L L L L L L L L L L  L L L ̝㿘a``  `6@ #a @@\?`$"` ?c&@` 8 @`&` &` @  㿘a2  `6 a8@'? $u"  `o?c&"`"`?@d@2\?   ,p*`        @ &  +`& & & & =& "7   # @@ 6$@@```h@& & $#& @̔ ?@& `ޒ`"   & &  ?@ & & & @&?㿘 gaP`6 ah_@ @@7C@ &&&@ * E??8 )`@4$@q 6$@@h```?h@\&&&$`$ $@7 @&&㿘 @?㿐@? a?F@`"1`` `/ a@h@?`$"6` @`@`" ` @?h@&@&`$` @  瀢 `2 ` ?2`?`&`(&`x `ܬ bݺ`  u  2 Ϯ& (@`& Ȯ`."*!`h`*"' `+` `#4 ` `-. ` (`l`0& ` !F@C B@? "= <@9 !5 63 0 @(`8``l2* `' @% (`(`0``&,`8` Ї) ) (@8Ј@(`(`0```88`! @,`8```c``"` `8 8` @(@ ?$ @" @5    ,`8``oA`u`d `in0  `xI`pGf!&  ` @ `0 , @  ,`8``uF   -  +;! 6,`0,.66 (!`0$ 0""  "! ,6.6@  ! @?` `X, 0(! '@4  '@@ ! >/ /ئؐ !@@i %@ e $d=  * 8``+#`-!` `028 0 `I 0 &   `(@& #  (`8``x 0 `* -:  &   `(@&  @?`0 0,`8`8 2  & (@`& 2 %`  * :  &   `(@& ??2 ,`8` 2 ֒& (@`& 2 @(8` ! %h2?㿐L'L'P'T'X'㿘@2@ ҡa@  : a a$@< , ɡ, @a$@`!`b%!܄ 'b!怤@  ;2 @*$@a$@< , , $@a`"@ & & Ө aa `ap#a$a` a@   $ ސ & & $ $a   I!a & apa a'!a` `'!!% $! { } ! 'Ķ )+i;ܐ @7`ɐ !`@b%! %b ( %!!  @ a$@< , ), @$@!``b%! %b |"! @ %!a$@< ,  , $@a`"@  $Ґ )V $!`b%!ۻ %b!’ 2&$'Ķ!`b  ۧ%!%ba & ̨ aaC `#a$a`a  G$  &  & !$ -$aސ 2  Ԑ  a ~`$ * (`   ,  !i a@p    1#p$?j ~5` & ,&*`~l& (`8```;! a$< , ~U, '''% @` ' @ ~D & Ȁ@* $@$@< , ~7, $@`"@~- & !}`!}`㿘@$ܠb(`@(`0`a =ظ#(8`  " 2 ap``"  {͒   a3a ``*0` /& j & a`}ϐ  $ a``}Ȑ $  `@ ( `@ :( `@(` ` `a }` $ ` @   ,`0``a0㿘 aa `܂` ! ap$! 1ӂ``?!Ӏ a"  ^$!&"  1!`  &!  a㿘ܤ!xa8@5 a((``"`@@א `" "`(`8`" `@ 2` (@@ `(`` "`"` "  @`  ``  㿘 a `}*  `  `$@@2  &$< ɡ, /h$@@ had`㿘 # ` ((`@((`88`  @a ` " 2 㿘  |.`  @(& .` @"& & `( @`""@`b^` (` * "`  & 2|[ۃ,|T㿘 ` c`h ?(`, @((`88`@ @ .@"@ 2 `  , Ǵ@|B "" " " "  @) $$@"" " " c@݄` @`" b@" ` ݐ`$@ `"  " (``  b@" 2  㿘 ` 2 `  Q`x `π` & `` `@?``@ & & 㿈 = !; ` `Ӕ@ےb ` & ` ``@&  `  !܂aH` (``"&  " & ̲b @ '& ''@   ݒ !ˁ` 㿘ݠ`!` 2 !!  !0``` !   㿘ݠ` $@`0" 2` `  2 ݂`ä́a aԒ`ˁ` )㿘ݚ` a b `  `!#@#$$#$( #`#`` " ӂ ` ``1ݰ &  !  @(z" T t! 4"`& T& t@"&!& 4`&"  @3̲bؒ8$" 4 `!0  - 㿘 "z’a8+a8 & a& `  @(``b؆ @& "̀ ܂aH` (`` π& `` & bز 㿘 a a aݠ`$@$ `"  `"  @(``"   2 㿘 &  " @ܐ  ``/ܐ  ``6 (``%!`?`?2  & & ! ``X$ ` a"& z4a8  @& 㿘L`  Lť`  L a @" a"ݠ`$@ a `"   "   `2  a`́aԐ"@㿘݅. `@꽠 $    a@"  a b"   `2  a a @"㿐܃(`(`0`` ݤ``$@H`ؐ ( 􀠠$ "(݂` 4`@] 2@ () @]  2" @] 2 @: @ ( @uŔ  2  @(  2  㿘@9#cL  @,  $cL a0@#@(" 9d 7 7 7 8@ 7 7 8 8 9 9@ 9L : :p :p : : 9 9 :0 :L :l :x :x AD A B B B@ B@ B B C B C Dl EX EX Dl F| E F F FX A F >l >t > > ?$ ? ? ? @ @< @` @l It I I I I I㿘 P  " y  2  x   x  2  x   x    x x  xx˒@ `xĒ  xh Ȓ  - B͢aP`  (`@@*  X: A $ (;(`8` 2 F0 $- ( ('(`8` 2  )/ $(` 8``{ {(`8`  (` 8``} }* :   ( | )sȁ㿘 `   ?@? @ :ڐ $0  `  ?@? :ϐ $́㿘͠ a`` , (`@(`` (``  `  ?  ?(`8`@` ` 2Ԡ?? *É:㿘 "x@%o㿘   x@`2@2 (`8`` ``5`& & ` ":  w* & `ƒ$ @ `$`& ` ":  wȑ* & `$ @ `$` 2` ":   w* w%@%    $` }$`   $`  $`w& & `s`& & 㿘;bHa(8` Tݴ T d R"4& ;j Ng d s c u (`8` 2 vͦb `  (`@i  * :  (` 8``"```$2  \풒  퉐 $톐 (  (`8`   )w $t (q (  (`8`  d ) )= "]  X "  $S (`8``{  J { b (`8`   (` 8``} } * /:   ( | )$u  d`?0 ƒ `? -,  (`8` 2 `"@(`0``W(`͆@`퀤 a @ʔ2 `@`퀤 a @2 1` * ``0``8`@@`(8````H`@`H@` @P`@y8 aX@q`@ ``h@c@(`8`` 2 ``x@W``"`@N`a@F @>```@2`a`aa@& @? ?@ | @``@a``a `` @`@` "(`8`` @ @ߔ a@ِ`@Ӓ`M(8`` ``@”@`` @0``@(%0`8`@`(``X``@` ``@ ` h@` 2\@ `  ``2` `널  w 9 w@[ `@ 2 / 0a (8``;2 ;a  Z  U 4?  M 4? @3?(`8` T %`Ĕ@?'P'T'X @P '8㿐P'P'T'X*'㿘 `       2 4```"`  0?`83 (`̈́8@%p`  x#  퀌`@ 퀌` 2 5퀦 0  abpa㿘! @?$ 㿘3` @?&` 3&`X   @jݠ  6@&`X@# b[  @-   @'  3 Kbؒ @Д   `@@#b;  ` @%`\ @ P Q Ql Q Q\ Qd Ql Ql Q Q Q Q Q Q Ql Q4 Ql [ [H ] [x ] ] ]8 ]\ \L \p \ \ \ [ ] [ ^ a a| a a a aD ad a a a a a a a a (`8``: (`(`0``1  (`8` ` (`(`0``2 ` (`8``[ (`8``(`8``[`]22㿘 (``?㿘  (`8``  (`8``=`?  ` (`8``  `]2`[2 "㿘 #(`(`0`` `(`8`((`0``2 ` [ː 2㿘 @>& `&`,  ``" `@&@2 @`r @ne    ~$ $ $ $ $@% $ 㿘 [@np a"@t@㿘uǐ"@  `  㿘 ?`(`҄@! < rfa8`Βa8$ <R  V"  cP!!t rNa8$!t׳ J  ."@ 1㿘`" r0 `a  `  r!  r 2& `a!@a&㿘    @l@i   &`r&@&  =,  $& @v  q㿐@G0 `"&  a `q0V b0`b@`(   ?" `2? "@ @#@  @@@܅(b@(`0`` c0#\" #8@"@`2`@2@  @(`8``0"` s <@ "``"  (c`(`8`)  `(``뀠"``"  (a`(`8`)  `(``뀠㿐 .@-3 (`8``[-  ( %.@?` Y`q $@r w 􀢠6&#8p`㿐'`Ԡ ܅(b@(`0`` ӂ  ` `$ ``'`$ `T``  2`T b&b"  &  & `"̐`& a&㿐!!`_t ܅(b@(`0`g`!!#ӂ`b $ $  , $b @D " @#@=` 4 . @H   7d$$b (``!&$$b $ -!#"? a@ݰ $ b }$b ``$ $$b $ $ !` U "  T`5``&`j& a&_ ?`(`ӄ(@! < oڒa8@cBa8$ <Ɛ @Y Ǡ (`8` P~@&q  l #at oa8$at@6 (`8``/ՠ@{Β  А@Ap p<@@Őa8$at~@&UV@##`g@@K ?  cT`  T@@Y~@&J~@&@ ~@̈& @Ӓ: @ d8bPa&b 88@ 8~@y&`"Ӑ? bXa&㿘db  cX U #8b8`" @* @^@8   cp  n & ` &"   `" Ɛ8& ` &   `a&ː an` 㿘d#X`  b   ` `㿘b2& aӂ` " "" @"  e`a&㿘ې ?`.(`ӄl@!&@ˢ ӂbP`"@~@2&c ~&a~&܂a`a&~&bX` a&㿘a" "2  2 ?&@ c8"' (`8``02! (`8```x`X@   (`8``0"    b` ܐ 4b#.` ?  $ ! ((`0``%Ѐ`   ``"?ɀ6?@ޒ  ̀-`2 &@?㿐q? `  m& & & ba&pa"[c8  T@cc : @$@    $(/ /@' ,@yƒ   #,@  ,@ , 0 `0 -,0ܐ:a`㿘!!!m7`!`!C= ":`` ` 25` ߐT 1 "T"Tb @iy&ǔ @* &@< , m , @ &@``?<@T2@*&@a&@< , l, &@a`&@l㿐 }?2'#x㿘  (`8``[2 t @"܄ b ?(`(`0``& (`8``= a$Φ @ ܂aH`(``h@ `X @`Ȁ  @a耢 h)! 6`F `?@@d 퀦`"#Xal`u8@p @bb`"  b"  b" v  `    $  b "@$ $ @@ $ $ 2$ "    `b` " k $ $ `"  k  2`#8"b   4& w ``c8 o 㿘ܤ"@a8k  b`P"  "@ `㿘a T    " a"  ` T< `ܒ 0!@ kQak+`㿘#a XkR`k" a``2`$ b$ a``$   $ L $ P   `$ T ` t ,  8 x @ @ , t 4 4 4 l  H x x x l | X c@` (``   .    @bb`5b: ( `2(@(`0``,(`@(`0``, ?(@(`0`` ?" `"??2Ȇ㿘@/`8``Wٸ`W&`h`B"V`F`,"`0`$"`%`G` 0*p bj`;j``T`Eb03`h`t`e"]`f`^`bS0P/`ރ8`ڀ`t`w`lG0(<`|Bbb b` b``0\b``'b b`?"  " `2??,  `"?  ??2? b` ``@b` b``?8b6`(@`2 ((`0`` 6 ?(`(`0``  6?((`0`` " @`" ?;??2Ű 5 b` ``@b b`?!"`2  6 ?`" ???2 yz /`8` `׃(`8` `Ԁ fa  /`8``,Ӏ`?b `Vb"? 2? J@(`8`@ ??퀡 fF " ? 43 4 b``&b`@%  b` ``@b` ` b` ``@bb `@b (@(`0``(`@(`0``!2 2`(@(`0`` `2  `& ??2 b` ``@b b ``2@2 @ `& ?? @@{ `2 ` 4 n?b` `` # `@(`8``[  `{`(`)2 ? `}M`]2 ?  <  $? &`? 0`@(`8``[ `[ `{`( `)2   ?  `}?`]?  A? Ӏ    ??   ܂aH` (``"    $` "`㿘 ``@㿘!"` "`@1"&@ @ 㿘`1 !"  @'? 4! "" @ @6?"@@" @ !"``@"@  ߁a, 㿘#դb!bȂ``??  ? #b`  c b cX ha̒cX㿘#b!` `@#Xb#X` , cX"@׀ bb` ha̐"Ё ܄ ac8c4c㿘#c,%ׄ  @  c0$c,@`* : #,$#,#, $#,c0 @@`* ȑ: #,$#, c,㿘 cT cTb@ c< 0 @ 8`   @ 2c<6׀@@`@&%%@ڬ%@$cL׃(@  @(`c<c0܂aH` (` 8` E2 2@@(8``  ` (`@*`"((` M(`@ -(`@`( ^`2 ( ^(`@@(`2  "  @6 "@@   ) $@   (% @((`88`,@ * : ,`$, `2 b@8 @0``  +` <@?`>% P,`(`88`c0c<ʐ ,,P` ,c,@L  @ L㿘cLׅ(cHׂc@@@ʒ    c0 c, (cP㿘c  c  ܒa8eP @ 㿘} 㿘 3ܒa8e>a8e<㿘܂aH` (``    G P $ @  @Y ^W㿘 `` @` `@$ $$ Б㿘%ܐ e:8 e68 $` @   $`$` $`$@㿀 !#`Ā`"!"`b$"$`ā" %$" ``` #`#\| ? $" \ ` ߦbc@`@@ | @6  T 2?@,` ?b ` b@ cׄ  c c  cא  b܁㿀   #\ #`| (?}z  㿀 !#`Ā` `b ""Ւ  $`ā !"` b+ $"$`ā" $"b``` #\@?#` ? |O `߰?9@ְ?a}( 쀠`.` |Ұ @|ʐ@   @ .  @Z  |@  `Ă`?!" bt" { 쀤` `Ă@(`8``/ #@j |ʐcׄ  c c  cא ' b܁㿘`2c@.%-(   ?)`X#b@ & &   @Qb ` c ?㿘 2 @@`0```@c@``E Kb 2H b D 2@c `2@#!b"@` `@ "b``   bܐ"ؒ@ @``y8׃(`ۄ@  `! , X `(`8`` "?`c   @"?@^Ғ "  (`8``  @[   ׂc ``$ `+ܤa8c @l@, `  @bbђa8,``, c c ` `cb׈  c c ``  ccנ  cא c A b  b  ah 2$ `x@`(`8`(8``c   kahbJ` `s?[  &l?@(`8``c(`(`8``w`W b``b `b``" ?` b`$ @(`8``% @(`8``c@N@(`8``yb `@(`8``c2cbׄ  c c  ` `! !עb"А #Ӱ? "bcׄ  cנ c #դbbА  ?    b`  ϐ?cbנ  c c ` c!"` `"` T`"`" 2c   ap` @ !# $#z c cׄ  c[ c cbנ  cא  c  kah$`#!c# Ғ i# $c #!c# ƒ"@ ]# $c @I$# b` Scׄ  c c `(``` 5`@   H?` @@(@ `@!#`c  cׄ  c  cb  cנ  c c  @4 \b  2 bc`  (@!p` !p` !p`cc   b `wa۸b@X $  !" cׄ  c c  @4!"`m!"` cׄ  c׀ c ""`T"" @  "b b!"#c "?!# #$c c  c# @Ղ?!#  b̦ (8` `Ȁ` {`?(`?8``N׀`?c ׀Jcc A  (`8``^ f `* '@#X  U C[ِ%@ $ $   @ ) `"-?5 '?? "? b`R b` (8`/ `2  " $ (8`  ` 2  (8`  `2  "  (``"ݐ??2  @`2    "     (8`cbׄ  c c   !    (8` "``2 2  #@G  A Ӏ Y b`"?w b `qcc c #!, @b`` `(8`8+@ "(8`8 +@!((`8`+@  `"@& c % c!"vՔ 7"5 `b ܂aH`!܂aH`"(``"$? + c`b   ?   c c  c㿀א? cb bא  c c  cׄ  c b b c ӆ" b h(!!  `` `  !" ` ` !cT  c8##0#c,?ׄ"#c, 4"##0 4%H?#!#@?#ܒ$H^a8H$#@#@ ^a8$ #!cH#@@ cH#@ @ cTc0  ׄ c< cLׄ (cPׄ  cT cX{=/c7;5תbp☨d #   !# !# {'??c `  2 { @@ f y +  =b` ` ?0׃(܄l@c`.  נ ^ cd 2> `!b bȀ`#b     @(`Ȁ`$    @  @ 2 !" b "@"` ` `  ` "' `i    " @@@     @ "Ȁ@ @!"!" b@ `  bĀ "F ; E %Gm   ?%0f' :% `Հ bbĐ Z Ȃ a /b bb؃(`8``s`c`CI bF?o Qbߒ KׄH!(``%Ӓ  @  4`bȄ bӂb(@   " @ ` `( c`  $`  `  ׀ ?fc` b  c@ ܀  h d?π`!ׂ? d}  -y h $#bt ` ``/!#  U c` 2Vb ` `@8" t" ``  `W r0``( `, . c?Ѐ`  bd((Є" bdh-$ h cӂ?π` `? ` d cbh- ☄(8a bh `!$# $#?Ѐ`  !b`((Є b`"d`b`$"d@{b`$"dbh- ☄(8@4 bh ``!ؐ$# !$#h -$# h  dAb̀` (`` א  c-@"@Wܔ (  c 2 ̀b @ ` $$`$`  0א c~׀2  b b̂   !ӂ"'$"' $"@_  @$ @? b  $̀'-@  ܄H (```!"`` `@"u" M ) -)  ` `!Ӏ`"!"`` `@"Y" ^ `@)) `` @"F"` `( ` b w ```OK bd   ׀ ! ; >0@c bT@ bd  b!"b؀  ׀ ? 0c`: b؃(`8``s`c`C2"ܐ  "* &  0w w^ w\ w!"` @ `@"@|" . ?cl#؀` @@h ? @ϒ`@]  a(`@ ` @Y 8 @  @oa@`㿘`X @ua@$ 㻐?a`  a#-& p b%0$ ccȒ@|d cȔ    @;#􀢠"cc @qaH c?@:?Ѐ c!"&`J.@!h 2 Kaxq @˒`0[@|ِ (`8`` ?@ ;(`8`` "*;V@ -`0 X` (`0`` @"d@: "8@5`-2d`"8@S"8 (0????@O؀ @S"@, "w@S! @  @S"`H@}耢 wՐ!``@dD |``ސ@d9 2 Δ`@밐 0``e@d'  _@h Yh@(`8`` (c`|@  @ǒ ޚ#\ b`@끔``0 `" @< 0@` 0@<0%'0```$`@<֐ 0@`$0@< ? y Ye @ے _ @l`@R"S <@@@t 2@"? @  @y(8 2@#/ @|h h<@@@rӐ@ @ ` #0@R <@ @Yq#ޤb! i  $ $` $`$ @͔? fb&(` @@sj ޤ `. @x x<@@"  $@@0Z$x@R#@ @ǒc@@yV (`8``/ /, c@:  /@ Y  (``    (`8``/"?    (`8``/2? @y!@c @̐  @x~ 2 ?2@`#㿘`X @;ch@ ` "` `* 8`` 2@Q@ (@` h c  ! s M # #@?뀢 N:  '@??Ԃ`R'  ' @uI  c `@>'  @ c?݂`S''  @u. `c@ Ȓ@ Ԁ6'̢ w a `<+@"@ (8``>20  , `8``<($ (`"! ` `? @J (````* R:   * @:  @ `Ԁ&Ă````7  `@y  c#㿘`X @Xc@ 㾘 a( @H? sb&`, , @` @w@c  `0!@9` `` @ @QH . 2*@@Ȑ 㿘 @wÐ @w `ؤ5&`   `  &`&`&` @&@`&`$@P&@@   @P@  ` @$.X@'[!@N ?$!Ё @/@ "  $!! @ ߰ X@'8!@ ?$!Ё @/@ɰ "  $!! |@   ɴ  x ΰ 㿘@. @+ &4a\&<&@+㿘 @$\   "  "  \" X$\" T㻐 `  + &$@*@v@@/({ @v`X`T @ , @ `@vO`X@$`X ?㻐`%$@*ʐ@vѐ@@/({ @vǐ X T @ $@v% X@$ X ??c(ȶd  < ` 8S -(`@ 4`?&` /J&`  `G  0@(``2A / @)?:   (`?(`8``b`f2 & `2 4 0 @ & 8 <$'@.א  @& & 8 8`2 @&` ?&` &    0@6ؒ` "    0 @*$?@ī ="   @l̒' @ZJ 0, @@7Ɛ   ؐ  Ȕ 9 ? 0@ ?  , @=$` @ s @l@8"@g` "@b`"K 0s&a< 8@. & 8`( ``$`z   W@.>@/@07(``<@/d(`0``1d(`0``` `2'    ?” ?`  ? d $ 7(``Đ0@  @ `$ 2 @&` ?`2  <$  `2 ``2&a<@  &`&`  &```"&` &a<  -&` ?&`?&` &  㿘 @ð  "@, @) a\& @37& 4  & 0@)@) @,㿘 @u @u  `&`[&`   `    `@`@@&@  `$&`&` &`&`@N20&@@   @N'@% ` @$.    "` $ @t)@` @` .  "X@$ @3 ?&aЁ @,@  " &a! tȴ@  ? @&a"X@$R@  @ @@,@"  a`A@ `?@ a"aЀ` `㿘@$a`   @'c   '' '' ```@(`)  @("* @@..6 6@.6@..6 6@. 6@@ @` @     `@ ` `(`@``(`@`(`@`(000(/`@@( 0 0@0(@@ @ *@  ' @ @+ + 3 3 @+ 3 @+`+`3` 3`@+` 3`@@@@    @"@@ %@@%@%@ @ @ @ 'D ?X  0? ? ? ( ?  0 ?( 8 ?0''''''''''''''''''''X  ( 8'''''''''x'|'p't'h'l''''''< <     0 @ +`   (@67` /`.  (/  .@ < 0**`     @ x@ 5;@-5'-5'-D '؃5-'؃-5   'Ѓ-5 '(    D ++@D D    - 5`-`'ȅ5  @'̆ @ 5 -`@' @ 5`ȅ- '- 5` '@5  -`'(  @ @@(@ H@> H@&ܐ+@@P @ .@B > @@3 H@> Hô @@ > @2 H8` H@> H`@# P @ .@B> @@ H@> H㿘? @ D+`0`?* @ @  P@@ @, @C @&> @@@ @.@C > @ @`@@> @? P@֔ @.@C > @㿘 @ D+`0`"?(P`p`Q p"  `PQ "@p `P3  ~@pw `H P @pq p?. P`H`L0`,`0`,`0``@(`,`‡2(`,`ć2,`Ň3`(`,`ȇ2`D,`Ƈ3`,`ɇ3`,`,`ʃ+`2@+`,`̇2+`,`͇2@,`,`ϰ,`,``P㿘@i @@[X 㿘 @@_b P @p* & @& D& H& L㿘 @ D+`0`?"?(P`8`?Q 8"  `PQ @"@p `Pג  8@o `@ P @o 8?. P`@`D0`,`0`,`0`(`,`3`(`,`3`(`,`3`,`,`,``P㿘@ @Z 㿘 @` P @oƔ & @& DX@9@@B  @-?` @'?"@'̀&@"́ P  ` `  $`D  ?$` $(`@`D㻐@'0 @$: -a &@"$ 2@-s  &0`@-k &4\@nŔ 0 @oK  @&`&\@#А@#˶ @'p * '   ?@-S#` @`"?Д @o @r@쀤?, 0`㿘`` 2]  d @`2V "S  h @ ``2H ```` 8  <"9 @ @` `@ \$ $  $ $ $$ ""  @,ܐ $ @B? @@n4```2  0` `"&  `2 ` ,& `& , 2` 㿘@"Ͱ ?(a?cDتd `x ` 8 -(`@ 0`& , 4`2  l?@(``? l`? t`? p`? x`? \2?`"`"2 `?`" d``ނ? d` ````?&``2  \ 4   ǂ? \`@G@) ? @& `?c?0c"-``2' @ "! @ `2 `2 `2`"`2  ``" @& 2 @)B @`2  d@`2 "  h@ ` 2 `^?`" \`2  h \ 4 t``& < h`" \`2  8 \ 4 t}`h& 8 8?? <;2 h"7&` h`" &`2&`+? 0`0  ? \` `@&hv "&` ?〢 ``  ,`2 ? ܠ?@&H? T 2 &``ʒ ?2 0``߂  ,`ۂ  \`"ׂ ӂ?@ ?Ђ & $ $ `` & $ (D  ,` &`  (@`?(`8``b  |@& $ & |` 0`< & @(`` @m@ ?(`8``.   ` &  C& & &  `(`8```. `&  `p& $@F<$o?@l7?  6  b2 `" 2 @FB . 2  , `&  & p$? E& & p$@F$9?@l? 2?@*p & |?&` & )   (`?(`8``b`f 2 | 2 `& &  `` $(`@ `D` ` @        @ &  @` 2?? @,`   `x  $(`@`Dh @ $?Ԡ  0@-@ 2 `x@%?@`@,`@ \`" | ِ@` 2??&` & @.H   @$G  & `(2`$ @$xx@% b|@&ʒ|7||(`` hN@&+dd((`00`2C`df((`00`2:` @kՔ d(`0`` `d 7' /  /2&`/ /@ 7 \`` $@@k*7o@$    |  `~(`0`@- @` 2??&` & @ `$  b"??``2 &a0 , &` &a0& &`   -&` ?&` & X & 㿘#c` @@-c@$c"㿘1#@C#@C㿘1# "@K  @+֒`&#@ 㿘@B#    `@B#㿘@ @"㿐 @# @ `#c@P$ 2*'``c` (`0``@*c@ ``` ` (`0```@9`?`@a "@DY c` @- `@ ?c@,Ò  &@j c@,&@, @| @"c@(``2c? &2c`"c&  #$(`8``, `('  ` `  " '(' "`''@ " 㿘@B&#   9 ``@B#쀠` @㿘 "@ @"Ր '@@"㿘@A#ܠ    ``@Aې#쀠` @㿘 "@ @"Ր '@x@u"㿘  #@Ac`'  @A 㿘  #@Ac`'  @A 㿘!  #@Ac'  `@A Ȣ@A#c`j      2 @Ak#` 㿘1@A^ @#`造 `H@$`@ "@AP㿘!@AH  `H @AE `L aԐ 㿘@!   "@  $ % (  @ $ @ڰ "#`` @( @`@" $`㿐`  @  @@ ""&.@(```&.@(```@e  @e   @e& .@(```& .@(```&  .@(```&$ .@(```(@d  "  @dٰ  '㿀'@@ @T@R"``X . `@`P 3 /@d'' 'm " `L` @$! `@$ " 2' @@"@@X 㿐'`$H "@'"㿈@@< `` HH` H 2 @dY/' '$`H P 2 @@ h'@@  @@"``Ǥ 3 `@`P@h@  1ɔ@d/Ȃ 'Ȓ'ؤ  `L` @! `@$ " 2' @~@{"@? 㿐'`$H "@f'"?`\" " " " " " 㿘`I@ 98@o@CB@H  " 㿐b` `2  #@ @# 4" & @(8`:", 2 b``2,2  ,  ٰ  㿘Ð '@(`8`` ` b`@"(`2`(`@)Mb  @@ @ٰ? "㿘! X X " 㺈 Ȓ`@'ݪ? ))(`8`` '􀢣 @d (z(z @f  @)Q @' @)D@? "㻈 Ȓ`@'? **(`8`` '􀢣!@ ({({Z @K   @)  @&א @(@C? "㿈     #\ #`#d @Q؁@)\U" `  ``\     .@ "?@? `/ `,   %/ဠ/ ` ` ``` @ဢ  ؐ@Q @?@fm "Q?y H`F`  t```t`h  ` `"  @? "  (`0`  @f5@@ΐ? @?@ @"@QF؀?3 ?0@ "@#\#`@"  @u` 2?@o?"@;p2@d|"??㿘@` @ b"  @` `2, @ @ @e=, @$ 0$ 8$ 4$ <\$ \@G㿀 A 0  8 D H @? 1 A`*  X ( % H/ဠ/ I` ` I``` @ဢ  ؐ@P @?  pat H`h DtԺ`` ` |` `" A -  ``@ @ ? @`?2 4 @`? 41 <`"/ 0 B(`0` \` @e5  \`@͖? @>~@:a?  0@PF?U? 0`"R&` 8`"N&` \`"  A0'@`/@?   @l & ` 5 1? `@& /& `a8`2@ \`"?&?2&`@T` т?&`@L 0@>% 8 8*&`?&`@Ca8 &` ?&` Q&  t           |  ̝㿘 `  # #!8!4@ ) @ `@d!8@&!8 㿘 @P " 4`$&L`"` < @c㿘 @%<  ` ` `"  "  " !<"!8" %<"!4㻐 `  #.  #($@G@dN@?({@ @dCa8a4 @: , @ `@ca8@$a8  㻐`%$@@d@@({ @d!8!4 @ $@cs!8@$!8 ??c| <d  ` 8 -(`@ 4  @ @  `?&` / L` ?2   L`?&`  `  0 @(``  `` ( .:   (8`@ 耢   4+ 0 `z ? 耢?2&a8@ 0Q@?   (`?(`8``b`f2   `  4 0` ` @Ȕ & 8$@  @ & 8 8`$`  @#` "l  `   0@ؖ$ " 0  4 L @$?@ H"  , @@$ې 2  @ ؀  ރ, @@ x؀ אؒ@G= А   ? 0@ ?  , ` N؀?@r @k@%!@f` "@a`" 0&a8 8@ & 8`(ق ```$@M`& P 4 V @8@@܂7܃(``@<$g@d(`0``\d(`0``"` `Q1`2K85 ??@$5 2<ސ@;ڔ$6ހ3ސ@$& -ސU ?2&ސ  ހ  C ހ  6 ? ނ7ރ(``0@ @`$ 2 @&` *?`2  L? @@&`'&`  `2 @``2&a8@ &`  P`" &```"&` &a8  -&` ?&`?&` &  &`㿘@e@v㿘 @]  "@ @ & 4`$&` ` & L@ސ  & 0@P@K @ `T  h  ! ! ! ! ! ! ! ! ! ! `㻐$@, @Ӗ@\   b0@& & <& 4& 8@\ 㿘@ ?(㻐a$ ` 8 -(`@  <@(``2?Ԃ & D & ` <`9 & @(`` @aW@ ?(`8``. &   B& & &  `(`8```. `&  `& @:{$$@ @a+6?  6  b2 `" 2 @: . 2  , `&  & {$? & & @:F$$  @`? ]  &`$&`  &` 4 8 @& @ M @L@I&` `2? &`&`$?=&`( @@ :& @``3 ` `/ @2`$ ```& D `# ``` 0a2  0b& 0  D2&` 0abʂ "&`$Ƃ  -&` ?&` &  㿘@=֖@  !''L'P'T'X''@`h ''7@`ob ''L'''@  ( )x * + /㼐 0     `2 ? @&`b`2  %&&  `4@#  2@b``2 @% l @ g6` e:  G [ E:  9 A 0, %U *g "M??I D?` [ c Or Xw L怤?R` c8  a݀?  p" t j"` n h> ì?P  n8Ph lÀ?8@< t x q5 s?  C z1 u?;h   `4@" 򀥠@ && Ud@@`h2|``y``l2v``s`qao`@,@j@ `h  } "@@@ ``^@ ` (@`a2(@ # @ -*` -  ]2 @ ]& -(`bB b?  @ : d2@``(@`0@2 `@2a` @`  <  b@``2`   `b@!Ԑ >b+ `& &@!Đ /b``2  8@, @" d   @&@!@ -`$@@&$]&  @ "?d #&`@& 4 @!t "`2Jڀ(``2 `2=& ,&  `4 @!M "2 @(``2 ,"?d # `&  &4@! 2@b``" + & ,&  `4@   $@b``" $@,Ŭ8!T@+ 7@9n;@`9`X`8:4- `0" 8&- `+<`-`9=`X`a`V) *R`f$ `xL, ???˃(`8`$ (`8` /?˂c *?ˆ $?  @4 `@?ߨ c  ,@& ```&@ r @2" @(ְ @m x X$@c$,@(@؝   @ 2 2  @8@2 !2   @ 0@( 8!t7P@9@@;/<+ @`9`E`0?뀠`-`.`+1 `e2+ %?c ?ۆ  @? @ ,@& ```&@ې @2$@" @@Ԓ@@8 @ e E@Œ @@$ ,@@<   @ѓ 8@@  @$q@2?㿘#``@L``@ ? ? ? ? ? ? ? ? ? ? ? ?< ? ?X ?t ? ? ? ? ? ? ? ? ? ? ? ? 6 >| >| 6 >| >| >| 6 >| >| 6 6 >| 6 7 >| 6 8 8 8 8 8 8 8 8 8 >| >| >| >| >| >| >| : >| >| 8 : : : >| >| >| >| 8| >| >| < >| >| >| >| >| < >| >| < >| >| >| >| >| >| >| >| : >| 8 8 : : : 8 8 8 >| 8 >| : < | < 8 < >| >| < >| 8 Cx V V C V V V C V V C` D V D D V F F F F F F F F F F V V V V V V V H V V G@ JP CX Jd V V V V F V V O V V V V V R V V S V V V V V V V V H V G GD JP CX Jd F GD F V F V N O Q0 F V Q F R V V Cl V G㿐@@X8(`@6@@X3@`#\   ?@b &?#@@W   ?@a?@[ @@~@&@  @[$@ &@?Ȃ '  @[{'0 @[w 33 `̠  /`/`%  b0@ )0   (`8``Z8(`  @  K',,@E@ (`8`Ѐ (򀤀$(`8``*   4.',,@(@ (`8`Ѐ 򀤀$W& (@I& (@  (`8`Ѐ` ( (('(`8`Ѐ`  $`(`8``h2}`@ zhx@(`8``l2r` o` mbkd]`@b& (@K d` & `ؒ&߄ `@ʒ&ф h&Ä  & & ` & & ` `|& `@n&u b`&g dR&Y @D&K  7&> ,&3  &' & `@b&  d& ` & `ڒ& `@̒&ӄ h&ń  & &     a ȪL#\  *` & ?@_&?O? @`86(`@@d %`@] `@V `@O `<@@G `@@ `<@@`$` @y? " @|7㿘``&` @O&`&` 0 'H"  `2 ?  (`0`` `2 @Q "  @??'L p"(`0``` 8 (``2x !''x'|@X    ,7Hx''x$7'''''x  'L@PƐ ?'L(`0``@":L `@56 '''\'X'T @Xz H'L'T'l )`% ?"0@- 쀤 Lc @@%@%`\`@'\X``'XZT ԪL@'L  // 'P?/иܨ@`(`8``Z8ـ(` @/_ a((``2@E ̀@&@,`,`@@  (`8`Ѐ 33$܀ H'ܔz܀,`'P'P , 'P 'PP6@ q 'P +/@(`8``*` F ̀@[&@,`,`@U@  (`8`Ѐ 33$܀ H'ܔ+܀,`  ,  &`?_@`̀%(&@(@(``8`Ѐ 33$KE 33̀ ((&@@(`8`Ѐ` `$22'P܀`*H'ܔؖ#@ @(`8``h2@`@(`8``l2`   ܀,  / ܀ @R ܀,F  @A > ܀ @܀), ܀, (` (`8`܀, (` (` 8`,  8`   -/` a  X x p/(/_'t/ P't/_l80`@I;܀,   @є ?t?#\@C ,   @ᷔ ?t?#\@B訒 b'l @c"g/f耥/_/_ & l@H ܀,   @y _?ȃ(Ȓ`?`@Cg਒ 21'l0 ,   @[ _?(`??Ȕ#\@Cc訒 @'l " c2'lc''l耠` -/c (`8``N2 ))` !8)!@`!H)!P 'p  @g'hG_ %h @8 /_8`G "h_(`A/  - + /~@޵  0 ,@@_  0,~(*_(8``e`E‚ 0/‚ 0( '`='p` "'d@'d,'p ܀,  L JL6܀@܀,  L0@܀,  L(@܀,  L @ܚ܀,  L 8 ,  L @ ܀ @4 ܀,D  @# < ܀"@ܚ$܀, (` (` 0`܀, `   ",     ܀,     x/( 't܀ ,   )!X  @N 2 "/@T / ܀ x@ߞ x܀,D  p@ߍ p< ܀"@ܚ$܀, (` (` 0`܀, `   ",    g a't ܀ h@> h܀,D  `@- `< ܀"@ܚ$܀, (` (` 0`܀, `   ,     2/ /6 `Nt` ` t`8)'p!`S %t `?`0-, 4`4 "2t`0. 0?+- @M `0 , @M  `0` `0,tt `?-4`, 4 @t @`d 'p@@:\//'p p@(`@(``23PT @ +%@ %`\``'\X``'X9 ? a%@%`\`@'\X``'X#T (``%@ %`\``'\X``'X T (``` 0/%@ %`\``'\X``'XT k`5pP  / %@ %`\``'\X``'XՒ O?T` %@%`\`@'\X``'XT 6p  .%@ %`\``'\X``'X ?T` %@%`\`@'\X``'XT 2T%@%`\@`_@  ,'T_(`䀠`d`%@ %`\``'\X``'X_T ٪TT %@%`\``'\X``'XFT   4%@ %`\``'\X``'X- ?T` %@%`\`@'\X``'XT j @d4 d%@%`\`@'\X``'XT rd88`   4.d%@ %`\``'\X``'Xܒ V?T` %@%`\`@'\X``'XÒT =dT %@%`\``'\X``'XT # @4 8%@%`\`@'\X``'XT  88` % %@ %`\``'\X``'Xu ?T` %@%`\@'\X``'X~`4 Z  T/`/%@ %`\`'\X``'XET   h \@'\X``'X1T h% 4:`   \`'\X``'X ?T`  \@'\X`'X `%@%`\``'\X`'X` `T m`  \`@'\X`'X` ޒT X2PPT  +%@ %`\``'\X``'X ;? a%@%`\@'\X``'XT 2' PLc @#\`'LT 2 'X \`" 'XT 2 'X (`0``@ l?'L@?'L "l@B܀  Ѐ" L@sL L㿘#``@Wa``@T`   ? @ @(`@ c 㿘@ސ @' `a 2+ ` X$ 2 ! $  !(``2 P! @@)^  P $   X @@,` P@ ` @' ```a`a& X` &  @@)6@O& <@b  i o o o o i jp j k l n o o np @a0d&@Aؒ @$$:Д$@ ?3T`  ""@L&\ =&T  &X@O@ d7``@ a7 7\T@@..`2`2@ 耠`@ "@64&< &8@@ } &@&X@: 㿘 @p ?" @] ?  @\? @U3?@`$ @@Uɐ@?"㿘 ` 2  h@א & ` & h@  @H "?& h& ` ? ` dP@@Ӓ耠`a 4((`00`@Y(`0``T(`0pOLJ(`0`& D& H֐@ 耠`= <(`0`@7 8(`0`@1 @@ +(`0`b@H? W"(`0`(0(`0`?c@ 2?耠` d@ @$? "h`0` pȺ ` 8 -(`@ `P`2 & =  P X  < L`& L P@& L& P T(@(`(` (& @Xw P&  c4Y #U& Q&` b8d b   L (X?&  T X@~ ?D@@T @"& "? @@T @"&  ` h @T @@T @"?& & d ?  @` @`W  `` 2    2 l  L (X?& & l   X@7  @''   T X , @   @M  '' @7$? @S`  l X@& l& l @TW t&  l`8/ `  @"?O l`& l p*`2`|& d?A ' 7 @T ? @`0  l ` d @ @Ô? @` 2 l@ 6" d@q& l[?@"@@S @?"@& `\ @` 2V @P   L(`@`X@L @ d&`( `&`$& `&`  D)&` ` `"  H &`$&`&`?&`(`"&`&` H .&` D       &`&`  -&` ?&`  ``2  X  &  &@  &` &` f& 㿘@0@}p@ @ .0ad&ܔ&0&T&X@P&\@@耠`@G "64؃(`0`&<ڃ(`0`@ &8 &@@D@@=   `.` (`8``   (`<? " (㿐'a   (``` @w &@㿈 Gɐ 26 @Y 21 @1ސ! "+ `@ 젒 %  (`8`` '( @   @%@j@ : @`  㿐a@ ( ? (`8`` '@>,@ ,v ߒ㿘(``@%L` @K^@ .,@` ",@ ,@㿘` `@K֐ 4(`8``..@Kː !(`8``.@(`8``.f@%@%5`@%/@$@K 㿘  @ `\@   `@  (2@  ` ݞ@㿘   da @#)   " @@ԁ㿘  p@  " """  " D " H?" L " T" P " X㿘   @ܒ "  `&" ?" " " 㻐 `  L$ "? @ ', $   ``$` ?ht`haa`PacI`@ ֒a# Ȓ@Jc@(y/Ȳ@@ȃ(`8`` fa@ @(yАG "$@@J(a 2H P` 2@ (`8``[# 5Ȕ!@$@$, ] "@ (`8``:*    ?@Ƙ#`2@ @} ?ɀ``2 P7 Pȃ(`@`\@I P`& P@Iܒa  2@ `2@@& Вa@Iɤ  ? @@I`  && < "@I  & < y@I  & <  b@I 2 & < f(@, < ے~@@IaȀ  `@  (2&  @ , c@@Iich / Z  V@@IZ`  @@IT 2H@@,`  @IG`@?`$ D @,`?/ @@I5a؀ 2)@̤ !@I+  `& @#  2'@     @ޚ`"& `&@@(``  PȐ @M,  $ \@@W  @& @/ !蠒 p@"ߒa@#!"X@#"X@# /8o@." ۂp@"b@"@"bX/ɐU㽘O <`2 PGb  P`2 ?b8 `2 "@  2 @" .   (@B&  ` @" .  `y ` `f@M " & & &  @M耢?W  b 4  8 S> @4h?A  D 4> @ m` *? #p/@@ `` (`0```@`?`?@  ?cp@[*@?   "& ,& 㿘`   @> K 2@U  @."P 2c(`8``!( +$  ?+% @ $V ` $ b`?"  @@ΐ   0㿘  da @  ` &    `  㿘 `T(`<@ ?" T@N T  02 `@ލ ` "/ @@އ+ @ @ "' <# < 8 " 0 0 "  " 0@ ^ 0 " 4@c 4 " |@] |  @W0 ` Z @L@㿘@@@ @4"㿐@.``'` ``7` @N? @`"`Ғ "@@""" " " "" " "  ``d? 0`0``0` `#\Rp  0            #d0#l1 #t3 #|2#2`#2  #3##`3`#\#h  #p#x# `5 #  ##4 4`445`2  `# #Ħ   ` `##########Ȕ @2M 㿀``"`s?  l   @_ 2_? @F . &  R.@ l % @ I$ .@@B " @`>?@\   @4 4?  @FҐ .  . @  "`2`` ````@Ð  &    ?@К`&  ?㿘 `?  :?c & @F  @& 㿈` @````777777ה 㿘 7HϒH㿘@Fv Ɛ.`2`.2` ` 㿘 `?   @@:?c & @E   @& 㿘 8@?㿘 ْ8@?㿘 ϒ8@?㿘 `X?  C + ``2  8 ` ?(`@0*@)`>.`#8& @Ec@ `@ `Ւ`2.@? @*% `dc   c0% ?݀Ԕ`ڂ`㿐$ddd `{   (`0`:dc& ?(`0`` d  ````2E-d`2` 2= d d ]dc$< \$$h XlAl>l;l85l " (`0``2d   d(`0``2 d    @6d &d (0@&  `  (`0`cH&  ` ?㿘$dd ` 㿘(`8``.+  (``0`2.@ @ . %@#$@?`>"`?`@Do2 `@(``ߐ`2.@?2.@`/ xc '  @j 8 @!0!0,ȃ(``@  2! ''''''''@D@ >А@,֒?!0@!0@Ҥ !0@K& `$@0㿐@` @u 4? 㿐  ?     @ @ & 㿐@ @+0@J? #@̞@` 0` 0@0 #@@@㿐.0`.0`@U?.@԰?㿀/ c ' / 7  #''7'@e  @`$@U'  8` @g  ""`(@ύ㿐\/ 㐒     (@`) 0`    @`*2?􀦀?&`g 㿐\(`0` ?i?&L 㿐1@ @ ` @θ `c(0-(0`  `+$@&``(`0``?&`1@` @@Ι`(`0`8 $ $@&`@B̔ $@@˰? ""@&` ԰?X/  c!@ @'  ?@ '' Ԛ '''''''''''''̐ @ƒ .?c @@G@<ޠ '@x ?(@}`(@w`@q`#@l@ O@^? #"@^0 ̂` &Ȁ ?c @"  @@ՀѠ @2 `  @0`  `$$ $  &  `@I-`,@=㿐!@ @&  @B   &&@GX $& &&   @# #  "#?" " "" #"@ "` #  " `" #@㿐@ @́㿐@` ` @`?" @H $ `& @㿐``㿐````@ @"` `` @IJ&@?c`/  c' ? c@A''''''''''''쀤 x'  `@$   $`  7'"5'       @  ' $?'̂cȂ' @w ?3@0`" @*?`7B 9'?cȂ' ޤ܄ '?c''  '' ' @v ?Ѣ    ?"@H ?$ P 0@ " `0@@ #"?c/ Vc' ?c @AS    8`   @#@      ?c @ה?@`" @?`7  @ " 0آ$`4@̳@ #"㿐  @@ @y ""?@  ? & @&  㿐  @@ @$ װ ? 㿐  @  @  @& ?? 㿐  @c   @^ & ?& & & @& 㿐@  `2" 0h/ Tc' @ G`<@ ?>$'''@ΐ@@ ' ;''0@,`w?#e@%`e `@F,`8`@tdo`8((``"  y@FҐ@ƅ` e`<@# `" `D@x 0@@5 ``HL $@+G@@$ ?$@h@@?@ ; a ,;@ @y` `@@ *;@ ` `P@0` `T@x0@Fj 0`" `P@ϰ 0`@@r`X@ǒ㿈/  c'' 2&`p@ (```t@xa  `x@>&@@ &`@ ?? ?@ &`(``x`&`?```e@f š?? @? &` (``a`&@M&`@I @)4>`(`@ ``&@3 @)  >`( (```&@ &`@&` @&`$ s`" (``@   f0h`@wİ 0c`@w 0\`|@ʠ`@w 0R@ @  @>F @<Ր`@w@4͐P/ hc` ' /` @)`1`В @)`(```$`` @`;h;`#p#\#t#x@ ` @``Д @`(`@.㿐/ @``@@"㿐/ `d @Ӂ?/ `d@' "L?@ĖP "\`h`''Ԁ`?'` 'ܘ   `+` ؃+  @  `d+` ؃+ @@u ؀? /@z ? `?0`` ?c ` ǘ ` ' `@ɕ`@v?`d`@C@ 㿐/ d`d`+@V !B!@b"  @G@4` @  b@K! @1@? "㿐/ خ|c' @ͷ /  `h@u ?2 `@㿐/ `` `@c `@v@ِ@V@T  㿐/ H`@c@5 XcE `J$ @`$ `N?`N` `($ @` $`N" `n" "@߀ ` X ``$ ` X (@`$ X   @ǐʀ @Ģ@vU   ~ @@ve  x/ "c'D' `_``'''@"I''耠`^`@u0쀢?3@'``?6 2 D;`@@ݐ @%``@) @ ?4& `"2  ,2 `)?&c@ #@`d`2@]@@S@S`'  `@?c`/ tc'  ^`@ʐ `@Ð ͪ? cȂc@@@u t@ @ : .@@;{ wO :.@,R $ @@;j ``  `@;Z `" ``@t  y `((`,,`@;8 ` @;2 `$@;,$ ?@  +c+ (`0``@ @4& '  3  :.@@Y "j |a@tU ? @֐ ڐ ߒ @@ a  `d @ a@㿀/ c?@' ??@>6 @>3 @>0 @>- @>* ''''@>#  @ W  @ T  @ Q  @ N  @ K  @ H `\@ C `d @  a z$a@ƹ㿐/ JD`h@@:c `l@{@`d$@ S@l&㿐@" `a@ ?? @T @T@T   @Ab㿀/ 4c' @; $"a@/ / %a$@@Ea& ea @  / @? ,a$@ݐa$@?''쀎' ' "'`'''0@ .`w?@@@ݰ? "@`#?@`a(a,@%n$#'@גa@@%a0a, a$#\@%R#@Ȱ@ ?"@ ?m"㿀/ Dc '  ' ''  @6 ? a4@Œ㿐/ @9  "  (`8``. 0Ђ``  ` 0 㻐/ c' @9#@&a8< ?"@tn  |aD@8 ;?@Ļ@@},; `aLHa8<@J ; @8͐ @8ǐ -@$#(:@ ?"@t% 0@ې @KF @`aP<@t  0@}0@`aT< @sڒi0߂aXa@@x/ [pc<a\' @'H'L P`had'pal'at 'ܪ'@ 0?(`8`` 6(@X # 2* (``@>  @ "' @s@ɒ 耤@8@ H@X  @ڒ,@ 4 (`8``02# "쀠"2 @ `@7ޒ 2ؐHL @ߔ ax@㿐/ ᐚ ``$ `2     @` )   ` ) <+`?- `.?Ѐ`? `      2<{Ѐ8 5`-`- +`@ 3`+ @@C@C   `#) ?Ѓ<`.`? ܄`` :< $>@ [  ` ) : @. @.<  `a| @ `(`8`>( (`8` "6 ``2 @ @1? "? l  gk7`/`/ +`@ 3`+ @@C@C @? "`2e       ? `$`a+`?#@ - @  @.   @  @- @ D>@@Ӓ@? ""㿈> @/ ɮȐb R: 8 0 @(0 8 @ cDa ( Ba(@ @ @2`*`* *@ 2*@BB:80  0 @ (8 @ `  &z` F  @R? ""& 2(   I M &S`F a|+`;` @!ݰ (݆倣 ?`c߀ ?3?a|(`8`#\ #` @! @0   a @Ұ  `a| F?   F? / c'  @   @Isp  @<א @ @W3 @W/H!@W+h@qh@!0!0@H0ނa@㿀/ |c '  ' ''  @2 ? a@/ c@' ]@''''''''''''''''ܠ@1ǔ `6(@2@X@ @@@'''''''''''''''''ܔ@1 `\(@2@/@ @@ @ @@s@ 'a@%@/ c\' "`?`"]?8Y?'@ Q@@'``'`' Ȭ5 (5 (@5 (.M??耤 '  >??'؆ @(2` @I@è ?@ a@@ '@ˀ@ " @   @  0㿐/ І  (`8`@" 0(`8`@2   㿀/ ڮHc'@' 'T /`(`.`8`8. 8``&@ RT`$ !`@ @`@ @ (`8`@2  {$ @ @8  `k (`8`` "h`a` ` (`8`@e `U`@Ώ@ @,T1.`8` ,䀥)@ ǒ $ +`(8`T.`8```8@"9 +  +` +@49䀠`2 @@ L`' '`?`?  'a< *9 `̀$ 9 "@"@22++  +  +`+@U ކa@v㿈/ 0ac @' ///@}ϔ젒   @@ $@`@&@@ a@F㿐/ ήxa@| :@ 㿐/ <ac' @} ? a@/ c' @@$  a@  (`8``/ya@ z$@  'la$@ 'lp  (`8``` `:2 *  (`8`` ` `:"  8   (`8```/U'@4l`?`쀢 @}?` R`$@ E@ : 뀦 (``2* 䀦`ڀ`$@ +$'la@H  (``a@ $'l@}? 0aa$@ט#(n'la@HTDDDDDhDD|DDD@DDDDDDDDDD$DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD(DDDDDDDDDDD㿈/ @ <a-@ b,%ct'' @(8```% @,@(8```@$@ s ۂ``M a(`@ (`8` "x@`~@    @耤 瀥 @,@`  @  $Wc$W@@;В d 0 d,@@`@@;Ē  0,@`@@  0,@ע```ִ``z<0` @(`r$ o@;  * @f(`8`$`   (`8`Z@{ %,@T`@@@à`@`@㿐/ Ԁ >) : Ѐ` 9 : `."K : `* 0Zƀ:  )   $cl(`0`` a(8(`8`0`: @;D  c* ƀ: 2  (`: (`) @: @Ѐ Ѕ(`(`@: `.`* ) : Ѐ` :  ) : Ѐ` ( ?Р@: `* @-ܐ ) 㿐? ''8`1 뀠)  (`  @1 )ch@(`) 1     @ @7`(1 /`7     ?7`(6 /`  @(@'@`7`(6 /`@09@0`: :;(`@@?()@ڂ ؂ă7`  @ϲ@(`1 )  @Hc@〠j8 ȁʈ ?v    Ȕ  #@ak@$6 @ т`@(@㿐/ c @'  '/'L`"ȑʁ @ *`' 'L`ȑʑ)䁠LϕHL㕢Ha@$ @ Ђch@(@㿐/ ,@((`88` `2  㿐/ Ā (`  a .((@/?  ?(`8``/ . (`8``/( * '    (`8``/"  @@ c"a@,(`8``/ဢ * ۀa< / /(``(@} ? "@ Ђa<@`" (0(@@@ Ђ`@ ( 04@@" " #`@"    `  0 "! H P """  """㿠   @" &  g @㿐/ a @j x/ c'' '? 'cp0 @? 6  '@}7 "a@]$8 @ ςb̂@(@㿐" >@+v "  8`    *``(`# `? @( ` ` `  `* # ` " ?#0? ` "  #0& ` $  *`㿀/ c @' `    ?@@ /4 @-* 0".`(     '" ''' "  "  " """ " ϰ b@㿐 g @- .. . . . . . . $T @ ΂ch@(@$ % @ ΂c @(@lT㿐/ ``\ \r \1``` u ΄` ~`r`*@` \) ` M) ``$`  - ^`)`@ h) /`  `  `  ?``"`  `?`$``"B`\J@))  ``ф`*`?`[`#ǀ`$2ဦ`"b.`%@`?`[`#@``0`)  \0 `0`00) )) .") \) ))  2) \ \ s ))  \ r ))  \ f ))  \ v ))  \ n ))  \ t ))  \ b ))  \ a ))  \ 0)) Ђ`` ) )   -)  ) ? ) 2E|㿐@/ h*`` `@:`*:@*``2`".㿐   *`*:`:۔`2 `@ *`Γ:`"*2@"*㿐@,d  @  ?@zð @j $@@z$@"p/ c'L@' $@''`''܄ ''+`9  ` `\DC`@*q:" @0`+`9 `L`2. (`8``` @*J: @"(`8``&@ g`` ```*E`?C`[A`#? @`9 `` ܀` "9 `؀`  9 "@`$` 9 `" `\.  ``".  \.2. Ѐ2ˀ`ކ `j@`"d@Ӄ9 w b@$ @ ̂a@(@㿐/ Tb @|$/ b@'  @6  bp@k Āp< @@ @y  O"b@b@렐$@װ@ xb / c@' b $b(b,'b04''<b8@$  @ @= $ (`8``#@0 $@+ $@& $ $$ @    @͘#쀠`$ @      @輘#쀠`$ $@@  @ "@*  @)В @)ɒ yܐ@)’ r@) l@) ֐ $@$ v @ ]bD@ Z$ (`8``#T@ $@ $ H@) "D$ @){ 0bL$ @ 1   @/#쀠`&$ @m    @#쀠`$  $ bHb@@㿐/   b @)/  㿐/ t4  b @) 㿐/ [b   bY 0㿐/ X ".(` 9 "(`8`` (` 9 `"(`8`@ 2.? && ӂ 0㿐/ Ů|bP㿐/ L`< ;@? 46`$`?A,@ @&@.@&   @ ,,@ `,* `@ @w? " 6В̢@%Ԭ ?( (  ,`@ @%@.@%* ,`@@%`4`@%  @*`  А ͤ$ @ ɂb@(@㿐@w "@?ؐ ?  @   &?   ?@v`"? % @ ɂa@(@$y @ ɂal@(@$Q @ ɂa0@(@## #$v @ ɂ`̂@(@0DXl㿐/ T  () bT ɂ`%bXb\b`bdbhblbpbtbxb|bbbbb ? #@<@p/ c'     '?@Ѐ 2''Ԃb@+$ @ Ȃb@(@" (# 㿐/ cX$= @ Ȃax@(@$i @ Ȃa<@(@㿐  @ׁ@u? "$ @ Ȃ`̂@(@$: @ Ȃ`@(@$) @ Ȃ`T@(@ $#㿐/ c'H'L'P'T'X' H@' b@㿐/ @uVcb@  |b  @ @)b@ X X X X X X X X X X X X L @ X X X X X X X 4 X X X X X X X X X X X X X X X X X X X L @ X X X X X X X 4 X X X X xdP xdP $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$l$$$$$$$$<$$$$$$$$$$$$$$$$$$l$$$$$$$$<$/ c' @(p 'p< @`   b@`i ?b@<bbbĝ㿐  @n :@ 㿐  " @  " @  @@㿐@/ ᔡ(` @%g@%d @%a@@6?< $`\`\Y`^`$R`(& (`< `\ ``(``@(`8``/`7``ߤ@Ð @ (`8``\" _`^`$O ,8 , @ @s`.`~`" `@" ` (`8``: `(`8``/*``"@Ô  (`8``/`@` `(``|`z $ @ $m6`~ ~ " "  ?(`8``:2, (`8``/ `" @  ~ @(`8``/`2,@` @Ѥx$  (`n ^k  ) 8`e \?Ђ``D(`]` Lj"% @ ݐ @ϐ`I `F `C  `Ѓ(`8`/!`7 `+`(`8``/``74 Т`+`)`& `# `  ` :  㿐/ Tp  " <` =`b2 @ -  585@*5@ `".  686@+6@ "@ - @rN? ""?ǀ . 6`6 @ 5`5 @p ? 3   (@ (3`+ +`@ `?@[   `  ?@R @ D@D@Dʀ@@r ? ""? ؃3`0  з(@㿐/ c@' @q" ' @m?? & @@ b @^bЂb@㿈/ zc' @q"@ @q `#`@`@``23(` ǂaԆ%@f'@q `#`&@ 6 ޒ ` '@qh`$`&@@q^? "?"  $  ז"b@n (`8``*`x` {@q3 `'`2&@0㿈/ c' @q" ' G@l쀢?P?G &_@q"b@3  b@, i@"1?#'" (``A (``=@b@]) @װ@pѲ "" D쀢 @0쀢 "@b@] @p "" "@bІ@ c@0@p`"Ҕ   b@㿈/ @ c' @pv" ' @l 쀢?%? &4@pc"b@㎐ 4@[1#? '쀢 @K0쀢 "@Db@\ @p7 "" "@2bЂb@S@X ` 쀠@"@(``2 @ fȀ@p `"@ 0b@\N @@o ""㿈/ c@' @o" ' @kz쀢?%? &4@o"b@ 8@1#?@@ +쀢 @0쀢 @b@[ @o "" "@b@[ 0b@  (``A   5  @߸   쀢 @d}  `y 'b@[ @l0(` dž%4`, ,`@ 3`+ +`@ ` ' @(`F`ʒ@P04`,`, @ 3`+ +` @@C@3`C+`+ @0@((@@ +`c3`+  @ ؠ 4`,`, @ 2**@2B**@ @ +`c 3`+  @` 4`,`, +`@ 3`+ @` 0((@ @c?'4`, ,`@( @n`"~ 㿐/ ܀` b@ɐ   @&  ٖ z `,b(`8``@  (``?  # c+`8`@ $ `,!(`8`@ !`,+``2 #(`` # +`8`@ ဠ`,+`( 2ن*"`0 @V  2@ $& `@k" @f bzc X b Ѥ Ҳc@Z ڀ`c @Z @? 㿈/ c'  2'''@S r $ $ 1(``-@ݮ o$쀠`@m  ?+$ ???>c@ZM @ @ =c c @Z2 c$@Z*  &@%c(@Z c@Z c@ 0c,@c04  _@Y 0c84 j@Y @ 0/ Utc @'   `"Gb` ?c@<cD''xHcL't'pP'lЬ' '| @Y    ` @  l @  p @Y  2  2` A@N;  c\@h .`'c` (`8``,`\}`2 ,@  = "* % i @8 @>'  'cd@hI !@  [) 8"+@ 2\U "/+@) 8`+@ch cl @@?4  )) 8` ` `"8 :+@`)   (`8``,@ @; " t @X&(`8`` ` 2+@+@`@g =  @g  =*/ @g = ``"``2  g?  `?  Y? R ?|@  "x@X cx    @~8 ` @ @@` 『` @c@Xe Y?cT      @t 6Ā c@XL  @@ @@c@X? 3? c  @X- ߐ!?s/  ?  ?  ?  w?  0?  )?  "?  Z?@cX@W ׂ?chcpct@` `F ł?` c|㿐9? `< Ԕ nP/ c@'  '@@R8@ 2 ?c@l㿐/ c'' @- : ,   ?@Ϛ` @   G "  (``  ` @(``@ , .@`   ?@ڠ`逦`  @   @ۀ`( ) & &2΀`c@?H/ Pc' '쀥`' &' n -耠`- @쀤  (@@( @ 0  @z 2 @f,'&C 耠`"$  ' 2' & |'$ 2 ckc@TM?c@h࢒ B $@  2@>  *@8  * @  ?@`@$@ ?ܤ ``$`@k ژ ̐@ɐ" @l " @@0?@0&?c@"@W7 v @c@X܀ ݰ ??2Ӱ 0с㿐/ `c'' 6(`8``0`=.` @(`8`@  `="@c@h " @(` @W 2  2ڒ`@i? " c@㿐/ c@' ('8=@ C` @(`8``=@ `62`"@@ 7c( '@  (`@` @ 2 @  `"Ϡ"@@i% ?"c@Ic `  `2 8`c @1 ӈ?@ ,@$%$@  `㿈/ c'' '(`8``!`=  (`8`@ `=@f$@ c  2 @h? " yc'@g "(`@` @W 2, @ O$(`(8)= = `=  = )(`8`` = )@`((`` c`&`2 8``c @}@ "?@@ -@%@'&@ `?c@i   㿐/ cv@Ɛ c o㿐/ cac` c @`  , $c@  H "D@g@9 㿐/ c̄ !- @gݰ !  $(`` @g˰  "㿐/ ($`2&@@g  "  `$` `2 (8``-C`+x `?d`0a`0>??@( ?@*?    Ѐ` 7 `@`1@?` `7$@) @@<   @ ݤ  (`8`@@gK "" ???Ƥ`` ``2&@ " "`0??`   (`8`(`8``x`Xꀠ )(`8`   #? P/ 8c'  '?''' @2# ?Ȁ`  @?c@ $ @ a|@(@㿐/ @c' `w ? c@㿐/ ༀ (`  c .((@(? ?(`8``/"  (`8``/*$(`8``/    (`8``/ @ cc@,< /c((@fN ? "㿈 #\ @H ǰ X/ c'  "@f*? /" @(8``0``lЀ` ic  @ " , , @@ W@`(```Ѐ` r`,@t``/?`>@<$@?(`_` @@(`W`(0@`#Ѐ`  @c` @" ޅ. . @@ 8@(`ɒ`Ѐ` (`@e? " 2@ 1"@ / ,  @w? m k     @5`` @e? ["@e? (V"`/8`.@`ȂЀ` a``(`8``x`X2N ` I`?F`$`D"?.` @`(`/`,+@``D$` ` *`@(`8`@," @ @!,@`,@@ (``Ւ2+*`/c@>cc@6 v(` ,@`    (`8`88`? $@(`& 0 cc@ ecc@ 㿐/ `c@ @(㿐/ c@ @$! @ `Ă@(@ o @ `@(@  #@Խ@% @ `,@(@㿈/    `#\@ $j @ c@(@@   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" $+ @ `@(@p/ c`' #A` 0` @(  ` @ (.`@@(   @ A ڲ` @/ ®c @' @ `@w@/ <c' [ 5 _e &gO +$ @ݒ 0 4@>g뀧 @c@!@c "b 8 ؔ d8Ԗ$ @ 4Ր@b @@b"0 `8̺@ 0ဧ 0@'p? `@@ٰ 0@֐0    #n@㿈/ c '  ''  @ϖ 8@? `@$. @ `H@(@㿀/  c'H'L'P'T'X' H 1'c`(@(88` g4'(@@"@` @ @`$   #c`0@( ' ''  @S '@`,@F$7 @ bp@(@$[ @ b4@(@$  @ a@(@$ @ a@(@%; @ a@(@x/ Dc' C `48'''''@4 @i?9 2  @( c<@$Q 4  0  @{y @  #   ??c    @?`@@X$ ` ` `#$ `# # ` `" ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` `# ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` `"" `"D ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` `"!l㿐/  ?#`$` `".  . 8`. `. (`8`. 8`. 8`c㿐 / ̮4`& `D   㿐 /  0 Ѐ` *    ". . (@8`@Ѐ   @  Ѐ`  ǒ ` `0  `` `  @ ` `(@( ` @ `@ *`*@ " ##   `  *`>@@ #㿐 @  @s  "$ $   w 㿐 `     (!& `0`@:`*`Ӓ@   (!& 㿐 / l 74&(/&(`8`@ (`8``]`H@`"@g 2 @(``"  ``      (`8`(`8`㿐 2@ (`&8`(`8``[2(`8``.2& .  ( (`8``."ђ , 8`˒   ̂(`&8`(`8``]&㿐 /  @  ` @ " >`4`@@ < .`  $&(@.`&`&` `.`@ @(`8`^"`8`]`-ڂ``L$@<- @ @(`8]` 8-"0 ``-2`[ǂ (`8``:"̂``=.`T(`8``-i,`8`@ ``@(`@` .`@* @3 ``?  `$@`s?,@ ` @ `"??2`  @`   @`@ 2 "  (`>` @(9 @2  +@  ` @ ` @ @     @ ` @ @ ` 2Π &@3 >>`$@  2Q@o `@i ` ;(` (`8``::`=`@$(`8``-Հ`]Ԑ "`   "`" $"@`@隔 2 @(``"T  `J @ (`8``:"9 (`8``]"$. @$(`8``-`]Β =@` @(`.`h@ (`8``="I +``" @ ``@(` .` +``   (``2`@&` "?@肒@4  (```@,@` `@>&` 2`` "&` @&`   |p ,   } p`P@ϔ  ^& `$@`-@(-`-.`@ C @`(`8``];$= @`   @`Ճ(  @4  `@D ` ` <2 @ i:   ,@$@@ ] " @`T@k  2~(` ?< @` @  .`@` `(@@@`2((`@.``"@` (@( `.`$@~  @t(``$@`]@(]`].`n,`(`8``] $(`8``- -$ː* 88,`8`2@$}@(`8``]2$(`8``]2x$}* :  @@,@`.`$@`-@(-`-.` ͚28`㿐/ Xdc'  & ^& /  ]///& & `X@Z㿐/ 1 c' `#8` `$` ` 4,` 4 `* :  & ]//& /m& &`\@㿐   .`  .@ * @@ @& 㿐 `#  ,  $@` $L ` L ."* @  $㿐/  c% ` .`  `@`(` @޲& "`ɔ  "(  ""  " 3$ $ "   ""  ۔" $ `O "_ &3=㿐   (`8``^s A (`8"~8`\E&!9O!>!1Y [ >Ѕ,`H`5`H`  `   H   $ (`8`*ʄ @ $8``\" $    G  &(`8`\8@(`8`a!9&!>J!>!{!<@, {:` / [A!( *" .,  `ܐB !!}2, Ē  (`8`@8 ̀`2ӓ,  Γ,    &/  ()   !)2,  w  `D `D D`  ,`@ `  `  (`8``\" \ )`  ,`@ `H  @(`8``\(`8``)4&L Y  &A" " 5" " ' (`8``{ $ 3& (`8``,u;  :a@R (`8``\L (`8``}F  &     & w  (` ( 0` 0 (ܓ (`8``)hj` &]  (` ( ,` ,  (`8``}@&  (`8``\@&    &Ѐ` !@ }㿐/ \t ch %   ](8`|VT܆``X&    E ւ`` (>`?`{" (`@( Ѐ` 8  &>`+" `+`?`*"    ւ``*(6   .     y(`8``|yP& "   @x "   Ѐ`     (` ( ,` ,  @`(8`< &`>m(h  k ! f  `"A \ ƒ  V  `D `D D  .@ ` = (`8``)  )  .@ `H&   &(`8``)       (` ( 0` 0  q" " e" "  &W >`+  L" " E`{2 O (`8``,W  *k& #  &Ѐ` !) 8``?ր`{2 @( Ѐ` ̐~  " "  "Y"x  P" $o   j  m &c  f ђ  ͒  "æ (`8``}2 (`8``}@&  *" ]&" 3$&" / _c' `$ # @  @!P@r 4  (` @`@c'' '@6 Z @@''''' @ `(`@2 @! &В &8!&4&&& &&(&,&0&<&@&D@P&H” `& `*`':`* 8&$=? @& & 2( c >3+-;9$"7@ @ m@@@ @@@4o&@ @2@ x(`` `` 80`@8```  ` 2߀`4`&4+h ``2" 80`@8` 2     2*`ے``@ @@@@$&@  (`@ @@ (&(   > @ @1 @ %@ 2"D &(`"T`7 D&L$$ 4bE&<e$ @R@&@ @Ӑ ̄#   ǔ  @8``@ &@  &<@` > @  (? * (&@㿐<be"  4bE&  $@  " @  " <@ < @@$ @ `@(@$ @ cĂ@(@$ @ c@(@㿐/ Lc`' 2&@2&h'd@ȵ "4 & @(`` @   @ ',  ,, `!`@&@Ȅ 2&  , `倦`耤@@&@`l@㿐/ ᠐ @  * `d " : ,+@``" (`" . +@  (``. 2+@ ` #@@   x $||    p|pp  p pp dpppp  pp| p|pp  pp  pp \ p   |||                                                                                                                                                                                                                                                                                                                                                                                       ( / c!'  '@R ?"  .  `%a  @. +?`i  ''ؒ Ԕ @ ?Ւ?ђ Βc̒ ʒ$Ȓ(ƒ d @ 2?c@RL W?"  ''ؐ @ 2?c〠 cc  ''!  'Ԃ ''Ԓ  @@ ?"u?@  @4:0k  ''؂  'Ԃ!T''Ԓ l @" ?"W?U|S ?Pc  'n'؂  $''ؐԒ  @ ?=?쀢`"9?076' @Q  @$ @Q'"쀢 ( @ #a!! e0`p@\?r ? /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@$ @ c@(@$„ @ cd@(@$ @ c(@(@㿐/ cx@' @(  (``"`|""`t@’  2%  %&@@ R@  " (`8`2`| &D!ˢ`@;#%(`` M"/Gk#m'g` #`@; ؒ󀠠K"`@:`@`$`$#㿐/       8 @8` @(@PT @ ` t   , L |<H<LT < < |T (   `   8 d㿐/  @Ђ``   @`&@ t , , @   @``/`9(&@ 㿐 !@ Q> 0`@8` d@ I$88㿐 #  @:@ "&@`@"@*@ܔ 2`&@ p/ 8c' ``'l? %@! $ct%'`'c|ऄ''''@(``"*`g` a;` @"` `2 ```" ``' @2`@(``܄``V`glTx&`@`%@@ 8glV` `"Z @(& (@& $2& ;```%  @`@'     @ۂ``U`(`@  ܐ Ö 5 2g@߰ @9 d @3! `0 c`@` G' ܐ   Ԅ?` x&@-%@@ע@  &(&  &$' c`@` c`' @,`@@ @@ '쀢 f bc`' @, h@Ɛ@x   8@@m '쀢 ? ;ܐ  c 4`(((! '`^   *  `Q     2@     2@  Ԗ ; 2x@ `#   = 2d@ܰ ` Ѱ  @"R@' @"K@`2`C@ c`@@"@Ӕ 2X`  @(' `֔ ܐ s  @ `&@` %@  _  |`@`%@ sc`@`Ԑ F c 2@b  "t ' @l`2  Հ`/c'(` 4% @ !n 9`&@`%@ , (    !`@`%@     `&@`%@`'Ѐ` |@`D4&d& '܂`?'   '(?&( @Y&$'쀡 & (` '& %@`&@@`'8%@ `&@@`',%@ @ "&(   & ( &$@'&(& '  `M' @``Tz'& &$&( '   ,,` @'' : @Ѐ (쀠4`:S`' @@s K ` G` @` &'P'M @N  $@  &  & $,' @ d ; '* * *  @ d@|* * * 2 &$& &(,,(`@܂`     ) '?&( @& o&$ @``` ߰ ` `` 8`&$`&(U' A @&$ @ @&$ #@$Ä @ `t@(@㿐/ 8c' 6@6      6 @. @ `@$ @ c@(@$ @ cX@(@$( @ c@(@$k @ b@(@㿐/ c`@' I  z `  `()  ?0 ` 0`0@ `  ] `() 0` `0`0  `?     ,@,`,`,` 惒 * @ז`1///  (  $`0 @ (0` @,(@`  (`0@ @+ = ).?@  =+`@㿐/ `4`ܦ$  (8`)   @@`2="b@e  "`  2`$ (8`ݒ ?`/ ˤ Ǥ 2` "(`.@"@ @.@ؤ(ߤ?@"8@.@m(@ (`(ͤ?@"8@.@`(@ (`  /` $?  ?`$`2 ?"?`"?`(`` `@`?(``?`$`2  =?"z? ` =`(`` n?2l? e 5` 0$ @ `@(@$W @ `|@(@ `   @   `@* ##   ``2`(#?#㿐``? @( '@  `@8'@? "'@.?' '@ ޴'@㿐``? @ '@@?@( '@ 2'@?' '@㿐@㿐@㿐 ``& ((@j ?(㿐`? `````(? %?@@C  '@`8?   ,`/` @/@/@/`\` ,`$ @ `@(@$b @ `L@(@㿐/ c'L'P'T'X' L@' `@ / c'D'  !'''@А`''$' ''7?D7'ِ @. 2? `@N#@㿀'XX#\#d#h#` @* $ @ b4@(@$ @ a@(@$ @ a@(@@              L       L  @L ܁㿐`I@/ (`8``g"J`8`g `o`-O`XD`+"F E`ua0`    ) @.@ ) @.@  .@"  +`@@ +`@@"   @@ (`8``g`8ɛ0` "   @`  .@`g`g `=`o`u #`=+`X`+`-2 *'* " * +3-5=2  `*  -*-"  + *2 #"  2ѐ *  @  @ @ (`((?* "  `*  `* 㿈/ =' (``8?' @l@X @X @d  @   )  `8Ѐ`  0 a %*`<`g `gڀ`o`a" <`+`-`=`=@@F "  u<`=`   =  <`` .(`<`=`"@ `@t  ̄?$@@/` X!*`<`Ҁ`,`+ Iʰ ǰ  ""?" "  "?"  $ =@ `@tj  ?$@@/`ۤ =R+R`@*`@tL  i?$@@/`*`:` t Iq |`<`=" @ `@t'  D?$@@/`<^0`u*< )*`<`g $8 @ `@s  ?$@@/` Xl ٨- ը @ @1 (``0a@@@E "" ,@ (`8``+" `-`X`# D#   (`8``+   (` 8``- `+`X`  (@ (`8``-`+  8@   8 @ # +  -+ # +  ++ " # +  X+   @sl   =/*`@]@3~ `/ c @' /`>` !`!2 !` @@ߔ@ 2 $  2@Р0` `  @Ò 2 a 2@በ0̂` 2@Ⴀ0ł`a@$9 @ a$@(@㿐/ c'P' P'T'X@'㿐/ ca@gc   a   @Җ @oa@gN @@@@ @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  㿐/ <) 8`" !#+A` ,` * ) ) 8`"+8"뀣` ) 8``+\ + (`8``"   "a(. (`8`` ` ` 2+ a(.+㿐/ a  @$8@ 㿐/ a @cܰ a$(@e&@ 㿐/ w,aa`$@{ Ȁ @, "?@`( ` (  2@(8``"`#a /;$@$` (``$`$`$` $`(` La,0a48a<@aDH`$"@`"` $`   (` %@C  " @<  2K "G@`"@` `$` (` ߰(`8``#< `#" $`(``"$` @͖ *`@"` V"U `" @ A @  2 " @`"` `$` @ؔ  2 " @`"` `z$` @Ô  2 " @`"` `e$` @ͮ  2 " @`"` `P$` @͙  2 " @`"` ` ;$` @̈́  2` (`8``=2Z@ =@($` (`8`` ` " Q$`%$` (``$`㿐 @ aP/ Lc' @ _ C@i0 >0<@   " paX / d.`.@.` e v.`.`.`   A L''' '  J @ "0@A{ @a\@7h `@9Ð &8<   @~@y" 48<ܐ@6 0@6 0@6 "0aT@~e@}` @ 0㿐/ _aLP!r    !O @A "$ @ bP@(@㿐/ c'L' L'P'T'X@'㿐/ ca`@c `   @+S @T$\ @ aD@(@H;jc"" &. `v" " " " #8/ c'@'   ` `  `(`((@@@#   @`' '` '@5ک'x@@@ (0:1V@  @( 0 ۄ @ ě(0Ț@0os@ @@(0 ̂@=_  @(0Ђ  *@ ( 0Ԃ *  @ (0؂@?Q@ @@ (0 ܂@`& ؂ @(0 "= @@ ( 0 ?ֈ @ (0@"W5@ @@ (0 @ " @@(0 ?f @@ ( 0 )P @ (0m ! @@ (0 @=@b@@@ @(00, @ @ @ ( 0 Q@ @(0:m  @ @ (0 @5Ě@]@@ @(0 S @ @ ( 06(y@@ @(09 Ȃ @ @ (0 @xs@@@@ @(00 ւ @ @ ( 0=5C@ @(0V  @ @ (0 *x@@ @(0?;  @ @ ( 0ق@ @(0? B  @ #J`@@ @(`0`   (0!}b @ @(` 0`@gX@a" @ @(`0`@?yN `  @@(`0`  )/ bD@@@(`0` c@ @(` 0`@=Қ@c` @ @(`0`@/ `p @@(`0`   &߈ bƄ@@@(`0` :Ic@ @(` 0`@5;̚@` @ @(`0`@" a @@(`0`  6u4 `9@@@(`0` 9a@@ @(` 0`@蟚@` @@ @(`0`@1+ be @@(`0` = HbD 1 @ ʿc* 2 0 @ *c+ 30@ ?$`9,4@@3@@VւaÉ, @4  1@ @@#3`,`4`0 @?`}, 40@ !aaћ- @5 @@3@@@@bO-`5`  1@ ?9b-@50 @@@(Pc/` 7`0@ a.@6@@3@@@@=߂b.`6`  3@ / 7   /Nb51 @ . 6  b 0 @. 6 @0#`:ᴂc@@ @ #*`2` @@ @ ah@z㿐 6 .@ + @ 3`@  @ `? @@> ? @z&@?  `@? @y㿈/  c 1 ' ) /1 1 /2@) ) ///22 @/) /2@ @? @/@ad  al@z.㿐 ) ) 0`) ( @ٔ X$; @ a@(@D,܁㿐/  @< " .  a%.@  ax@v ap@p at@j a|@d $ @ `@(@$τ @ c@(@㿈 #\#` @    " ?` ?`g * !" "" * #㿐/ c'L' L'P'T'X@'㿐/ @<%ca@^ ` K a  @[ @za@^א @   ɔ  #@@㿐/ a ?(`(`@@@aj $@ @ư (``a   $`a@e 㿐/ a ?(`(`@@@a $@ @n (``a}  $`a@#  `?$*#@O@$? @ c@(@$5 @ c`@(@㿀/ $c'  Ѐ` b`$`) 8`0+   Ѐ` `8|?В )  ?`% #"8 `D`8 @?*``a  ) 8`x`X Ϣ   ) Ɇ 8`.  $ ` Ѐ` ``"$  ` $  )8```"%?``*```䀠耠`쀠(`((@@@ ڰ `װ &@a@wc@䀠`(`@Ȱ ?c@䀠耠`(`(@@ 㿐/ B<c' ; ? a@w㿐/ a.   h/ c'@' ''Paa'`$''`''P'` 'Ȅ''̄x''' ($!2((P   '',,' 'X'','('L'P'T'\'`'d'h'l'p't' '$'0'4'8'<'@'D'H''g b ] X 'R 'L 'F '@  ' :L`+'P```@qu  H(8`` B` @؀:/?*@`"$,` 8 /̅) @(`8`/ ",8 /Ѕ(@(`8`/, @q/  @9m,X`@ , 2X ѐ  ͐  ɐ  Ő    ֽ  ֹ  ֵ   ֱ `  ) !, " @OL 8  (@@  !  `"' @ ?@9`X`"  ?ְ 'ת@ ҪL ,'@uP`nX'Xn`"?/n @{'''': 5 0 + '% ' ' '  '  @*—PU ȐŒ  @8k"i'@8}' c"@8w' ]"a@u㿐/ a   # `@h/ xc@' `" Ȕ ,@tВ`'в``` @89 "?@  t`0  n`0  h`0a@uE< ܜZ(0 Ȃ - ?`*@!Y - r( X w( (@`@X`@h`  -( R - r( Q w( $`Q`vd`  -( K - r( J w( " J w"i"  t( ((#z= ? p*@!` -(  -( (@`@ x(  -(  -( $` x(  -(  -( "  x(# (( d`r*@ s`n*@h@  s(~d  s( S( T(# (( S(e   -(# (( l`?*@`<*@ c`8*@ b`4*@$d @ b܂@(@$K @ b@(@$ @ bd@(@$ @ b(@(@x'H''''''܀`X      ( B0`;@(` C00() ''1 '''ܶ  @  ;;@ C; 'B0`) / 7 @ 1 (` 7` ;;;/`  ;H㿐 #? c+`  ,`   ?@  0 ?( @3`+   (+` ?? (0 *@2@  3  ?2   0@@  @4@ @ @Y> >P`   ;?#? c @?? 7?    ??Ж ? )?  ???    @? `( @ @,`6 .* @ @ 7`2 ?  /  @+  @  2 3`3 @  2   @1 ?(`0) @ ,ܻ/`آ@.@@ @ @ @(` 0 @@й) @܅(Ի(`@1 0Ȫ@01 (0@@1   @@ۆue@>Y\ea@9;"acm@Y]bs@& (& & $> > > 㿐 (  " @ (. ' >    @ @  @ @ 0㿐ؒ `?+` @  ?  @(0@ *   ?,  @ 3` ` 4` + ?@  (0(+` 4 ? ?   @3 2  0 @   >㿐 ' (`& (  @* '@ @qː~   @qt` @q`/ c@' N @ a@r$E @ aX@(@$  @ a@(@$D @ `@(@$Z @ `@(@$' @ `h@(@㿈/ ,+?@$ и`?'`]`:`-@(``0`? `[; *?(`0`@2   (``?@@(`0`@@(`0`@@`8@@i a(``  ?(`0`  @(`!4 @`?2F`4  @`@"$@@(0`@4 @"  (4 @` (@* ``(`0`@( `@((`0` ٲ`( в`Φ ?(`` @(` (`0`@ `2  #`"  *@(``  ##㿐  "  (`  `@{@2  @{&    ,  @{ , @{& 㿐` #@@@`#@1!`(1" `  "` @{g`` @  ``@{X@` "`@{O&`` J?c@8д`@ag  "```r` ;&`(`` 8@@S& X |@``@(`$&@`@@(`$`  ,`@_ ?@{&```@a  "```<3&``&` ?c:@` @,  $@`@(`@o @`@(`@ ```(` $` @`@(`$``Ą(` $@2?"@z?/ c\@' `) 0`"6`/n-  . 0 ) 0``/``/Z0`6 "  % @2`?" /6 6倠6؄ך  @@ $   `@p(@   `"(`0``/ p<@(`$ʰ Ű  / 0) 0`/` <$ "- `$1 ?@1 ? `  @16"(``עa$@ `@$@" `@{ 'l 'hl F @"  % cx (8``.)/6 h @ (&4@ 4@`@  @ 2E#\6a@nAJ (`0``.2lӀ4@  `@9@0$ 2G `@5,@ 2=p<@@26@ /6.6@'DcX'l#` l @&0@16?" /66@hπ / c@' ? ) 3``~?@?И##`* `?`[3`*``?[ `[D`*2 4@`) 3```?4@(``2 #\@@"` `  r``a"@ *  @&c@ [` @a&` (`0`@"4@`ƛ) (4`!(`  [4@4!`?) ` a&` 4@`)  ]̐ 44@`!`(`0``[ `4(`0`-V0`]"H` 0`[ `(`0``: [ : 2`] (`0``]+?c@@"@ 08`  `??" @ (`0`@ `2  (``" `]` ?a&` ]4>) (0``]?`-44(` n` h ݠ  (0``׀`/("(( (0```/( (``T wx 2N @כ) ?` !R4`??c#` = @@2` ` `Tc?#D (" ?8 :44(`0``[s(`0``:9 `y4 "@ @ (`` 8`0"0  (``8` 0(``@80m) a@ ۀ@0b??a@l`"@ @z? - ``,`  #@   `a@%[   @` @`  @``@wC i<a@%@ ` ` `㷐/ c@' (`0``{"_ I { c 4@`4@ (``/    5`}8 (` "1 `[`{ (`1 `].`,(`0`]20``怡 (` @@  ω(` ȉ(`ނ(`0``} (``0ۆ/ 3``[" `[I`{`,'  ː (`3``[ (`0`]? `<(`0`]`2: ܈ 0 0(``=  ? `} ߀τa@k{㷈/ ĮLc'' '쀎`'&&`&~&&& @6$$ ? 2&6??cꀠc @@0` ` `0Д0a@k"`\ `?`\  0  0 ` @ 1?Ԅ? @#@ެ@@#@ޤ@㿐/ c`  ` & @` @ρ@$R @ `@(@%: @ ``@(@㿐/ $ @`((``2@((0$ @ c@(@$_ @ cd@(@㿐/ (a@l$ @ b@(@$/ @ b@(@$a @ b@(@㿐/ D a #㿐 $`a` `㿐 $@t   @t@t`$` @t@tx/ ͮc $' ܔ! @`@  @ b@I:``@  `$ab@iP/  $c'      `$ ''  @ٖ Ȑ@F   '@F``@ @'' `@F| "߂ $@ $` z$`Ղ b@i|x/ ~?Pc@' `" ` + ` $ܖ @   @t1$ @G " ' & &  & C0ݐ@8$ & &  & b @i:/ ~Hc (' @y0 e!@y* ka$` $`$`@`$ $ $ $` $`$` $ @ PT'D'8'H!  '<'@'L`@&@E8 *$` $ @x$ $ @hx$@ $` $` 5b @ $``@@s@s 0b ఔ @߰ 0cఒ @Ԕ @s 0Ȃb@h/ ~lc' @y!?   (@ /Ǫ@1U  a p   60b@hf$I @ }b@(@㿐@0  (@7>! $-&# %~/` "-@ "rL"f `.`k# @2`@ (`(@ @2`@`(`@ݳ.`/` `"(2κ`2˺`@`(`倠I2` @6@(0@@"`'@ ͳ(݀܂@`  (` ``@(`"``) @    (@  .@@v`2s` (`@( h`(@@2a`(8`@@Z`X`@(`y@O`@J`㿐 / |@ 0 (`8` *  `$  @ @(`8` "^  c "  `  ` ޘ?`- `2_" @`2 _"  ` 0`_-`{`(82`2E@C``  , ` 0` `` Ӏ ΂{_̀`  lŖ`"w ,բ `x 㿐V)>c-;$O `8  " 8.`@` ? @̶*@ݐ֘?`@Ɣ`) @@.`"@@" `) ^} x "*5p} /M &( 8`D!qd":} &(`8/9 㿐@/c5> # $'% )?~`.`  "." A"  ŀ ``@2`_H "2` @/`@` (2ܲ``@/`@2`~2Ʋ` @'@/@(``((`"`&@޺ր H"&t(2` 2` `@/ɺ`.`"``+@   (@ `@(~` (` `u` @/`ˀ "`i`2e` @/`(` X`@`}("u`L`2H`) 8`@ "`A`>` @/d` "`3``(`-`㿀/ zH8'L'X`$'%>; 5$ @ .88" " 8h "L @8 @"X  "l8&& 2L.L (@@ @@` .L_ (2 @ ` @?(`8` Ƕ_ƃ.wL 2LͰ  @" (`8``  `.VL..@2.FL((`88`@y  "r  ?(`8`` bg?(`8` ]_[X(`8` @2  `"U @E?(`8`` " 0=J5  c @&(` `8$\LX#\ " (`8`  K  8`_2D 0 `2` `.L ` * !> @@#$'"\LX#\. *@@@@ .@@" X(@u @\LX @#\% v rX~'XȖ @. `^ Q\L @  @ @ -@@X  &8c @(`  \LX#\3 6 8`\LX#\"  @,X ) @ ` "'X`dO`'\'X2 0E<L<㿀/ x@'L'X`$'%>; 5$ @ .88" " 8h "L @8 @"X  "l8&& 2L.L (@@ @@` .L_ (2 @ ` @?(`8` Ƕ_ƃ.wL 2LͰ  @" (`8``  `.VL..@2.FL((`88`@y  "r  ?(`8`` bg?(`8` ]_[X(`8` @2  `"U @E?(`8`` " 0=J5  c @&(` `8$\LX#\ " (`8`  K  8`_2D 0 `2` `.L ` * !> @@#$'"\LX#\. *@@@@ .@@" X(@u @\LX @#\% v rX~'XȖ @. `^ Q\L  @ @ -@X  &8c @(`  \LX#\3 6 8`\LX#\"  @,X ) @ ` "'X`dO`'\'X2 0E<L<㿐 'L/ u6@ ( 4 0 (`8` `@ , Κ`$  @ @(`8`  "`  c "   ? -? `2 _" @`2 _" ? ` A _>{`I @(``2 @ L`  ,  `  0 ``@@_`@_:`o € {_` # `"a  , `b  0㿐V)>c-;$O `8  " 8.`@`? ̶*@?`@`) @@.`"@@" `) ^} x "*6pqj_ /M &( 8`D!pc"9| &(`8.9 8/ tlc@' 'L'<be @4bE2e `(`2a `` h `` `L@?@'L `$ @@@J `<@ %(`8`^?(`8`@2 `@4 @  2 ) '''''''` @Oy '  ' ' '' (`'܂' ('ܐ'@Ҷ  `$''䀤@ (`8` `@ҡ , `@]Ò'Ѐ@ @(`8``@ "'` M`   K   R? `/  ``2`_" ?  @`2 _" `  ``뀤 `_耤 ?{`((``Ȅ'(``〤L`2 `H`T`'Ԑ L"u`HĀ``D ă+`??8@@8```D@`H`2`Ld|`L`؀`2` ?ܘ #\ LĀ "@h?؀ "@h9@h6  I`` `@?'L `$ @@@ `<@ %(`8`?(`8`@2 `@4 @ 2 İ  '''''''''''(@$'̀@ (`8`  Ѐ@ @(`8`"` d`, 1 c    ? `- ``2`_" @`2 _" ` ``  `_ ?{`(2`󀥀'Ԁ`ВL` `H`K`'Ԑ! L"^`HĀ``D ă+`??8@@8```D `H``L`؀`2` 3? ,#\ LԈ$ 9  8 ` 8@L   >`>L ߄D) ??>> ` `,  `` `0  ``9`@[`@[:` ? ?{ _` " ``" `, ` `0@2"@ XLp``֠  , Ԁ`Ҁ 0  ʠ``S`  ?{_`  <`" ,ʠ ` @:@Ԉ$ 9  8 ` 8@L   >`>L D) ??>>d2`LԐ Ā "@f؀  @fް `Ԉ$ 9  8 ` 8@ L``Ԉ$ 9  8 ` 8@E b@[  `D @L` \'@eذ  @K '`L`| {@e `D @K` m' @e @e@e @Kٔ '`L` @e s@e @el㿐/ pxc`c``&```X(@`&`Xc@_`X`p. 8`` 2`X@o`X㿐/ oҮc`` &```X(@`&`X`p. 8`` 2`X@P`X$Ƅ @ ocL@(@<@ @??㿀`$/ oc@' (9 `0? 9 `x'`X"&    s?А ( 8??Ѐ` `?9  `D` * @?`a   ډ(9 `.(?$`(9 `0Ƣ   (` ?$ @ 8` . (`@ ?b @Y㿐/ o&@&@W. 2@W% &) !.`  $@   !)  `@ #@)  `@# ٠㿈/ nb$`' @d ='P'D'H "  ` ? @ %`@” 2@@אA 뀧- 2  /`@"& @ ߢ``(cPH(`8``:b(@Z`  ?2۲  "@Բ 6/`@ @ ``~LP2  "   cP-H `m` H(`8``:`  :}cPH(`8``:b,@@EU(`8``:b0@ cHPcP" H(`8``:b4@В `7`  H@(8:` ` :cH ~   xPcHD(`!c @d    ?㿈'D'L'P'T'X/ mc@cb8` LbL@!@ $L(`8`-X`+XcH @b<@b$? !@XbPb<'쀥'`?{? *@$ @?$%@`%@`2 @(``0P@Dy&,' (`8``-2 (`` L@ - "b@?b<@" @<``P`-'P"}@(`"v(`8``-X`"m`: @L  LPTX?[bP'c %@A&$b$mXV'XL`R'L`-2H (``K?`'XL`A'Lb<P'b@@$@ @%@??%$H  %@b@2%@?  (`8``:F' (``@`%@cPL(`8``:bD@C`  ?'Xr (``RPb<P'%@)@$@ @%@ T'`-L (``L@ǒ hP``W"   (`8`:"= (```@`\%@(`8`;  (``>D@`6%@cPP 'L(`8``:bH@Ғ W` L(`8``:` *`:H (``"  @P`'%@(`'LPTX (`8``:D@`%@cPP'L(`8``:bH@(`cH @ #@ #@   #@$ @ kb@(@%7 @ kb\@(@㿐/ k c' 6@>>      > @. @ bT@V $C @ ka|@(@$ @ ka@@(@%6 @ ka@(@$P @ k`Ȃ@(@$ @ k`@(@$3 @ k`P@(@㿐/ kc' ..@      .@ @6@ @ bX@U$ @ jcp@(@p/ j4c' `  `@??''ؒ@ b\@UQ㿐 / j@@ 2 @  ``@  2`"   @  `  @&㿐/ jɮb`  㿐 @_@S 2 @`"   @Ȩ 2 `  @r&㿐/ jbd͔  㿐 @R&@_  & @_& & & 㿐/ jDc㿈/ jc@' bl?pc@ "?쀢" @ (`8``#`  @@ ? (`8`` "@ђ # "'`@b` @S&&`,@@9 "@ *(`8`` Z ` "X @9 Ð,@@M @"@@(``2@ 4@* `0`& & ` i @9n&  "_$@ [* *  2!: U$@"  `?*`@@;$@@9R` "C$@*  ">$@ *  "9$@:  •    (`8`` `   (`8`` `  w'bx|@ @&@]?bt@S@D֔  `(`&` &`$@& $@H  &`@aƒ  &`@?@8"㿐/ i@bh  㿐@/ h  @6` @&` bx|@~` &@@&` 㿐/ hήcށ㿐/ h\c@' @$ .  " "`2(`0`@2@   @@"@  b@S= / hLc'X'L'P'T'  !'''@~?b 7@c!7''  L'''n?  (@@a "'@ @]'@'@ ?" b@R㿐/ hc'H'L'P'T'X' H@' b@R㿐/ hcb@8`  v  @ 㿐/ hc`` &` (@` @K`. 8`` 2@[㿐` (`0``,``(`0"``?`&`@ (@`&@ `&``. 8`` 2@@)@w "`0@# ?"㿐/ gc` `@@㿐`0"``,?`` (`0``-&```)@` @*``&`(`&@@  ` (`0``% #@ ? `` (`0``&`@  `@u  @@? "㿐/ gԀ$ `2&@@ " `$` `2 (8``-9`+j `?Q`0N`0)?@?  Ѐ` . `@`(@?` `7$@  ´    (`ǣ8`@G "" ??Ϥ``4 `2&@" `0` ?Ӓ@)? (`8`(`8``x`X倠 (`8`    ` "` #㿐/ fb㿐/ fb@QZ㿐/ fb@QD㿐/ fޮᘶb@Qf㿈/ fϮ\c@' @9@b@@ b@P㿐/ fc'L'P'T'X' L' b@P㿀/ fLc@'  ? ? <@ b@P# ##㿐/ e@q? y? "`  ?b a ?ޗ  ޔޑ `F b2ހ`(( "* * "*  `9* #"*  c 㿐/ eHb 㿐b/ e  @ 㿐/ ebb@V1# $ @ ea@(@${ @ eaL@(@㿐/ ec& (``@! 2  & (``  㿈/ ec '  '''  @ 8@? b@O / ec @' \`(``  @@ u@ @8 `" @(``" @ @8 " $'$T'c''c'''@ ''0'?@'ԅ8''''''''``?? #\@    @.1``? `h@  @  Ȑ@v@0b@O'@$@@_  '@_  $@@N@(@N(@Yΰ א0/ dI4c ' " (``  @ r@> @8 `" @(``" @1 @8 䀦" 4 T''c''cx'@' '.'?@'ԅ8''''''``?? #\@  ``@-``? `h@K  @䰒 " @v@0b@Nh'@@^i   '@M@@( 㿐@  @` @`㿐@  @` @`  $`#@y@㿐@  @` $`#@y@$@ @ ca@(@㿐6`H @հ  "㿐 @X  㿐" $@` 0@X @`  @X @`@X $`?   "   " @X @X @X ͐@Ƞ@"㿐 $`Xߐ @[  " ("  2 H $ P` & L@M㿐 @    @X]@W&  ?" @[&  " &  "& @XJ&  / bc@' ;`P $`p`L`!@Ж .<@9(  `  @ '@  "@&`  @ 0`ƶ?@ @ 2&`@ "b@M `P&`8 (`>`0 8``.&`<`Q(``#?`P @@ `@`6 0 @` 0@ 24@ 282&@  / bnc@'  $` 4pJ? "`8@"@"@ t"`0@? "x|`4ڵݰlj0ނb@L? ː0ם㿐 / a"㰠@$   @  `  @\  @ ! .@  ` ( @=c$  " $  "$ @W2$ $ p/ a@ ̀`" $ $`͂`'䀠?`? /@ [ o  $ ''$(`8``/@ " @  /(`'@c@ '@ l @  @: 7 $` 2 ` `(`8``." ` `N`  ` (̒`$ @$  `$ $܀``" $  4 D$ $ 쀠`"'' @ 2 $@"+ $  P"  @  2@`P" @ ` @`P $`" @'(@`2 @`2 $` `󀦠 `"쀦$< `?(` `@ `?/׀ `  ''3'"d $䀠"  $ `  2Z $ $` P  ($ @ P@ ِ4 D`$`$  D(`0``$ (0``T쀠`T'S @  "   $` ' $ @ @$  `%$ $@U@3 5D $@& $@ ' ?"` P  $ 4 D4 D(``?`@ @ې `7` 2 `@ @ 5D $& $@ '"$  _?4 D" F׀"F@ %F'`@ 5F'@ݐ $  ''~/ j'䀈` '@ t@Uu0ج     5D $& $'5D'b?@ `2' @ O5D'x%㿐/ _@` @ @ > " @ 7" $  D(`0`` 2` "   O@  @`  (`8``/ $` $  $ @$ $b@ גѐ$ 4   㿐    @v *  㿐/ _t 2$Q  H6 H(0``J D(0``f0  @T @`"$ H(`0``"`"Ր `$` P(`8``/ /@* (@ $  " ?c$$$\  $$ (`0``( 0?6 D* 2  $`b@ &  F`6 F`"  F$@" 8 " F(`0``  r$ 6 D ?6 D`@T5`@`$(@`@2@`F$`` @4`D$`2 (S 2$ ( P& $@@M /  e @@`& ( 8& & $ $>? 6A$(`0``L`$`` {` ` ?6 D* 2  "$ "6 H` b@ N&  F`6 F 6 H@  F`& 6 F Ć` 2ø \ Q(``" 2x``bߔ? "n`$$@$$ "b`$@$$ @S|@ v"$@ p & 6 D 6 H@ g & 6 D@ _r` @ Z"㿐/ ]t @ O  " (@Vw `$ $ $`$ $T$u$Ԑ jb _?$`@ `  ;*&` `,@`>? P`9&`&`@&` $Ĕ 6`D* 2  ܀ 6`D6&`%  `ئ-d $"  0`D $#@Rې0@  "@RҐ@R @Rͪ ܐWҤb@ $  $`$ $㿐/ ]c`? @R&` (@R¬@- ( ?@R&` (@-`@-@R“#/ \c@' p p<@@@ ]  "@   @W 0  @LА?(`(@@Ws&  & && & & (& & & & $b@G`@R5 0֝㿐 _ ? `    Ֆ  < < K @  "㿐( ? 㿀@ '6''/ \Ѐ o 䀠`k`l6`<`5`(' W `̀`&$x%$@  `"%`$E () %$ @8  `<$ @,@(`? *’C-$ ` Ӓ@2 @ &@&$$@@ `"@` @.@(`?@ $Բ$ 5 ` 2 ``$%%@ o 쀥`0$$#@]A )( %2M`F`@%$@C (,? /`  @,@,` ̠#@ "? #@!  %p Ȑ: @(,@?` 6`/ '耢  $ | $$ `   9 6 "? 0` ! %2 !  ?ŀ !  ٢@u 6on "? .    & m &he ޢz &W &ߢ]㿐&@ ) (`0`# ` @&   2     @&  &   ?  " @ "? > &@ 㿐/ Zc@' ``@* (@@ @* (b@D$1 @ Z`@(@㿈 #\#`  㿐@/ Y㘀`0`" @z 2 $8` Ѐ`      ?@v# P/ Yծ'' '@ڒ B b @!̄ 'Ȉ )(``(`8``| `:'Ȁ b(@ b@ c@ :  X`& Xc@?"c& (@c & 0@c& ,@c& 4Ȓ@_  bZ6 c@ϔ?" 0c& 86 p@Ô?" 4c & <@?c$& @?c(&  @cc, '@[c0 @Tc4 @Mc8Д @F  6 r a ` 4 $`(8``q?/////@i?48`$4 ̒@^$@X? ^̒@M?U` , ̒@Ŕ , `(8``qŢc<, 8 6 @̠ 0/@& \? $@ (8``5/@`? $@ (8``5 aW& @M& 4, @  ~) , @ z?@ v, ,  8 ,̒@͔? 6 c@@Bp`P@0 p`P@0 㿐/ WcD 㿐/ W㬃+ 8`` `:  + 8```: @+`(`;9 (%: +`;(`9 􀠠Ճ+ 9 `@݀:`9 @˃+  (`8``@:+`9 ``:+  @(``"  8(`8` (` (`8``|`:`"  ? (`8```:?#`| ۆ  㿐 #{? * (8``0&  1 @(Ѓ8` Ѓ(8`````ɐ &   (8``x`Xհ   Ѱ 㿐 =;? @Qɐ d + d@(8``:`2*@*@` @@P/  &?``"@@P d  d۲`? @Lj?㿐/ V㤐 = ?@Q d  X`% d@(8``:``^*@`` @@O z &?`\"`*@``2@"@@OՒ d dך d`(8``:ـ`"*@`*@`(8`:͈`"*@Ђ```@(`8`/Ѐ7) `@Ѓ(`8``/`7в`) *@```2 *@`(`@ *@` *@` *@` *@` *@` :*@` *@`? @Kİ?㿐/ VH cH @wj&cLPcT!  㿐/ V, cX @Kc\&  @c\ @P$@cX  ?@cP @@* 8/ Uc'@' \''X'Ȳ` ?` cX ? @P~$ ? c'`cd''D''؄d ''  @% 'Ԥ (8`` `,@8  $@u} Ф @(8`` @( ,@ (`8``\,@ (`8``Һ``#ϐޒ ˀȀ`X (`8``: ` @(`8``:2` `,`@ ,`Xch' ''b = k (`8```: ,?#\D " 耦? ? :(`8```: '!'(`8``: :( '%$!@$ @@@N, $@'@$ '@@m@i@Jo@?$ @@N A$DԀ`@v̒'@@ Ѐ @@ @ @h (`0``Ԁ`\ ,@ @J* ڰ?ذ?@J ԀJ@? "@$#+@'   K '@'` @ ?- +(`8``i`܄''@s   '@u @s,@u@̰? "@I|?` @?,? c\@@N$ @@>f@'Ԃdպ` cl@>Ԁ`D@IT@IԀ/@I@? C"@M5 .8@I?9`?@I@  @N "*?@>'`@   @ @u0ѐ@Id?@u0C@I[0?x/ SlcLX`c\' @@cH@"@ IcPC  cp@t@=א@@@!.(w@ #\   @@!ϖ @@@ c\'@ @@I @" @N$ \c؄d$'(@ @(8`` $`, @d @@Lu =$@ @s)$ " (8`` `((, ?(`8``\!?̠@3@ (`0```2?@tR@%@% +@r %@?, (`8`` `#$@@8 @!?\$'@I @A@т@ 0%0p_ ct@=@d@rw?%@ % 0P㿐㿈/ Rܮ\c#\'  њ  cx@=`㿐/ Rc@` (`0``촐 @(`0``첐$ @ RbX@(@㿐/ Rc<@   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  㿐/ Qxc' ' `v c|@ 6@  `?}$ hՐ7(`0`c` 2Ȑɰ  H$ H & & & , H , I 4 J4 X$ L $ h@| A5" @ @H l %?" h" \  \  ? `@$%@ &@ 2  @El0|{ c@倥 @Eb #R@ ,#"@0"`4"`㿐  T@ T#` `` # 9 ! 9 #  " #" $" ("   : #:㿐  `"  X?" X$ X``@ T@E @EP/ Oc ' @J#  p@J } (``5`&b $`    $@$` $`$$`($`$`$`@C`T '`8  '''@`'@_ 2`X``@D@D 0*@[J * `|6 ``X$`P``"@c@c$@^$ .$ Q c  @a-& %    $`c @ `4 `$$ `4 W$$ `4 N$$ ?0c @ `4 8$ $ c@9\@D2@D/ 0@/ N&c' @' 'H\`'''``T`8$`<``{  `d''`,H  ''$`T$`,@%@`X`P`  d`X` ] @ Uƀ P@ ZV `N  $`T@``'''''@C +@^ `, "@@ 32@@^`, *@ @ 2$`T`,2 @ `,` $`,@ `, $`,̰   $`,c@8@ `   $`,$`0Ԁ`Ԃ @^$`T`, `,`Ԃ $`,㿐$ I?@@? & 0& ,h/ M6c' 2  { ' #7  *(@@ +`;ЬȺb@   -К@,Q   @,I#,`(@@+`  ?& ,@2?&  6 & 0& ,?(`0`` `" "` & 0& ,? "? & 0& ,c@7 @#@bԞ@㿐@ @`` @`@_`㿐 @a’ ` @a #@a@ @#@b@#@a@|TTt㿐/ L㘈  )   LcԆ%         㿐/ Lc ' @. ?c@@'  ?c8?@. @'c@`. @''c@73$O @ Lb$@(@$$ @ La@(@㿐/ Lc@`Hc`(c@. .  (*/ "@@A@`(`(`"* @F$$ @ $@ c@ $@@. .  (:$$   @є  $@0ށ㿐/ L@?  `$㿐/ K?  `$  `?#`?@㿐/ Kή㈄?  `$ 㿐/ K@?  `$㿐/ K?  `$㿐/ KⰄ?  `$㿐/ Kh?  `$(`8``㿐/ Kr?  `$㿐/ K`Є?  `$㿐/ KNሄ?  `$㿐/ K<@?  `$D #@  #?# #㿐/ K଀(``(``2@((```(x/ K,c' @ c @' ''؂ '''耡 +'c  X`? X@@``    @ߒ@`ې Xc͐ X c@5]$ @ Jb̂@(@$B @ Jb@(@㿐/ JTc?@ c@??@  #c@?@  `  㿐/ Jc?'  \c@ Uc H@ 7%ʑH'''c𑢉H@L 7-ʑH' + H''ݕc@Hc𑢉H@L  H'Ԅ?Ӳ?c@4$` @ Ic@(@㿐 @B@I 2 `@ `  @j&㿐/ I`ג  㿐 @j&@?"  & @?& & & 㿐/ Idc㿈/ I<c@' `@h "?쀢" @ (`8``#`  @@hp ? (`8`` "z@[ # "'`@Br` @3y&&`,@@+ "@ *(`8`` I ` F@ ,@`@- @"@@(``2@ "@& ` \ & `E$"  `?*`@@=$@ "3$*  ".$ (`8``'` 〠`    (`8`` `   (`8`` `  '`@hj S&@n?` @3t$h @$n  `(`&` &`$&  &`@Aa  &`-?(I"㿐/ H`  㿐@/ H`  @` @&` `@h` &@@&` 㿐/ HcށHc;j"&.`" "  0va" " " " #0/ Hxc'@' ' @@2Ԃ@@ (`0`؄@(0Ȃ@@(`0`''@@(`(0`0̆@@@(`0`@'(0'@(0'd ' (0@ 'D@@(`0`@@' ''t(` 0` ('T0' d DT@@(`0`'  (0 '0@@ (`0`' (0'0t@ @ @(`(0`0@'Td@@(`0`'Ĕ D (0Ĉd'' @ @(`0`'h0D   (0@'H@@ (`0`thЄ@(0'HT'Ԃ @@(`0` t'  T(0 'x0@  @ (`0`'X  (0@'$hx@@ (`0`HX0@(0'$'4 @@(`0`Ĉ' 4 (0 'x@ Ă@ (`0`'  (0@hX'Ȃ@@ (`0`'$H@(0h' 4@@(`0`ԈH'l  (0 'Llx@ Ԃ@ (`0`'  (0L@X@@ (`0`$x''@(0'|X @@(`0`4$'\ l| (0 '(\L@ 4@ (`0`'  (0(@@@ (`0`'8@(08'' @@(`0`' "|Ȃ @@(`0`'"\l @ @(`0`'! ( L @ @(`0`'! l @ @ (`0`'p 8L @ @ (`0`'P @ @ (`0`@' `p|@@ (`0`'#`P@  \ @(@'`(`0`'# 8(̄ ((',| @ @(`0`'# $`0@'`# (,0@',# ,p     @@(`0`'# 0P`,   ̂@  @ '+`'8@'@) (`''<(' ' !@'(0@@ @ 3`  @@@@ @+(30 @ @,`+4`3 @@  , ,`4 4`@@ @@  ,, 44  @@  ,,44@@@@ @- ,5 4 @@ @-`- 5`5  @@ @@ @.-`65`@@ @@ @@7`@ @/`@.6@  @@ .`6`/`@7` @@* 2 @.`6`@ @@ +32 @*   @@ , 4 3+@@ @ @@ * 2 4 , @@@ @@ *22 *  @ @  +32* @@  -53+@@7  / .6d-5@@ @@  z@#Ԃ/ @ 7 @@ @+ 3 D.@6  @ *2@3 + @  @ , 4 2*В@ @*`2`4 , @@@@ +32`*`t@ @* 2 T3+@  @*`2`2 *  @@ @ +32`*`@  @,`4`3+@0@@ @* 2 4`,`@ @, 4 2 * @@ @(0@4 , @  @+(30Ġ@@ @, 4 3+@@ @ @* 2 4 ,   @+3h2 * @  @H*`2`3+@  @ , 4 @2`*`@ + @3 @4 *, 2 @ + @3 (@#܂ @  @@, 4 2*x@@ @2*X4 , @ @  @@@+*32$@ @ @4 , 3+ @  @ @* 2 4 , @4@ @ @3+2 *  @ @ @*`2`3+@@ @ @ @2 @* @2`*` @ @ @+32 * Ȓ@ @ @2`*`3+@ @ @ @ @ @, 4 2`*`@ @ @2 * l4 , @  @@@L+32 @@*   @ @4 , 3+ @  @ @+`3`4 , @ؔ@@ @ @ @2*3`+` @ @ @4 @, @|2* @ @@4`,`@\4 ,  @ @@ @@3+,`4`@  @ @, 4 @3+ 2@!ւ@ @ @8,`4`4 , @  @* 2 @4`,`@  @+32 * @  @*`2` 3+@@ @@ * 2 ̃2`*`@ @, 4 2 * @  @*`2`@4 , @  @ +3p2`*`@  @, 4 P3+@@ @@* 2 4 , @ @+3܃2 * @  @*`2`@3+@  @ * 2 2`*`@  @, 4 `2 * @@ @@*`2`4 , ,@ @ +32`*`@  @@, 4 3@<+0 @'<3` +`4 , 3  @  ('+`03`@3 @ @ @@') 1 @& @ @( 0#@ @ !&! <    &@+5@ @ @@+.`? @`@`? @ @&@+㿈/ @ c ' *8`(` 2 80*@ )  8`  `     `$@+B㿐 ?@8(0)   ?@ `$# @ @b@(@$< @ @a؂@(@|hT@,d4㿐/ ?̀ `` ` () &? ?c%.`8``?C`@.& .`8``\@.. .`8``-4`^2 & & ``l(`&?&Ђ``ư (`@. Ђ``(a& &@.  @a%`. &  & &  .&  .& .& . & .&  .&  .&  .&  .&  .&  .& ?. &  .&  (`@.& 㿐/ ?Ac'' @(`8``+`/ "@ +  "@,? $  @ (`8``ٲ`   d?$, "@,`(@)㿈/ >c'' (@(`8` %`ٖ "@/ & @4? 0(@.@(`8` ߲`   @(.&:ϴ.˴ "@Ԁ@(..`,@)/$c @ >b@(@ (#$  @ >aȂ@(@%= @ >a@(@$U @ >aP@(@   #@@  #`?*@@㿈/ >c' cp@O 0@   @" @3 0  0`" a a & (`8` N&  3\; @쀦J@8 *`*`D 2(" & 6 & ;&  "9&  & & ` ?6? C & 6 & & & ͐0@31  3\׿0` `2@G@& `װ0Ǣ?oâ?@88`0@(.㿐/ =(` 8`@"(`8``?&$h @ =a@(@P/ =lc`' #,`4 0` @(  ` @ @(.`@Y @  @7֐ ڲ`8@'/ =®c @' +*Ŕ@ `<@'@/ =c' +p 5 _e &gO +$ @" 0* 4@>g뀧 ?R:"b 8 ؔ d8Ԗ$ @! 4Ր 1"0 `8̺@ 0ဧ 0p? `@@'"  00    #n@" $# $% @ <a@(@㿐/ <Tc@' `@`H "@ @2 B@ 2@`;?@ 2"+$@`@]K @{ ?`" @1?0܂`D@ @1~`D@ { `L@&`D@ o0Ýx/ ;c'@' (`8``r'`wR  "c (`8`` '䀠`e(``@6c '` @@ wc?_ Ccܠ(`8``w`?,`@@^ ?@`?(`? ` `u`H !(`8``e,`? ??  `H &c (`8` @`" @! 0c24˰ @0a(`8``r`?*`? :?`TX`\@ lG `D@ 0i`P@%`D@ `D@ `H `!@ u`D@ pY ?֔ ?  ?20$㿐/ :lc#?h/ :8c @' (`` "c?@ @r / ''̒ ?)  :c|%@ `  *`2`#``d` $ $@-*`hǔ '`lp`t @2d)''  '''' p `x @[    (``"@ܤv "@ /@( @ܢ@,{``l0e`|@~V @ #`'쀠`  @r"'̂``@$j< H"`㿐/ 9c%㿐/ 9c'P'T'XP' ''L   '`(``#`"L'"@@'` "` @`'  `@$ "?㿐/ 9Ȯc'P'T'XP' ''L    '`(``#`$L'"@@"`` ' @` ' ' `@# "?㿐/ 9}pc'P'T'XP' ''L   '`(``#`%L'"@@'` "` @`' cu `@#}O "?㿐/ 88`+ c@ 0`a 2@`"@ a@`ҵ 0`瀠 &ز? #"@㿐/ 8Dc'H'L'P'T'X' H XG.' `@#㿐/ 8ᬐ@KK  `@N @J` @J` `@`` @ @ 㿐    @  㿐/ 8@@J’  ?@`  @8@ "@   @@`  @@-w@&@``… @2&@ @ Ӷ ` ఔ @{ @` "2 J "2 J   "2 J  J 4444\444444444㿐/ 7᐀ `. `㿐/ 7H`4@  *`@f! ,`,`ϐ @#``@P! ,`,``㿐/ 7Xc@“`㿐/ 7$c @I㿈/ 6 c@' @!`!@ ? !` @ @ n @耡 )  ` 7a%`@ߒ?`@o7! 0`@ɒ?9@&$`*`@?$@"`@?À`@?瀤 ˂ `@!㿐/ 6h\c@`㿀/ 6(c@' @K'c ''''`0`?@:`6@   #`0`@ p/ 6(c' (``#ذn @"ْ@&`&  $@$`$@: l @'`'Ԃ ''֤ܰЂ`@ m`   @8  #` 0@(( #,  ( 0   @`<  \#㿐  ` `?(`@    $ @   & & `  `"  !  #מ@ `@:!   #@@   ! ! #㿐   $ @@   $ $    $ 㿐 @`" ,  $  `"?& (& , 㿐` ( ,@ @4&@`& ( ֐ 쀦`  c/#`#㿐  D`2 $ P  L  @ `?(`&@  X T " @@ &#&@ X T& X &@ &&@ L P@& L& P &@  Hc2 \&@  4 H& D& P& L $& T& (& 0@& X& , &@ @4&@ T@&&@ < & T $ 6 X c& 4 & H $@-  H $ ("@& & (& <& $& ,㿐 @` ( , @ # @ (&@@& (  ( ,$ 怦4 ( @ ( @& (㿐/ 4Dc @' `  @   0& 4c& 0 `@㿐  0`   4`& 0Ɛ 2 0  4` , (@`?㿐/ 4 c@'  @`" 0`$ 4ǐ    4`$ 0 2 0 @ ` $ 4Д " ($ 0  , `$ 0 `@f㿐 " 0`  4`` 󀦠 & @ 0 @$ 0 㿐/ 3B\ c' 0`(, @`8 °  &@   &@0(` 0 (`@ 㿐      @  @$ @@ $  洦 㿐 @( @( $@(㿐/ 3߮@-ِ ` 1@-$ 8 3$ @-$ < 7$ $ `& & $ $   H$$ $ $ ($ X$ $ $ ,$ 0$ D$ P$ @$ T$ $ 4$ L` @v ` @v @(d` @v  @(W@(U㿐   z ?`" `"  (? @20 , "@㿐 ߐ? "   @  $   " 0  ( ,  $ $ ($ 0 㿐/ 2  c. (`8`㿐 (/ 2̀`Rc@C@ (`0`@"- ( P`` 0 @@9 f`"@ <8`@f@`"@`"@  @@@8F`K   @ ?   (`˃0`302 @ߕ?c "ʲ?㿐 ߆? W"` 0㿐/ 1 @Ք c  f6 "@ _"㿐/ 1|c@` 6 ސ 6 @܁/ 1`@' ` (c@2=@     ) 0`h dTc "7 (6 @  ƀ?ۀ 0   @""@& 0"  & &6 @{  `ٰ? "@@ !(`8` ɂ(up  p< @@Є$& L6   p* ]:   @Ex)  0`ǃ)   <0`8 8 @ @D@`2 L L  8   ƀ?  0&&    @""@&w 0" 6 @`"  0@ (`0`@"H  P`2 0`   8@D@ E3 @:h (֐! @@9 d`  <8`@d0`"]  P 0  ;```I  <;`@ d2( 0@`x@?  ƀ ?J  (`0`ʤ0,@ S @ $2n L@(k L$"& &   @""@% 0" ?6 @z  0`  @@@Ad 2U 0В  ƀ !  ) 0`2 @@R,   @& H&a@8! L 2 0ݤ? "<?0Ȇ :` #Z@㿐/ 0X(`8` (`8``@2? 㿐/ /c'L'P'T'X' L@' a@㿐/ /lca@ ` >y a   @s @&a @㿐/ /c'L'P'T'X' L>T' a@;$  @ /bD@(@###$ @ /a@(@/ /' (``Ӷ `'l (`8``/s@$ ဦ@U$@g#ς q`oPa'hp ?'d'`A @g / `$@#S@K@(w$`@ @(`8``/ #= /..(``ـ@Y Ӏh@R 4 ɐ-@@ /*  Ĩ" ?(`8``/" ( ..  (``` c@ wD ?"X @@gN$#d hp<(@@ m`f# ߄@((`8``/D -@@ /*  "@(`8``/ # /(@(`@g$#`$@fӴQ$@f͐ 5 3 @# a$@f ٰ  ". Ũ a @@($ } `۽lk"۸ >u"㿐  ` ۬  "@(֐$ $@?@# $ @ .`l@(@$  @ .`0@(@$| @ -c@(@㿐/ -c'L'P'T'X' L08' a$@v܁㿈/ -c(' @*L   )  -c@%c! @'@ ( ""3 (ca,@'㿐/ -􀦠$`2&@  "  `$`  `2 (8``-R`+ `?Q`0N`0>`X @K   @p  `$D    Ѐ` y `@`s@?` `7$@k`8Hk >@@< @ b ר   (` 8`"e `0 ` `?@K# ?@p# $@@ <   @ ŔE " "?  @4 "" ?#? `F2?&@  " "?  (`I8`(`8``x`X  (` 8` D #@]@ddddddd\ȁ㿐/ ,Lc' @H`@ k0` `(` ? H@ aD@ / ,Үa0c@' `' ,'؂b''% `-' (`8``0ƞ (`8`/94   ,@@ И  ' (`8`/94 @ ,  * * @@ Ј ' (`8`/ @(`8`@      `e`E  V    '` ?c\,`'H J?؀$@   ?c\؅( J?؂?# a48` ''' '' @~.@~,@~*@~(@~& " "(`@ ``<`N''`&@` ) ' '(``"' (`8``0> (`8``X`x '(`8``0"`ɀ`( ' ' @"' ' (`8``+`-    '(`8`Ѐ` 8'耣`0  '(`8``0π`5 В ' `(`8``/`9!  'Ѓ(`*8`*`/@`9! `*b% 2  `(`8`  (`8`   (`8` `(`8`'  (`8`   Ѐ` ܪ `@  ,@`@ ؄`,4`* * @@22@@%, $  @ @bАa8@Y$a8@1_ 4'` '''''@}3`  *@@} '@~  '    &#@ 6   @  < @  (@  (@@@@4`!$$@` @~ '@~E䰒  @|'䀤  @} r'䀤@~֒ k `@}ݒ c @}Ւ Z'@}u T' " @{ &U@0aL@  _uP()#H"2?8.?aT@  aX@ L'P' ,--' @'??@ @ؑJ?؀"%L@|!@|@|@|a\@ H?-?@t? a\@N؀`C`?aP@  :a\@ H~-     h l `N`i`I2'a`@/x "'ad@/m'耢  `' ''aahP@F`0   '(`8``0π`(0  $ aX@ ʑH'G؂c 8(@H?؃(?,' J(?؆ 9 $4 c?'K'al@H܄ba4@, `:``8`䀢@@/@{B@#(`@t $  `   c\؅-  J?ؔ   ?,??'@l' @؆J?؂@c׀?''؀ #܀` cat@ @z@z@z@z@z̀` ''ap@  ax@ 0al@dH    9 c\؅( ?؇9  3 @?j؂a<8@H`?؀ k 0`  $[܀4a' '|He ''''F'܂aH@nI'آ Ј  ``,, @@  '(`8` '#'~`n2<'a@- "3'(`8``(c?'''ܶ 'al@J, ~c @܀@ ؐ?@?@z@z@z @z @z `9T ? J?؀瀦`0܀`c@``@{#  '@yT ؀ $S'@y@yǐ@y@y@y؀\ * * @W@ \aD@c܀`2΀ @ Q$c\؅) % J(` J}?؂c @y0m?9$c\؅-   h?ؐ?ya|@H]?'9'+ @@8?0` k? (;c@)? @'܈@>'؂a@@.Ѐ  ','?c? ?'#'܄?(@' ?(@ 'd㿐/ &Ḉ 8)  &a%?c& & @& ""& &@& `&& &@3& `(?c&p/ &Ůc@' !a'''''Ԡ@"@ aa@㿐/ &c' ?0 `  ?()  8`8@     @(a@s㿐/ %$$`2&@4  "  `$` `2 (8``-C`+x `?d`0a`0>??@~ ?@~?    Ѐ` 7 `@`1@?` `7$@) @@{<   @ ݤ  (`8`@ "" ???Ƥ`` ``2&@ " "`0??`   (`8`(`8``x`Xꀠ )(`8`   #? 㿐/ %4?R`[c^`0 " ` `2` ? ` (0``2 `0`"9`06` `0@ A ``@&@`@^@t  @@`0&@ @`0, @&@(``&` @{ "O` `?@.Dc"`0`0`߀  6` @: `@2`&@@`&`8&`<`@"@`0  `B.`B&@ &``@$ „#`0 @`0$ `B`A`@((*#&@&`&`6` |㿐?c@ ``)@t?mrѿ  "㿈c/ $a'' `,' ,@@2@} #@] 2 @(`8``,!@,ц "? &a@k@90a @I     @A `逤0a@/ #dc' ` @(`8```$(``   p@ 5? " 2 `(`8``22 @p  0a@F㿐/ #p@@G@a0 $.` (9``?0`  .l.* @@"&.```0 `.(`@ 0`@` .(l (@@Ӑ ..  .. / #ac?@' ??؀<@(`8``$"`Т? "@@ (`8``2``ab@ H8 H `(`8``$`Ѐ` ڐ` Ѐ`  (`8``$@I?``Ȫ`@* @`??a\ ?X ?T3 `(`   <(8`@ ,k * @@> `(`  (`@ ,kג ?T* @#`@(`w r`(`m i(08`@?,X?c\@ @  `!?(@#l@@=,0` @ @S@O `@7Ơ ȤƦ @*$  ? cl@@   @ˈ +@0`0`++0`)!  `a @l_  ?#l`H@lG@@lD @lA  @l= 0@$  a@ 㿐/ "o<a =  㿀/ !]c@'   @kv  a@l` E @   K? "a@ q㿐/ !)$a Ô p/ !c' Д   ? Z 2? @k 0a@ 9/ !Dc`@' e ap Ò P[ dTXh (( @ (`#$r, :b`     ,   u` 4 ?@ 8`@ $    4 0a@ P/ !c@'  =  ?@ @)@&@3 Έ? " =@k+ 0a@ 㿐&0@@7@7``(`$@7`7`(`(`(,`( 1 `(`@1 1 (`(` (@  @7``(`@7`7`(`(``( 1 `(`@1 1 (`(` (@ @7``(`@7`7`(`(``( 1 `(`@1 1 (`(` (@ @7``(`@7`7`(`(``(  1 `(`@1 1 (`(` (@ $@7``(`@7`7`(`(``( (1 `(`@1 1 (`(` (@ ,@7``(`@7`7`(`(``( 01 `(`@1 1 (`(` (@ 4@7``(`@7`7`(`(``( 81 `(`@1 1 (`(` (@ <@7``(`@7`7`(`(``(D 1 `(`@@1 1 (`(` (@ &@@&㿐7@D$@@7``(`@7`7`(`(`(,`( <1 `(`@1 1 (`(` (@ 8@7``(`@7`7`(`(``( 41 `(`@1 1 (`(` (@ 0@7``(`@7`7`(`(``( ,1 `(`@1 1 (`(` (@ (@7``(`@7`7`(`(``( $1 `(`@1 1 (`(` (@  @7``(`@7`7`(`(``( 1 `(`@1 1 (`(` (@ @7``(`@7`7`(`(``( 1 `(`@1 1 (`(` (@ @7``(`@7`7`(`(``(  1 `(`@1 1 (`(` (@ @7``(`@7`7`(`(``( &01 `(`@1 1 (`(` (@ &@@&㿐/ a@eH*`2`  (* 0`@   @  `2#㿈/ ׮dc.&0' 76 Ք`@$( 07`H''$$ ,  ޔ`&(&0,  a@k㿈/  c/ &0' 77  @@$@(`0.7`H''0g@'`@'$$ ,  I@'B@'j'(' 0 ߃,  a@㿐.61㿐.6  `= `(0`@㿐.6  ` `(0`@㿈/ ߮c' 3 `@``````() +`+ (`(@ @  @ ''00.`.`.@.`1 1 0.`.`.`1 .` Բ` a@㿈/ \c' 3 `@``````() +`+ (`(@ @  @ ''00.`.`.@.`1 1 0.`.`.`1 .` Բ` a@5㿈/ K4c' =  @(2() +`+ (`(@ @  @ ''[.00...0.0.. .ɴ a@㿈/ c' <(((`@@@'(`(('o. .0`....0`..@(2ȴ(`() '(((`@@@'5 ..0`....0`..@(2 a@U  #@@㿐/ ⌀$ `2&@ " `$` `2 (8``-D`+ `?v`0s`0 f@h n $   c - Ѐ` F `@`@@?` `7$@8 w " ޤ  (`8`w  ͤȟ "" ?¤Ȕ "" ?`2&@!#@"  `0`  (`y8`(`8``x`X  (`t8`㿐/ ㄄  @`@ `@ $ @ c @(@$& @ b@(@㿐/ a @b$@ @b$@ / ޮ0a' @b& @b @9$ c`(`8`p? @;b a@0@ $ @] `@ & C`$$@n 2 3$ `  (`8`#`/8`#ꀠ`$`",  "(`(8``#`,$  (Uƚ_ < @Uƚ1 (@ Uƚ_(@@<@T UUƚ@?UƚA UƚS0UƚDZUƚDZ0aAUƚ&CUƚ&CUƚ&C)G$AUƚ&CUƚ&CUƚ&C*[hAUƚ̊Uƚa=Uƚ+WlAUƚ̊Uƚ Uƚ ,PUƚ0IUƚތUƚތx4~!Uƚ6'UUƚ6'UUƚ6'Ul+!Uƚ6'UUƚ6'UUƚ6'Ue!Uƚ˩Uƚ˩UƚDZm5!Uƚ˩Uƚ˩Uƚ?P j,!Uƚ˩Uƚ˩Uƚ˩|G!Uƚ˩Uƚ˩Uƚ˩  !Uƚ˩Uƚ˩Uƚ˩h$ !UƚgVUƚgVUƚgVb!UƚgVUƚgVUƚgVOK!UƚgVUƚgVUƚ!:Kzi!UƚgVUƚgVUƚgV4u!UƚgVUƚgVUƚgV {!Uƚ?Uƚ?Uƚ?F(!Uƚ?Uƚ?Uƚ?iOi!Uƚ?Uƚ?Uƚ?|$0!Uƚ?Uƚ?Uƚ+\L/ˁ!Uƚ?Uƚ?Uƚ?w!Uƚz"Uƚz"Uƚz"wf!Uƚz"Uƚz"Uƚz"wD!Uƚz"Uƚz"Uƚz"w.aUƚz"Uƚz"Uƚ+\L//aUƚz"Uƚz"Uƚ+\L/{aUƚ1Uƚ1Uƚ+-maUƚ1Uƚ1Uƚ+U#!Uƚ1Uƚ1Uƚ+6r !Uƚ1Uƚ1Uƚ+68uW!Uƚ1Uƚ1Uƚ+64uB!UƚɾUƚɾUƚ+6q@paUƚɾUƚɾUƚ+hQR!UƚɾUƚɾUƚ+BeaUƚɾUƚɾUƚ+-!UƚɾUƚɾUƚ+`aUƚ bEUƚ bEUƚ+!Uƚ bEUƚ bEUƚ+LFaUƚ bEUƚ bEUƚ+Ej!Uƚ bEUƚ bEUƚ+n «aUƚ bEUƚ bEUƚ+Tښ!Uƚ bEUƚ bEUƚ+-6aUƚ wUƚ wUƚ+;.!Uƚ wUƚ wUƚ+PvyaUƚ wUƚ wUƚ+`Q!Uƚ wUƚ wUƚ+/2aUƚ wUƚ wUƚ+&n!Uƚ {Uƚ {Uƚ+QaUƚ {Uƚ {Uƚ+8!!Uƚ {Uƚ {Uƚ+UtaUƚ {Uƚ {Uƚ+ ?!Uƚ {Uƚ {Uƚ+  aUƚ ,Uƚ ,Uƚ+ ݉!Uƚ İ%Uƚ İ%Uƚ+ EaUƚ İ%Uƚ İ%Uƚ+ g!Uƚ İ%Uƚ İ%Uƚ+ |uaUƚ İ%Uƚ İ%Uƚ+ /!Uƚ ]=Uƚ ]=Uƚ+ =aUƚ ]=Uƚ ]=Uƚ+ 7!Uƚ ]=Uƚ ]=Uƚ+ [aaUƚ ]=Uƚ ]=Uƚ+9q; AO@@`6@`L  ) ` 6 @?#` *?( !@:Ă@b8   '''@^'@aO:@(`  @& b4@P/ lb<@'  '' ??7''?? ''@a9  @"В '''` xĒ F[  """"#" #㿐/ Lc'P'T'X' P@[' b@x/ ݮc<@' "` bDbH ##ɒ`  8@` @ "B#'`bP(@^''@8(8 @@   ƀ88` @$@$@  `bT@^ 88` @$@$@ `` `  :,` ,) .bX\'$ $.? ) ".8`%(8``mg`%쀤  逤 . .?)  .@s88` @$" 4 ? @?* ?(`8`` "?@` %@I b` '''' J @s{?8@`5bd G *%N bh  ''''Jy|4@N@^ 88` 6?$y'blwbp@]88` @$$@>c$&`4 @]ݒт8'bLO㿐 `&`㿐/ `bt@x 㿐/ $bx@  \ >. `?@@KȐ=`)    \`  @+.?ْ  0 /?\w `  -.@T ڲ ײ @@] @K "@>㿈c/ |#` ! #\  㿈/ \cc#\#` w w ""㿐?   -@f ] "?㿐?g  )3`@  8`) )  @@ @ @  `@ 0@ 8`) )  @ @ `6 ?@ 0@ 8`) )  @@@ +  0@8`) )  @@ @ `  0@@ 8`) )  @  `6 ? 0@@ 8`) )  @ @ "@\@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@d/ c@' E@?'Zp Ě   w#\w???c`?@ w??@   "" b㻐/ c ' ?(``2  @J\ / 0~G b``b@VK bb@p!  _b@J5 .@ݐ@  ``@` b  aIJ%(``8``"(`:`%/(`(`@(8```:(C?@(```@(`܃8`b@U b@U 2`@?``((`(в`(̆@`Ƅ) `(`@(`) `(:``@(``"` `(` `  (`8(`) ``(`() `w` (` p`  (`i8(e`2J Eb@Ue `b㿐/ t   (`8`@` /  c ' !'''@o`c` "''?''77(@ b: |  p d H < 0 (     \㿐 @Yڐ)\)\``&)X0/ $c' c@oC''t'b @ZY@o7b'@o/'b '''@o%''`''b @Z;@o'b ''Ē F yb"`  '@[b㿐/ bb!@oF "b  z 㿐`` / o@bj ` (`0`( b\?c0@6 ( (`0`0@`bF?㿐 / =(J  `&@& 8.`  @ ` @+` 1 (1  @ @.@ `?@ `@ @  `2  `"@ @ ` Ѳ ""@ @+` 1 (1  @ @ք@b  㿐/ b ,.bڒ  ?@ 6` (6`@ @@( @ @"`` @( @ @``` )8 㿈  / ă(`@:I c( (#\   ?t9? @mє `J  +`@@00 (@ @@(`! !   `@ +`*` 2"  & @& &  6` 6`(@ @ (`#@    &  b?  H/ 5c'   @$ $ $  bP$ (%bb '`р`ŀ`2$`F1 ?  ( Eʔ 1 "`(` Ă``<8(` $ ``׀`@W  $ ,#\   #?s`?@m  @m@(!g* @"& & #\   `sk?& ?  (` (`@ ` `D   ,&8&)$c @ms  {$  @$ $ $ $$ ($ $ $ $ $ $$ $ }$  z$  w$   $ $$ ($ p$  m$  j$  g$  d$ b$ $ $ ^$  [$  ((`aV$ (!S$ ( (0`O$ (@ 2N``2`0[y 2T`@Rb9 & c  ` ? "@m: c  0b 㿈/ b,b  ?c@@`c ?)8?c@@`t6 )Xl$)X\( ?  "@  (`@ ``@,a@@ j,` $ `7``. $! @ $!`" `@k ߁  ! @$! j`a"@kВ " @lR `m)X!@()XcH#\   ?r `f@lnb `Y?!@ :c+#\   ?q`A@lIb ̔ @k b@l4 #\b@l, #\c 㿐/  \?c@c  b5 (!!a )Xai\&)X4 +b  ! @&! #`(`?@(` 􀤠S*` 2&$c ( ? @(`a' `a`! @ (`c (!@ )X%()Xc `  ` a a!@&!(߀@ bi@k;   㿐/ Ybh @c"`  (@($l$c(g@dc38$`" z`~`L4 `?@2  ( 4  (@@ (0w0 (`0` "  !    (``2   `2  @j  ِ (`` `$ ` $     `[?c@ `2 $$@i ߒn@i ``/?+)XZ\`(`@i@T&)X io)X?&)X\ (``. D( $ ` $ c$r$?c@ @j=" "c(`  (`0``{  D(`0`@(`фB)Xc H z 8)Xc,=㿐/ 6  ,c'bc0@*!b@&@y@&@@j "@jbc0@!`c4 @j㿈/ b;$?8 @ c@ ? $``"$$c`"k$` @ `@,@"gib `   iXi\`D$iX(@ Ӫ@ @b| i| *`(`0`` 0iXi\$iX (`0` 6?6(`@``( ?6 6(`@``( ( (```ރ6 82``"u$$$"@hs Ё@4i|` 3`4 (``2     @ `( 0"8`(`@ /(@ `_ \Z@hF  0``` 8``iX^.ߐZiX S Ք  " (`0`"   @h  @h" " c(Œ iXPi|$ @h Ё@g    ?  `0@`0`(``!- `  o@    @@gג @ Y$ F " 4 $ 4 4 4 @hR t (`0`   3`?(`@0`` ( ` `(@@0 3`@$@ `%@$   @g $$(@04 $ 4 4 4 c86! #\   ?mΖ?Q ``" `%" p``$` `$``$  a㿐/  `cRbc<@~!b $0"@a@`$8 @1?c@I@@nc@ ? `$`O``2`$$ @fޒ @gM  "$`"` @"& `cs 3 "cDi ?@gy〦`  s Բ  b@ @g#" "`c(F `8@8? " ?  $ &@   z "b b&@㿐/  `c@`<bcHU!?c @  ?PY@7b,$b  @$ "  "@f`c  "@f急  @` ` i  "i ?0ӂc 0@f 㿀/ pQc@`vbcL!b@ %@  ?$8@@[cQ`@@ $@@\$ !4 @```@@ %@@fL  `-"~ ? `* Ő@@%@ " "@f# ,˰  "c  "؀fo0`?@ @a$@' (`kb' (@``a 8(aF*` a$a! @&!$a`nc  Q$   c$ u@R$@dԒ M@O   8'kW$:$`"$@ $N" @dG$#\  9? @e"?D쀤@) ݐ "bJ " @e  $$ @e$ "c(2 `$  @dm$a iac( $#\   j?㿐/  \̨c@`*bcP6!b*$  @$ "  "@d`cВ  "@d怦 '  㿐@ 62 P    ,㿐 / , (`` ` ? 8 㿐 `8``>`@"  (``` ? @8  @0 @W<@Wh `0㿐  (```` 8  6  (&    @WB     * @W   㿈/ \c' \@W~ @ @ ''쀢` 5``  8 2`U R @O` M `t @ @ (`@ P {`@$C`"@W'``2T$`?`?` ` @ `? 2>``2 >`(`@` ,@ #   x$  P&@ N @$@V `$&` 'A$ ""$` @W   $$` P $ װ `  @ 5@ (`@ ؐ   ݠ `(`@@U` ``@   o'(`@`0] @0`X`a c`  `/ cTc@' ''`' 'c''''ܚ% `-' (`8``0  '(`8`/P94N   ,@@ И  ' (`8`/94 @ ,  * * @@ Ј ' (`8`/ @(`8`@ &     `e`E@  `ۂ 2W؀`2؀`N`i`Ich@ < |cl@ 1'܀  ܈`'܂ ''` *`8 @0`(`@`0'`@4' ""؃(`@  ' '(``2e ؂ '''` 耢@ @U?c @@  a'' 3'܂@ @܈ ' (`8``+ `-     ''  '(`8`Ѐ` 8'܀`0 ܄ '(`8``0π`O ܔВ ' `(`8``/`9!  'Ѓ(`*8`*`/@`9! `b 2( '` '  ' ''`?'  ` ', ?c\, 'H ct@HJ?Ȁ 5``^$@ V) cX'ԃ+`f@SԂ 5 @c\ȅ(` J`5 ?Ș #\e - 耠`%  (`8``X`x '(`8``0`] @v؀ &'耢 ''$@@   ?c\ȅ( J?Ȃ?8` Ȕ@T䀢 '!  '@''` 4m''?'c\@H ' ''|  'x't'p'l@T ` *c@T `  ؐ `` *V @U଒ `D|    ,"@x$@@ @@#@@ @@ @@@4` $@$ @Uؒ "e @U. "` @S$@`@T֐ "T @U "L @Tƒ "D  @T "< @T^ "6 `$o @R$ `I &u 2G ``  8(``` :c     :Z" '耧4`d %` ' (`@` @R{$ `' !I'@-cx@   .   't '耤   ! ' '|'??'p@Sul  ` @T%   (`@@R+`@S '`"  ?@T  '@R'@R'@ ''@R@R@ @ @R@R@R@R `(`8`  (`8`  = (`8`27 `(`8`'  (`e8`   Ѐ`  ܖ`f Y ,@`@ N``,4`* * @@ʒ *'  @(```''  *   @QD ?F' ' F'ް @@^u $  @^m @7c\@^c$`2 ' @'耧 `  `?   X `V " P''`2䠧  @S ' '@Q @Q@Q@Q@Q: ``9`2`@Q'   8`(`@@ ' ? 8  " @0  '  c @' J  ?  'c@ vH`' ?``2?c@  0' @'?T     c   cȈ?@  'Ȃ@ J0` |?Ț c@'Ȁ 0 Ȃc 9 @H `?b `0   '(`8``0π`(ܢ  H ? 'b  !`'$@R$   @PU  '@؆ @''`/c@ Jc@̑!  @'聨 c|@؄ `h' ""  ِ `@O@O @M`ct@ҕH Y   ?c\ȅ( ?Ȃ?J 8`  c   cȈ?@  'Ȃ@ J0` |?Ț c@'Ȁ 0 Ȃc 9 @H `?@ `'''@ K cp3آ'@Qb '' @(', `@Oe@Ob @`D`|`,, @@  '(`8` Ј  X`ncd@ ܂`#@ '(`8``(Z'@<'S'؄ P `' ""zب  @Q '@''+ @$(' `  @ P4'耤 2_?c@ M? ? 6 @' '` * * @@ @?``'`00#\g  - @ (c\)  J#@(` J#\ G?Ȁ   0 !'耠md'c\ȅ+` #\  ?Ȁ  @@N1'Ԃ  @='"8"  6'@ CL +'@ C؂ !'!` '"  ?(@@  ! ؆ `  !''''?$؈ ' ` `㿐/ c``< 00& 0 @0` `2+ @`"   @ `@  `0   0"  ``?  @   ` `  `2  `連   $ (` Pp  && i `$` 8`` @Nw a ``   `@ `  @   "E" `(@      "$< @Ml$@, $@"@  $@ @OP %%`` 4 "@@ ` `K``K@M P ""     @< (`@ (2 @^`$@  " &` ```ʀ  && `+ `- "%4"  >  >@    +`+`@2 5 3 @& $ " `      O @2K @  2@9 "?:`(`@` (   `@'   @ʒ`$7`@M7  ""  w   s Ĭ @#@Y $ Y@Yy @2Q  @ "M  # "$@.`2$, = ! "9 @`22   $%@&` b& ""@ "&@@L.` @6 @_ `  0<`(`@` ( ! "` `S`ɀ @L ΂ $$  0`@  0`?`8`f@`,8` <`` 8`` @L &"     ? @$ ` (` @8 ``& ْ ע w0 /@ *@㿐/ @(``(`8``@8`Z$` @"@ & (`:``*`@` `"  @" @8"# :`@@) ``@: @`  ` #`) (@`0 (  )  #㿀/ c' @K{ !@Ku?`  ( `'(`@'@  ' (`@'c㿐 b    (` @K  " ` "   @4"  * :@MЀ 2   *:@MЀ " ܰ㿐 /  >`! (`(````@` 0@ @(@ ! @0!! 8``& & @! !@ !  㿐/ (c @' (` ``  `'`  @@  '@J&c㿐/ XcFc@& `& `& ` & `& `& `& $`. (`. )`. *`. +` . ,`!. -`". .`#. /`$. 0`%. 1`&. 2`'. 3`(. 4`)!. 5c cL&& !& 㿐/   @(`  (0&? &㿐/ `< `0`@`8`(`@`  `` ( (`8``0" `    @2Z $< ` 8` `   Y_` @ @: @`  ~ `  `  (8``0І `(`8``x``X2dž `` (Æ (`@$ ` ( ` $  $̔ F `"@@ ? 0@@&@)`?`* (`8``  `)&`` @(`8```) @4=@(`8``x``XL `` HE& 2 `Ղ`& [&㿐@/ `  .㿐/ c< cݔ cؕ 㿐 `/ <@I  K  $ `?(``` ` @00`@@@ 3`@ 0`3@`  @ 0 ` @(`@ ?@c0`@3`@0`@3@` 0`   "  ($   @IP     *` @I` 㿐/ c-`-c0$$@ " !@UC  Xac0@ $,㿐/ ήc@Mԁ㿐/ Į`<c,ސ`"  X (`` ,6  0&& & & & & D?6   0& & H"  !@T 2,.s  c$ #p$$ X& 0$ 0 " !@T͐  X!,c @ 㿈/ @Q0 !cAc 2#\`2@U&  "$ `@U`   ?Z? "  >$$ $$ $ $ @U c ` 0@U8㿐/ @Pc@`cc&%,`,` @ ` "=  @"9 ?<2 l&@`U #c@@ @`"0Q "@ @D    @ 2@`/@T  "$@`Ā@``2?@Tr @`@TĀ@`"@T@T@T @Tt$`@T@ 2@`2@ 2'v 2'㿈/ @P% K?cFc " #\  `@=#\   ?Y?7`5" = $`$@$ ($ ( @@ ` ` `@S  ?c  `@T.@T'@S  " ?"    " 㿐/ c@Kc@A `  `" @ ` 2 ta  " @ `"@ 2 @` "@ `"@ 2 @`@S@S t0`/ cc ' 7??Ȃ?' o!6 #\a b@! $c' ?''?' #\chD ܟ (`` @4 .  6 `4  `4 "@ `` c+( @#"@D"`H"`㿐  L@ L#㿐/ ᔀ`  .` b% >(> ;0;8 0>8> & &&&  ; ;( 㿐  `"  P?" PX P``@ L蝐蛁P/ lc '  \``x Zt@&l  (`` * `26 iVc%`%`   & & &??&?&>0&p&8&(> @;&hl 'L '''@'@ P@O&d&@.& ($@@ ?c܄ @6h `4 $$  0_= ?28X`4 $$ c܄ @6A `4 $ $ c  rĔ  '@ _  ?Д " &x??b`+#\/ ٮ'` c'H@' 8\'h'\'X'T'P@?M`0' 7H'D'l 'd'LȈ'H'@'<'8p@   Lآt'4'0',P$Ld`ll`0P@ #` @ X\  P@lL(8 H`h? DP'`@`'@T'|''d (Zƒ#  *(@@ +`W)< -  (@@G Ј"?@ ?/@!@ @   $@c@ #?- 'p   T ` `#"(  $D$@(`0`` u`۠ "`8 К@c,X@CЄ?`?/C a<@   @ `   i` (d(lt@2^(4 @0@ `,@@ Bd`w` @ 5d?'dǀ hȂ Ƃ [ X ИC?b@e "Gh@H F 'hT  $DC$@  ?$@ct:@`| `   $@$D` @N$L"@40 @#''$@ 㿐/ c` ``<` `(# # ##x/ ۮc@' < @ <` @ -`& &   && & & & ܒ (@@ @`& <``"Ր@ѐc  Ȑ  $ p㿐 / ਀``  "&@ (A)  &`&`&@ &@ &`@`" ` $`"  `" ` &` &@@`&` &`&@ &` &`&@ &@ &` &` &@ &` `Ԇ% &@ &@ &@ &@㿐 &`&` @ @d` @` @ޒ` @ٓ`㿐@P  @` `@ʒ`  @=`@`㿐/ ]0@  @,` ``c`  @d` #@@㿐@ ` !@m`㿐  @` " ` ````@ @p`  @k`㿐/ ؀` &c& & & & c& & & & # `   "  "@ `" # `   " @   `" #  "#   @@ @ " "  # @  @   # #㿐 @   @&   @& 㿐 @   @&   @& 㿐/ uc @' ` & @ ' (((( `& @@ `+㿐/ I c @' `  &  ////&@ `& @@ `㾀/ Tc@' `d!` G V  ''` ) .`(,.@ '$䰒 %%՘   $@耢  "@ ' '`  %  0f? ."`،'Ұ??@Lؒ  #}@㿐@  @` @` @` x/ c'  ܟ' `D #㿐/ ݮ`c' ``` @'@    @  &@`㿐/ c' ``` @'@    @  &@`㿐``* ``?` @㿐``* ``?` @㿐/ Gc' ``` @'@    @  &@` x㿐/ @c' ``` @'@    @  &@`$F㿐/ xc' ``` @(`8`'@    @  6@`(㿐/ c' ``` @(`0`'@    @  6@`,㿐/ {c' ``` @(`8`'@    @  6@`0֪㿐/ Gc' ``` @(`0`'@    @  6@`4v㿐/ 8@c(' 8''   .@ `8S㿐/ c@' '8   .@ `<2㿐/ Ϯ(c' ```@ @ '@    @  @ &@`@#@㿐/ 8  ` ```? @ ` 2   `   "  `  0ސ `0՝㿐/ T<  @  @ 2 㿈/ /c' `" ` `@'' @쀢 2&  @ $ 0@쀢   @       >@`0`DH㿈/ c' `" ` `@'' @쀢 2&  @ $ 0@쀢   @       >@`0`H㿐/ Xc@' `%@` ޒ 8 `" `0 @@ " @I1'ߞ &@  , &@  , `LԬ`P @-Ɣ ̐ ?#@㿐/ 7Ƞ@  `"`` ``O $ `p$ `T ఔ @-  $`#@㿐/ ⤀    @? &@ `O`+`$ .)  (E? ) #@,5 .\2` \)  )?2%?  `?(`@@ *?:?  &?@(`@@ * ?@ )   `  `@ `  "#" ?# "?㿐/ s??`$   `. (`8`x'T'Hø@ `  ` `2 `HT '쀣` ?@"l @B `"\T쀠@.! !.`sl`(  ."g\  "q`>Ql/@ @'|?ؠx`؂$,C @ @ .  \"`'e?ؠa`ت`8@T ?(`@@2 @`2`% T`H` 88/@0` @/``2$#? `"`.2Ϫ`m``܆% `8d@pT  N HH( @? (`8``6  .! ``` `Ѐ` `-_2 ` .(` ;` .ဠ.````Ѐ` ꀣ` # # (`8``*#@ (`8``.`#  #@ (`8`    8`\ `?(`8` ߀`] .  (`8`  #`. #|@ (`8``  ߀`](  # #  * #* 2    (`() #*`#* 2 *@2 2 *`*@2 *`*`#㿐/ ᬀ  `. (`8`㿐.`` . 0`C'H.`* , 6`2`0C<6``, 0`p/ c@' K J X`\a/(0``#@a`d@/7`h`l2 c 6@@/6`p2  a5@? c `t, 7@ h0*  2 !  ,`_2 *  5@!@ϐ#`x*  4 @*`K2`*  ``2@4  c`|`4@`5@06( J` @ >(` 0`@!?` 4@* *`2 Bg2`@(`0`a΃@` 75* *`2 2` @ * 0`0``  @b @"((`@  @(`@ X. 6 c@ < ;q* $  2*#`d`h`l`p`t``|``` 䀠@ # ໐($ ^` `Ю㿐   @.{㿐/ c' @@ !%   `" ``2 @D, 2`@, 4     @ 3  "`X#*@p/ c @'  '' '''' آ   @A7 ?$`"R&ީ   @A& ?` ?@ c?0 )     (`0` :)`2` ~`2 ` (`0`@@ ` `` (`0` ܞ`++ ΐ  @D@ڪ'  (`0` `2 ` x`2 ` %`,`%`4`@  # (@ %` @ @` `%` (`0`耢`%@'Ԩ + 0`"s*`0`@ `h  (`0`@   :`" ` `   :`"     g@   :6 .0`"x/ 0`@ `m%`%`%` (`0` @  8`" ` `2   8`"  @ ` ` 8 / "#%`@  6` پ䀧@82&%&˰ &ٱ 02@ @U `E @`  @C!آ@%`KѢ@%` Dʢ@%@ه 0`Ϋ@/㿐/ c/'  ` (`8`  @^ $" (`(`@2,  4  ,(`8`      .2 " "  ,.`.@.`.` `Np/ c '  "@ /"? 0''''(`:``:K'ܨ``?'ت    'Ա:` @@޲` ؀,",`@'@ (`@ː  :PD@(``Ԅ@ 4`--@   ̓(`* `@(`:``: 0   -4`-耥%` @ )(?@ܐ< x Ӷ@(``ͥ .k  f Ӏ^ 㿐@A  ݑ p/ pc'  EB'"@)@$@@i ; @(``2  J`4 .@c1* `ߐ   `, '@ ܀"`? ` &   ݠ Ҁ`"̀Ӡ (Ѡ Ϡ `"Š `㿐/ L$`2&@  "  `$`  `2 (8``-R`+ `?Q`0N`0>`X @   @%  `$D    Ѐ` y `@`s@?` `7$@k`8Hk >@@7< @ b ר   (` 8`"e `0 ` `?@d# ?@%c# $@@7` <   @ Ŕ " "?  @  "" ?#? `F2?&@  " "?  (`I8`(`8``x`X  (` 8` D 㿈/ tc'   &@:耦`負`?  `  ``㿐/ c@` (`0``{+ @(`0``{)㿐 H@   D)? $ H$ D 㿐/ c`W 0" `;? <@9 "N   &@  @&& 6 ` $@ 2! D & @& &@` Dzư  4@ " `-&@ z 0@9 2   Dʻ@@p В  @9 2  Pk $z &@㿐/ c@' @P   @ .* ! ,c!c c 6`6` &`$&`,&`(&` &``Ր  @8ے 0`E6`   "6` ² 㿐/ l?c@A`>`; :c_0"`O?`&& (`0``0@I@$@@& "`1$(? (B  W" `@6 $@ 2$`"$(ؒ yА$y0є @&&`y0yߐ$㿐     㿈/ c '  '''  @; 8@? `㿐/ T`@@`2  @!㿐/ 􀦠`@@ `2  @!㿐/ |(` 8``"(`8`@?&㿐/ `  (` ;`" (`8`@" )?# #   # @  #.@㿐 / 4(``Oc@E 0`" a a (`0``3  `" @  &? (`0``  0   @"  0  D "& & D& & 6 @`x  0@5͠x 0? " " `#@` #@,@㿐/ |c@` `& `@&@`x]xR `& @㿐 0 `?@?   `$ @$ 㿐/ d``D (0`` ;& `2$ 0`k`Y6  `_ (0``4  $  @& ?& c6    @" Y 0  <`&  8 &?i 2`@` ?6 `?@5d6  @6 (`0`` ` 2 @4 & 6 Ƅ?@4ڐ 2؄? & & 6 @5  " ?`@6  (`0`` `  ##@4@㿐/ c@' c  "@ ?@Q   J  `@8$ 4  @a4 @c c 4 $ $$ ,$ ($ $ `Iђ  2  Iʐ  "㿐/ D(`8``r7`w1`a  }  "  " (`8``@`e`x`+"   (`8```e&@       ڄ&  ք @HhP$DxP  D |    D T x    4 L \ h |㿐/ H@.@(``  .@(`` `@2㿈/ c@'  @&VԔ@ `ƿ㿐/ \ d  d d@E dE  dE d * -` ` ``` ` ``<`@&  dנ?րӠ / m ' (`G`''''''`܄''c|'|'`Ԅ't'x`'l'p .  (`8`% `z8퀦(` ܆D%c@ ` `&ݦ`$  <DY <DV, , ,  <C v``R(``۔`` 8(`@`0`'l  `ڔaՔ`!'``  @'l! !m d .!n! (!n!m @ ?"&`@@ @!ِ !mҒ d  !n̒! !m!nɢ@ܠ Ţ@`t;`· " t}.`tu&ak@ad``  C"t```   C"tN`'l  k`( O` `|@ (`E``8>(`@<```` 86(`5 'ԒԀy@&'ͦ` t` a `a  `a `3  a t`a`` a ,K@~a ؒ @$=l` xHp`3x 'Ԃ '`'l  Қb. S@`| 'Դ ,8``V`g M$@BҒ   '`i f㿐/ hc@' @N'`"*@ a$'И"` *?a -㿐/ (`8` 80`?. @ (`?`?   2`(*`8@*  @  C 2 #@ b  #<a@"  (8`Ѐ` ,-+  `(`8`` Ѐ `,`-`+2 #   (`8``@ # # Ѐ`   #) ) (@8@Ѐ   Ѐ` () 4 "@㿐/ fc'  ϖ (( ( @&@ (8:"  ali  ; @(( @&@ (`8``:   < @@&@㿐(`8``-`+   @ &@   㿐(8``JF`MЀ`   `&@ e!m  (`8``/+` &`  &@`  Q  (`8``.2ސ  ` C   (`8``.2А `  5 р  S`&@ ` *!mƀ 㿐/ ؀   d'  6`";`L`   ? 8`F@ F ** @(`!?) b 8@`瀢; Tယ@? C8`F@ F !`?`ˀ`(` (`#@+`! )  8@? 8`F@ F  ?a(-`-` @@ @ ( (!)  @(` 8D` [ d@ d   (`(` "* @?,`< <`0`0@8`8  " & @,` (-`-` @@(``@  @+`  `+`+` !)  @(` 8? @8`F@ F 㿐 !@Y> 0`@8` d@Q$88c @@  ` @ # @@   㿀/ c'H@'  `8) ?,'@ @) `P ' ' 'T@ရ*`+` (@ +`a,철   ߒ d  ْ!`?(`8w4`,`, @ 3`+ +`@ 0` ((@@ 3`c+`+ @ @@5b ap#T@aH@'?* +` (@+` &H@ @ a@ ?Ta@ ?b@@  Ϡ   d  }!`?(آ6? "  %^?~.&p <>w <&i& &` d Z! a(0&@  %&(@@H& &$ & ata( &c @@  ` @ # @@   㿐@  >!0$$@ҁ>880$$@ǁ `` ` ` `@ # / ac@' &  ,   < 2 ? <  ??@@ L  2?ĀCȐ= * *  @$''Ĭj 2߰?d'l /a, s    d  !`?(@'>? "?ax8=t 8a,n"     W d  Q!`?($ ' a(`  8 d  2!`?(( @@(`@ $'Ā ' 'Đ  VĐڒ8 N;Q'Ȭ    5`-  @-` ?88'<0=  3 @@(08 @ C3`+ ; B ? 〥@ 4?ـ@ pΒ F34? $glg'v?ŀ  ;'@8?뀢 䀥D4 ?2߰?(ܰ??ԦЀ@4?2ΰ?@(˰?? &= @  @5@`2???@  &5 `$ 0a0@Sa4 "?  - -  @H@`'@" ? q?䀠`8m lঀ ,,@ H@`@@ 8`9 C @c?@   2Ԁ 覄 ʤa8?*'? #?㿐 `  㿐/ ea8`8@+@ @?@"  + `P@+< 㷐/ =c '  ` & `"   |  && a0@ua42?? ( @   a+`@ ;?/` @ ` w#;`   bHԐ?/ (`(`@@@2  ,`(`(`@@@@`? @& &A`   @`?&& `@؅,`Ÿ a|a8 ?"q?㿐/ \  ` a<H㿐/ $ 2 ` a<; 㿐 ` .`.`@.@.@ @bH@@@   `bP@`bX@@bH@ @0 @`??c/ 6c ' &Xa?  &` 2&`>  (`> `:->   (`> `/)@0 # ? O@  /  a@ F a1 > `/ې;  ݐ ?֠&6 ̀` ?"XT@ ,?`h@#@?"H`@ ?`H`\@@#@"T?@X ?`@ @?| ?`@#@?x  ?`t@#@$?p (??`lh@#@  ?d ?|?`@@?`x@z@?&@tt?&`pn?&``l@h@@2X&` ``Ta4S``NdL J 2H2E@`2@(`(` ,  ,?d&?@h%`_?  = `< `6  : (`> `:`/@  . 2> a$@ސa$@ $@  .@  A  2` a.@    @ a@(  4?``@@   $ ` @``  $ `$ a`    @bH(@  @H!(@?`\@@  <$ @@@   : `/?`X@@ ` " (`8``^  ?T ` `" (`8``F  `   p&` (``&&  (2 ?`@@- `?`@`#@" `$ ` (`8`` J`; a@ `@@ " ` 1` "  &`  a(@- `@?  k "?`@ "? &`ְ 0 &` (`8`` 2`a4`?`,@ @ 2` `2``   `24` dP$`$bH @ @ `  &` (@ ` ?`@ $@``,@`  "a  "0`@ ` 2 (`?*`@ ᘒ@@, @ @@8`(&``  }`` ?"H@ + +@@ @ `@ ``"\ ``  ` ` ` + +@@ @ @ `` ` &` `  `@   P/ |c@' '(`8``<K" (``?@@   >\ (`8``>  @-y!'a 2&@(`8```<" (`8```,q' (`` 8``,`;`?`# a@ d(bH( @@`   @ (( @@ ` @ a@  \&@ @ ` ` ` `@ H&@ `@ ! `! ` ! ` ! &@ L&@ &@P&@d `&@ &@ &` &`  @&` ` b]?!"H@1@ T "I@ @(0Lg!`;$쀢 2~ @?8`a 1 4? (`8``,.Đ '$ '? (``"a@  "\&@ @   @ "H&@ @ ! !  ! "d! &@ &@ &` &`"L &@"P &@&@ "`'&@ '' `(a'@4 -쀧4>?@ >?.>? .``&`    H d  B!`?a, (@(` (`#@+`! )   8@   G C d=  ?'  @H@  a   (`(`@@@ `  @  Xa H@ (`(`@@(2  8@C:` ` 7 tS?axa@  "H@ ` ` ` ` "P&@&@&` &`"L&@ &` Ԩ  > (`8``>( W"(L>?>? .>?J.㿐/ xaD֔   㿐/ (aHDaL`a4<I` aP&(bH&(   cha4 $0aD&(㿐/ Ů0aT㿐 㿀/ a8c' I?`" @46?@"6`(` @4 @"`   8`(@4@" & ?@ a ((+`@`?4@@ (`@`<@ တd@B?`2`*`B * @ 3`+ +`@@3`C+`+ @@5`C-`- @ 3`+ +`@ ` 0@((@ 2B**@2B**@*B2@ *+`@ 3`c @+ @d?@S @"(`@`I "`M? 8`"@ E ;` &@ -+ @``  bL`"( ! "H- & c| ) bH@#@ @&( j(Z@ b<@ސB?`2`*`B * @ 3`+ +`@@3`C+`+ @@5`C-`- @ 3`+ +`@ ` 0@((@ 2B**@2B**@*B2@ *+`@ 3`c + @@\?ހ``@ڀ`?@(@8?(@U0@(I az@J 쀠(T@ @Rc㿐a8/ >|aPc"`"@$j#`& bH  bH (`(`@   ("@   $ 2 #@   a H$ @*` @:`  _,@ #bH H a @@`@`@)c @( , @aD"@"`㿐/ aXa8?  k  ^Z Œch $Q㿐/ Pa\ΐ́㿐/ a@z WaX@ a`@(N @@(!@ `;$@a8@>  (``2@@aD!! !  bPbLbH!"H!!@!"   (`8``:@ @a`@!hKch $@ׁ㿐/ la\Ua0Ȕ  L ? #@㿐/ a\4k3 .㿐/ ߮a\ W㿀/ Ѯ`c?' _: DW?@ : d4'耣E@ 7D?D?@ : d 4耠 + 貀@ 5@ `D %?@ : d4耣  貀@ 耠  2a㿈|?: @ fh/ P\c' R@ ac㿐/ 4adT ,w i 㿐/  ahT ,c  㿐@ʑ㿐/ ,c @'  ','`L  H@ )`' '`LJ僠)⁠LҕHL䕢Hap/ c ' [ 9  a;aa ^@'& >a   #\#`#d#h@3?uy  W" -a(  aa( #@& auOa "@%0an㿐/ aȄ H z H  #r@㿐/ ⤄ (`` &?"(((`` &?㿐/  (`8`@ `0 (`8`@`2  㿐/ -(``*(`` 2 & ) ` () ` ( @&I 㿐@/ Ѓ(`8``2`@&3(`8`` @2@  2? 㿐/ 8@((8`8`@  `2  @㿐! @ ( ,  0㿐 ( ! & (6 0  '*! , w  1$!! (`&!&!@ `  $  ,(`@`D& * @ `D ,& 0& ,@**U !@%$ @%@!&!& ?㿐 ?`a?t "㿐!4/ ` ! b aa && & @!! 7 ?! 0  @!8` @`Đ* 2@&]  " ?sǰ? Os"$a,㿐`  a4`  s? "? @   &a0㿐!4 @٤ H!؀ !!؂&!(`!&!!} "!/!`$! !8 `n!@ ! "!d! "!^!?+jV  sKsGsC?"㿐 k  &!؀`&!   _.@ `  !؃)) (`@   ss?"㿐 ?u 㾐/ <c`' d )!ܢ ?$a$a , @ @ ?^$7p  `"$a a!?$!"@# OĀ `?``c$`8!$` `$`$`$`  $a   $`$`!@`D@$6$`4`Ē @$2 @ %s "Pr r" r "  r@$` $`%  `2$`4`2$a ` `ဠ " $`re "$`-`4  & @|* @   `D(@$` *  `D$`$`@$  ``,* $`,!0@`?$`<$`0-$`(@X `,@4$`  `z@C@$a0  a0````$a4? $D$a$ oaaaa"  " " " " " " " _"] c$a @  $`(@@f$` 0|aa0 O``+a @ `@2" O``(-U 1 ` `` (`@`D*a8 :$a@#:*q)a0 @ː$a0bqq" 㿐 |!$`kj  "! (``2t!(! "A!$*!(((``"   $!( (`` *` @ߓ2`$! ?(``р !$$! `$!$!($!((`0`Ӈ(!$$! ! ` $!$$!(Ĉ !$ (( $!$$!  (`` ( @ $!( @   0Ƅ $!$$! $!($!$$!(?$!$ q? "$!, (`0`+`(`0``  @ڰ ! `(`0`&@?(`0`(`0` &`! (`0`&(`(0`0 @&  㿈/ ή`c@'  X  @9'쀢   `* @(0 -`  (`0`%@"[``(`0` 8@ &@*`2`@  "5`  (`0``8J`@&) 2 `` /`@ ('@* 2 `:@ږ 2`?/`c@ L@ @ 2`"8*``)@` /`@ "`԰?, (`0``#@((`00` @#`@(K "`?@(C "`b -㿐  !`  $ o "&!,?o "&!,㿐  " !o "&!,?!` f`o "&!,㿐  o "&!,?㿐@`  ((`00` `((``"&@ (``2 &@*`@2` 2` &@(`0`` (`0`㿐`   (`(0`0  ` (`0`@*` @2` 20?! g &!"`  &!((`0``%(`!$&! `&!$` ,0`!`*`2`@ <@ 4` ̢?o3? "@*`2`@ &!  (``2` !$㿐`. @(`0`" ` `(`0``(`0`@*` @{2` 2`?f(`0`@(6 (0&@(`0` @&(`0``  !$&! `&!$&!(  (`@*`2`@J &!  &!( (``!$&! `&!$ @*`2`` @. $@(0`"?&` , 0` .`!,`2`2@@!& (`0`@*` @2`   ` ה n? "㿐`   (`0`( 0 ` @(`0`@*` @ۓ2` (?! X $!.  ` ,0`!`*`2`@4@ 4` 0n+? "㿐 &??! &x/ dc'' \ݘ  ? Iܢ74 * 2 `=$ @@ ` `()  0(` 0`0 ) 0003(`0`2$$ `(@(0``܀`"$ $  b@' $ ?(```@ 7@`(01@(`0`3@@!܀ ?7`㿐`(`1 @`'PP'D| 2P`c$@-,`4 2 @b4 0%(0@ 7@(`0`7```.``(`1 @`I(`0`41 ($0, 2 @5(0(`44(($07@ (074D@! Q@(0@(`0`  0```.``(`1 @` 5 (`1 0`+($0`, 2 @(`0``(4`4(`(` 0`@0`(04 4``.` ?P`"Ԇ 4D@!   `* (`1 @`㿐` . (0`3(`0``. *`@2` 6?`    (0` (`0`` $* *2 2@'@   ې? 2?.** 2 2@ ?㿐` . (0`";(`0``-00`2-(`0@(``2*0 `, *`2`@ `@ P J  (`0``؇(0`ؤ (`0`܄@(`0(@`(&`  1 (` (`0`3@ (03` `.`@ `@@  8 & 81 1   &`ؘ ?  @ 8@`! "!"!"!ā#@` `"` !"` `"@!"` `*` @#㿐! +!@(  ` `` 2 `"  " @$      @!@2  @ 〦`?㿐u  @@?   "a a a &  @$a & @  aa @"a@ `"  ` 2`  ``@  a @  `  7  25 $ $ &, aĄa$ $a $  @ `?@l ec/`%!  6@(@) "o!0  @(`0``l 2j  "$ $  ,0`@ " $  & a.`&a&   @ & ,0`@ @(`0``(`@ " @E "$aސ  ?" "" " " " ` F$ ` @" a`jg$a`? e, (`@ `a؃1(``a0`( `2 @ "     a a $  @$a $ @ a@  i `]㿐/ h @ `2 ? xph`XPH㿐/ 䀦`"  `` 0` )  c%  @(` @(` @(` @(` @(` @(` ְ@. @ @(` @(`ׄՄ ؄ ۄ ބ       (` #㿐  &@ `" ` ` ``㿀/ c' ?c@0.` *c ''''?'0`*?@`* $$` ?   ǐia  W" `@6 @`ڴU׀U0bu㿐/ ,  c (` +`(`8`"` (`8`   (`8`   (`8` (`8``=  `@ ڀ`#@8`&㿐/ c' '(`8``  `=` @(`8`` `="@@ ""@` @(`8``""@`=b㾰/ 0c'  ?n@H [`Y?@V @R(`8``XL?(`8``X&@?* ?&@`=?cw9c@  ,`@ >* h2 * 2  ?`, @@ `%,`&02! 62֠h\? "hW? " ,Đe!?h?`"ݪ0˒!  h2`"Ъ٠?h*`Ҡ` b M㿐  T @?   #H@   #?@   #6@ # .@㿐  ' 8` #@㿐@```(`((& ````(((`@@@& `` ` ` (`((& ` ` ``/ ׮(((`@@@& ````````` ` ` ` ` `o`b$ @(((`@@@& @ (`((& $ @ (((`@@@& ( @@(`((& ,(`) (8`8(@8@@&() (`88`(8&    (`) (8`8(@8@@&   (`(8`8(@) 8@@& b(`````````` ` ` ` ` ``" 0" 4 @ ` ` `(((`@@@" 8 ` ` ` `(`((@#@@" Pb`@'P@'P`?`T"`4"`0 (P'T"`4"`0b4[`/ Lc@' @Q (?b,Eb0$ `@   @`@  ((`@`P@! ޒ` `@`@ `$ ` ` ` ` ` ` ` ` # @ ( @$@e @b @ D#\  $H ??4$H@ ?+b0%$!ۖ ̐#\  $H ??$H@Ŕ ?" %$@8 ~9^$H@b8㿈/ Pc' `ib,0`, @3b0$@ `@f `P@@@! @?`@ `@`@ `$ ` ` ` ` ` ` ` ` # `т @b0@d@ @@/`/`/`/(`(@(`(` @@ @v#\  $H ??$H@& ?  &$@b<&8$H@\㿈/ c@`b,m@i @ `nb0%)$ `@Ҕ `D`@! `` `@`@ `$ ` ` ` ` ` ` ` ` # `"H@@`"@$@$Z @% @ `&@$ `@ `#\  $H  k??#$H@ ? $$I@* @ @`@ʁ@|8($H@#㿐 @ڐ/ Pc'X'P'T' `c` x !''x'|@?"''P77'''Ȑ(@ b@B 0\    H       㿐/ (8``2.@  .@@(8``@.@ . 㿈?/ ٮᐃ0`'@@\ @7*  bp%bDc'@ bHc'@ @0`g|9'  @ǐ p  *?8* 3>@?c*@? 8`@ '@/bL@ J?@0`gz'ʲȲ bP '@ :@``*`?0`'` `@c`* (``2#@ 2$ .@(`8`@(( (``  (``"ڀ @10` !  ـ (`8`` р ``̀  ǀ `'` ` #@㿐/ cbT'  /0`(`bX;`` cd` # cd`  # # c`  # #c@ 㿐/ c ' ?ߠ'@ @&  $  @ @ 7 @2@  0 @ c@(@2"㿐@w%+ @ c@(@㿈?#\@ cc&|| @/ c'  5\'@@@?()b\@ H3b` '@?  g c`'c@bl@&  '@c@Ƞbh@ ٰ??@ ΰ 6`gA?|c'؂ @bp?@'bt @ Jx|LJb\@NL ' w   'c\-  'Ĩ?! c   Z @'' 8    ? '''@? k`쀥` c\ (=   c   ? c8@ H`? Ā` `G ? H' b@ T?0J?@ ?ȑ,-- ''8'@8 ܀@-@+@), '$?쀠s rc\- V?67b\@  НH'0P,ʁ Rˠ 2 TH   H? (8``92? 0. 0 , bd ?   '''2   @4@ @.@@'`i??;͆ @ 'K'Q `@&@%@%'Ȁ=@’ '@ |@@v  u'Ѐ`MȀ"'Ԁ`2'c2 '"'Ԇ ``'Ѐ`˂ @` ̲@@'̀`43`4)Ā̀`4)Ԁ@j  " `  *@r  "  `'܂''@ `/ '@[ܬ@@䢒 "հ ` `0@@ `!9`쀈` `〦܀9,@y  @ ܒ @ٔ ' @Ҕ '`c.%@ 'Ȃ@?' '  'Ȁ$ ' '''Ȃ @,@Ȁ`"kTc\*T?'()  0ȝ΁ (.́ d*+b @́  "W? RRL'0,  > %''  L#? @X \@  b@H'' 1.   'c\b\*@ʄ?L@ V'0. ,- 0, LJȁT#''0, b@L )!?΁ ? (`8``0"? ˨ 01w c\ `(;` H(k)()c8@ H`*Z+ @ŵ@@s'̐ @ ''`4?yb?@ H' f'm'@  [ @ 2?M'(`@@` 0 @   @ "I `@ 0,`` ``$?'@'ܐ@  "0 @䀢 k? (8``9`2? 1 .! `؀`3 6 @@  ?'@@ @< 1'@  18@b ' @j ' @c ̀`߰ @\ 'ذ 3,נ ````,ʠ ,Ơ ? (`8``0"? @0  " @a䀢 :2, 9,x `$,1,  @Д 6' 2,2, 㿀'H `/ HV -``@'`'`H'쀢 `E H@'䀢 ; '   @ B@  c @ c @  `   `-``2@:! `"  ! `2! @ !       '@W @ D  ` `$  `2H@:! `! `@ ! ?? ( ` `#@@㿐   (@ @7 " 㿐 *(``  ((`` `2&@  -0  #?c  0 0 02 0   #0   #0  ? *  ?<* 0*  *  # #㿐 `/ d@(`@` @ ` `㿐 / ܮc('  @&@    @ 4@ . ,@ ?(*)   ?@ ,@ @2  *??@?ۚ  ?ӱ0@?0@ *њb  @*(`` ` @ *(```#㿐/ uP   c@ b) $ `0} b($@!}㿐/ Gc`  b,  - ` & & `0}  (,``0`(` (" & `"& `0}j& & b &(@8,``0`@ ݑ(`(`!& & 㿈/ 0c ' ? 20``''쀣`)'o 5 (@$`0@' $`@`$`;΅, &, $& H $`$` ` {͂@& 5 &$`b㿐 G`N <  >  `# (`*`@``  @ ` ` !`    :?  ` !  ?`?`#  ## 㿐  `>`@@ (@  +    !`@ ,  `(```  @ (@ ! @0 !`& !@ !@ 㿈 `@^ @@   N /``` @`8 @, ,``@``@& @ `    '@9 @B $@ $`$! ` ! `2! ! 㿐9   " " 㿐 >`>   @ @ &D`    - & @ `       * YҰ  㿐/ A`j>``%b`=c؀`0>``b@ "`">`8 ?>```"{g @ " `{_ ހ`$@ "c`0{H ``"`0{>  Y"q$ "b(U >`㿐/ c6 @' ?c@i6` )$ $ $@$`VR`2 * @4 , @@@- @5 @@@  4  @,  `b㿐/ @c ' O G 6/  @ $@ & &$@@@` ! i   `@ $@Ф ͒&` `b㿐``^  (0`Z `V@`@9`  `"+@q   DB @@& 2A N` @`"&`$@`ڨ@` Ҫ`@```d $ ,@ $@` @`&` @Q  (0`  , @ 4Ŧ ?`@6   @& &@ 2   @b  " ` b`")@(0`@H b""@k  @& &` @`&`$@ `ܨ@`ժ` ( @( K@@F& "` @ , , @ $ Ҥ@   @@, `*, ` {   @@& ) & && 1   @& &VN ?F"㿐 (`8`"#  `& @ &  $   , @ @ ?`@6   㿐/ c@` ǐ@`BB0㿐/ $ "c@ (`0`` @`BU? "Bu `@㿐/ h`  (``< X2㿐/ `` ) 0` 32    &  &  &   "  0   @"  0    ?& 6 & (`6 Ѕ0?bb@J (`ƅ0`/ c ' (`8` &$(&@@ p p<І`?  &$(&@bZ&@ & Lݰ( ( @ְ$԰(㿈/ c @' (`0`` C & && @@ ++ & & & 6  * @j:  2   C`& 6 & & b * #:  @㿐 * : ~?  > P @6 2  ? c6 㿐 (0`a    *  [:   ?c. 4 > ޝ㿐 * N:  :  P@C> P ?c6 㿐 8@ 㿐/ 쀦 `@ 2 ? #@E@㿈/ c' @2 bk㿐/ `   @ ((`00`(0@@0 .`(`0`(@6H/ ۮc@' b  ?c@ ^   ?M674 4`6`77777777`B.`AC.`0`S֒, * 0`Sϐ* Sʐ,* 0` S ?`* \* 4 V* Q4 * 6 b '(` `  `(`?`` ւ @'(`' (`@0+`'0c'̄(`'` &!+`0'`0+`(`@0`'''''Ĭ @`(4`̃(`0`, ̤S>, ,0`  ?#` ȶ @, *`4 2`q$$4@@4 ? @ (4` @0`5 Ș @(`(0`0@00`? 53@Ȃ`''Ȁ +"  *` @((`00`0 (@@0 *`5@(() 0(`0`?އ(() 0(`0`(`o0` ' '㿐/ <>@w:;@`"6@`n  + ?`6`#  .`D( @`"6`2  ? +?  @6`?#?.` `?(Ҵ&  @&㿈/ b@' `  @@  ' ''   @ ??20b#@@㿐/ 8b@ c,$ b@? cD $`   ? @ @(`@ # #㿐/ T .   @@8&@(8`. . @@&@. @&@Qd? T"&@ @@򀠠2  0 뀠 .   *    @@("  @   @ @#@#+ @@ (! #@#@#@@㿐   `.`Q ? T"8`(㿐/ `(``2  (``"& &   ``?#㿐/ p`Pΰ? "  ")x??  `?(>`@ )@??  @?P? T"  㿐/ P? "`g?"3@`?@8 @/) ` (@(8```?Pj? T"?ʂg 2#&`  2#@ "&&&?```҂  @ @`    @`  ( @`b  㿐 "@2  @  @&@`5@ @(``1 P? T"  `@ @(``    ݢ`@ (`8`` &H ?B?̀ 20ɠ ` (`` &@  (``  `  `(`` &?? "&@@ &@@@&@@?@&@?㿐/ îc ' `O? "@ H F  @@&@ @ @ ``K- ,,@@`&` ?@?@&@v?@ ʐئbj     @, ``S?2 ?&@㿐/ @((8`8`@ `2  @㿐/ ,>w:;@@`"6@`n`  + ` 6`?#@`.`D?(`6`2`  ? +  @ 6` ?#+` `@(Ҵ&   @&㿐/ (@` J " $2 @ c@(@$* @ cp@(@$e @ c4@(@$ʄ @ b@(@$x @ b@(@$L @ b@(@$S @ bD@(@㿀'XX#\#d#h#`!0 $J @ aȂ@(@$ @ a@(@$ @ aP@(@$> @ a@(@########㿐 Ǧ  Ḓ `$ḡ<  ,  "  ?(@$.@ a8$. @0`ā㻈/ c!' ?*  S xbb$#_?' Ҕ?@?&!p8 Ɣ !?"M? `ဠ "i@ 8` @ ' @ +@+`+`+` `:5  <] @ 8`(@  0`8+0@+@@?/@  L? O"L? ?" :b 2  <(@  *  @ '@@@ް?(`0``   7 ((@ې *  @b㿐/ 8c!'  6@  6` 6` WW6  <I @ 8`(@  0`8+0@+@@E?܆? I6@`2 @(``"6@ `ဠ`"@@ 8` Æ  @`' *@*`*`*`@` d*  @bd  <(@  T*  @@@@`L# O?"7.@.`@(`0`` ј `7 @ *`*``o 㿐!@ + .`@$!8 .`@`Đ* 2 >  2!8!8 㿐`  (0``(`@`@ $(0`g@&& $  `9*`8(  < 0`@8(  (@) < 0`@8(  (@) Ӂ㿐 4/ *@```.`  ,  $`D ;@(8+, a8 "@ (`@  @&`(2E (`@=` @6@`ݦD`& $ D '$ (D, DD&   D (`@|`80`@8( ,  (@ @ (`<0`   (`@2 < 08+`@  (@#@ n*` $ ,?  D"2H(@`@"'%( @(`0` Q  $ (`@8`0n8& $耢'(@(`0``<& 4 9& 4c 1ΐ JȰ  "o@ , @   ˂`D  `D݆(D,@ `DD& , Dr   &` ``* @`) 0 @3`@ (03`0 0 7@`| @0㿐` @,`0`$, 2 h`(`0`6$ , 2 ]`,`006 6 4㿐`- 0`+(`0``U((`0``c`a/`0`h*`2`ީ F?`- 0`(`0``8A { 4?  (`0``(`0`@`(0ls ? `,  8& 8՚(*`2`f 2`?ƒ(`(0X)`@$4, 2 $4, 2  455@ ( 05(`0`5@``.` 8 ( `*& 8 4 ? `,  8& 8(/ Tc@'     ?c@   '``` /``` (`7) 3``''(`0``>  7 '', *`2`@'0`*2$ '2'(`2 ) 0`@@(`- 0``٪```) (0`'ĄԨ?''''- 3`0`:2(`0``֖((`` 3``((`0`` 2 (`0``(`0`@`(@0`@0 `P ``,` ) (0`0@~((`0``w, *`2` '2(`0`"'(`0`'((`00` '/@2(`0``(`0`@`(@0`@> z` ``-`(`0`@'((`00` '67 *`, 2`2 $ S@-$@00@ ђ `̒ ` 8) ?!4(0 0@ (`0`@0``/`(` #\  Ȁ`"?Ā``'E` ) '?`/``(`!6?(0 @3*`(022`e '   ) ''c `ư 㿐`. (2`Y ?- "0`@ .` (`0`?4`@448%8 `-`  - "0`@ .`* *`2 2`2"   @  @`01 @  (`@`@01 @  (@"%(㿐 '/ c'@`L Hc'@Hc`@L LH㿠оUsage: %s ..., where is one of: instbin%s: %s not compiled in ddmount_cd9660md5sha256sha512dfmountarchsyncsttylndisklabelpaxtarcatifconfigsysctlping6dateeeprommount_nfsgrepegrepfgrepumountfsckmorelesssignifymknodpwd_mkdbrouteftpreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownchrootfsck_ffsnewfsrmmtejectmkdirsedkshsh-shencryptsleepmvdmesghostname!ƈ!Ɛ!Ƙ!Ơ!ƨx@@!ưD!Ƹ(!!8 $@@! ! !!unknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdnonenoxferunknown status %s%s: illegal numeric value,unknown conversion %s%s: illegal conversion combinationbscbsconvcountfilesibsifobsofskipstatusnoerrornotrunc%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %lld.%03ld secs (%0.0f bytes/sec) skip reached end of inputA.!!!P!(!0!8!@!P!X!`!h!p!xusage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwnetautoaccesstimeatimedevexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'%s (%s) = %s %s %s usage: %s [-bcpqrtx] [-C checklist] [-h hashfile] [-s string] [file ...] error encoding base64cannot open %sstdout: write error%s: read errorbC:ch:pqrs:txbase64hex%s doesn't support %s ,unknown algorithm "%s"SHA256SHA512usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %lld %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsext2fs@Ynfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-AadfNruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%smalloc on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%omaskshortnowin95direxecnorripgensextatt/statfs %s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %swaitpidforceAadfNo:rswt:uvrqnoautogetmntinfounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlylocalnoatimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/sbin/usr/sbinusage: machine [-a] usage: arch [-ks] machineksOpenBSDsparc!! !#!!!Ѐ!!!! ! !( !!0 !8 !@!H!P!X!`:!P!X!`!h!p!x!߀!߈!ߐ!ߘ!ߠ !ߨ !߰#!߸3!#!3!2!3!3!#!@!@!@!@!!! !(!8!@!H!P!X!`!h!p!x!!!! ! !@!@!!!!!!!!#8!!!!!! !(!0!8!H !P !`!h!p!x!!!!!!!!!!!!!!!! !(@!0@!@@!H@!X !` !p ! !!!!!Ⰰ!!@!@!!! ! !C$!C!C$!C!! !0!@!P!X!`!h!p!x!!! ! !!!!!@!@!!!!!!option requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2erasekilllnextminquitreprintstartstopsusptimewerasebrkflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeed%ldlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sospeed %sispeed %sillegal option -- -%scbreakcolscolumnscookeddecekeverythingextproclcasenewnloldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupclhup-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbelecho-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendincrt-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZusage: %s [-fhLnPs] source [target] %s [-fLPs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).fhLnPs!h""h"p"x"""""""" 8"""P"""!"H"`"""("("("("("("(!!P"/h"("(!"("/p"("(!"("("/x"/" 8""""" H" "("0"8"@"H"P"X"`"/""P" @#"/"/""""/"("P"/"/"/\msF@VT%Ŋ\UdbY^NIC`H"Hf*?m3D[Vzfz~]דg{qrkjUԨsשGa4z9ϣыFie&27M*Rh# Y\iƪH*uf&ި&\et@"xgiڿ΢L%7V_1|D*j*ʮ~ _E77s<`M. / ~tm JWWQB-oƇ<>_F/-Eg/4zИF;$. 8B,eSyLk5U,Wf{M s0>y\IIl M fU@x5YV 8n0 %0[ QTH2 6<չ>f-.gTSμ\y #*{N!a{͛:%QŰ?DZla)v9N'9[b{w,]E')}~ G^ԉ|}3J %;B:C{d %)Ss)װ*Y (Nֆ3 Xb|u=L76UnЉ h!ě\Vj=$-"G HrAMUeAh8i^@\UG8ǡX+071D:"ؐ!%xQ-j.+`D<멗Qs 4oq&`&9R ,zw&)+⬿0sjpdѢ8蟣E%ֲcKޥKPIJbMG:`L)cpS]&dUP JV%EA[R8Zk ,CUˆI46g,B?;׍MINY`ӉUqcCr,8JN!\S@p_! eB~$vSaDM=fa,LdD5ܜyƲ!-䳤6d%e3ʰElF3&䪷:WcRf50ݮn"fR\)ɢl*8=̮܂ 502hO۬l,6lyvxVe9rn1 O؄YY*tc4p}ɷ.3w‹/6@py%Np 䤙 E36xda좣5@B*AU6: [E3Z tp1batMÝXΣQaԼ$qP>t$&'UN 8k#Yn7&s뱝HU#?㪬tp"˪t?.9p*NJ f݄v KBۉ1 Hs*G?3 f-I`ƺ4ujK^ӗOKAB_' "Ֆ+*ô6)$q&-ij 7BtنDhj唏DЭ  ڠۓiYSf)E\ k lQY;Xף j[Nz)./ppLQQ\ OޕRU0w8FYSY ON/r}} 0vҁ%!욀m"UT\ ȕlV'ViTXxɦ]h4Q𳾧Op/aXU͆=VUXMUa-bs0e?2&?S;Y7X( 9 Raպvs2#2=Zb:P{rzq*N,RpzW/61z*׳1Jbfb)) XFf\؋Uy[Y!`J5XSL?Q8!&;ӯSaTuer/Pqaީܗ bcJR,Ս*;E r=YPǽJB u z'7Pyl=R4빮zI\˥l}xW5Z9efz76a61X, k x2ĻF7 A2vQ[?TUD'1Ko.4"*g.Ja$[+,$>%ybp  1B}0׮xylFy/ȮZC GGF]Yswa` yنRH9w(Uo_1fI ~ F5uι,qEAkȑlu[FniɄm|̀ݴSd6#p?N3/Gp jur*I'#@ċJ-ioyJ|1,K f)J'xPPaǣ yQŌ:zuޞ(L"y#1f^/ɮ8ffmyX7ZZ`mz$MfQœP &}K~ʇd.uB z6Iِ"Té[ Q~@v˅KDw S!̌\q:yђu䠯Uȸa3Atc>Xnm;#G*+4o/Tshz)AЏ s]½D?[UYXgSڄl־/?Ս(LPTZLVY.v \tKSU 6-m\>o!ď&躵Vv(#IL Р*Z._Zq2׶Yv虗*F6/} OBW,Rch 0mjIJ>9j:40tZ19? @H`3C v.Ĥ)=mډ~'!$rB@Q%AL)+oUDr1y1K ~ &-@-Q-/,RWLJoBy N;(ρG"JIhⲩ'Cu!џ/ ~Dk9G|WLc بcكT~_.!!)A# U ؂SBuJ-~,SW%6[Eˮhh\j yF*;q-p$t>Xy`FI:9#Zi{gۉQqPum({#bdW5Z{@_ }m!hW#q#cŷ5/!''@NzЌ!_ZqpGxH:;ijXZ9ɱ<)N`*u`]٘zݕ]¥rY6R͕oSo32~+5HSp=b+6 aKaҺ 0vl~[F49,!hc#Q)!^Ss|$s۲HS̫A4(57mei^\ΊH?; 9uL{zt %va\fzD[h ¹rRD bұ/G6ѩ>Kpt%۴q06 |g"Q}p:! O`NaHKۛ EjOy͞HCXAncmG/ӓ+H|VGlxF=*l]"ưK ({|c0 @Ģe^@P|GQ?SHSEީ‚joL-4D)<EsPNŶs Gt攤 cWq9"x~K%`lݬ?mACC%a'x=$tmF bV١]b3gW.i\/j鏔̮evUrjf{dD:@ɷk>)5E :xEQDVomYGN]$h!!~=_E2Z2lmՀp=sG_Q޳xCx#rm]uYg3!Qy?pึ= Yެ7TN}&_}+a 'p"D<>Tpj6}-h7^ +\eҔxI,?mQF'A˖GB[=(?6C}ʗtC{%_t6zNە#Tx>`a 9|1t͸n w_vbp $䟴Mzxxp8KGK&y9kǩ}\d*m qAq;wz(8Zf}amJ ĝ =HEoBnQm!ɮDmԚҞ9 m'<`hV^SM-aLbH5i(l5^bdJc2%FJ;IwfJ).c8,x?VWL%0Q瞺 m[҂^9<ɶCy4ZV)6kSԃv#]'w9rDA/ ` n4֥Y':mjo7lm⥍ &O`RO?xۊ0ɨOr`3ՙVBsEX[={Auk//>p4;wÍۃ y|>{TFɫiB, *9ej'vc/^v;D[Wܱg^S)Lr"T1=@JLhoUPjA8SPt6/,gإX퓷ӕil;D.(ЧoL} V\Z@MIe85/G&=3΁wphrEWA?P>>=pCusage: disklabel [-Acdtv] [-h | -p unit] [-T file] disk (read) disklabel -w [-Acdnv] [-T file] disk disktype [packid] (write) disklabel -e [-Acdnv] [-T file] disk (edit) disklabel -E [-Acdnv] [-F|-f file] [-T file] disk (simple editor) disklabel -R [-nv] [-F|-f file] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %lluwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0this architecture requires partition 'a' to start at sector 0partition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %llu offset %lluBootstrap doesn't leave room for disk label line %d: syntax errortypeunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsdiskduidline %d: bad %s: %sbytes/sectorsectors/tracksectors/cylindertracks/cylindercylindersrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seektotal sectorsboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi%s %s/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:ioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFO # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: unknown disk type: %sbckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:tT:vwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cparse percent %s: %s%s: parse error on line %u%s: min size > max size on line %u%s: sum of extra space allocation > 100%%Treating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. %lluOpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c/dev/%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.Command aborted BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. Where to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. 0123456789Possible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Invalid entry Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. 1, 2, 4 or 8 times ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be 1, 2, 4 or 8 times fragment size (%llu). fragment sizeSize of ffs block fragments. A multiple of the disk sector-size.Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. This architecture requires that partition 'a' start at sector 0. The offset must be in a free area. partition to modifyThe letter of the partition to modify, a - p.No space left, you need to shrink a partition (need at least one full cylinder) No space left, you need to shrink a partition partitionThe letter of the new partition, a - p.Partition '%c' exists. Delete it first. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Changing device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions can't get mem sizeYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.Original label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdFLOPPYxdhdVNDsvndabcdfiklnoprstuvwxBDEGHLPTUXYZ0Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive file%s%s: Waiting for tape drive close to complete...done. %s: unknown format, %llu bytes skipped. %s: %s vol %d, %lu files, %llu bytes read, %llu bytes written. could not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %sUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...Cannot chdir to %sCan't fchdir to starting directoryUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sAccess/modification time set failed on: %sUnable to restore mode and times for directory: %sUnable to stat directory: %sDirectory vanished before restoring mode and times: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %sUnable to create %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %H:%M%b %e %Y%s%s %s %s%2u %-*.*s %-*.*s %4lu, %4lu %9llu == -> %s: unknown option %c %s: %c argument missing input compressed with %s; use the -%c option to decompress itbzip2compress7zXZinput compressed with xzInvalid option nameUnable to allocate space for option listInvalid options formatusage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory Invalid block size %s/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578TAPE-IUnable to open file '%s' for readProblem with file '%s'-CInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value: %sab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cDestination directory was not suppliedThese format options are not supported %s = %s ustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archiveRemoving leading "%.*s" ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s CPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.Unable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory for directory timesCannot canonicalize %sUnable to store mode and times for created directory: %sDirectory access time reset table ran out of memoryNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryCannot allocate space for directory access time tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableHard link table out of memorydeferred symlink hardlinkdefered symlink hardlink pathsymlink tabledeferred symlink removaldeferred symlink%s: %sdefered symlink pathdefered symlink valuedefered symlinkFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sInvalid extended header recordInvalid extended header record lengthExtended header record length %lu is out of rangeMalformed extended header recordlinkpathwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %susage: ping [-DdEefLnqRv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms clock_gettime(CLOCK_MONOTONIC)packet too short (%d bytes) from %ssignature mismatch!%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %d bytes (default %d)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfromA??zG{%6d usage: %s [-benstuv] [file ...] benstuv#uDx$ Dx"Dx"Dx"Dx"Dx"S"S"S"="O"RL"RL"R"R"""C"C"j"i"(g"8l"H|"P|"zJ"XJ"zHJ"`="zX?L"p["xb"Zp"""O"O"Y"Y"X">H">H">H">H"{d"{d"( "0Bx"@Bx"X@t"h@t"x@t"P@t"@t"@t"@t"A"A"@t"@t"@t"@t"(ED"Dx"Dx" Dx"Dx"@Dx"Dx"f"iX"h#e"(Nl"8Nl"@@=h>"HH^L i@ivքv"xP4T,Kȁ iiv֨v@ "P "``"h"p"""!8"!#"#"#"#"$"$"$"$"%"%"%"%"&"&"'" '"0("8("H)"P)"`*"h*"x+"+",",","-"-"-"."."/"/"0"0"0" 0"01"81"H2"P2"`2"h3"x3"3"4"4"4"5"5"6"6"6"7"7"c" c"0d"8d"He"e"P"X"`"h"p"x""""""""""""""""""" "("0"@"P"" " """"""" " " "`"`"" "("0"8"H "P"X"h"p"""G"""""""""" 8"$ """"""`!"("""""`!"("0"@"H"P"Xrandommalformed link-level addressSIOCSIFLLADDRSIOCIFAFDETACHSIOCIFAFATTACHSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROY%s media mode %smediaopt instance %d"%.*s"%.*s0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %smtu %s: %sSIOCSIFMTUinet6autoconf not allowed for this AFbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xInvalid trunk protocol: %sSIOCSTRUNKSIOCSTRUNKDELPORTSIOCSTRUNKPORTSIOCGETVLANSIOCSETVLANvlan tag %s: %s vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%d: bad prefixlen trunk: trunkproto %s trunkdev %sstrdup trunk id: [(%04X,%s,%04X,%04X,%04X), (%04X,%s,%04X,%04X,%04X)] trunkport %s MASTERSTACKACTIVECOLLECTINGDISTRIBUTINGDISABLED supported trunk protocols: trunkproto %s trunk: trunkdev %s invalid vlan tag and device specificationinvalid %s %s: %s%s not allowed for the AFvltimepltimeunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %snwid chan %u bssid %s lladdr %s %u%% %ddBm powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSD RADIO_MEASUREMENTDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACK,wpa2,wpa1,wep,802.1xCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restore ieee80211: nwid chan %u bssid %s %u%% %ddBm nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_NOPRIVACYMPLSWOLAUTOCONF6 rdomain %d metric %lu mtu %lu lladdr %s status: %s %s: no media types?calloc media: supported media: tunnel: inet%s %s -> %s:%u vnetid %d ttl %dunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKpersist:SIOCS80211NWKEY: too many keys.0x%smalloc failedInvalid WEP key lengthSIOCS80211NWKEYinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupinterface name '%s' too longdestroy'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevgroup-groupautoconf-autoconftrunkport-trunkporttrunkprotoanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacypowersavepriorityrtlabeltxpowernwflagrdomain-inet-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactiveinvalidkeepalive downroundrobinfailoverlacploadbalancedefaultusegroupwep40tkipccmpwep104BO %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%*llu %*qd total %llu %b %e %H:%M:%S %Y%s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufound""x""""_0usage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-V rtable] [hops ...] host ff02::2:0000:0000-%u %uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap???Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) ...refusedunknown qtype truncated no address %s(TTL=infty)(TTL=%u)\%03oNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply, %sBad ICMP type: %d --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: invalid peernamefailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%lusendmsgping6: wrote %s %d chars, ret=%d invalid socket buffer sizeMust be superuser to flood pinghoplimit is %s: %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadinvalid source address: %sdatalen value is %s: %sa:b:c:dEefHg:h:I:i:l:mnNp:qS:s:tvV:wWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> recvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefused@@usage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZ-t %s: %sad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many argumentsconversion errorunknown keyword %susage: %s [-cipv] [-f device] [-N system] [field[=value] ...] cf:ipvN:-sysctl(machdep.cputype)hwupdatememsizememtestscrsizewatchdog_rebootdefault_bootbootdevkbdtypeconsolekeyclickdiagdevdiagpathttya_use_baudttya_baudttya_no_rtsdtrttyb_use_baudttyb_baudttyb_no_rtsdtrbannersecurebad_loginpassword/dev/eeprom/dev/openpromproperty `%s' not yet supported(out of memory)open: %sOPIOCGETOPTNODEioctl: OPIOCNEXTPROPioctl: OPIOCGETold: OPIOCGETnothing available for %s invalid keywordnew: nothing available for %ssecurity-passwordsecurity-modeoem-logoOPIOCGETNEXT %*sNode 0x%x OPIOCNEXTPROP%*s%s: %08x + OPIOCGETCHILDinappropriate value `%s' for field `%s'field `%s' not yet supportedmemory allocation failedopen: %s: %slseek: %s: %sread: %s: %swrite: %s: %seeprom contentsfailed to read field `%s'eeprom checksumfailed to update field `%s'eeprom writecount(ignoring)(fixing)eeprom writecount mismatch %seeprom checksum mismatch %seeprom checksum incorrect %senable_bannerdisabled%s=%s (%s) %s=%s unknown type 0x%x for %sunknown truth value 0x%x for %sunknown %s value %d%s=%c%c(%x,%x,%x) otherSun%s=%d (%s) %s=%d b&wttyattybcolorp4opttruefalse640x4801152x9001024x10241600x12801280x10241440x1440!!!P!(!0!8!@!P!X!`!h!p!h!x!"""!Ѐ" !А@""!p!h"( "0@"8!!! !0usage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCMNT RPCbad MNT RPCcan't access %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportportnfsv2ac0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxy"h"x"""A"B"C"D"E"F"G"H"U#pV"a"b!Ơc"e#f" h"0i"@L"Xl"pn"q"q"r"s"v"w"x"uinvalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\)\(($%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionwarning: recursive search of stdinCan't use small fgrep with -wbinary-fileshelpmmapline-bufferedafter-contextbefore-contextcontextdevicesextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetsreallocarrayreallocLine is too big to process--Binary file %s matches usage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s afh:t:vfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't set resource limit to max data sizeCan't get resource limit for data size-b %s-l %s: %sInvalid option stringusage: %s [-dfNnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] b:dfl:nNpT:t:vy%s: unknown special file or file system.strdup failedrealloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d STHE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%susage: %s [-dfln] [+linenum | +/pattern] name1 name2 ... %s: unknown option "-%c" out of memory! No previous command to substitute fortcgetpgrpTERMlicohcxnpagensamxsclsosgulosucusugpchocmcdbctiSHELL ...Skipping back ...Skipping %sto file %s --More--(Next file: %s)(%d%%)[Press space to continue, 'q' to quit.]exec failed can't fork ------------------------ [Use q or Q to quit]Line too long!%sNo previous regular expression...skipping Pattern not found Pattern not found"%s" line %lld[Not a file] line %lld...back %d page...skipping %d line ***Back*** +%lld%s %s %s[Press 'h' for instructions.] ******** %s: Not a text file ******** *** %s: directory *** MORE:::::::::::::::::::::::::::: Most commands optionally preceded by integer argument k. Defaults in brackets. Star (*) indicates argument becomes new default. ------------------------------------------------------------------------------- Display next k lines of text [current screen size] z Display next k lines of text [current screen size]* Display next k lines of text [1]* d or ctrl-D Scroll k lines [current scroll size, initially 11]* q or Q or Exit from more s Skip forward k lines of text [1] f Skip forward k screenfuls of text [1] b or ctrl-B Skip backwards k screenfuls of text [1] ' Go to place where previous search started = Display current line number / Search for kth occurrence of regular expression [1] n Search for kth occurrence of last r.e [1] ! or :! Execute in a subshell v Start up /usr/ucb/vi at current line ctrl-L Redraw screen :n Go to kth next file [1] :p Go to kth previous file [1] :f Display current file name and line number . Repeat previous command ------------------------------------------------------------------------------- , )c]!!\cX%`-V%`,i\1Sn6i!XfffffffffffffffffffffffffffffffmRQw }dNfev_gY&V0V$xYMuAAM pywy@so+lRJ'x/C/=M+ O$+malloc %zuuntrusted comment: invalid comment in %s; must start with '%s'comment too longmissing new line after base64 in %sinvalid base64 encoding in %sEdunsupported file %sverification failed: checked against wrong keysignature verification failedSignature Verifieddup failedcan't open %s for %snot a valid file: %smsg too large in %sread from %susage: %1$s -V [-eq] [-x sigfile] -p pubkey -m message verify with /etc/signify//../untrusted path %smust specify pubkeyCGSVc:em:np:qs:x:must specify sigfile with - message%s.sigpath too longmust specify messagewrite to %susage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:-1%s:*:%s:%s:%s:%s:%s usage: pwd_mkdb [-c] [-p | -s] [-d directory] [-u username] file %s.orig/etc/spwd.db%s.tmp/etc/pwd.db%s to %sline too longat line #%dline %d: superuser override in YP inclusionline %d: wheel override in YP inclusionwrite oldcan't find user in master.passwdbasedir too longusername too longcd:psu:v_shadowcannot find `%s' in the group database, aborting%s must be specified as an absolute path%s: unable to set group to %s%s: unable to make group readable__YP!close edpclose dpclose oldfclose/etc/passwd/etc/master.passwd"G"""""""""" 8"$ "0123456789abcdefUGHRBD M@dmCXLS1@2 3cPT l@bconnectedstaticospfis-isripbgpbad label: %s is %sinvalid table id: %slabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; priority is %s: %s sockaddrs: locks: inits: set_metric mtu: %s is %sset_metric expire: %s is %sking bula sez: set_metric with invalid key route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8lld%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8lld%cso_dstso_gateso_maskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketroute-sysctl-estimateactual retrieval of interface table128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)readgot message of size %d on %smust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplsnetmask missinghost: gateway %sentry in userouting table overflownot in tableno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:vrouting table %d/dev/nulladdblackholechangecloningdstexpiregatewaygethopcountifaifpinterfacejumbolinkllinfolockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortDestinationProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesExtra `@' characters in usernames and passwords should be encoded as %%40 KMGTPftp://http://file::/Can't allocate memory for URL decodingerror in base64 encoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy host.Can't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... connectr+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s Host: %s %s%s GET %s HTTP/1.0 Host: %s %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%sWriting HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: ://Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.abort%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uBad family! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %1$s [-o output] ftp://[user:password@]host[:port]/file[/] ... %1$s [-o output] http://host[:port]/file ... %1$s [-o output] file:file ... %1$s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dD:Eegik:Mmno:pP:r:S:s:tU:vVUser-Agent: OpenBSD ftpnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiAIimageM%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d: %02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. usage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): !!!P!(!0!8!@!P!X!`!h!p!X@!!x"!h!@usage: mount_ffs [-o options] special node o:filesystem not supported by kernelfilesystem must be mounted read-only; you may need to run fsckmount table full%s on %s: %sreload.@'"#"##"(##"#3H###'# "0#@ #(&"#8#@#`#P##X!°"$#`#h#p#x## # #!##p"(#x"###################(##H$x#X" #h$x#x$x#"#$x#$x#"`P#"`P###" ##(#0"w#H#`#h" #x"`P#"#"`P#"`P#"`P#"###"`P#0"w#H"`P#`#(#p"w#"`P#$x#####"(### ## #(# 8$x# H## X## p"# "w# #(# #(# "# #!#!$x#!" #!0"w#!H"w#!`$x#!x"(#!"(#!"(#!$x#!##!$x#!$x#!##"##" ##"0##"@##"P##"`##"p##"##"$x#""(#""(#""(#""(##"(##"(##("(##8###H"(##X"(##h"(##x"(##"(##"(##"(##"(##"(##"(##"(##"(#$"(#$"(#$("(#$8"(#$H"(#$X"(#$h"(#$x"(#$"(#$"(#$"(#$"(#$"(#$"(#$"(#$"(#%"(#%"(#%("(#%8"(#%H"(#%X"(#%h"(#%x#%#%"(#%"(#%"(#%"(#%"(#%"(#%"(#&"(#&"(#&("(#&8"(#&H"(#&X"(#&h"(#&x"(#&"(#&"(#&"(#&"(#&"(#&"(#&"(#&$x#'"(#' "(#'0"(#'@"(#'P"(#'`##'"(#'"(#'"(#'"(#'"(#'"(#'"(#'"(#("(#("(#( "(#(0"(#(@"(#(P"(#(`"(#(p"(#("(#("(#("(#("(#("(#("(#("(#("(#)"(#)"(#) "(#)0"(#)@"(#)P"(#)`"(#)p"(#)"(#)"(#)"(#)"(#)"(#)"(#)"(#)"(#*"(#*"(#* "(#*0"(#*@"(#*P"(#*`"(#*p"(#*"(#*"(#*"(#*"(#*"(#*"(#*"(#*"(#+"(#+"(#+ "(#+0"(#+@"(#+P"(#+`"(#+p"(#+"(#+"(#+"(#+"(#+"(#+"(#+"(#+"(#,"(#,"(#, "(#,0"(#,@"(#,P"(#,`"(#,p"(#,"(#,"(#,"(#,"(#,"(#,"(#,"(#,"(#-"(#-"(#- "(#-0"(#-@"(#-P"(#-`"(#-p"(#-"(#-"(#-#%#-"(#-"(#-$x#-"(#."(#."Couldn't open '%s': %sCouldn't write contents to '%s': %sShort contents write to '%s' (%zd vs %zu)fchmod(fd, 0x%x) of '%s' failed (%s)fchown(fd, %d, %d) of '%s' failed (%s)short IMSG_WRITE_OPTION_DBwarning: hostname %s contains an underscore which violates RFC 952short IMSG_WRITE_RESOLV_CONF/etc/resolv.confwrite_option_db: imsg_compose: %swrite_option_dbwrite_resolv_conf: imsg_compose: %swrite_resolv_confInvalid option name: '%s'Unable to clone leaseUnable to apply defaultssearch %s no memory for domainnamenameserver %s no memory for nameserver# Generated by %s dhclient no memory for courtesy lineno memory for resolv.conf contentsegresssocket errorno interface in group egress foundioctl SIOCGIFGMEMB: %sget_ifnametoo many interfaces in group egressInterface name too long: %sInterface name too longdaemoncannot forkchdir("/")%s [priv]no memory for priv_ibufpoll error: %simsg_read(priv_ibuf): %sUnable to truncate '%s': %s%s; restarting.RESTART FAILED: '%s': %s%s; exiting bootp; %s { %s interface "%s"; fixed-address %s; next-server %s; filename server-name option %s %s; renew %w %Y/%m/%d %T UTC; rebind %w %Y/%m/%d %T UTC; expire %w %Y/%m/%d %T UTC; } offeredcannot fit offered lease into option dbcannot make offered lease into stringeffectivecannot fit effective lease into option dbcannot make effective lease into stringlease file not opencannot make lease into stringoptions do not fit in DHCPDECLINE packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDISCOVER packet.DHCPDECLINE on %sdhcpoffer: no memory to record lease.option-dhcpoffer: unknown option %dBogus data for option %sdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.bound to %s -- renewal in %lld seconds.mtu size %u < 68: ignoredNo acceptable DHCPOFFERS received.Trying static lease %sTrying recorded lease %sNo working leases in persistent database - sleeping.DHCPDISCOVER on %s - interval %lldDHCPREQUEST on %s to %sUnsatisfactory %susage: %s [-d | -q] [-u] [-c file] [-i options] [-L file] [-l file] interface %s: no link .... got link sleeping No memory for rtmmsgroute socket buffer overflow%s, not %s, added to %s%s added to %sActive address (%s) deleted; exiting%s, not %s, deleted from %s%s deleted from %s%s downLLADDR changed; restarting%s departuredno memory for errmsg'%s' is not a regular filec:di:l:L:quifi calloc%s: no such interfacesetting routing table to %u: '%s'socketpair: %sno memory for unpriv_ibufconfig callocclient calloccannot open %s: %s_dhcpno such user: _dhcp%s.%s/var/db/dhclient.leasesasprintf/etc/resolv.conf.tailCannot open /etc/resolv.conf.tail: %sCannot stat /etc/resolv.conf.tail: %sno memory for resolv.conf.tail contents: %sCouldn't read resolv.conf.tail: %sGot no data from resolv.conf.tailShort read of resolv.conf.tailcan't open and lock %s: %scan't open %s: %ssocket(PF_ROUTE, SOCK_RAW): %ssetsockopt(ROUTE_MSGFILTER): %ssetsockopt(ROUTE_TABLEFILTER): %s/var/empty/setresgidsetgroups/etc/dhclient.confno memory for reject address!expecting option name.too many options.expecting hex octet.string constant too long.expecting string or hexadecimal dataexpecting ':'.expecting identifier after option keyword.unknown option name.expecting string.option data buffer overflowexpecting signed 32-bit integer.expecting unsigned 32-bit integer.expecting unsigned 16-bit integer.expecting unsigned 8-bit integer.expecting identifier.offexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.expecting interface name (in quotes).wrong interface name.expecting lease declaration.expecting left brace.no memory for lease.unterminated lease declaration.Obsolete client identifier (%s) in recorded leaseexpecting a statement.unterminated interface declaration.Corrupt lease file - possible data loss!get_rdomain socket: %sCan't create socketioctl(SIOCGIFFLAGS) on %s: %sinterface_link_forceup: SIOCGIFFLAGS failed (%s)interface_link_forceup: SIOCSIFFLAGS DOWN failed (%s)interface_link_forceup: SIOCSIFFLAGS UP failed (%s)%s receive_packet failed: %s%s too many receive_packet failures; exitinggetifaddrs failed%s rdomain changed; exitingpoll: %sdispatch%s; restartingsend_packet: %ssocket(SOCK_RAW): %ssetsockopt(IP_HDRINCL): %ssetsockopt(SO_RTABLE): %s/dev/bpf%dCan't find free bpf: %sCan't attach interface %s to %s: %sCan't get BPF version: %sKernel BPF version out of range - recompile dhclient!Can't set immediate mode on bpf device: %sCan't set filter-drop mode on bpf device: %sCan't get bpf buffer length: %sCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %sCan't install write filter program: %sCannot lock bpfcSc%s%s/%u %s""'$`\\%cpretty_print_option: bad code %d%s: Excess information in format string: %s%s: no size indicator before A in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: expecting only %d bytes: got %d%s: expecting %d bytes: got %d%huUnexpected format code %coption %s (%d) larger than buffer.option %s has no length field.Can't allocate storage for option %s.Can't expand storage for option %s.DHCPACKDHCPOFFERDHCPNACKBOOTREPLY%s from %s (%s)no memory for info stringeof in string constantstring constant too longtoken larger than internal bufferappendbackoff-cutoffbootpdenyethernetfixed-addresshardwareignoreinitial-intervallink-timeoutmediumnext-serverprependrebindrenewrequestrequireretryselect-timeoutsendserver-namesupersedetimeout%s line %d: %s%*c^ %s: msgbuf_write: %sRTM_DELETE write: %sshort RTM_DELETE write (%zd) DHCLIENT DHCLIENT %dcreating route label: %screating route label: label too long (%d vs %zu)default route socket: %sRTM_GET of default route: %sget default route read: %sno data from default route readdefault route read rtm: %ssendhup: imsg_compose: %ssendhupadd_address: imsg_compose: %sadd_addressset_interface_mtu: imsg_compose: %sset_interface_mtudelete_address: imsg_compose: %sdelete_addressadd_route: imsg_compose: %sadd_routeflush_routes: imsg_compose: %sflush_routessocket open failed: %sSIOCAIFADDR failed (%s): %sSIOCDIFADDR failed (%s): %sSIOCSIFMTU failed (%d): %sdelete_addresses getifaddrs: %sRouting Socket open failed: %sfailed to add default route: %ssysctl size of routes:routes buf realloc:sysctl retrieval of routes:route cleanup failed - %s %s (msize=%zu)opening socket to flush routes: %s%d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetroutersIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlBpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81relay-agent-informationoption-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120classless-static-routesCIAoption-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143tftp-config-fileoption-145option-146option-147option-148option-149voip-configuration-serveroption-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248classless-ms-static-routesoption-250option-251autoproxy-scriptoption-253option-254option-endexpecting semicolon.time string too longinvalid time string%w %Y/%m/%d %T UTC%w %Y/%m/%d %T%u %Y/%m/%d %Tunparseable time stringtime could not be representedexpecting unsigned 32-bit decimal value.expecting CIDR subnet.expecting '/'.Expecting CIDR prefix length.expecting 'ethernet'.expecting '.'.expecting decimal octet.filename must be a stringno memory for string %s.dispatch_imsg: imsg_get failure: %sbad IMSG_DELETE_ADDRESSbad IMSG_ADD_ADDRESSbad IMSG_FLUSH_ROUTESbad IMSG_ADD_ROUTEbad IMSG_SET_INTERFACE_MTUbad IMSG_HUPreceived unknown message, code %uusage: %s [-] [-s] [-p string] [file] cannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot seek temp filecannot write temp filecannot read temp filep unexpected end-of-file& no previous commandinvalid pattern delimiter%d \  \abfnrtv\cannot read stdincannot write filecannot open output filecannot close output filecannot read input filenewline inserted newline appended cannot open input filecannot close input fileinvalid mark charactered.hup/ed.hupno current filenameinvalid filenamefilename too longno matchnumber out of rangeinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailable!unknown commandHOMEcrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s unbalanced brackets ([])trailing backslash (\)no previous patterninfinite substitution loopnothing to undo%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory lchown: %supdate times: %schown: %schmod: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %soverwrite %s? #F#F#F#F#G#G `^4[<_#G(#G0#G8#D`#Dh      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs#GH#GX"(#Gh#Gx#G#G#G#G"(Vusage: %s [-123456789cdf%sh%slNnOqrt%sv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfh%slNnqrt%sv] [-o filename] [file ...] usage: %s [-f%shqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimens: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gz123456789ab:cdfhLlNnOo:qrS:tVvcfhLlNno:qrtVvfhqrZgzz1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... group is %s: %suser is %s: %sHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %sinvalid file mode: %susage: %s [-g group,group,...] [-u user] newroot [command] g:u:no such user `%s'unable to get login class for `%s'too many supplementary groups providedno such group `%s'setusercontextsetuid"h"p"x"""""""" 8"""P"""!"H"`"" @ ?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRFILELINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu NAME=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%lld %s I=%lluBAD STATE %d TO BLKERR cannot find inode %llu bad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d Cannot allocate space for inode buffer cannot allocate memory for inode cache cannot increase directory listbad inode number %llu to nextinode %llu bad inode number %llu to ginode I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s PARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)cannot alloc %zu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER starting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****-%c flag requires a %s Alternate super block location: %d conversion levelcannot do level %d conversion bad mode to -m: %o ** lost+found creation mode %o usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:BADEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEDUPEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.cannot alloc %zu bytes for inoinfoPARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %lld bad indirect addr: %lld LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llutoo many inodes %llu, or out of memory phase 1, inode %llu/%lluphase 1b, inode %llu/%lluROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORT%s %s: LENGTH %zu NOT MULTIPLE of %d%s %s: LENGTH %zu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'phase 2, directory %d/%dphase 2, parent directory %d/%dBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (REMOVED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%llu phase 3, directory %d/%ldZERO LENGTHBAD/DUPphase 4, inode %llu/%lluDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %lld MARKED FREE ALLOCATED FRAG %lld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%dioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKsuperblock mismatchesoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATECan't open %s: %s Can't stat %s: %s %s is not a character device** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d ** F%sile system is clean; not checking ** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %zu bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %llu out of rangereturning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %lldProgram terminated WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %lld (%lld),PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ:deadlocked buffer pool   delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modePATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk label%s: unknown disk typeioctl (GDINFO)%s: can't read disk label; disk type must be specifiedinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s is mounted on %s%s: block device%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %llu sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %llu out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d fragmentsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemcan't get rlimitwarning: fsck_ffs will need %lluMB; min(ulimit -dH,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d usage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %llu): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countblocksizebsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:p\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangewfile too longno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'-i may not be used with stdinrename()%s: %s %sin-place editing onlyworks for regular files%s/sedXXXXXXXXXX ..."usage: sed [-aEnru] [-i[extension]] command [file ...] sed [-aEnru] [-e command] [-f command_file] [-i[extension]] [file ...] Eae:f:i::nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtv#8 )#@ CX#H ;!` ;#X .p#h :#p # &# # '# ;# A# .p# .p# '# 7`# %# %"g ###( bd#0 G#8 q#@ St#H G#X St#h [x#p J#x T# G# T# Rl# c# P# Z # a# \# q# G# v$# V# Ql!ˆ H# G$ x#-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$!##4"##t#f#c#d#s#l#m#n"p " # # # # X# # # |# #0 ,#@ #H `#X ! #` # #p # #0 # # # d# x# # 4# # # # #0 #@ #P X#X #h x# # # <# # Ǥ# `# # # p#( L#p 0#8 @#P H#X #h #x # # t# #"X##++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():tc8###IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }###lX#"#a##c#"0##e###i"k#l#X"Hm#C!n# f#(#0#Hb#8u#@#P#Xp#hr!h#s#xh#v#`#####x!Ƹ##### # # # # ##"֐##!@#({#0}#4#8#@#H#P#X#`#P #@#H#0#P#X]]<>!let||&&()" #0##lX#"Q# # " " ### #0#8#@#Htc8@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directorybad substitutionCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletprintpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tacan't suspend a login shellinvalid file modeusage: mknod [-m mode] name b|c major minorusage: mknod [-m mode] name ptime: -%s unknown optiontime: -%s requires an argument:p%s%*lld.%02ld%s%s%*lldm%02lld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numberugorwx%#3.3o bad numberaugo=+-rwxugoXsbad masktrap -- bad signal %sprsu,REPLYnothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift*=times*=trap+=wait+readtest+trueulimit+umask*=unsetsuspendmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited %ld unlimitedinvalid limit: %s-%c exceeds allowable limitbad -%c limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS!"#$&'()*:;<=>?[\]`{|}\;|&()`+@!fileglob: substitute errorFPATHLINES nothing to yank yank something firstduplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return code I-search: beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeoteot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markyankcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $(<) input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %s_builtin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16 %.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %d%Tfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlj_suspend: tcsetpgrp() failed: %sj_suspend: setpgid() failed: %scheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrksh/shSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPautoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractiveloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedrestrictedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextracealnumalphablankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunexpectedunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s too many <<'s too many redirections forselect%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildofunction{}[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T! %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --blowfish,%spref too longunable to get login class `%s'localciphercan't generate hashusage: %s [-b rounds] [-c class] [-p | string] rounds is %s: %spb:c:Enter string: getpassusage: %s seconds usage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longusage: %s [-s] [-M core] [-N system] sM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-s] [name-of-host] sethostnamegethostname/etc/networksB/("q7D#e͵M;/ۥۼ9V[H8Y?O^mB[Epo$1N䲌U }r]t{oޱ;%5ti&iJG8O%Ƌյ$ we-,oY+uJtn\ܽAvڃS>QRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGXj ggʧ;l٫Ak[~!yB/q7Dۥ9V[Y?^[$1U }r]tޱtiG$ -,oJt\vژ>QR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqxj gg= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d %u.%u.%u.%uSHA256EndSHA256DataSHA256FileChunk0123456789abcdefsethostnamesetproctitleSignal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGSTOPTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHINFOUSR1USR2THRsystemnonnewlineordinaryregcomp[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashzeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELstrtofflags ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaquesysconfgetbsizeBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocks_strptime%m/%d/%y%Y-%m-%d%H:%M%I:%M:%S %p%H:%M:%SESTCSTMSTPSTEDTCDTMDTPDT__lshrdi3__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/dprintfvdprintfsetmoderegerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***_errc/etc/ttysrtsctssoftcarwindowttyname_r/var/run/dev.db_errxMD5TransformMD5PadPOSIX_V6_ILP32_OFFBIGPOSIX_V7_ILP32_OFFBIG-lpthread_errinet_atoninet_addrreadpassphrasetcsetattrSipHashglob2glob0globexp1globmarshal_new_authauthunix_refreshauthunix_validateauthunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problemauthunix_create: out of memory regexecHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread ASTinet_networkunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s__ashrdi3__ashldi3utimegetservent_r/etc/services,/if_indextonameasprintf_warnxgettimesyslog%h %e %T timegetdomainnameyp_nextyp_matchyp_next: clnt_callyp_match: clnt_callfts_statfts_safe_changedir__fdopendirreaddirgetdiskbynameb0b1ncdtscsbpxbxfxoxtxdxgetentcgetnextcgetent%s.dbtc|:tcsetpgrp_yp_dobind/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFDclnttcp_createclnttcp_callreadtcpclnttcp_create: out of memory inet_makeaddrputsC__fixunsdfdi=Agetprotoent_r/etc/protocolsSHA1TransformSHA1PadstrunvisstrnunvissetvbufSHA512EndSHA512DataSHA512FileChunk0123456789abcdefpclosepopenexecvpeexeclpexecleexeclexecvp: : path too long printfxdr_array: out of memory clnt_sperrorRPC: (unknown error code)%s: %s - %s %s: %s ; errno = %s; low version = %u, high version = %u; why = (unknown authentication error - %d); s1 = %u, s2 = %u... RPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)fputsperrorset_input_fragmentxdrrec_skiprecordxdrrec_getlongxdrrec_create: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~fseeko_warncfprintfrealpathfscanfstrtof__sulp_D2Astrtod<Ҳ؉9I#ը32D=%[όh(doCinityan@??5?55?5__strtord__ulp_D2Acrypt_newhashcrypt_checkpassblowfishbcryptblowfish,8bcrypt_hashpassOrpheanBeholderScryDoubtbcrypt_initsaltbcrypt_newhashbcrypt_autoroundsbcrypt_checkpass6789:;<=>?  !"#$%&'()*+,-./012345./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$2%c$%2.2u$$2b$%2.2u$testpasswordBlowfish_expand0stateBlowfish_expandstateblf_ecb_encryptblf_ecb_decryptblf_cbc_encryptblf_cbc_decrypt1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىyinitshells/etc/shells/bin/csh/bin/kshinet_ntop4inet_ntop0123456789abcdef^[Yy]^[Nn]yesMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Ymemcpybackwards memcpy__stack_smash_handlerstack overflow in function %ssyslog_r__vsyslog_r_rsyslog%s: unknown facility/priority: %x<%d>[%ld]Error %dlibcUnknown signal: Unknown error: load_msgcat_catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%l.%c/%N.cat:/usr/share/nls/%l/%N.catLC_ALLLC_MESSAGESLANGUndefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedCannot allocate memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supportedvsnprintfwrterrormalloc_initmalloc() warning: unknown char in MALLOC_OPTIONS (%d) in recursive callchunk info corruptedmodified chunk-pointerchunk is already freeregions_total not 2^xinternal struct corruptmunmap/etc/malloc.confMALLOC_OPTIONSmalloc init mmap failedmap roundmalloc cachemunmap roundmalloc cache underflowmalloc free slot lostmalloc cache overflowbogus pointer (double free?)bogus pointerguard sizemprotectdouble freefree():free() called before allocationpp & bitsposix_memalign():mapalign bad alignmentmapalign roundcalloc():realloc():malloc():rvOK__strtodg !#&(*-/14<V__ratio_D2A__trailz_D2AABCDEFpmap_getport<clntudp_bufcreateclntudp_callclntudp_create: out of memory authnone_createxdrmem_putlong_unalignedxdrmem_getlong_unalignedbindresvport_saxdr_freexdr_intxdr_u_intxdr_int32_txdr_u_int32_txdr_shortxdr_u_shortxdr_int16_txdr_u_int16_txdr_charxdr_u_charxdr_boolxdr_int64_txdr_u_int64_txdr_stringxdr_string: out of memory xdr_bytes: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~__res_randomid if_nametoindexgetifaddrsinet_pton4inet_pton01234567890123456789ABCDEF0123456789abcdefstrtonumtoo small__moddi3 ((((( AAAAAABBBBBB fopengethostname  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~fdopen_conv_fmtstrftime-0%2d%03d%e-%b-%Y+%04d%a %b %e %T %Ygetsecstimesubtime2subtime1tzloadtzparselocalsubposix2timectime_rmnGMT/etc/localtime/usr/share/zoneinfoposixrules,M4.1.0,M10.5.0abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page__floatdidfasctime3JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat??? ??? ?? ??:??:?? ???? %Y%.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s __hash_openhash_access%$sniglet^&__big_splitfwritegetenvmktemp_internalchacha_encrypt_bytes_rs_stirarc4randomexpand 32-byte kexpand 16-byte ksnprintfInfinityNaN`__flt_roundsabort__dtoa??҇coCa?Ɗ(`ȳ?DPy@$@@__b2d_D2A__d2b_D2ACAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doC?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒ}__lmulq__muldi3__swhatbuf__smakebuf__umoddi3__qdivremgetpagesizeUS-ASCIINONEUTF8_citrus_utf8_ctype_wcsnrtombs__put_page__get_page__split_page%s/_hash.XXXXXXHASH: Out of overflow pages. Increase page size "("("("("("("(!!P"/h"("(!"("/p"("(!"("("/x"/## #0#@#P#`#p#x#ψ###"######### #(#0"(#8#@#H#P#X#`#h#p#x#Ҁ#҈#Ґ#Ҙ#Ҡ#Ҩ#Ұ#Ҹ#P#`#p#x#و#ِ#٠#ٰ#######`#h#p#x#ڰ#ۀ#ۈ#ې#ۘ#ڰ##`#h#x##########(#8#H#X#p#########(#@#X#p#####`#h#x##########(#8#H#X#p#########(#@#X#p#######8#P#h#x##### #H#h#######0#P#h###$$ $(" "$0$8$@$H$P$X$`$h$p$x$$$$$$$$$$$$$$$$$$($0$$8$@$H$P$`$h$x$$$##P#@$@$X$p$$$$$$$$0$H$h$$$$$$$$ $0$@$X$x$$$$$$$ #($ $ H$ `$ $ $ $ $ $ $ @$ X$ p$ $ $ $ $ $ 0$ @$ X$ $ $ $ $ $ $ H$ p$ $ $ $ $ $ $ $ 8$ H$ `$ x$ $ $ $ $$ $8$X$$$$$$$$($X$p$$##`#h#x##########(#8#H#X#p#########(#@#X#p###"("("("("("("("4"("("$"#"$$$$$$$$$$$$$$$($0$$8$@$H$P$`$h$x"$0$8$@$H$P$X$`$h$p$x$$$#P#$h$$"D8HD8Pt8dt8`$ t4 #`#X#p#À#Ð#à4 ##ð##"X!݀## te({hte8te0###m#8#Ĉ#x#Ġ#İ#"ɠ##@!# #(#8#P#0##@!#X"@!݀#X#h!h"" " " " #`#" ##Ő#h#Ũ##p{p"(####"X###8#H##X"9"4#x#`#Ɛ#"X##X#ư##ƨ#(# ###0#8#(#P#H#`#x#Lj#Ǩ#ǘ{p#ǰ#Ǹ#####4#!{x{"# #&"h#H{#X#h#p#Ȉ{{{"`#Ȑ#ؠ" #!@!(!P!Ҁ#Ȱ#ȸ#Ƞ""p!{####ʐ#x#h#H# ####ɠ#p#H#(##ʰ#ʸ"["#]te<te@4!#h##ˀ#˘#P##˸####H####(##H#`#h#p#̈#̐#x#̠"(#h#̀##@#(#0#̰####͠# ###ͨ"h##"("W#l`#lX##@#`#h#΀#H#Θ#θ#Ϙ{#Ϩ#ϸ###ؠ#{###{teH{{## {(#X#h#@#0#Ѐ##Ш##{(#H#ш#X#h#x#Ѡ{@{@teL"[#Ѱ!݀!h"" #{HteteP#####4"#H#8#{X#("(#ڐ##P#p"#8"X"{x{t{pthth#ڴ4"4"#ڠ##(#8#P#@#۠##۰# `##pti#܈""a #x"["#]{`{d{{H#߀#ؠ#8#"!#ߐ#ߘ!8#ߠ{h{p#ߨ#߸"X"[ti#####l`#"["#]{{{x{Ȥ{Ƞ{Ȑ##0#@ 8{,{Ѩ"\#fX#P#`#ptj&&#x"4##4##{Ұtjxtj|######8##X#tj###8#`tjtjtj###"(###{Ӱ{{" ####ؠ###"[tj#(## #8!"ָ{tj#@#P#h#X###"9"4"(##{tjtk"p###n(!"E"X###"8!ƈ### #(#0#8#@#tk\{Մ{Ռ{Հ{Ո{|{x#h#ؠ#p#H#x#P#`#tkd####### #0tkh#h#@#P#`#{Ք{Ր{՘#fX#!Ȑ##!Ȑ"####"h{՜{ը" ###ؠ##### #0#@#x#H#X#htk{մ##" !h"#!h" "4####lX#l`#####4#{ո4$$# #P#@#]#####h#fX#!݀#X###fX#"tk### #0#P#X"["#]#`"4"9#h#xtk#{ּtk{ָ#tk###"ip"ih### 8#"p"h###!Ȑ##tk###H#X#`" #(#8#p#{{##p########X####(#8#H{${({ tl$#ؠ$#H$$"e{0$"($$$$"($0$$X"v$h!݀#fX""$($`{p$x$$$$$ $8##$($$$| |{| $$ #(#H#fX$$0$@$X$p$$$$$$$"Vp$$$ $0$H$`$$$x$$$$$$$@$($P$`$p|@$|@$## 8#$"h#"ip#"ih$!Ȑ|@$$|@ "#$|@H|@|F|Y|@PtmH|Y$|Y $0$@$ tm`$x$P$h|Y(tmx$tmtmtm$$$tm|Y,$$$$ $0$@$P$`$p$$$$$$$$|Y@tm|YP|YD|YF|YH|YL|YJ$0tn|YNtm|YX$ $8$H$x$$$X$h4'0$$$$$$4'P$"0$0#$`$X"a #$H$"w##(#8#P$8$@#fX#@!$ #$$|Y|Y||Y`$@|Z|Ztn|Z|Z|Z|Y|Yt|Yx$x#$$$$X$$H"9!$$p$$$$"$$"h$$Y$)|Z|Z"p$$$$x$  D|$$$$ $0$8#$@$$|[|[$P$h$x$$$$"$$!Ȑ"$$$$$$ $"ip$($0$8#"h|[ tn$|[H$h|dH$@$P$x$$$$tn8$$|dP$$$ "($ "/$ X$ ("Q$ 8$ h$ H"h ttn 4&ttlht{O$ d@|ktmXt{|ktl,tj0<$tlqp|k|k|ktn|k4 tl|d\|mtktl$tj$tn tl t8Xtnt{ |ktl0|l$`|rtk`tl4%te |dhtl(|k|k|ktjtm8\ |r|mtmttn T|ktn(|m|mqvP"(!!!!&!&!&!/t!A!]T!^!^!h!!!!ӈ!2!=T"H!4! ɔ!( !0x!87!HH|!PH|!XH|!`c!hkh!p!x!€!ˆ\!! !¨b0!°!¸!!#`!/!A!A!A!!!!! "_!0{P!8d!@!H!P!X(!` d!h d!p d!x X!À 8!È !Ð !Ø à!`unblock and -DNO_CONV?! x OP!@ , 2@!H!X!`"(!x"(!Ӑ"(!Ӡ"(!Ӹ"(!"(!!!!!!!! !"(!!P@!"(!0!!@!@"("(!H!P#h!ްe!޸gt!gt!e@!d8!dx!h!e!ݸhp!d!f!e!f!h!f`! f,!(g!0g!8e@#ϐf!@f!Hf/tmp/EdDk.aXXXXXXXXXX" 8""""" H" "("0"8"@"H"P"X"`"h"p"x"""""""" 8"""P"""!"H"`"" ! "p"/ "/ @"/ "/ @@ "/0 @"/@(@"/P %("/`@! "p `N"/@"/`_!"p@d!t> t?t?ht?t? !(T$p,0"M($l,0 tl8uϤ.? ;"!8"`"h"p"x"v֔v(vHv8vָvPvوvlPtDX.""""""t.Ad"#|" 6x"(6x"00 "8."H."X1x"`3"h-p"p!.""1x"(,h!P6x!0Q6x"X."Y58"[."`."a58"c."h*|"#|"#|"#|#|"("8"0"H"X"8"@"H"P"X "`"h"p"x"""" !H!P"X yP^   """"""͘""!` " !X " " ""Հ" ""(#"H"xP"0"@"-"H"P!#"X"H"h"P "p!""!0#"$"׀%"׈&"Ͱ'$ ("ט)"zX*"h+"נ,"ר-"װ."׸/"0"1"2"3"4"5"6"7"ͨ8"p9":"(" "8"X"؀"ؘ""" "@"`"ـ"٨"""("P priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDMPATHMPLSLOCALBROADCASTUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC SRCMASK LABEL<NOOP !""""""" 0"(# (( 0(EHC P E(  0(EHDHC{#pHtV"(#O8 ... ..."w#J#J#J#KvPsjph`Dn``qp!!!P!(!0!8!@!P!X!`!h!p!X@!x!h@@@......#|#|#| #|(!#|0 ! #|8#|@#|H#|P#|X!#|`#|p"#|x#|{}abcdDgGhHilnNpPqrs tw xy !:#={3{3tc P#####"#lX#4###(#####"#h#x######### "#8!#@!!!(#`"0!H"#H#P!È#X!8!X!h#`#h!`###H#p###H###u(#p#{g` _ xx:xx:xx:xx:xx:xx0000000000000000 /etcte0#̈{@##"(##@"(#" "(##x"(#""(##Ӡ"(##"(## "(##Ԁ"(#u#Ԩ"(##԰"(##"("(######## #(#0#8#H #P #X #P #` #h #x #Հ #Ր #՘ #ը#հ#ո############# #(#0#8#@#H#P#u #X!#p"#ր##֐$#֠%#ְ&#'#(#)#*#+# ,#(-#0-#@.#H.#X/#P/#`0#h1#p2#x3#׀4#׈5#א6#ט7#נ8#ר9#װ:#׸;#<#=#>#?#@# [#8\#H\#X]#p^#؀^#ؘ_#ب_#ظ`#{#{#|#}#}#(~#0GMTUTC#ܘ#ܨ#####(#8#P#58#`#p#ݐ#ݠ## ## ##( #H#X #p"Vp #ހ#ސ#޸#####("(#P###H#p###H###u(#p#)),+T*?"(" 8""""" H" "("0"8"@"H"P"X"`"h"p"x"""""""" 8"""P"""!"H"`"" <|YRYZh\] P[#Nkh455" $$4$D4$T\4&4'$tl0 |ntl |o tl |ptmLtl0tmL|@tmX^ZPZZ,[,Zdee\eeeji`mm<llll0lkkkllll0lpk$$ tntn5|[HRuneCT10NONEBBBBB@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~$t{######### #u@##tn<t{ t{4DlX\h.shstrtab.note.openbsd.ident.init.text.fini.rodata.eh_frame.openbsd.randomdata.jcr.data.rel.ro.got.ctors.dtors.data.bss TT0%x+1!((_x9$  C4  W4  \4  TiD((HnD8H8HuD8P8P|t8X8XBt{H {H@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3bin*Binaries Commands and Source//sbin/nologin1binrdrrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody f]\W operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpa  n}^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3bin*Binaries Commands and Source//sbin/nologin1binpbprootdaemonCharlie &/root/bin/kshs2rootdaemonCharlie &/root/bin/kshs3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody e\[V  operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpa  n}^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]="&& chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]="&& chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]="&& chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]="&& chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 bio diskmap random R fd0 sd0 sd1 sd2 rd0 cd0 ;; std) M console c 0 0 600 M tty c 2 0 M mem c 3 0 640 kmem M kmem c 3 1 640 kmem M null c 3 2 M zero c 3 12 M stdin c 24 0 M stdout c 24 1 M stderr c 24 2 M ksyms c 122 0 640 kmem M klog c 16 0 600 M eeprom c 3 11 600 M openprom c 70 0 600 ;; vscsi*) M vscsi$U c 128 $U 600 ;; uk*) M uk$U c 120 $U 640 operator ;; tun*) M tun$U c 111 $U 600 ;; systrace) M systrace c 50 0 644 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 119 $n 644 n=$(($n+1)) done ;; pppx*) M pppx$U c 130 $U 600 ;; pf*) M pf c 59 0 600 ;; openprom) M openprom c 70 0 ;; hotplug) M hotplug c 131 $U 400 ;; fuse) M fuse$U c 82 $U 600 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 24 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 129 0 640 operator ;; bpf*) M bpf$U c 105 $U 600 ;; bio) M bio c 124 0 600 ;; audio*) M sound$U c 69 $U M mixer$U c 69 $(($U+16)) M audio$U c 69 $(($U+128)) M audioctl$U c 69 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 30 0 644 M apmctl c 30 8 644 ;; wsmouse[0-9]*) M wsmouse$U c 80 $U 600 ;; wsmux|wsmouse|wskbd) M wsmouse c 81 0 600 M wskbd c 81 1 600 ;; wskbd[0-9]*) M wskbd$U c 79 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyIcfg ttyI0 ttyI1 ttyI2 ttyI3 ttyI4 ttyI5 R ttyI6 ttyI7 ttyI8 ttyI9 ttyIa ttyIb ttyHcfg ttyH0 ttyH1 R ttyH2 ttyH3 ttyH4 ttyH5 ttyH6 ttyH7 ttyH8 ttyH9 ttyHa ttyHb R ttyGcfg ttyG0 ttyG1 ttyG2 ttyG3 ttyG4 ttyG5 ttyG6 ttyG7 R ttyG8 ttyG9 ttyGa ttyGb ttyFcfg ttyF0 ttyF1 ttyF2 ttyF3 R ttyF4 ttyF5 ttyF6 ttyF7 ttyF8 ttyF9 ttyFa ttyFb ttyEcfg R ttyE0 ttyE1 ttyE2 ttyE3 ttyE4 ttyE5 ttyE6 ttyE7 ttyE8 ttyE9 R ttyEa ttyEb ttyDcfg ttyD0 ttyD1 ttyD2 ttyD3 ttyD4 ttyD5 R ttyD6 ttyD7 ttyD8 ttyD9 ttyDa ttyDb ttyCcfg ttyC0 ttyC1 R ttyC2 ttyC3 ttyC4 ttyC5 ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 78 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 78 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; bpp*) M bpp$U c 104 $U 600 ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 20 $(($off+$n)) M pty$nam c 21 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 125 0 666 ;; tty[a-z]) u=${i#tty*} case $u in a) n=0 ;; b) n=1 ;; c) n=2 ;; d) n=3 ;; e) n=4;; f) n=5;; *) echo unknown tty device $i ;; esac M tty$u c 12 $n 660 dialer uucp ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 36 $o 660 dialer uucp M cua$U c 36 $(($o+128)) 660 dialer uucp ;; spif*) case $U in 0) offset=0 nam=j;; 1) offset=16 nam=k;; 2) offset=32 nam=l;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 8 ] do name=${nam}`hex $n` M tty$name c 102 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 103 $(($offset+0)) 600 ;; magma*) case $U in 0) offset=0 nam=m;; 1) offset=16 nam=n;; 2) offset=32 nam=o;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 16 ] do name=${nam}`hex $n` M tty$name c 100 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 101 $(($offset+0)) 600 M bpp${nam}1 c 101 $(($offset+1)) 600 ;; cua[a-z]) u=${i#cua*} case $u in a) n=0 ;; b) n=1 ;; c) n=2 ;; d) n=3 ;; e) n=4;; f) n=5;; *) echo unknown cua device $i ;; esac M cua$u c 12 $(($n+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 11 $n 660 operator M ${pre}rst$U c 18 $n 660 operator n=$(($n+1)) done ;; ch*) M ch$U c 19 $U 660 operator ;; vnd*) dodisk vnd $U 8 110 $U 0 ;; rd*) dodisk2 rd $U 17 106 $U 0 ;; fd*) typnam=$U${i#fd[01]*} case $typnam in 0|1) typnum=0;; # no type specified, assume A *A) typnum=0; typnam=0;; *B) typnum=1;; *C) typnum=2;; *D) typnum=3;; *E) typnum=4;; *F) typnum=5;; *G) typnum=6;; *H) typnum=7;; *) echo bad type $typnam for $i; exit 1;; esac case $U in 0|1) blk=16; chr=54;; *) echo bad unit $U for $i; exit 1;; esac nam=fd${typnam} n=$(($(($U*128))+$(($typnum*16)))) M ${nam}a b $blk $n 640 operator M ${nam}b b $blk $(($n+1)) 640 operator M ${nam}c b $blk $(($n+2)) 640 operator M ${nam}i b $blk $(($n+8)) 640 operator M r${nam}a c $chr $n 640 operator M r${nam}b c $chr $(($n+1)) 640 operator M r${nam}c c $chr $(($n+2)) 640 operator M r${nam}i c $chr $(($n+8)) 640 operator ;; cd*) dodisk2 cd $U 18 58 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R presto0 bpp0 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 cd0 R cd1 rd0 xy0 xy1 xy2 xy3 tun0 tun1 tun2 tun3 bpf0 bpf1 bpf2 R bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 fd1 fd1B fd1C fd1D R fd1E fd1F fd1G fd1H fd0 fd0B fd0C fd0D fd0E fd0F fd0G fd0H R diskmap vscsi0 ch0 bio cuaa cuab cuac cuad ttya ttyb ttyc R ttyd audio0 audio1 audio2 fuse pppx hotplug ptm local wscons R uk0 random tty00 tty01 tty02 tty03 tty04 tty05 tty06 tty07 R tty08 tty09 tty0a tty0b apm pf systrace xd0 xd1 xd2 xd3 std R st0 st1 fd ;; presto*|xd*|xy*|sd*) case $i in presto*) dodisk presto $U 26 25 $U 0;; xd*) dodisk xd $U 10 42 $U 0;; xy*) dodisk xy $U 3 9 $U 0;; sd*) dodisk sd $U 7 17 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi . ..MAKEDEVconsole tty memkmemlenulllezerolestdinestdoutstderrksymsklogeepromopenprombpf0rom biodiskmaprandomsrandomurandomarandomfd0aomfd0bomfd0comfd0iomrfd0amrfd0bmrfd0cmrfd0imsd0amrsd0amsd0bmrsd0bmsd0cmrsd0cmsd0dmrsd0dmsd0emrsd0emsd0fmrsd0fmsd0gmrsd0gmsd0hmrsd0hmsd0imrsd0imsd0jmrsd0jmsd0kmrsd0kmsd0lmrsd0lmsd0mmrsd0mmsd0nmrsd0nmsd0omrsd0omsd0pmrsd0pmsd1amrsd1amsd1bmrsd1bmsd1cmrsd1cmsd1dmrsd1dmsd1emrsd1emsd1fmrsd1fmsd1gmrsd1gmsd1hmrsd1hmsd1imrsd1imsd1jmrsd1jmsd1kmrsd1kmsd1lmrsd1lmsd1mmrsd1mmsd1nmrsd1nmsd1omrsd1omsd1pmrsd1pmsd2amrsd2amsd2bmrsd2bmsd2cmrsd2cmsd2dmrsd2dmsd2emrsd2emsd2fmrsd2fmsd2gmrsd2gmsd2hmrsd2hmsd2imrsd2i \sd2j \rsd2j \sd2k \rsd2k \sd2l \rsd2l \Msd2m \Nrsd2m \Osd2n \Prsd2n \Qsd2o \Rrsd2o \Ssd2p \Trsd2p \Urd0a \Vrrd0a \Wrd0c \Xrrd0c \Ycd0a \Zrcd0a \[cd0c \\rcd0c \ #------------------------------------------------------------------------------- #------------------------------------------------------------------------------- usage() { echo "usage: ${0##*/} [-a] [-f filename]" >&2 exit 1 } waitcgiinfo() { wait "$CGIPID" 2>/dev/null [[ -s $CGI_INFO ]] || return sed -n "s,^http://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $CGI_INFO >$HTTP_LIST 2>/dev/null set -- $(sed q $HTTP_LIST) : ${HTTP_SERVER:=${1%%/*}} CGI_METHOD=$(sed -n '/^method=/s///p' $CGI_INFO 2>/dev/null) CGI_TZ=$(sed -n '/^TZ=/s///p' $CGI_INFO 2>/dev/null) CGI_TIME=$(sed -n '/^TIME=/s///p' $CGI_INFO 2>/dev/null) } #------------------------------------------------------------------------------- #------------------------------------------------------------------------------- bsort() { local _l _a=$1 _b (($# > 0)) || return shift for _b; do if [[ $_a != $_b ]]; then if [[ $_a > $_b ]]; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } http_time() { local _sec=$(cat $HTTP_SEC 2>/dev/null) [[ -n $_sec && -n $CGI_TIME ]] && echo $((CGI_TIME + SECONDS - _sec)) } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [[ -n $_l ]] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } stripcom () { local _l [[ -f $1 ]] || return set -o noglob while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 set +o noglob } tmpdir() { local _i=1 _dir until _dir="${1?}.$_i.$RANDOM" && mkdir -- "$_dir" 2>/dev/null; do ((++_i < 10000)) || return 1 done echo "$_dir" } #------------------------------------------------------------------------------- #------------------------------------------------------------------------------- diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;H;d;}' \ -e '/.*# total bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } makedev() { [[ -z $(cd /dev && sh MAKEDEV "$@" 2>&1) ]] } scan_dmesg() { bsort $(sed -n "$1" /var/run/dmesg.boot) } scan_disknames() { local IFS=, bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -n "$1") } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { local _if _iflist=$(rmel vlan $(ifconfig -C)) for _if in $(ifconfig "$@" 2>/dev/null | sed -n 's/^\([^[:space:]]*\):.*/\1/p'); do isin ${_if%%+([0-9])} $_iflist || echo $_if done } getdevname() { local _dev=$1 if [[ ${#_dev} == 18 && $_dev == +([0-9a-f]).[a-p] || ${#_dev} == 16 && $_dev == +([0-9a-f]) ]]; then sysctl -n hw.disknames | sed -nE "s/^(.*,)*(.*):${_dev%.?}.*/\\2/p" else _dev=${_dev#/dev/} print -r -- "${_dev%[a-p]}" fi } disklabel_autolayout() { local _disk=$1 _f=$2 _dl=/disklabel.auto _op [[ $_disk != $ROOTDISK ]] && return while $AUTO; do ask "URL to autopartitioning template for disklabel?" none [[ $resp == none ]] && break echo "Fetching $resp" if ftp -Vo $_dl "$resp" && [[ -s $_dl ]]; then disklabel -T $_dl -F $_f -w -A $_disk && return echo "Autopartitioning failed" exit 1 else echo "No autopartitioning template found." exit 1 fi done while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in [aA]*) _op=-w;; [eE]*) _op=-E;; [cC]*) return 0;; *) continue;; esac disklabel -F $_f $_op -A $_disk return done } #------------------------------------------------------------------------------- #------------------------------------------------------------------------------- lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $cppid 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } #------------------------------------------------------------------------------- #------------------------------------------------------------------------------- get_responsefile() { local _rf _ifdev _mac _mode _lf _hn _path action= [[ -f /auto_upgrade.conf ]] && _rf=/auto_upgrade.conf _mode=upgrade [[ -f /auto_install.conf ]] && _rf=/auto_install.conf _mode=install [[ -f $_rf ]] && cp $_rf /ai.$_mode.conf && action=$_mode && return for _ifdev in ''; do [[ -x /sbin/dhclient ]] || break set -- $(get_ifdevs netboot) (($# == 0)) && set -- $(get_ifdevs) (($# == 1)) && _ifdev=$1 while (($# > 1)); do ask_which "network interface" \ "should be used for the initial DHCP request" "$*" isin "$resp" $* && _ifdev=$resp && break done [[ -n $_ifdev ]] && dhclient $_ifdev || break _lf=/var/db/dhclient.leases.$_ifdev export AI_SERVER=$(sed "/^ *next-server /!d;s///;s/;$//;q" $_lf) _mode=$(sed -E '/^ *filename "(.*\/)?auto_(install|upgrade)";$/!d;s//\2/;q' $_lf) _path=$(sed -E '/^ *filename "(.*\/)[^/]+";$/!d;s//\1/;q' $_lf) _hn=$(sed -E '/^ *option host-name "(.*)";$/!d;s//\1/;q' $_lf) hostname "$_hn" done if [[ -n $AI_SERVER && -n $_mode ]]; then _mac=$(ifconfig $_ifdev | sed 's/.*lladdr \(.*\)/\1/p;d') for _rf in {$_mac-,${_hn:+$_hn-,}}$_mode; do _url="http://$AI_SERVER/$_path$_rf.conf?path=$HTTP_SETDIR" echo "Fetching $_url" if ftp -Vo "/ai.$_mode.conf" "$_url" 2>/dev/null; then action=$_mode ifconfig $_ifdev delete down 2>/dev/null return 0 fi done else [[ -z $AI_SERVER ]] && echo "Could not determine next-server." [[ -z $_mode ]] && echo "Could not determine auto mode." fi while :; do ask "Response file location?" \ "${AI_SERVER:+http://$AI_SERVER/install.conf}" [[ -n $resp ]] && _rf=$resp && break done _mode=$(echo "$_rf" | sed -En 's/^.*(install|upgrade).conf$/\1/p') while [[ -z $_mode ]]; do ask "(I)nstall or (U)pgrade?" [[ $resp == [iI]* ]] && _mode=install [[ $resp == [uU]* ]] && _mode=upgrade done echo "Fetching $_rf" [[ -f $_rf ]] && _rf="file://$_rf" ftp -Vo "/ai.$_mode.conf" "$_rf" 2>/dev/null && action=$_mode ifconfig $_ifdev delete down 2>/dev/null [[ -n $action ]] } _autorespond() { typeset -l _q=$1 _key local _def=$2 _l _val [[ -f $RESPFILE ]] || return mv /ai.conf /ai.conf.tmp while IFS=' ' read -r _l; do [[ $_l == [!#=]*=?* ]] || continue _key=${_l%%*([[:blank:]])=*} _val=${_l##*([!=])=*([[:blank:]])} [[ $_q == @(|*[[:blank:]])"$_key"@([[:blank:]?]*|) ]] && resp=$_val && cat && return print -r " $_l" done /ai.conf [[ -n $_def ]] && resp=$_def && return echo "\nQuestion has no answer in response file." exit 1 } _ask() { local _q=$1 _def=$2 _int _redo=0 _pid lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" _autorespond "$_q" "$_def" && echo "$resp" && return trap "_int=1" INT trap "_redo=1" TERM read resp lock; rm /tmp/update; unlock if ((_redo)); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap ((_int)) && kill -INT $$ : ${resp:=$_def} return $_redo } ask() { while ! _ask "$1" "$2"; do done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y; return 0;; n|no) resp=n; return 1;; esac echo "'$resp' is not a valid choice." $AUTO && exit 1 done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef _key _q _key=$(echo "$_name" | sed 's/[^[:alnum:]]/_/g') while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (($# < 1)) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." _q="Which $_name $_query?" echo -n "$_q (or 'done') ${_dyndef:+[$_dyndef] }" _autorespond "$_q" "${_dyndef-done}" && echo "$resp" \ || _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." $AUTO && [[ -n $RESPFILE ]] && exit 1 done } function ask_until { resp= while true; do ask "$1" "$2" [[ -n $resp ]] && break echo "A response is required." $AUTO && exit 1 done } askpass() { stty -echo IFS= read -r resp?"$1 " stty echo echo } askpassword() { local _q=$1 if $AUTO; then echo -n "$_q " _autorespond "$_q" echo '' _password=$resp return fi while :; do askpass "$_q (will not echo)" _password=$resp askpass "$_q (again)" [[ $resp == "$_password" ]] && break echo "Passwords do not match, try again." done } #------------------------------------------------------------------------------- #------------------------------------------------------------------------------- dhclient() { local _i=0 while makedev bpf$_i && ! /dev/null /sbin/dhclient "$@" } dhcp_request() { local _ifs=$1 _hn=$2 echo "lookup file bind" >/etc/resolv.conf.tail echo "send host-name \"$_hn\";" >/etc/dhclient.conf ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient -c /dev/stdin $_ifs << __EOT initial-interval 1; backoff-cutoff 2; reboot 5; timeout 10; send host-name "$_hn"; __EOT mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep -q 'groups:.* dhcp'; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." else dhcp_request $_ifs "$_name" echo "dhcp" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask for $_ifs?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_info() { ifconfig $1 inet6 | sed -n ' 1s/.*/dev/null | sed -n '/bytes from/{s/^.*from //;s/,.*$//;p;}' | sed -n 'G;s/\n/&&/;/^\(.*\n\).*\n\1/d;h;P')) _prompt="IPv6 default router?" if $AUTO; then _autorespond "$_prompt" && _resp=$resp && echo "$_prompt $_resp" else local PS3="$_prompt (${_routers:+list #, }IPv6 address or 'none'): " select _resp in $_routers; do [[ ${_resp:=$REPLY} == *:* ]] && break [[ $_resp == none ]] && return done fi route -n add -inet6 -host default "$_resp" && echo "$_resp" >>/tmp/mygate } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } ifconfig $_ifs inet6 >/dev/null 2>&1 && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) ifconfig $_ifs inet6 >/dev/null 2>&1 || { echo "No INET6 support."; return; } ifconfig $_ifs up ifconfig $_ifs inet6 autoconf && echo "up\nrtsol" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' >$WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | cat -n | more -c ;; *) _nwid=$resp ;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" ((_haswpa == 1)) && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(*vlan: +([[:digit:]]) parent interface:*) ]] || break ((_vl++)) done _vd= ifconfig lo0 inet 127.0.0.1/8 rm -f /tmp/mygate while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (get_ifdevs netboot; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan+([0-9]) ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while ((++_vi < 4096)); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan+([0-9]) ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan+([0-9]) ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if ((_vi < 1 || _vi > 4095)) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || echo "up" >>/tmp/hostname.$_vd chmod 640 /tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && ((_vl++)) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs (Uƚ_ < @Uƚ1 (@ Uƚ_(@@<@T UUƚ@+ pp?Uƚ++AUƚS0UƚS0UƚS0(a&AUƚ̊Uƚ̊Uƚ̊)AUƚ̊UƚGUƚG*ZAUƚa=UƚUƚ+:%AUƚa=Uƚa=Uƚa=,-&KAUƚa=Uƚ iUƚ i-'qaUƚ sUƚ sUƚ+`x[!Uƚ sUƚ sUƚ+{0aUƚ sUƚ sUƚ+[L]!Uƚ sUƚ sUƚ+7URaUƚ n>Uƚ n>Uƚ+4)!Uƚ n>Uƚ n>Uƚ+k9aUƚ n>Uƚ n>Uƚ+G!Uƚ&QUƚ&QUƚ+aUƚ&QUƚ&QUƚ+!Uƚ&QUƚ&QUƚ+}aUƚ&QUƚ&QUƚ+s!UƚUƚUƚ+/,GaUƚUƚUƚ+Z!UƚUƚUƚ+)ZaUƚUƚUƚ+JD!UƚX;UƚX;Uƚ+NTaUƚX;UƚX;Uƚ+Ym!UƚX;UƚX;Uƚ+9aUƚ{Uƚ{Uƚ+wP!Uƚ{Uƚ{Uƚ+ aUƚ{Uƚ{Uƚ+2!Uƚ{Uƚ{Uƚ+uaUƚm.Uƚm.Uƚ+!Uƚm.Uƚm.Uƚ+ 4aUƚm.Uƚm.Uƚ+߯!Uƚm.Uƚm.Uƚ+:)aUƚ" Uƚ" Uƚ,o~(!Uƚ" Uƚ" Uƚ,o%ut|aUƚ" Uƚ" Uƚ,o3!Uƚ}Uƚ}Uƚ,o(aUƚ}Uƚ}Uƚ,o.!Uƚ}Uƚ}Uƚ,oaUƚ}Uƚ}Uƚ,o !UƚS5 UƚS5 Uƚ,oHNaUƚS5 UƚS5 Uƚ,o !UƚS5 UƚS5 Uƚ,o 2|qaUƚS5 UƚS5 Uƚ,o!y*!UƚUƚUƚ,o!inJZaUƚUƚUƚ,o"A&!UƚUƚUƚ,o"?=aUƚqUƚqUƚ,o#5RN!UƚqUƚqUƚ,o#aUƚqUƚqUƚ,o$*o!UƚqUƚqUƚ,o$x~GaUƚUƚUƚ,o%ze,I!UƚUƚUƚ,o%9φaUƚUƚUƚ,o&(H/dev/null | grep -c ^) _p=done done } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -n '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $NIFS == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -n '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >>/tmp/mygate; break; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } get_fqdn() { local _dn _dn=$(hostname) _dn=${_dn#$(hostname -s)} _dn=${_dn#.} echo "${_dn:=my.domain}" } #------------------------------------------------------------------------------- #------------------------------------------------------------------------------- sane_install() { local _q=$1 _s for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue [[ -n $_q ]] && return 1 if ! ask_yn "Are you *SURE* your $MODE is complete without '$_s'?"; then $AUTO && exit 1 || return 1 fi done } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2;; done) break 2;; -*) _action=rmel;; *) _action=addel;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS \ _tmpfs _tmpsrc _cfile _fsrc _unver _t _issue _srclocal for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]] && isin ${_f%${VERSION}.tgz} xbase xshare xfont xserv && continue isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at $_src " echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col $AUTO && exit 1 echo return fi isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" || return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp _get_sets=$(for s in $THESETS; do isin $s $_get_sets && echo $s; done) _unver=$_get_sets for _issue in ''; do ! isin SHA256.sig $_files && _issue="Directory does not contain SHA256.sig" && break _tmpfs=$( ( for fs in /mnt/{{,var/}tmp,home,usr{/local,}}; do df -k $fs 2>/dev/null | grep " $fs\$" done df -k ) | ( while read a a a a m m; do [[ $m == /mnt/@(@(|var/)tmp|home|usr/@(src,obj,xobj))@(|/*) ]] && ((a > 524288)) && echo $m && exit [[ $m == /mnt@(|/*) ]] && ((a > 524288 * 4)) && echo $m && exit done ) ) if [[ -d $_tmpfs ]]; then ! _tmpsrc=$(tmpdir "$_tmpfs/sets") && _issue="Cannot create prefetch area" && break else _issue="Cannot determine prefetch area" && break fi _cfile=$_tmpsrc/SHA256 _srclocal=false _t=Get/Verify [[ $_src == file://* ]] && _srclocal=true _t='Verifying ' ! ftp -D "$_t" -Vmo "$_cfile.sig" "$_src/SHA256.sig" && _issue="Cannot fetch SHA256.sig" && break ! signify -Vep /etc/signify/openbsd-${VERSION}-base.pub \ -x "$_cfile.sig" -m "$_cfile" && _issue="Signature check of SHA256.sig failed" && break for _f in $_get_sets; do rm -f "$_tmpsrc/h" "$_tmpsrc/fail" ( ftp -D "$_t" -Vmo - "$_src/$_f" || >"$_tmpsrc/fail" ) | ( $_srclocal && sha256 >$_tmpsrc/h || sha256 -ph "$_tmpsrc/h" >"$_tmpsrc/$_f" ) if [[ -f $_tmpsrc/fail ]]; then rm -f "$_tmpsrc/$_f" if ! ask_yn "Fetching of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi continue fi if fgrep -qx "SHA256 ($_f) = $(<$_tmpsrc/h)" "$_cfile"; then _unver=$(rmel $_f $_unver) else if ! ask_yn "Checksum test for $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi fi done done [[ -n $_unver ]] && : ${_issue:="Unverified sets:" ${_unver% }} if [[ -n $_issue ]] && ! ask_yn "$_issue. Continue without verification?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi [[ $MODE == upgrade ]] && rm -rf /mnt/var/tmp for _f in $_get_sets; do _fsrc="$_src/$_f" [[ -f $_tmpsrc/$_f ]] && _fsrc="file://$_tmpsrc/$_f" case $_fsrc in *.tgz) ftp -D Installing -Vmo - "$_fsrc" | tar -zxphf - -C /mnt if [[ $_f == ?(x)base*.tgz && $MODE == install ]]; then ftp -D Extracting -Vmo - \ file:///mnt/usr/share/sysmerge/${_f%%base*}etc.tgz | tar -zxphf - -C /mnt fi ;; *) ftp -D Installing -Vmo "/mnt/$_f" "$_fsrc" ;; esac if (($?)); then if ! ask_yn "Installation of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) GOTSETS="$GOTSETS $_f" fi [[ -d $_tmpsrc ]] && rm -f "$_tmpsrc/$_f" done [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" } install_http() { local _file_list _prompt _mirror _url_base waitcgiinfo ask "HTTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${http_proxy:-none}" unset http_proxy [[ $resp == none ]] || export http_proxy=$resp if [[ -s $HTTP_LIST ]]; then _prompt="HTTP Server? (hostname, list#, 'done' or '?')" else echo "(Unable to get list from ftp.openbsd.org, but that is OK)" _prompt="HTTP Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$HTTP_SERVER" case $resp in done) return ;; "?") [[ -s $HTTP_LIST ]] || continue cat -n < $HTTP_LIST | more -c ;; +([0-9])) [[ -s $HTTP_LIST ]] || continue set -- $(sed -n "${resp}p" $HTTP_LIST) (($# < 1)) && { echo "There is no line $resp."; continue; } HTTP_SERVER=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) HTTP_SERVER=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done set -- $(sed "/^$HTTP_SERVER/x;\$!d;x" $HTTP_LIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (($# > 1)); then resp=$resp/$HTTP_SETDIR _mirror=yes fi : ${HTTP_DIR:=pub/OpenBSD/$HTTP_SETDIR} ask_until "Server directory?" "${resp:-$HTTP_DIR}" HTTP_DIR=$resp _url_base="http://$HTTP_SERVER/$HTTP_DIR" _file_list=$(ftp -Vo - "$_url_base/index.txt" | sed 's/^.* //' | sed 's/ //') install_files "$_url_base" "$_file_list" INSTALL=$_url_base PACKAGE_PATH= if [[ -n $_mirror ]]; then PACKAGE_PATH=$(print -r -- "$_url_base" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/%c/packages/%a/!;q") fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp; break; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp; break; } [[ -d /$resp ]] && { _dir=/$resp; break; } echo "The directory '$resp' does not exist." $AUTO && exit 1 done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { local _drive=$1 makedev $_drive && mount_mnt2 $_drive || return install_mounted_fs } install_disk() { if ! ask_yn "Is the disk partition already mounted?"; then ask_which "disk" "contains the $MODE media" \ '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' [[ $resp == done ]] && return 1 makedev $resp && mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | sed -En '/swap|unused/d;/^ [a-p]: /p' >$_file _parts=$(sed 's/^ \(.\): .*/\1/' $_file) set -- $_parts (($# == 0)) && { echo "No filesystems found on $_dev."; return 1; } if isin "c" $_parts; then resp=c elif (($# == 1)); then resp=$1 else cat $_file ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | sed -En '\''/swap|unused/d;/^ ([a-p]): .*/s//\1/p'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } #------------------------------------------------------------------------------- #------------------------------------------------------------------------------- set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in [lL\?]) echo "Available layouts: $_layouts";; default) return;; *) kbd $resp && { echo $resp >/tmp/kbdtype; return; };; esac done fi } donetconfig() { local _dn _ns _n configure_ifs v4_defroute if [[ -f /tmp/resolv.conf.shadow ]]; then mv /tmp/resolv.conf.shadow /tmp/resolv.conf for _n in $(grep '^nameserver ' /tmp/resolv.conf); do [[ $_n == nameserver ]] || _ns="$_ns$_n " done set -- $_ns _ns=$* _dn=$(sed -n \ -e '/^domain[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '/^search[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '${g;p;}' /tmp/resolv.conf) fi resp="${_dn:=$(get_fqdn)}" if [[ ! -f /tmp/dhclient.conf || $NIFS != 1 ]]; then ask "DNS domain name? (e.g. 'bar.com')" "$resp" else echo "Using DNS domainname $resp" fi hostname "$(hostname -s).$resp" resp="${_ns:=none}" if [[ ! -f /tmp/dhclient.conf || $NIFS != 1 || $resp == none ]]; then ask "DNS nameservers? (IP address list or 'none')" "$resp" else echo "Using DNS nameservers at $resp" fi if [[ $resp != none ]]; then echo "lookup file bind" >/tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } questions() { local _d _cdef=no ask_yn "Start sshd(8) by default?" yes sshd=$resp aperture= resp= xdm= if [[ -n $DISPLAY ]]; then if [[ -n $(scan_dmesg '/^[a-z]*[01]: aperture needed/p') ]]; then ask_yn "Do you expect to run the X Window System?" yes && aperture=$MDXAPERTURE fi if [[ -n $MDXDM && $resp != n ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} [[ -n $CONSOLE ]] && _cdef=yes ask_yn "Change the default console to $_d?" $_cdef defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n;; *) CSPEED=$resp;; esac fi fi } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return ;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue ;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) ((${#resp} <= 31)) && break ;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full name for user $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed." ;; *) ((${#resp} <= 100)) && break echo "Too long." ;; esac done username=$resp askpassword "Password for user $user?" userpass=$_password userkey= $AUTO && ask "Public ssh key for user $user" none && [[ $resp != none ]] && userkey=$resp } ask_root_sshd() { typeset -l _resp [[ $sshd == y ]] || return if [[ -z $user ]]; then echo "Since no user was setup, root logins via sshd(8) might be useful." fi echo "WARNING: root is targeted by password guessing attacks, pubkeys are safer." while :; do ask "Allow root ssh login? (yes, no, prohibit-password)" no _resp=$resp case $_resp in y|yes) sshd_enableroot=yes ;; n|no) sshd_enableroot=no ;; w|p|without-password|prohibit-password) sshd_enableroot=without-password ;; *) echo "'$resp' is not a valid choice." $AUTO && exit 1 continue ;; esac break done } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitcgiinfo if [[ -n $CGI_TZ ]]; then _tz=$CGI_TZ [[ -n $_tz ]] && isin "$_tz" $(<$_zonefile) && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue ;; "?") grep -v /. $_zonefile | showcols continue ;; esac while isin "$_zonepath/" $(<$_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols;; *) _zonepath=$_zonepath/$resp;; esac done if isin "$_zonepath" $(<$_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } get_rootinfo() { while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs) ;; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk" ;; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b } ifstart () { local _hn=$1 if=${1#/mnt/etc/hostname.} ((NIFS++)) while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1 while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case "$af" in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" if [[ -x /sbin/dhclient ]]; then cmd="$cmd; dhclient $if" else cmd="$cmd; echo /sbin/dhclient missing - skipping dhcp request." fi ;; "rtsol") if ifconfig $if inet6 >/dev/null 2>&1; then rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" else cmd="$cmd; echo no INET6 support - skipping rtsol request." fi ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name" case "$dt" in dest) cmd="$cmd $dtaddr" ;; *) cmd2="$dt $dtaddr" ;; esac case $af in inet) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet alone is invalid" return fi [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a X"$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd=";route -qn add -host $name 127.0.0.1" ;; inet6) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet6 alone is invalid" return fi [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done <$_hn } enable_network() { local _f _gw _trunks _svlans _vlans for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [[ -f /mnt/etc/$_f ]]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} if isin ${if%%+([0-9])} $(ifconfig -C); then case ${if%%+([0-9])} in trunk) _trunks="$_trunks $hn";; svlan) _svlans="$_svlans $hn";; vlan) _vlans="$_vlans $hn";; esac else ifconfig $if >/dev/null 2>&1 && ifstart $hn fi done for hn in $_trunks $_svlans $_vlans; do ifstart $hn done [[ -n $rtsolif ]] && ifconfig $rtsolif inet6 autoconf [[ -z $dhcpif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == @(*:*) ]] && continue route -qn delete default >/dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } startcgiinfo() { ((NIFS < 1)) && return set -m ( ftp -Vao - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$HTTP_SETDIR" \ 2>/dev/null >$CGI_INFO echo -n $SECONDS >$HTTP_SEC feed_random ) & CGIPID=$! set +m (sleep 12; kill -INT -$CGIPID >/dev/null 2>&1) & } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || $_fstype == nfs || ! -f /sbin/mount_$_fstype || $_opt == *noauto* || $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed 's/softdep//') if [[ $_fstype == ffs ]]; then _opt=$(echo $_opt | sed 's/[[:<:]]ro[[:>:]]/rw/') else _opt=$(echo $_opt | sed 's/[[:<:]]rw[[:>:]]/ro/') fi echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [[ ! -s /etc/fstab ]]; then echo "Unable to create valid /etc/fstab." exit fi } check_fs() { local _dev _dn _mp _fstype _rest _fail _f _passno ask_yn "Force checking of clean non-root filesystems?" && _f=f while read _dev _mp _fstype _rest _rest _passno _rest; do _dn=$(getdevname "$_dev") [[ $ROOTDEV == @(${_dev#/dev/}|$_dn${_dev##*.}) ]] && continue [[ -f /sbin/fsck_$_fstype ]] || continue makedev "$_dn" || continue ((_passno > 0)) || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /dev/random 2>&1 if [[ -e /mnt/var/db/host.random ]]; then dd if=/mnt/var/db/host.random of=/dev/random bs=65536 count=1 \ status=none fi } install_sets() { local _cddevs=$(get_cddevs) _d _locs="disk http" echo _d=$CGI_METHOD ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $_cddevs ]] && : ${_d:=cd0} [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" : ${_d:=http} if ! isin "$_d" $_cddevs $_locs; then for a in http $_cddevs nfs disk; do isin $a $_cddevs $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do _cddevs=$(get_cddevs) umount -f /mnt2 >/dev/null 2>&1 ask "Location of sets? (${_cddevs:+$_cddevs }$_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; [cC]*) if [[ -n $_cddevs ]]; then set -- $_cddevs [[ $resp == @(c|C|cd|CD|Cd|cD) ]] && resp=$1 install_cdrom $resp && METHOD=$resp fi ;; [dD]*) install_disk && METHOD=disk ;; [hH]*) isin http $_locs && install_http && METHOD=http ;; [nN]*) isin nfs $_locs && install_nfs && METHOD=nfs ;; *) $AUTO && echo "'$resp' is not a valid choice." && exit 1 ;; esac [[ -n $METHOD ]] && _d=$METHOD sane_install quiet || $AUTO && _d=done done } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO" >>/mnt/etc/rc.conf.local elif [[ -n $sshd_enableroot ]]; then if ! grep -q "^#PermitRootLogin $sshd_enableroot\$" \ /mnt/etc/ssh/sshd_config; then sed -i "s/^#\(PermitRootLogin\) .*/\1 $sshd_enableroot/" \ /mnt/etc/ssh/sshd_config fi fi [[ -n $aperture ]] && echo "machdep.allowaperture=$aperture # See xf86(4)" \ >>/mnt/etc/sysctl.conf [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]] && echo "xdm_flags=" >>/mnt/etc/rc.conf.local if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } encr_pwd() { local _p=$1 if [[ -z $_p ]]; then echo '*' elif [[ $_p == \$2?\$[0-9][0-9]\$* && ${#_p} > 40 || $_p == '*************' ]]; then echo "$_p" else encrypt -b a -- "$_p" fi } store_random() { dd if=/dev/random of=/mnt/var/db/host.random bs=65536 count=1 \ status=none dd if=/dev/random of=/mnt/etc/random.seed bs=512 count=1 status=none chmod 600 /mnt/var/db/host.random /mnt/etc/random.seed } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done $/\1/p') md_installboot $ROOTDISK if [[ -f /mnt/bsd.mp ]] && ((NCPU > 1)); then echo "Multiprocessor machine; using bsd.mp instead of bsd." mv /mnt/bsd /mnt/bsd.sp 2>/dev/null mv /mnt/bsd.mp /mnt/bsd fi echo "/usr/sbin/fw_update -v" >>/mnt/etc/rc.firsttime store_random cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats [[ $MODE == upgrade ]] && \ echo "After rebooting, run sysmerge(8) to update your system configuration." $AUTO && >/ai.done } #------------------------------------------------------------------------------- #------------------------------------------------------------------------------- AUTO=false RESPFILE= while getopts "af:" opt; do case $opt in a) AUTO=true;; f) RESPFILE=$OPTARG;; *) usage;; esac done shift $((OPTIND-1)) (($# == 0)) || usage . install.md rm -df /tmp/lock rm -f /tmp/update if ! $AUTO; then ( while :; do lock if test -e /tmp/update && [[ "$(dmesg)" != "$(/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap fi ROOTDISK= ROOTDEV= PACKAGE_PATH= SETDIR="$VNAME/$ARCH" CGI_INFO=/tmp/cgiinfo CGI_TZ= CGI_TIME= CGI_METHOD= INSTALL= METHOD= HTTP_DIR= HTTP_SEC=/tmp/httpsec HTTP_LIST=/tmp/httplist WLANLIST=/tmp/wlanlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -n '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot HTTP_SETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && HTTP_SETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") NIFS=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed /dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done if ! $AUTO; then cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT elif [[ -z $RESPFILE ]]; then if ! get_responsefile; then echo "No response file found; non-interactive mode aborted." exit 1 fi rm -f /ai.done echo "Performing non-interactive $action..." /$action -af /ai.$action.conf 2>&1 >/mnt/etc/rc.firsttime ( /usr/bin/mail -s '$(hostname) $action log' root < $_lf && rm $_lf ) >/dev/null 2>&1 & __EOT exec reboot else echo "failed; check /ai.log" exit 1 fi else cp $RESPFILE /ai.conf || exit fi set_term rope/Warsaw right/Europe/Zagreb right/Europe/Zaporozhye right/Europe/Zurich right/Factory right/GB right/GB-Eire right/GMT right/GMT+0 right/GMT-0 right/GMT0 right/Greenwich right/HST right/Hongkong right/Iceland right/Indian/ right/Indian/Antananarivo right/Indian/Chagos right/Indian/Christmas right/Indian/Cocos right/Indian/Comoro right/Indian/Kerguelen right/Indian/Mahe right/Indian/Maldives right/Indian/Mauritius right/Indian/Mayotte right/Indian/Reunion right/Iran right/Israel right/Jamaica right/Japan right/Kwajalein right/Libya right/MET right/MST right/MST7MDT right/Mexico/ right/Mexico/BajaNorte right/Mexico/BajaSur right/Mexico/General right/Mideast/ right/Mideast/Riyadh87 right/Mideast/Riyadh88 right/Mideast/Riyadh89 right/NZ right/NZ-CHAT right/Navajo right/PRC right/PST8PDT right/Pacific/ right/Pacific/Apia right/Pacific/Auckland right/Pacific/Bougainville right/Pacific/Chatham right/Pacific/Chuuk right/Pacific/Easter right/Pacific/Efate right/Pacific/Enderbury right/Pacific/Fakaofo right/Pacific/Fiji right/Pacific/Funafuti right/Pacific/Galapagos right/Pacific/Gambier right/Pacific/Guadalcanal right/Pacific/Guam right/Pacific/Honolulu right/Pacific/Johnston right/Pacific/Kiritimati right/Pacific/Kosrae right/Pacific/Kwajalein right/Pacific/Majuro right/Pacific/Marquesas right/Pacific/Midway right/Pacific/Nauru right/Pacific/Niue right/Pacific/Norfolk right/Pacific/Noumea right/Pacific/Pago_Pago right/Pacific/Palau right/Pacific/Pitcairn right/Pacific/Pohnpei right/Pacific/Ponape right/Pacific/Port_Moresby right/Pacific/Rarotonga right/Pacific/Saipan right/Pacific/Samoa right/Pacific/Tahiti right/Pacific/Tarawa right/Pacific/Tongatapu right/Pacific/Truk right/Pacific/Wake right/Pacific/Wallis right/Pacific/Yap right/Poland right/Portugal right/ROC right/ROK right/Singapore right/Turkey right/UCT right/US/ right/US/Alaska right/US/Aleutian right/US/Arizona right/US/Central right/US/East-Indiana right/US/Eastern right/US/Hawaii right/US/Indiana-Starke right/US/Michigan right/US/Mountain right/US/Pacific right/US/Pacific-New right/US/Samoa right/UTC right/Universal right/W-SU right/WET right/Zulu Africa/ Africa/Abidjan Africa/Accra Africa/Addis_Ababa Africa/Algiers Africa/Asmara Africa/Asmera Africa/Bamako Africa/Bangui Africa/Banjul Africa/Bissau Africa/Blantyre Africa/Brazzaville Africa/Bujumbura Africa/Cairo Africa/Casablanca Africa/Ceuta Africa/Conakry Africa/Dakar Africa/Dar_es_Salaam Africa/Djibouti Africa/Douala Africa/El_Aaiun Africa/Freetown Africa/Gaborone Africa/Harare Africa/Johannesburg Africa/Juba Africa/Kampala Africa/Khartoum Africa/Kigali Africa/Kinshasa Africa/Lagos Africa/Libreville Africa/Lome Africa/Luanda Africa/Lubumbashi Africa/Lusaka Africa/Malabo Africa/Maputo Africa/Maseru Africa/Mbabane Africa/Mogadishu Africa/Monrovia Africa/Nairobi Africa/Ndjamena Africa/Niamey Africa/Nouakchott Africa/Ouagadougou Africa/Porto-Novo Africa/Sao_Tome Africa/Timbuktu Africa/Tripoli Africa/Tunis Africa/Windhoek America/ America/Adak America/Anchorage America/Anguilla America/Antigua America/Araguaina America/Argentina/ America/Argentina/Buenos_Aires America/Argentina/Catamarca America/Argentina/ComodRivadavia America/Argentina/Cordoba America/Argentina/Jujuy America/Argentina/La_Rioja America/Argentina/Mendoza America/Argentina/Rio_Gallegos America/Argentina/Salta America/Argentina/San_Juan America/Argentina/San_Luis America/Argentina/Tucuman America/Argentina/Ushuaia America/Aruba America/Asuncion America/Atikokan America/Atka America/Bahia America/Bahia_Banderas America/Barbados America/Belem America/Belize America/Blanc-Sablon America/Boa_Vista America/Bogota America/Boise America/Buenos_Aires America/Cambridge_Bay America/Campo_Grande America/Cancun America/Caracas America/Catamarca America/Cayenne America/Cayman America/Chicago America/Chihuahua America/Coral_Harbour America/Cordoba America/Costa_Rica America/Creston America/Cuiaba America/Curacao America/Danmarkshavn America/Dawson America/Dawson_Creek America/Denver America/Detroit America/Dominica America/Edmonton America/Eirunepe America/El_Salvador America/Ensenada America/Fort_Wayne America/Fortaleza America/Glace_Bay America/Godthab America/Goose_Bay America/Grand_Turk America/Grenada America/Guadeloupe America/Guatemala America/Guayaquil America/Guyana America/Halifax America/Havana America/Hermosillo America/Indiana/ America/Indiana/Indianapolis America/Indiana/Knox America/Indiana/Marengo America/Indiana/Petersburg America/Indiana/Tell_City America/Indiana/Vevay America/Indiana/Vincennes America/Indiana/Winamac America/Indianapolis America/Inuvik America/Iqaluit America/Jamaica America/Jujuy America/Juneau America/Kentucky/ America/Kentucky/Louisville America/Kentucky/Monticello America/Knox_IN America/Kralendijk America/La_Paz America/Lima America/Los_Angeles America/Louisville America/Lower_Princes America/Maceio America/Managua America/Manaus America/Marigot America/Martinique America/Matamoros America/Mazatlan America/Mendoza America/Menominee America/Merida America/Metlakatla America/Mexico_City America/Miquelon America/Moncton America/Monterrey America/Montevideo America/Montreal America/Montserrat America/Nassau America/New_York America/Nipigon America/Nome America/Noronha America/North_Dakota/ America/North_Dakota/Beulah America/North_Dakota/Center America/North_Dakota/New_Salem America/Ojinaga America/Panama America/Pangnirtung America/Paramaribo America/Phoenix America/Port-au-Prince America/Port_of_Spain America/Porto_Acre America/Porto_Velho America/Puerto_Rico America/Rainy_River America/Rankin_Inlet America/Recife America/Regina America/Resolute America/Rio_Branco America/Rosario America/Santa_Isabel America/Santarem America/Santiago America/Santo_Domingo America/Sao_Paulo America/Scoresbysund America/Shiprock America/Sitka America/St_Barthelemy America/St_Johns America/St_Kitts America/St_Lucia America/St_Thomas America/St_Vincent America/Swift_Current America/Tegucigalpa America/Thule America/Thunder_Bay America/Tijuana America/Toronto America/Tortola America/Vancouver America/Virgin America/Whitehorse America/Winnipeg America/Yakutat America/Yellowknife Antarctica/ Antarctica/Casey Antarctica/Davis Antarctica/DumontDUrville Antarctica/Macquarie Antarctica/Mawson Antarctica/McMurdo Antarctica/Palmer Antarctica/Rothera Antarctica/South_Pole Antarctica/Syowa Antarctica/Troll Antarctica/Vostok Arctic/ Arctic/Longyearbyen Asia/ Asia/Aden Asia/Almaty Asia/Amman Asia/Anadyr Asia/Aqtau Asia/Aqtobe Asia/Ashgabat Asia/Ashkhabad Asia/Baghdad Asia/Bahrain Asia/Baku Asia/Bangkok Asia/Beirut Asia/Bishkek Asia/Brunei Asia/Calcutta Asia/Chita Asia/Choibalsan Asia/Chongqing Asia/Chungking Asia/Colombo Asia/Dacca Asia/Damascus Asia/Dhaka Asia/Dili Asia/Dubai Asia/Dushanbe Asia/Gaza Asia/Harbin Asia/Hebron Asia/Ho_Chi_Minh Asia/Hong_Kong Asia/Hovd Asia/Irkutsk Asia/Istanbul Asia/Jakarta Asia/Jayapura Asia/Jerusalem Asia/Kabul Asia/Kamchatka Asia/Karachi Asia/Kashgar Asia/Kathmandu Asia/Katmandu Asia/Khandyga Asia/Kolkata Asia/Krasnoyarsk Asia/Kuala_Lumpur Asia/Kuching Asia/Kuwait Asia/Macao Asia/Macau Asia/Magadan Asia/Makassar Asia/Manila Asia/Muscat Asia/Nicosia Asia/Novokuznetsk Asia/Novosibirsk Asia/Omsk Asia/Oral Asia/Phnom_Penh Asia/Pontianak Asia/Pyongyang Asia/Qatar Asia/Qyzylorda Asia/Rangoon Asia/Riyadh Asia/Riyadh87 Asia/Riyadh88 Asia/Riyadh89 Asia/Saigon Asia/Sakhalin Asia/Samarkand Asia/Seoul Asia/Shanghai Asia/Singapore Asia/Srednekolymsk Asia/Taipei Asia/Tashkent Asia/Tbilisi Asia/Tehran Asia/Tel_Aviv Asia/Thimbu Asia/Thimphu Asia/Tokyo Asia/Ujung_Pandang Asia/Ulaanbaatar Asia/Ulan_Bator Asia/Urumqi Asia/Ust-Nera Asia/Vientiane Asia/Vladivostok Asia/Yakutsk Asia/Yekaterinburg Asia/Yerevan Atlantic/ Atlantic/Azores Atlantic/Bermuda Atlantic/Canary Atlantic/Cape_Verde Atlantic/Faeroe Atlantic/Faroe Atlantic/Jan_Mayen Atlantic/Madeira Atlantic/Reykjavik Atlantic/South_Georgia Atlantic/St_Helena Atlantic/Stanley Australia/ Australia/ACT Australia/Adelaide Australia/Brisbane Australia/Broken_Hill Australia/Canberra Australia/Currie Australia/Darwin Australia/Eucla Australia/Hobart Australia/LHI Australia/Lindeman Australia/Lord_Howe Australia/Melbourne Australia/NSW Australia/North Australia/Perth Australia/Queensland Australia/South Australia/Sydney Australia/Tasmania Australia/Victoria Australia/West Australia/Yancowinna Brazil/ Brazil/Acre Brazil/DeNoronha Brazil/East Brazil/West CET CST6CDT Canada/ Canada/Atlantic Canada/Central Canada/East-Saskatchewan Canada/Eastern Canada/Mountain Canada/Newfoundland Canada/Pacific Canada/Saskatchewan Canada/Yukon Chile/ Chile/Continental Chile/EasterIsland Cuba EET EST EST5EDT Egypt Eire Etc/ Etc/GMT Etc/GMT+0 Etc/GMT+1 Etc/GMT+10 Etc/GMT+11 Etc/GMT+12 Etc/GMT+2 Etc/GMT+3 Etc/GMT+4 Etc/GMT+5 Etc/GMT+6 Etc/GMT+7 Etc/GMT+8 Etc/GMT+9 Etc/GMT-0 Etc/GMT-1 Etc/GMT-10 Etc/GMT-11 Etc/GMT-12 Etc/GMT-13 Etc/GMT-14 Etc/GMT-2 Etc/GMT-3 Etc/GMT-4 Etc/GMT-5 Etc/GMT-6 Etc/GMT-7 Etc/GMT-8 Etc/GMT-9 Etc/GMT0 Etc/Greenwich Etc/UCT Etc/UTC Etc/Universal Etc/Zulu Europe/ Europe/Amsterdam Europe/Andorra Europe/Athens Europe/Belfast Europe/Belgrade Europe/Berlin Europe/Bratislava Europe/Brussels Europe/Bucharest Europe/Budapest Europe/Busingen Europe/Chisinau Europe/Copenhagen Europe/Dublin Europe/Gibraltar Europe/Guernsey Europe/Helsinki Europe/Isle_of_Man Europe/Istanbul Europe/Jersey Europe/Kaliningrad Europe/Kiev Europe/Lisbon Europe/Ljubljana Europe/London Europe/Luxembourg Europe/Madrid Europe/Malta Europe/Mariehamn Europe/Minsk Europe/Monaco Europe/Moscow Europe/Nicosia Europe/Oslo Europe/Paris Europe/Podgorica Europe/Prague Europe/Riga Europe/Rome Europe/Samara Europe/San_Marino Europe/Sarajevo Europe/Simferopol Europe/Skopje Europe/Sofia Europe/Stockholm Europe/Tallinn Europe/Tirane Europe/Tiraspol Europe/Uzhgorod Europe/Vaduz Europe/Vatican Europe/Vienna Europe/Vilnius Europe/Volgograd Europe/Warsaw Europe/Zagreb Europe/Zaporozhye Europe/Zurich Factory GB GB-Eire GMT GMT+0 GMT-0 GMT0 Greenwich HST Hongkong Iceland Indian/ Indian/Antananarivo Indian/Chagos Indian/Christmas Indian/Cocos Indian/Comoro Indian/Kerguelen Indian/Mahe Indian/Maldives Indian/Mauritius Indian/Mayotte Indian/Reunion Iran Israel Jamaica Japan Kwajalein Libya MET MST MST7MDT Mexico/ Mexico/BajaNorte Mexico/BajaSur Mexico/General Mideast/ Mideast/Riyadh87 Mideast/Riyadh88 Mideast/Riyadh89 NZ NZ-CHAT Navajo PRC PST8PDT Pacific/ Pacific/Apia Pacific/Auckland Pacific/Bougainville Pacific/Chatham Pacific/Chuuk Pacific/Easter Pacific/Efate Pacific/Enderbury Pacific/Fakaofo Pacific/Fiji Pacific/Funafuti Pacific/Galapagos Pacific/Gambier Pacific/Guadalcanal Pacific/Guam Pacific/Honolulu Pacific/Johnston Pacific/Kiritimati Pacific/Kosrae Pacific/Kwajalein Pacific/Majuro Pacific/Marquesas Pacific/Midway Pacific/Nauru Pacific/Niue Pacific/Norfolk Pacific/Noumea Pacific/Pago_Pago Pacific/Palau Pacific/Pitcairn Pacific/Pohnpei Pacific/Ponape Pacific/Port_Moresby Pacific/Rarotonga Pacific/Saipan Pacific/Samoa Pacific/Tahiti Pacific/Tarawa Pacific/Tongatapu Pacific/Truk Pacific/Wake Pacific/Wallis Pacific/Yap Poland Portugal ROC ROK Singapore Turkey UCT US/ US/Alaska US/Aleutian US/Arizona US/Central US/East-Indiana US/Eastern US/Hawaii US/Indiana-Starke US/Michigan US/Mountain US/Pacific US/Pacific-New US/Samoa UTC Universal W-SU WET Zulu posix/ posix/Africa/ posix/Africa/Abidjan posix/Africa/Accra posix/Africa/Addis_Ababa posix/Africa/Algiers posix/Africa/Asmara posix/Africa/Asmera posix/Africa/Bamako posix/Africa/Bangui posix/Africa/Banjul posix/Africa/Bissau posix/Africa/Blantyre posix/Africa/Brazzaville posix/Africa/Bujumbura posix/Africa/Cairo posix/Africa/Casablanca posix/Africa/Ceuta posix/Africa/Conakry posix/Africa/Dakar posix/Africa/Dar_es_Salaam posix/Africa/Djibouti posix/Africa/Douala posix/Africa/El_Aaiun posix/Africa/Freetown posix/Africa/Gaborone posix/Africa/Harare posix/Africa/Johannesburg posix/Africa/Juba posix/Africa/Kampala posix/Africa/Khartoum posix/Africa/Kigali posix/Africa/Kinshasa posix/Africa/Lagos posix/Africa/Libreville posix/Africa/Lome posix/Africa/Luanda posix/Africa/Lubumbashi posix/Africa/Lusaka posix/Africa/Malabo posix/Africa/Maputo posix/Africa/Maseru posix/Africa/Mbabane posix/Africa/Mogadishu posix/Africa/Monrovia posix/Africa/Nairobi posix/Africa/Ndjamena posix/Africa/Niamey posix/Africa/Nouakchott posix/Africa/Ouagadougou posix/Africa/Porto-Novo posix/Africa/Sao_Tome posix/Africa/Timbuktu posix/Africa/Tripoli posix/Africa/Tunis posix/Africa/Windhoek posix/America/ posix/America/Adak posix/America/Anchorage posix/America/Anguilla posix/America/Antigua posix/America/Araguaina posix/America/Argentina/ posix/America/Argentina/Buenos_Aires posix/America/Argentina/Catamarca posix/America/Argentina/ComodRivadavia posix/America/Argentina/Cordoba posix/America/Argentina/Jujuy posix/America/Argentina/La_Rioja posix/America/Argentina/Mendoza posix/America/Argentina/Rio_Gallegos posix/America/Argentina/Salta posix/America/Argentina/San_Juan posix/America/Argentina/San_Luis posix/America/Argentina/Tucuman posix/America/Argentina/Ushuaia posix/America/Aruba posix/America/Asuncion posix/America/Atikokan posix/America/Atka posix/America/Bahia posix/America/Bahia_Banderas posix/America/Barbados posix/America/Belem posix/America/Belize posix/America/Blanc-Sablon posix/America/Boa_Vista posix/America/Bogota posix/America/Boise posix/America/Buenos_Aires posix/America/Cambridge_Bay posix/America/Campo_Grande posix/America/Cancun posix/America/Caracas posix/America/Catamarca posix/America/Cayenne posix/America/Cayman posix/America/Chicago posix/America/Chihuahua posix/America/Coral_Harbour posix/America/Cordoba posix/America/Costa_Rica posix/America/Creston posix/America/Cuiaba posix/America/Curacao posix/America/Danmarkshavn posix/America/Dawson posix/America/Dawson_Creek posix/America/Denver posix/America/Detroit posix/America/Dominica posix/America/Edmonton posix/America/Eirunepe posix/America/El_Salvador posix/America/Ensenada posix/America/Fort_Wayne posix/America/Fortaleza posix/America/Glace_Bay posix/America/Godthab posix/America/Goose_Bay posix/America/Grand_Turk posix/America/Grenada posix/America/Guadeloupe posix/America/Guatemala posix/America/Guayaquil posix/America/Guyana posix/America/Halifax posix/America/Havana posix/America/Hermosillo posix/America/Indiana/ posix/America/Indiana/Indianapolis posix/America/Indiana/Knox posix/America/Indiana/Marengo posix/America/Indiana/Petersburg posix/America/Indiana/Tell_City posix/America/Indiana/Vevay posix/America/Indiana/Vincennes posix/America/Indiana/Winamac posix/America/Indianapolis posix/America/Inuvik posix/America/Iqaluit posix/America/Jamaica posix/America/Jujuy posix/America/Juneau posix/America/Kentucky/ posix/America/Kentucky/Louisville posix/America/Kentucky/Monticello posix/America/Knox_IN posix/America/Kralendijk posix/America/La_Paz posix/America/Lima posix/America/Los_Angeles posix/America/Louisville posix/America/Lower_Princes posix/America/Maceio posix/America/Managua posix/America/Manaus posix/America/Marigot posix/America/Martinique posix/America/Matamoros posix/America/Mazatlan posix/America/Mendoza posix/America/Menominee posix/America/Merida posix/America/Metlakatla posix/America/Mexico_City posix/America/Miquelon posix/America/Moncton posix/America/Monterrey posix/America/Montevideo posix/America/Montreal posix/America/Montserrat posix/America/Nassau posix/America/New_York posix/America/Nipigon posix/America/Nome posix/America/Noronha posix/America/North_Dakota/ posix/America/North_Dakota/Beulah posix/America/North_Dakota/Center posix/America/North_Dakota/New_Salem posix/America/Ojinaga posix/America/Panama posix/America/Pangnirtung posix/America/Paramaribo posix/America/Phoenix posix/America/Port-au-Prince posix/America/Port_of_Spain posix/America/Porto_Acre posix/America/Porto_Velho posix/America/Puerto_Rico posix/America/Rainy_River posix/America/Rankin_Inlet posix/America/Recife posix/America/Regina posix/America/Resolute posix/America/Rio_Branco posix/America/Rosario posix/America/Santa_Isabel posix/America/Santarem posix/America/Santiago posix/America/Santo_Domingo posix/America/Sao_Paulo posix/America/Scoresbysund posix/America/Shiprock posix/America/Sitka posix/America/St_Barthelemy posix/America/St_Johns posix/America/St_Kitts posix/America/St_Lucia posix/America/St_Thomas posix/America/St_Vincent posix/America/Swift_Current posix/America/Tegucigalpa posix/America/Thule posix/America/Thunder_Bay posix/America/Tijuana posix/America/Toronto posix/America/Tortola posix/America/Vancouver posix/America/Virgin posix/America/Whitehorse posix/America/Winnipeg posix/America/Yakutat posix/America/Yellowknife posix/Antarctica/ posix/Antarctica/Casey posix/Antarctica/Davis posix/Antarctica/DumontDUrville posix/Antarctica/Macquarie posix/Antarctica/Mawson posix/Antarctica/McMurdo posix/Antarctica/Palmer posix/Antarctica/Rothera posix/Antarctica/South_Pole posix/Antarctica/Syowa posix/Antarctica/Troll posix/Antarctica/Vostok posix/Arctic/ posix/Arctic/Longyearbyen posix/Asia/ posix/Asia/Aden posix/Asia/Almaty posix/Asia/Amman posix/Asia/Anadyr posix/Asia/Aqtau posix/Asia/Aqtobe posix/Asia/Ashgabat posix/Asia/Ashkhabad posix/Asia/Baghdad posix/Asia/Bahrain posix/Asia/Baku posix/Asia/Bangkok posix/Asia/Beirut posix/Asia/Bishkek posix/Asia/Brunei posix/Asia/Calcutta posix/Asia/Chita posix/Asia/Choibalsan posix/Asia/Chongqing posix/Asia/Chungking posix/Asia/Colombo posix/Asia/Dacca posix/Asia/Damascus posix/Asia/Dhaka posix/Asia/Dili posix/Asia/Dubai posix/Asia/Dushanbe posix/Asia/Gaza posix/Asia/Harbin posix/Asia/Hebron posix/Asia/Ho_Chi_Minh posix/Asia/Hong_Kong posix/Asia/Hovd posix/Asia/Irkutsk posix/Asia/Istanbul posix/Asia/Jakarta posix/Asia/Jayapura posix/Asia/Jerusalem posix/Asia/Kabul posix/Asia/Kamchatka posix/Asia/Karachi posix/Asia/Kashgar posix/Asia/Kathmandu posix/Asia/Katmandu posix/Asia/Khandyga posix/Asia/Kolkata posix/Asia/Krasnoyarsk posix/Asia/Kuala_Lumpur posix/Asia/Kuching posix/Asia/Kuwait posix/Asia/Macao posix/Asia/Macau posix/Asia/Magadan posix/Asia/Makassar posix/Asia/Manila posix/Asia/Muscat posix/Asia/Nicosia posix/Asia/Novokuznetsk posix/Asia/Novosibirsk posix/Asia/Omsk posix/Asia/Oral posix/Asia/Phnom_Penh posix/Asia/Pontianak posix/Asia/Pyongyang posix/Asia/Qatar posix/Asia/Qyzylorda posix/Asia/Rangoon posix/Asia/Riyadh posix/Asia/Riyadh87 posix/Asia/Riyadh88 posix/Asia/Riyadh89 posix/Asia/Saigon posix/Asia/Sakhalin posix/Asia/Samarkand posix/Asia/Seoul posix/Asia/Shanghai posix/Asia/Singapore posix/Asia/Srednekolymsk posix/Asia/Taipei posix/Asia/Tashkent posix/Asia/Tbilisi posix/Asia/Tehran posix/Asia/Tel_Aviv posix/Asia/Thimbu posix/Asia/Thimphu posix/Asia/Tokyo posix/Asia/Ujung_Pandang posix/Asia/Ulaanbaatar posix/Asia/Ulan_Bator posix/Asia/Urumqi posix/Asia/Ust-Nera posix/Asia/Vientiane posix/Asia/Vladivostok posix/Asia/Yakutsk posix/Asia/Yekaterinburg posix/Asia/Yerevan posix/Atlantic/ posix/Atlantic/Azores posix/Atlantic/Bermuda posix/Atlantic/Canary posix/Atlantic/Cape_Verde posix/Atlantic/Faeroe posix/Atlantic/Faroe posix/Atlantic/Jan_Mayen posix/Atlantic/Madeira posix/Atlantic/Reykjavik posix/Atlantic/South_Georgia posix/Atlantic/St_Helena posix/Atlantic/Stanley posix/Australia/ posix/Australia/ACT posix/Australia/Adelaide posix/Australia/Brisbane posix/Australia/Broken_Hill posix/Australia/Canberra posix/Australia/Currie posix/Australia/Darwin posix/Australia/Eucla posix/Australia/Hobart posix/Australia/LHI posix/Australia/Lindeman posix/Australia/Lord_Howe posix/Australia/Melbourne posix/Australia/NSW posix/Australia/North posix/Australia/Perth posix/Australia/Queensland posix/Australia/South posix/Australia/Sydney posix/Australia/Tasmania posix/Australia/Victoria posix/Australia/West posix/Australia/Yancowinna posix/Brazil/ posix/Brazil/Acre posix/Brazil/DeNoronha posix/Brazil/East posix/Brazil/West posix/CET posix/CST6CDT posix/Canada/ posix/Canada/Atlantic posix/Canada/Central posix/Canada/East-Saskatchewan posix/Canada/Eastern posix/Canada/Mountain posix/Canada/Newfoundland posix/Canada/Pacific posix/Canada/Saskatchewan posix/Canada/Yukon posix/Chile/ posix/Chile/Continental posix/Chile/EasterIsland posix/Cuba posix/EET posix/EST posix/EST5EDT posix/Egypt posix/Eire posix/Etc/ posix/Etc/GMT posix/Etc/GMT+0 posix/Etc/GMT+1 posix/Etc/GMT+10 posix/Etc/GMT+11 posix/Etc/GMT+12 posix/Etc/GMT+2 posix/Etc/GMT+3 posix/Etc/GMT+4 posix/Etc/GMT+5 posix/Etc/GMT+6 posix/Etc/GMT+7 posix/Etc/GMT+8 posix/Etc/GMT+9 posix/Etc/GMT-0 posix/Etc/GMT-1 posix/Etc/GMT-10 posix/Etc/GMT-11 posix/Etc/GMT-12 posix/Etc/GMT-13 posix/Etc/GMT-14 posix/Etc/GMT-2 posix/Etc/GMT-3 posix/Etc/GMT-4 posix/Etc/GMT-5 posix/Etc/GMT-6 posix/Etc/GMT-7 posix/Etc/GMT-8 posix/Etc/GMT-9 posix/Etc/GMT0 posix/Etc/Greenwich posix/Etc/UCT posix/Etc/UTC posix/Etc/Universal posix/Etc/Zulu posix/Europe/ posix/Europe/Amsterdam posix/Europe/Andorra posix/Europe/Athens posix/Europe/Belfast posix/Europe/Belgrade posix/Europe/Berlin posix/Europe/Bratislava posix/Europe/Brussels posix/Europe/Bucharest posix/Europe/Budapest posix/Europe/Busingen posix/Europe/Chisinau posix/Europe/Copenhagen posix/Europe/Dublin posix/Europe/Gibraltar posix/Europe/Guernsey posix/Europe/Helsinki posix/Europe/Isle_of_Man posix/Europe/Istanbul posix/Europe/Jersey posix/Europe/Kaliningrad posix/Europe/Kiev posix/Europe/Lisbon posix/Europe/Ljubljana posix/Europe/London posix/Europe/Luxembourg posix/Europe/Madrid posix/Europe/Malta posix/Europe/Mariehamn posix/Europe/Minsk posix/Europe/Monaco posix/Europe/Moscow posix/Europe/Nicosia posix/Europe/Oslo posix/Europe/Paris posix/Europe/Podgorica posix/Europe/Prague posix/Europe/Riga posix/Europe/Rome posix/Europe/Samara posix/Europe/San_Marino posix/Europe/Sarajevo posix/Europe/Simferopol posix/Europe/Skopje posix/Europe/Sofia posix/Europe/Stockholm posix/Europe/Tallinn posix/Europe/Tirane posix/Europe/Tiraspol posix/Europe/Uzhgorod posix/Europe/Vaduz posix/Europe/Vatican posix/Europe/Vienna posix/Europe/Vilnius posix/Europe/Volgograd posix/Europe/Warsaw posix/Europe/Zagreb posix/Europe/Zaporozhye posix/Europe/Zurich posix/Factory posix/GB posix/GB-Eire posix/GMT posix/GMT+0 posix/GMT-0 posix/GMT0 posix/Greenwich posix/HST posix/Hongkong posix/Iceland posix/Indian/ posix/Indian/Antananarivo posix/Indian/Chagos posix/Indian/Christmas posix/Indian/Cocos posix/Indian/Comoro posix/Indian/Kerguelen posix/Indian/Mahe posix/Indian/Maldives posix/Indian/Mauritius posix/Indian/Mayotte posix/Indian/Reunion posix/Iran posix/Israel posix/Jamaica posix/Japan posix/Kwajalein posix/Libya posix/MET posix/MST posix/MST7MDT posix/Mexico/ posix/Mexico/BajaNorte posix/Mexico/BajaSur posix/Mexico/General posix/Mideast/ posix/Mideast/Riyadh87 posix/Mideast/Riyadh88 posix/Mideast/Riyadh89 posix/NZ posix/NZ-CHAT posix/Navajo posix/PRC posix/PST8PDT posix/Pacific/ posix/Pacific/Apia posix/Pacific/Auckland posix/Pacific/Bougainville posix/Pacific/Chatham posix/Pacific/Chuuk posix/Pacific/Easter posix/Pacific/Efate posix/Pacific/Enderbury posix/Pacific/Fakaofo posix/Pacific/Fiji posix/Pacific/Funafuti posix/Pacific/Galapagos posix/Pacific/Gambier posix/Pacific/Guadalcanal posix/Pacific/Guam posix/Pacific/Honolulu posix/Pacific/Johnston posix/Pacific/Kiritimati posix/Pacific/Kosrae posix/Pacific/Kwajalein posix/Pacific/Majuro posix/Pacific/Marquesas posix/Pacific/Midway posix/Pacific/Nauru posix/Pacific/Niue posix/Pacific/Norfolk posix/Pacific/Noumea posix/Pacific/Pago_Pago posix/Pacific/Palau posix/Pacific/Pitcairn posix/Pacific/Pohnpei posix/Pacific/Ponape posix/Pacific/Port_Moresby posix/Pacific/Rarotonga posix/Pacific/Saipan posix/Pacific/Samoa posix/Pacific/Tahiti posix/Pacific/Tarawa posix/Pacific/Tongatapu posix/Pacific/Truk posix/Pacific/Wake posix/Pacific/Wallis posix/Pacific/Yap posix/Poland posix/Portugal posix/ROC posix/ROK posix/Singapore posix/Turkey posix/UCT posix/US/ posix/US/Alaska posix/US/Aleutian posix/US/Arizona posix/US/Central posix/US/East-Indiana posix/US/Eastern posix/US/Hawaii posix/US/Indiana-Starke posix/US/Michigan posix/US/Mountain posix/US/Pacific posix/US/Pacific-New posix/US/Samoa posix/UTC posix/Universal posix/W-SU posix/WET posix/Zulu posixrules right/ right/Africa/ right/Africa/Abidjan right/Africa/Accra right/Africa/Addis_Ababa right/Africa/Algiers right/Africa/Asmara right/Africa/Asmera right/Africa/Bamako right/Africa/Bangui right/Africa/Banjul right/Africa/Bissau right/Africa/Blantyre right/Africa/Brazzaville right/Africa/Bujumbura right/Africa/Cairo right/Africa/Casablanca right/Africa/Ceuta right/Africa/Conakry right/Africa/Dakar right/Africa/Dar_es_Salaam right/Africa/Djibouti right/Africa/Douala right/Africa/El_Aaiun right/Africa/Freetown right/Africa/Gaborone right/Africa/Harare right/Africa/Johannesburg right/Africa/Juba right/Africa/Kampala right/Africa/Khartoum right/Africa/Kigali right/Africa/Kinshasa right/Africa/Lagos right/Africa/Libreville right/Africa/Lome right/Africa/Luanda right/Africa/Lubumbashi right/Africa/Lusaka right/Africa/Malabo right/Africa/Maputo right/Africa/Maseru right/Africa/Mbabane right/Africa/Mogadishu right/Africa/Monrovia right/Africa/Nairobi right/Africa/Ndjamena right/Africa/Niamey right/Africa/Nouakchott right/Africa/Ouagadougou right/Africa/Porto-Novo right/Africa/Sao_Tome right/Africa/Timbuktu right/Africa/Tripoli right/Africa/Tunis right/Africa/Windhoek right/America/ right/America/Adak right/America/Anchorage right/America/Anguilla right/America/Antigua right/America/Araguaina right/America/Argentina/ right/America/Argentina/Buenos_Aires right/America/Argentina/Catamarca right/America/Argentina/ComodRivadavia right/America/Argentina/Cordoba right/America/Argentina/Jujuy right/America/Argentina/La_Rioja right/America/Argentina/Mendoza right/America/Argentina/Rio_Gallegos right/America/Argentina/Salta right/America/Argentina/San_Juan right/America/Argentina/San_Luis right/America/Argentina/Tucuman right/America/Argentina/Ushuaia right/America/Aruba right/America/Asuncion right/America/Atikokan right/America/Atka right/America/Bahia right/America/Bahia_Banderas right/America/Barbados right/America/Belem right/America/Belize right/America/Blanc-Sablon right/America/Boa_Vista right/America/Bogota right/America/Boise right/America/Buenos_Aires right/America/Cambridge_Bay right/America/Campo_Grande right/America/Cancun right/America/Caracas right/America/Catamarca right/America/Cayenne right/America/Cayman right/America/Chicago right/America/Chihuahua right/America/Coral_Harbour right/America/Cordoba right/America/Costa_Rica right/America/Creston right/America/Cuiaba right/America/Curacao right/America/Danmarkshavn right/America/Dawson right/America/Dawson_Creek right/America/Denver right/America/Detroit right/America/Dominica right/America/Edmonton right/America/Eirunepe right/America/El_Salvador right/America/Ensenada right/America/Fort_Wayne right/America/Fortaleza right/America/Glace_Bay right/America/Godthab right/America/Goose_Bay right/America/Grand_Turk right/America/Grenada right/America/Guadeloupe right/America/Guatemala right/America/Guayaquil right/America/Guyana right/America/Halifax right/America/Havana right/America/Hermosillo right/America/Indiana/ right/America/Indiana/Indianapolis right/America/Indiana/Knox right/America/Indiana/Marengo right/America/Indiana/Petersburg right/America/Indiana/Tell_City right/America/Indiana/Vevay right/America/Indiana/Vincennes right/America/Indiana/Winamac right/America/Indianapolis right/America/Inuvik right/America/Iqaluit right/America/Jamaica right/America/Jujuy right/America/Juneau right/America/Kentucky/ right/America/Kentucky/Louisville right/America/Kentucky/Monticello right/America/Knox_IN right/America/Kralendijk right/America/La_Paz right/America/Lima right/America/Los_Angeles right/America/Louisville right/America/Lower_Princes right/America/Maceio right/America/Managua right/America/Manaus right/America/Marigot right/America/Martinique right/America/Matamoros right/America/Mazatlan right/America/Mendoza right/America/Menominee right/America/Merida right/America/Metlakatla right/America/Mexico_City right/America/Miquelon right/America/Moncton right/America/Monterrey right/America/Montevideo right/America/Montreal right/America/Montserrat right/America/Nassau right/America/New_York right/America/Nipigon right/America/Nome right/America/Noronha right/America/North_Dakota/ right/America/North_Dakota/Beulah right/America/North_Dakota/Center right/America/North_Dakota/New_Salem right/America/Ojinaga right/America/Panama right/America/Pangnirtung right/America/Paramaribo right/America/Phoenix right/America/Port-au-Prince right/America/Port_of_Spain right/America/Porto_Acre right/America/Porto_Velho right/America/Puerto_Rico right/America/Rainy_River right/America/Rankin_Inlet right/America/Recife right/America/Regina right/America/Resolute right/America/Rio_Branco right/America/Rosario right/America/Santa_Isabel right/America/Santarem right/America/Santiago right/America/Santo_Domingo right/America/Sao_Paulo right/America/Scoresbysund right/America/Shiprock right/America/Sitka right/America/St_Barthelemy right/America/St_Johns right/America/St_Kitts right/America/St_Lucia right/America/St_Thomas right/America/St_Vincent right/America/Swift_Current right/America/Tegucigalpa right/America/Thule right/America/Thunder_Bay right/America/Tijuana right/America/Toronto right/America/Tortola right/America/Vancouver right/America/Virgin right/America/Whitehorse right/America/Winnipeg right/America/Yakutat right/America/Yellowknife right/Antarctica/ right/Antarctica/Casey right/Antarctica/Davis right/Antarctica/DumontDUrville right/Antarctica/Macquarie right/Antarctica/Mawson right/Antarctica/McMurdo right/Antarctica/Palmer right/Antarctica/Rothera right/Antarctica/South_Pole right/Antarctica/Syowa right/Antarctica/Troll right/Antarctica/Vostok right/Arctic/ right/Arctic/Longyearbyen right/Asia/ right/Asia/Aden right/Asia/Almaty right/Asia/Amman right/Asia/Anadyr right/Asia/Aqtau right/Asia/Aqtobe right/Asia/Ashgabat right/Asia/Ashkhabad right/Asia/Baghdad right/Asia/Bahrain right/Asia/Baku right/Asia/Bangkok right/Asia/Beirut right/Asia/Bishkek right/Asia/Brunei right/Asia/Calcutta right/Asia/Chita right/Asia/Choibalsan right/Asia/Chongqing right/Asia/Chungking right/Asia/Colombo right/Asia/Dacca right/Asia/Damascus right/Asia/Dhaka right/Asia/Dili right/Asia/Dubai right/Asia/Dushanbe right/Asia/Gaza right/Asia/Harbin right/Asia/Hebron right/Asia/Ho_Chi_Minh right/Asia/Hong_Kong right/Asia/Hovd right/Asia/Irkutsk right/Asia/Istanbul right/Asia/Jakarta right/Asia/Jayapura right/Asia/Jerusalem right/Asia/Kabul right/Asia/Kamchatka right/Asia/Karachi right/Asia/Kashgar right/Asia/Kathmandu right/Asia/Katmandu right/Asia/Khandyga right/Asia/Kolkata right/Asia/Krasnoyarsk right/Asia/Kuala_Lumpur right/Asia/Kuching right/Asia/Kuwait right/Asia/Macao right/Asia/Macau right/Asia/Magadan right/Asia/Makassar right/Asia/Manila right/Asia/Muscat right/Asia/Nicosia right/Asia/Novokuznetsk right/Asia/Novosibirsk right/Asia/Omsk right/Asia/Oral right/Asia/Phnom_Penh right/Asia/Pontianak right/Asia/Pyongyang right/Asia/Qatar right/Asia/Qyzylorda right/Asia/Rangoon right/Asia/Riyadh right/Asia/Riyadh87 right/Asia/Riyadh88 right/Asia/Riyadh89 right/Asia/Saigon right/Asia/Sakhalin right/Asia/Samarkand right/Asia/Seoul right/Asia/Shanghai right/Asia/Singapore right/Asia/Srednekolymsk right/Asia/Taipei right/Asia/Tashkent right/Asia/Tbilisi right/Asia/Tehran right/Asia/Tel_Aviv right/Asia/Thimbu right/Asia/Thimphu right/Asia/Tokyo right/Asia/Ujung_Pandang right/Asia/Ulaanbaatar right/Asia/Ulan_Bator right/Asia/Urumqi right/Asia/Ust-Nera right/Asia/Vientiane right/Asia/Vladivostok right/Asia/Yakutsk right/Asia/Yekaterinburg right/Asia/Yerevan right/Atlantic/ right/Atlantic/Azores right/Atlantic/Bermuda right/Atlantic/Canary right/Atlantic/Cape_Verde right/Atlantic/Faeroe right/Atlantic/Faroe right/Atlantic/Jan_Mayen right/Atlantic/Madeira right/Atlantic/Reykjavik right/Atlantic/South_Georgia right/Atlantic/St_Helena right/Atlantic/Stanley right/Australia/ right/Australia/ACT right/Australia/Adelaide right/Australia/Brisbane right/Australia/Broken_Hill right/Australia/Canberra right/Australia/Currie right/Australia/Darwin right/Australia/Eucla right/Australia/Hobart right/Australia/LHI right/Australia/Lindeman right/Australia/Lord_Howe right/Australia/Melbourne right/Australia/NSW right/Australia/North right/Australia/Perth right/Australia/Queensland right/Australia/South right/Australia/Sydney right/Australia/Tasmania right/Australia/Victoria right/Australia/West right/Australia/Yancowinna right/Brazil/ right/Brazil/Acre right/Brazil/DeNoronha right/Brazil/East right/Brazil/West right/CET right/CST6CDT right/Canada/ right/Canada/Atlantic right/Canada/Central right/Canada/East-Saskatchewan right/Canada/Eastern right/Canada/Mountain right/Canada/Newfoundland right/Canada/Pacific right/Canada/Saskatchewan right/Canada/Yukon right/Chile/ right/Chile/Continental right/Chile/EasterIsland right/Cuba right/EET right/EST right/EST5EDT right/Egypt right/Eire right/Etc/ right/Etc/GMT right/Etc/GMT+0 right/Etc/GMT+1 right/Etc/GMT+10 right/Etc/GMT+11 right/Etc/GMT+12 right/Etc/GMT+2 right/Etc/GMT+3 right/Etc/GMT+4 right/Etc/GMT+5 right/Etc/GMT+6 right/Etc/GMT+7 right/Etc/GMT+8 right/Etc/GMT+9 right/Etc/GMT-0 right/Etc/GMT-1 right/Etc/GMT-10 right/Etc/GMT-11 right/Etc/GMT-12 right/Etc/GMT-13 right/Etc/GMT-14 right/Etc/GMT-2 right/Etc/GMT-3 right/Etc/GMT-4 right/Etc/GMT-5 right/Etc/GMT-6 right/Etc/GMT-7 right/Etc/GMT-8 right/Etc/GMT-9 right/Etc/GMT0 right/Etc/Greenwich right/Etc/UCT right/Etc/UTC right/Etc/Universal right/Etc/Zulu right/Europe/ right/Europe/Amsterdam right/Europe/Andorra right/Europe/Athens right/Europe/Belfast right/Europe/Belgrade right/Europe/Berlin right/Europe/Bratislava right/Europe/Brussels right/Europe/Bucharest right/Europe/Budapest right/Europe/Busingen right/Europe/Chisinau right/Europe/Copenhagen right/Europe/Dublin right/Europe/Gibraltar right/Europe/Guernsey right/Europe/Helsinki right/Europe/Isle_of_Man right/Europe/Istanbul right/Europe/Jersey right/Europe/Kaliningrad right/Europe/Kiev right/Europe/Lisbon right/Europe/Ljubljana right/Europe/London right/Europe/Luxembourg right/Europe/Madrid right/Europe/Malta right/Europe/Mariehamn right/Europe/Minsk right/Europe/Monaco right/Europe/Moscow right/Europe/Nicosia right/Europe/Oslo right/Europe/Paris right/Europe/Podgorica right/Europe/Prague right/Europe/Riga right/Europe/Rome right/Europe/Samara right/Europe/San_Marino right/Europe/Sarajevo right/Europe/Simferopol right/Europe/Skopje right/Europe/Sofia right/Europe/Stockholm right/Europe/Tallinn right/Europe/Tirane right/Europe/Tiraspol right/Europe/Uzhgorod right/Europe/Vaduz right/Europe/Vatican right/Europe/Vienna right/Europe/Vilnius right/Europe/Volgograd right/Eu dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :eA=\E)0:ec=\E[%dX:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1l\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:\ :kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:\ :l4=pf4:le=^H:mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:\ :nw=\EE:pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :u6=\E[%i%d;%dR:u7=\E[6n:u9=\E[c:ue=\E[24m:up=\E[A:\ :us=\E[4m:vb=\E[?5h\E[?5l: sun|sun1|sun2|Sun Microsystems Inc. workstation console:\ :am:km:ms:\ :co#80:li#34:\ :%7=\E[194z:&5=\E[193z:&8=\E[195z:@7=\E[220z:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:F1=\E[234z:F2=\E[235z:IC=\E[%d@:\ :K2=\E[218z:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ic=\E[@:im=:\ :k1=\E[224z:k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:\ :k6=\E[229z:k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:\ :kD=\177:kI=\E[247z:kN=\E[222z:kP=\E[216z:kb=^H:kd=\E[B:\ :kh=\E[214z:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:me=\E[m:mr=\E[7m:\ :nd=\E[C:rs=\E[s:..sa=\E[0%?%p1%p3%|%t;7%;m:se=\E[m:\ :sf=^J:so=\E[7m:ta=^I:u8=\E[1t:u9=\E[11t:up=\E[A:  Ud < @ Udb   Ud @@<@T UUd UdVCW̤{ZخY|2n)+wOb[dbɐvnKߥ4ER <[|̎ `VMC7Zɥ!d݈Y6"^ݘ8~)g'#htNUX& /}b1}:9o]9'$"NU`g낹4>}wjT˃~%;s\Ot :?F#Up8QLk} lebuQGڕ-*0A(ϖX$.UD[0^^37lce]/6 ݺ/oάvPЗ-b ~Rug|g% $vbv(ECyL'_Ata4o ΄rzvkx'CR`ՎNGU|=,E5/uLb=q ^)rH$@o(v尐Mk*pv=vN#Xi?aU ?2jy{mB2F5 ;H; 8HPX`hpx-Paltl|ltlsER<CEpSTSL@RR@CEpSTNMCLX0PLX0RE@RR@CEpSTPXTFtPNRR@CEpSTd;hly<ltt,zDl|T ll<llldhp:<t;d|d <Ҥ48,4Ť48,nativeK48``nativeK482(8N[  | H w$[GTh x  x4u,uu  0<  ̀ Θh$u` u u0w`w  h/$T0  6, <[dT  8T.L (0 ' % -x@u|Pl t ` t   ݘ T0  Шh|   |L p ڬ@$$p{4z|,  p )HH $ $8t  '8 u $ &\`X-h # # x$  w ~ 0x uDN  ˜HXl`  H$`,  vwX`hxp$`,)**p4H\4H\4H\4HL4I4Hl 4H 0 P4I4I4I4I4J B@Ӑ4I4Jx4J4K(4K4K4L04L4L4M84J Ԉ4MԐ4MdJ׈נ4N 4N<ܐhp$,t>< T ((ֈ08J@H(NKP0XZP`pMxJJ,, D 0   @PPpttyclsttyopnttybgttyinttyoutDLpLZ9`G@1[:8LLLL[LL7LLLL[LL7LLLL[LL7LLLL[LL7LLLL[LL7LLLL[LL7LLLL[LL7LLLL[LL7LLLL[LL7  $0@84Rd4Rd4Rd\PXD|4Q4RdlX$P;;4SffsČcd9660 Lnfs2lockf@`  ;<;D;LtL0tՄԄhtר;<;D;Lp:<;ddt<(;D;L<hhtt<tht<;<Xh`xhht<<<<h<P (L@4V4V4V J4V$^^3333``#$%&'()*+;,-.;/;0;1B@2T 3T 4T 56T 7T cdeB@B@LK@O[T@n6%Ql7Jpp@@@@ j j j@0ww`ww 4Z04Z HPŨDh4Z`4Z,24\cUUdG4\C# s@.,H4\l(0< 4\(d4\<(d4,4\4\9h(d.D4\)9h(d4\(dd4\(d4[4\ dX4] 4]$4],4]04](<8Q @X,4]4]4]4]4[4[4[ 4[4]4]d4]4]h4]l4]p4]t4]x4]|4]4]4]4]4]4]9H(@AAA==(A* dd%(i @@@@@@@@@@4_ 4^:p`:pP4_4^4_$4_44_84_($4_4_4_ @     F'' EF''' ?F''F'' F''' F'' EF'' ?EF''' ?EF''' ?EF''' ?EF'''' ?F'' ?BF''' ?BEF''' ?EF''' F'''' F'''''F''FF''FF''F'';<;D;L; F H  : e,  C \ 5 mt m( D0 { L  @0 T$ @ 8 3T< W 'D @d  *L|H;<;D;L |p:< X  C ;d  P< @d $ | p  T Ӭ * *l *T; E ( < M . K "l 5 h -t " " "t " + * L / 7< 2D 0X F ) .| 4 #l * *l *T Ep:< F K ;d " ( L< F ( # $ # $ # $ ... ... < |H s| vd  4f4g@4g&h t | d T  Y4j$) 5 4 w4j$C.  @H4j$lڔp0 4j$ hp ` g4 _ l _X4j$: f ` g4 _ l t U C(4j$< 184j$+ 84j$, 64j$)8 ` _ l.D4j$8 ` _ l4j$ hp ` _ l hX.4g4j$@ t 4@  XdX4j4l4l4l4l4j4l4k$4k(4l @E8(@AAA==(A*4jX4jd4jh4jp4jx4j|4j4j4jl4j4j4jt4j\4j`4j4j4j4j4jQ 4l4l < G0D H@D H8D H0D H0 4 I 0 4K 4K0 I(0 J0 KX DKPd8l 0  KsparcO D O 4 XX( ä $ @ XX( ä h x@lȤȸ  hθǰX|0Ǡ  h θlǰX|0pǠ  h @l < h <ǰX|0ptɀ  hɘ<ǰX|0p  @ h ͐lǰX|0pǠ O4pO4pP4pO4qO4qP4q P4qO4qP 4qP(4s(P04r P@4r PX4rPp4rP4rP4rP4rP4rDP4rDP4q`P4qP4rDP4rDP4p|QQQ0QHQXQXQ`QXQXQhQQQQQXQXQX QX0 ˤ 4TޭޭUK %%%%Dh P I  Ψ l   ( VP$lP @Y *PPY *P(Y5tMYx 0 ߸WDZl ,l@m@pHq ,d2-8'h**x( /TLM =r`MP=rTU=rVV=s WX=s<$(X|`xp<D(|<P|<Hh\ P DH(P#L(534(65\pHESN,M$M8MlMMMMNN MLM\MlMMMMNN az\g0f ef(d2ddL++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyBoldface.iso1 4Gallant 4404lwfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xpHhPdtWh$ 4Whh0 (8    $!,!1+$A'* + + '$+) 'X/+,<20x7\23h8`=@G?L@TK IH x4KK` XLN([ZL!8p9100_romfont`\$\cDa!pd8c"0v`tulyw"~\z({``#(| ll#`(4##% %&''P*<& 81p`40KXcx60+8Ol4Xyu07Xyu07]x  0?P4(0  WxAhApLLLLLLLLLLLLLLL`+d_Mt6@b`LL DLLLLLLLLLLLL,TTTTTLLLLL<d TTTTTLLLLLLLLLLLLLLLLLLLL 4  \ ޠ ޔ:t:8|655d  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLTTTTT@@D<=?=?DL=LLLLLLLgtgLff$teLe l    L $LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL`+dK0KMtLL$LLLLLLLLLLLLLL!!   &TMDLLLLLLLLLLLLLLLLLLLLLLHLLLdLpxLL$TTTTTLL$TTLLTLLTTTTTTTMDLTTTTTtTTLTLLLLLLLLLLLLLLLLLLLLTTTTTLL$LLLLLLLLLLLLLLLLLLLLLLLLLLLLTTLLTLLTLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLTTTTTTTMDLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL<LL$LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLTTLLTLLLLLLLLLLLLLLLLLLLLLLL 4  X 0 LL$LLLLLLLLLLLLLLLLLLLLLdX0LL$TTLLTLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLTTTTTtTLLLdtLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLu<bb$cn8pc`pl LLLTTTLTLTLTTTLTLTLTTTTTLTLTLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLTTLLTtLTTLLTtLLLLLLLLTTTTTTTMDLTTTTTtTLTTTTTTTMDLTTTTTtTLTTLTTtLH TLL:t:5P5(6LL$TTLLTtLTTTTTtLLLLLLLLTTTTTLL$TTTTTLTLTLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLll ws lLLl(TTLLTLLLLLLLLLTTTLLLL$LLLLLLLTTLLTLLTTLLTLLLLLLLLLLLLLLLLTTLLTLTLTAtA|AAALL$TTTTTLTLTTTTLTLTLT  |ШиѤ>4`CDDDD,pXXPrTr$QQQQQQRR R0R@RPR`U8U8U8U8U8RpRRRRRRRRSSS S0S@SPS`SpU8U8SSU8U8SSSSSU8U8U8U8U8U8U8U8U8U8U8U8U8U8U8SU8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8TTT(T8THTXThTxTTTU8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8TTTTUUU8U ޭxUPx.shstrtab.text.rodata.data.openbsd.randomdata.bss @klX `x H4H4$35H4?848  p9``@!` #``!" $@```d@ a@2`"` H*/+"c\ 0 "" @א?`  ?`°`㿘c` @ ͐"㿘 @#㿘` &c1?@ "㿘@#{  㿘`$b$ ,(?(`İ@ `(b `. ,?# ,İ@`@0@ ,c@9<6@@@¦2@`  Ȱ`@6@# , Ȩ`@ ,?# ,Ĩ@`Ղ$  Ȃ  b,  ("@pb$ Ж  @ʐ@(` (`&@ P`0 @#\@ @ xb `? ``a` ⬄$ $ b   `( `, ` [`c` ⬄p  b0@|ؐ@ٰ @ `$  `$㿐1@"?c'@$@$"@W" bP#@$c"#c %c@ c@'@$ސ#("c'@ bP4`` 4b@%@㿘! 4`  4`$ 4@[  b  40bP  b  b` ` ? bP㿘 ` ; < @ @㿘 ` b@ 8@! @  @"4?$?㿘`` `8"` ` "`"`"` "`"``@,   bP?  㿘#c\` `"` c\`@ '@``",06 @ * '@. @ …`㿘c\`@4@㿘c\` @?"  8@? 㿐1#\`,!" ` #\`P" `/. 8`` 2.  /. > ?`$(?`$(#\`P" `/?#\``  #\@㿐c\8X/(8`` (8` (/8`@ ? 㿐c\/` @ T@㿘  㿘c\t㿐1#\` @ #\`pX#\`p㿘@ b:  b  `  ˆ@( 㿘c\`㿘c\@㿘c\@㿘#a؀`2 `` 4 "$a & 4$a؁㿘c\ @  @"Ԑ#@ @㿘!!pޖ ?!p8` ,㿘'ت`$ ?` )# `$ $ $ %# $ $ $ $ $ $$ ($ ,$ 0$ 4$ $ $ $   @"#h"<b$) + Y`T b  E@ ((b b,< ;@c"  Ġ@ @ `b( @$ 0  ` @# ` @"B#^$ 4@$ @#%`؂`$؁   @#㿘1! &! 2&!@#㿘  c  =@} 㿘mb 2  `2#& c\` %"W``@J  : && &   7 8& ?` & ?`@! `H )`x`@ ~  .`.` @  @i ?` & @@^ @[ P@Y 㿘c\`@ `@` 0 @`耢 ) @` " bb@(`8`(`8`@2 `((`88`@2  㿘c\ ` |@@  |@㿀)" `N'\ `r @ cX `X##d) 8``  `- () 8``)#d( ((`8`` ( " (8``-" " `]#! #$",", ($b$ b(`-2(#d?`,`````\````` ``$`(`h `L `p `T `` `X `P `d `l a ` `t$\ ` `H  a,\ `8 `H X (` \+@(`8``)`\+@ @ cd `mǒ` (``I# b$@@b$M !$", %" ", ($b$ b((8``w`c" #` `d`a#``!#` `s#``!#`#` `@#cp!#`d!#`@a "#@a  $b ! #G$", !$",@ ,# %" @a(  @!0Xb #c\`@ @@dXc\|@  .@ .` .` .` .` .`㿘 ,`@א㿘  ,`@ @Ð`??@Ð!㿘 `   `@  4 $` $`$$`(@ 뀢 '@ '@㿘  `   ?$ `$( s ?$ `$(㿘  `c\``@ `(@ 㿘@ - `Sc\`(_`$`#@cX Q bbad%@%` %`cX %`&``"Jb0Lb0```` ``L  bpbp ` ` ` ` ` ` ``  ` ` ` ` ` ` b `b%% 7#ffa؄%` %` #cX@!#@cXbhbh```` `` pp       cX@! @?@x?`x @֐bP  @@"< @@2 @H 0㿘   * * @"" 7 * ch* t @? '`2!?  &? &@8 *?  #@  #@*? @?ݐ?? x'b@>"`?`@h @"h ccd0(  ct 7(``7b#a`ch#`-;>/-c `%`P8$g?`22 550`(`U?@ܐ#(%@ 2 h@ y'ܔ@$ܠ #``z@ @``&```6!@''@ G,`9# `  `@ @`=?H'ܐ@ ΐ  @ ?o@  @v#X@v#@Ð#xx(``x$#X@i#@!(``2bP "  @ "' 2'bPH@m!##P"  c:# "8"@;' `c\   b1UbP *. a@`"$ `8`>@+p3@2!?: d    ? bP? 8@"妤?? @2   ? bP?`,'D(`0` @SD@ d?D@\#@bP cc@ @@[,@) D `??'N h`hc`@@''Ԃaa``  ' ''' '"L` ) 0`@*` @@``@ `` @"` @[@`@@ @ ",`  ' `@' ,) 0`@ڲ` `@` @|`@` w 4'' ' '  '  `" `IȀ ")`b0c`@ #`D@  d ?g` `@D`2`D?``& Ѐ`" `` 8'@ 8'`@(u,؀`0 @Ԁk,``̀`2` `2`Ѐ#0@ @Q,O'4&6*6,& @ 4@#`` ` "@`` 2,2` #@bP cc@ @@N D@  e f?>0(`0`(`(`@@D@@_ bP cc@o @R@0 +`0 '@ ' ;(`  '20@1#bP cc@A @$#ب 'ܰ` @퀏` @܀` 2@ P@E `7?  ``+`0`@ڠ ( `8`܀"'  "$  ` c @ߐ ( D@  e Ɣ? D@ %@E ?$ 0` Ʈ2  0@bP cc@ɰ @@v @` 4Đ@V?? 4@ p1"P cc@@ O&"P"P @` 1 O&"P"P`21  41 "P} @` @ @a @\ X1"P cc@l@O"P `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2* (``    (``2 "/*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@ @((8`8`@ `2   @@@@ @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @@ @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  㿐  &@``?`  `㿘?c@6 6` )$ $ $@$``2 * @4 , @@@- @5 @@4  @,  `㿘 IA 0)  @ $@ & &$@@@ Ud < @ Udb   Ud @@<@T UUd Ud!Pkrui43ׇ,/8685]2=*fl.P˾XGz !$nw@IeM?c:OS)㓒uuju&Vz6h2Rfy_ n/Uh +,uHɽB{sV$.äf gOVPƔs $;K9 e6}tjPEҚr"FU9fF]`{F`ZiVyBg{ GIT0B3&(xE9jw#M< (vtL7m[m9ݛUjzL+ݍ_'\d VˋvBN\t>+1=8g3Q*$(<@TfW7G @۸pʮqq,O3I<gM%lM1Vt4a"i  p9``@!` #``!" $@```d@ a@2`"` H*/+"c\ 0 "" @א?`  ?`°`㿘c` @ ͐"㿘 @#㿘` &c1?@ "㿘@#{  㿘`$b$ ,(?(`İ@ `(b `. ,?# ,İ@`@0@ ,c@9<6@@@¦2@`  Ȱ`@6@# , Ȩ`@ ,?# ,Ĩ@`Ղ$  Ȃ  b,  ("@pb$ Ж  @ʐ@(` (`&@ P`0 @#\@ @ xb `? ``a` ⬄$ $ b   `( `, ` [`c` ⬄p  b0@|ؐ@ٰ @ `$  `$㿐1@"?c'@$@$"@W" bP#@$c"#c %c@ c@'@$ސ#("c'@ bP4`` 4b@%@㿘! 4`  4`$ 4@[  b  40bP  b  b` ` ? bP㿘 ` ; < @ @㿘 ` b@ 8@! @  @"4?$?㿘`` `8"` ` "`"`"` "`"``@,   bP?  㿘#c\` `"` c\`@ '@``",06 @ * '@. @ …`㿘c\`@4@㿘c\` @?"  8@? 㿐1#\`,!" ` #\`P" `/. 8`` 2.  /. > ?`$(?`$(#\`P" `/?#\``  #\@㿐c\8X/(8`` (8` (/8`@ ? 㿐c\/` @ T@㿘  㿘c\t㿐1#\` @ #\`pX#\`p㿘@ b:  b  `  ˆ@( 㿘c\`㿘c\@㿘c\@㿘#a؀`2 `` 4 "$a & 4$a؁㿘c\ @  @"Ԑ#@ @㿘!!pޖ ?!p8` ,㿘'ت`$ ?` )# `$ $ $ %# $ $ $ $ $ $$ ($ ,$ 0$ 4$ $ $ $   @"#h"<b$) + Y`T b  E@ ((b b,< ;@c"  Ġ@ @ `b( @$ 0  ` @# ` @"B#^$ 4@$ @#%`؂`$؁   @#㿘1! &! 2&!@#㿘  c  =@} 㿘mb 2  `2#& c\` %"W``@J  : && &   7 8& ?` & ?`@! `H )`x`@ ~  .`.` @  @i ?` & @@^ @[ P@Y 㿘c\`@ `@` 0 @`耢 ) @` " bb@(`8`(`8`@2 `((`88`@2  㿘c\ ` |@@  |@㿀)" `N'\ `r @ cX `X##d) 8``  `- () 8``)#d( ((`8`` ( " (8``-" " `]#! #$",", ($b$ b(`-2(#d?`,`````\````` ``$`(`h `L `p `T `` `X `P `d `l a ` `t$\ ` `H  a,\ `8 `H X (` \+@(`8``)`\+@ @ cd `mǒ` (``I# b$@@b$M !$", %" ", ($b$ b((8``w`c" #` `d`a#``!#` `s#``!#`#` `@#cp!#`d!#`@a "#@a  $b ! #G$", !$",@ ,# %" @a(  @!0Xb #c\`@ @@dXc\|@  .@ .` .` .` .` .`㿘 ,`@א㿘  ,`@ @Ð`??@Ð!㿘 `   `@  4 $` $`$$`(@ 뀢 '@ '@㿘  `   ?$ `$( s ?$ `$(㿘  `c\``@ `(@ 㿘@ - `Sc\`(_`$`#@cX Q bbad%@%` %`cX %`&``"Jb0Lb0```` ``L  bpbp ` ` ` ` ` ` ``  ` ` ` ` ` ` b `b%% 7#ffa؄%` %` #cX@!#@cXbhbh```` `` pp       cX@! @?@x?`x @֐bP  @@"< @@2 @H 0㿘   * * @"" 7 * ch* t @? '`2!?  &? &@8 *?  #@  #@*? @?ݐ?? x'b@>"`?`@h @"h ccd0(  ct 7(``7b#a`ch#`-;>/-c `%`P8$g?`22 550`(`U?@ܐ#(%@ 2 h@ y'ܔ@$ܠ #``z@ @``&```6!@''@ G,`9# `  `@ @`=?H'ܐ@ ΐ  @ ?o@  @v#X@v#@Ð#xx(``x$#X@i#@!(``2bP "  @ "' 2'bPH@m!##P"  c:# "8"@;' `c\   b1UbP *. a@`"$ `8`>@+p3@2!?: d    ? bP? 8@"妤?? @2   ? bP?`,'D(`0` @SD@ d?D@\#@bP cc@ @@[,@) D `??'N h`hc`@@''Ԃaa``  ' ''' '"L` ) 0`@*` @@``@ `` @"` @[@`@@ @ ",`  ' `@' ,) 0`@ڲ` `@` @|`@` w 4'' ' '  '  `" `IȀ ")`b0c`@ #`D@  d ?g` `@D`2`D?``& Ѐ`" `` 8'@ 8'`@(u,؀`0 @Ԁk,``̀`2` `2`Ѐ#0@ @Q,O'4&6*6,& @ 4@#`` ` "@`` 2,2` #@bP cc@ @@N D@  e f?>0(`0`(`(`@@D@@_ bP cc@o @R@0 +`0 '@ ' ;(`  '20@1#bP cc@A @$#ب 'ܰ` @퀏` @܀` 2@ P@E `7?  ``+`0`@ڠ ( `8`܀"'  "$  ` c @ߐ ( D@  e Ɣ? D@ %@E ?$ 0` Ʈ2  0@bP cc@ɰ @@v @` 4Đ@V?? 4@ p1"P cc@@ O&"P"P @` 1 O&"P"P`21  41 "P} @` @ @a @\ X1"P cc@l@O"P `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2* (``    (``2 "/*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@ @((8`8`@ `2   @@@@ @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @@ @   (@  +` @ `(`3`@!`@ `v"   *3`"  "`0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  㿐  &@``?`  `㿘?c@6 6` )$ $ $@$``2 * @4 , @@@- @5 @@4  @,  `㿘 IA 0)  @ $@ & &$@@@`    @ $@֤ Ӓ&` ``   @  ((`00`( 0@ @0  *`(`0`(@ 2P c  ?    ?I674 4`6`77777777`<.`;=.`0`, * 0`* ,* 0`  ?* * 4 * 4 *  'Ġă(` `  (`?`  @(`' (`ڂ@0+`'ȉ0c'Ԅȅ(`'Ȁ` ĒGȐB+`0'`ă(`0`+`0@'?''c''̬ @`(4`ԃ(`0`, )Ԥ, ,0` ĤԠĀ ж@, *`4 2`k$$4@ @4 ! (4` @0`5Ā` И @(`(0`0@00`? 5ڂ0Ј `''Ѐ ,Ȁ`"Ē Ȃ *` @ȅ((`00`0 (@@0 *`5@(() 0(`0`?(() 0(`0`6 (`p0` ' '    ??  8@` ` 8@@@ B 8@   (`0`"@ "` "` :`P㿘 ` b``@ `&@@  `&@@  ) `h D@?/`@y ``d0 , , `@ 02, $@ ؐʒ-  ?@@耠`@0$ & &.`@`8 &㿐  `P Re8<` %  `(@8`eD`L  Ȁ@ @&@%@& @  c 6  H@  Ȁ@`0`  `=`#  @ $ $  @&@%@& @  c א  ,84(@@ ͐ #@ &@ `d`  *  Ā $ 8eD @8`0$ 㿐`? `@4v %*  @(`0`(@`" @  @C <@ @  @ (`0`@C <@  @C <@" `.@?$@$` `Đ.@㿐3 `@,( 􀦀@>@@@ <@`@@"`2&@ے"` `8в 㿘 `   @`0  "  @`0 @ @  `" ݞ@ 㿐` @~0@ฐ,x``*༠8` ;d``0 ,  @ 0@"x @} *  @@ ?%% % % % % 0@j0x@3 В  @ @,&`@% ```    "e\ kFaT `0@g`t% `t% `t% w    8''''(8```/2   (8``/" `" <(`0`@@Ƕ.8``/  .`  8``/ u .`8`/`%%{ u* d(`0`(^`"  @2  o 2 /  < (`(0`@@' ʐ@D 8+ 䀠8% `` ' @ِe(8`4ؔ@ѐ(`8``/O Ւ K'c ܀`0@x1@@=@" /@8 (@܀(    2צ@`d0``ܕ*   ܔ@ '@0' @((```@ " ! !00! `0!  ! `"@? ` ` ` `??() +`? c@@@?@@@ @ "@㿘`&@@`&@.@& 㿘& @&@   T ?cܤh''ߒc ΐ֐   6 H&"#\#@#`a b@   H bP? ''h쀢 Œu #' p ?c  '؂'''#a'b'̐=   4 ?$!̒b#@ T#`#\ @A  <#!bL@"H"HV'4bL *@2X  ?@_ \c'  c3c "*cX  ` ?@: 㿘 . a  - `  bP  bP? bP?    ??  8@` ` 8@@@ B 8@  "`"`a$"@  :`P 㷐P @M`@` G`D@  `,4  @(* :  /􀢨H `g"''`@ d (􀠀 # "'@ @<@  `@4@ @" ` &@@ $ '@逦`@倦㿘  & @ C 㿐@ (! ` h/(@  2! @``"* `@s```<  2(:  (@ ( @ ( @  `(`@h` `(`(@@ )  `@`h```"(@2`,``  (` ( * :  Đ" @ @ ’(gx@ ٠ ,:`/   ` @,:`/( ` (` (   W@U  -8`@2N?  ! "@   +`` `: (`8` ` aӗ,+`:`/` ```  ) `(+`@    -8`@" @ ` a@  @Ն?  x:0 4 @@"A ` ``2'@ `  |`! @(=`  @ ,s @ @(3 ```?8 (`8` @ ʤ @ Q``` - (:  phk @ ` ` ` (`((@@@  (`8``.`?`;92< (̰ @  " " " " &`""  ` ` ` `(((`@@ @"  ` ` ` ` (((`@@ @8`! ! @ r @(``À @ i `" ? (`8``;2@ ?   Ѓ(`8``; (?@ O ~ |  㿘    1 / #=.鿰   5   * -: 2 0    0Ҁ  ? 0.    `D ??  8` ` 8``@ B 8` `0`4`(@ "@`8"``<"``@"``D :`P 8K a̬b \`KKNX@?@@ 2?( *<  @ &+> @ 2  @ '  , $''$L#\@#`̐1"Pcp@ !8 &@ !1 H&"P"P1&"P"P㿘  "& @  x&  0X`X @ Ɛ!X ,9a(`8``〠`/2 `0 (`8``/" `"&``0`ݨ @ C x@" "" ,`8``Ũ`/   `/ @  ,`8``  ,@``?`?`?`d? *    @ '(@ h#\#`"  @,? p  l, 0`"$ @@  x80`@8``(`Ӧ` bP @ M  0@ I D, 0`‥@  ?`"?` ?`$? #`#\@ ?C . A O@ # (@d( % @ @@ (`8``/'@ x@  7, @ @  x $@  x@  bP 0O&` ې x@ אܰ ڰ ?@! D    4` $@@ِ 2  80`@8``(`'@ Ԅ $#\#`a b @_??$ Ԁ!ؠ"h @  $?!?$ 8$ 0$ 4  נ   bP? bP? H bP?"@?2cT(bЄ2  @ 2  @ 2  ?T`  TT` T(` @@ ` ` `㾐ab@q\'Ĕ?= 6   '?'?@F? '? '?P`` P'?Ġ@?Ă @   #\ " |{a8"<@?  H `  `& @@ ! H bP?'x 'p't'|#\#`  p  !"P@?@ א!x H$"P'?ؐ6  o㿘9@'"P ?@cP2?``2?``` '"P@ !?㿀@ٶ  (`0`hh"? (`0``@?<@ `0`(``@  7 (`0` ` Ҁ` &@ e  7  @ ((`00`@(``'(`0``%4    &' / '''''7 @ &' ' ' ' 6(`0``?&' ' ' ' ??@ !ȁx&$`$` $`$`$`$`c   ːȐ ?& @ ?   `A```21  D@?`& @ ?`0 ꀢ?`0 ? & & & T`?& @& &|   Dtq* ??`i?2?`㿘a^[X?, ?& @, ,`* 㿘. b\@ @li`e % % 1@ /% @ @`2P P D`2L P  "H P T`P ` D`&"P L@ %  % D"P2t P L%@ % @  P@ " % P Pd? @`2 P  @2  = =   @ r % P @ k" % P&?@-` @ݔ   " @@% % % % @g   "%   & @ C = @ =  % D" Ӡ% DP`"  P?% @ق% @㾘 . U. \`TC\O `  @ ?@4`L? @$@$`$`$` $`$`$`$`$` $`$$`($`,$`0$`4$`8$`<$`@$`D$`H$`L$`P$`T@Д8$@$`Lt$`H`2@,@ @I?$` @> ?? bP "$` a?? bP א@e !”: 2 a2 adꀤ `F@um ? bP?l㿘 . . b\@  @ L@@ X@  bP? `| 㿘@?`@D X. b\ @ """ " " " " " " " " $" (" ," 0" 4" 8" <" @" D" H" L" P" T? @@8  @M X@P?@&`L &@&`H@3㿘衒@`` ?@* @ @:`? ``   `    #` !?"  㿘 . a```` `@` $@    bP? ``" ` @뀤 bP? bP?㿘  . a  ?? bP   a?? bP 8 ` @B 8㿐`  ` @@`  ``  bP?` `$ $$ 'L 20$ `"($ ) (``$'℀`  bp ℤ@ `@@ ``  @$ bP?$,, @@$ 㿐 . a ? bP " @`  `  +`0`    bP @C >  '`  bP& ? ::::::::::::::::::D::d:::Н㿈`@. @,Ơ  ? * :  ?㿘` "l`X@* : !"lq ox`@؀ @(`8` %` @`(`` 8 % @(` 0  x @  ` + ,3`3  ? * : *?~ @w @ *m:`   (`8`K (@@ @?  ,   (`8  8 (`8` 4 †`(`8` { (`8`  q@ k@ $ a@e  X@"U@ >Q@ l0`  - bb#㿐bH'H'L'P'T'X'(#@   ( 2 @   @ (:,:#p:#p:#p:#p:#p:#p:#p:#p:$H:$:$:$:,p:+:%$:%:&:.:-:(:*p:):-:+:#p:+:-X:*Ȁ 2 $?  " " " " " " 8 0  ( , 0 8 < L l P  2 $? ` <@`  8" < (@ @ (@" 8 㿘?(`8``125?@22? /? ($  ,`  0  ?0 `$ $>``"``8 ,"`$"`4$ 0c$ ("` bh$ , 0@?$ $  c@ 㿘 2 $?` ,``4 0@ $ ,@ 0& $ 2 $?  `" "`0  ! @ `"    `! @ `  @@ 㿐 2$??2<`?`h<8 `$<)$$8  * 8<1 $8$<`$hh @$@<$h`ð?ݐ  << $ 2 $??`  <`?㿘 `W?`$`2`(?N?`,`J `0 ?0 B`4`@ `$`(`0 *@ "1`0 @`3 [a0`Le0*`la,@8 `l`P0  @$P$L`l @e0$l`$`4 9*$4$ $ `,@?˰ 㿘 $ 4T ("! $&@@ :( 0"@ +"@@26 0 (@@)$ 0 ,@ @$ , (@$ 0$ ,$ (&@@ * 0"@  ($ 0$ , "@ 0 (@@$ 0 ,$ 0@ ڰ  4"@ڔ ($ 0$ ,  $ ( 0  (@ $ 4  㿘 2 $?``` @`     & `( `4@"@`($`, $`  @"$`,` ؒ  @X @U`ڰ?$@?㿀 2 $?`? ``" @   `lbae0`8`<'''`p`T`X ''' 8٦?) "&  @(@`  ?5 5 - ? (`$`& 8   $@` `s  @ $`& 8 $@`"& ``․   5 ?$@Ĉ"&  @(@`   a5 `$```5 $`d``$`\5 ?򀠠 $`h$@`h`\( ^ @"_&  @(@`   (`$`h0`@0`p5 ?@ (  ^@(`$`h0`@0`p $`l$`L $`T@  b $`h$@```d`h   `T`L( (`@` `-((@ (  ` 2 @& & && `($`8` $`<@`  @"  [ Ԃ     ' &@@> C > ``@ $` " ` `"@@+$`& 8`@`<` @ (`?(`& 4`"Ϧ?0"&  @(@`   $`5 `B $` $@@0?و`@ $(@ 5$`@ $@`X`P (@ (@` @ `s(@ ( `  `e`2 @t& `, @ $@"i& `D':B`@`0 @`4`(  @@`@8!%$`@ @)` `@``@x$5 5 @$(0`$`D$`H $@`H"`D `D(@` 2 @& $@+??5  @| $`@   $@`@`<  `@@ @$$`@@%@(   $@ ``  "&  @(@`   ' @> ``@ $`` @"'@ $`& 8?`5 5 ? - (`ʸ !&  $@  ?  5?(@`  2 @& ``  $@Έ"&  @(@`  5   * A   `"`$a&  $@s?$0`5$`@`  `@  ` $`H$@`H΄  `@(@` 2 @Q& "N& `@/@` $@$@`T`L (@ (`  `u`(@ ( ` ` g`2 @$& '@̆ $@ ? `"9@)?٘( (0` @0@@ (`@ @    $( 0@@ (`@  @ ` @2 @& (0``(U+ `` $(@` z2 @& $@&  $@`R(``L  0`( 0@@ (`   Ѓ(`( 0@@ (`@  @  `2 @&  !&  $@Ɉ$ @50`p$`hh !,@(`2@&  $@`D $(@ 5$`D 0`$5$`@$@` $`P! $`X$`L $`T$@ $@$50` `` @  `- `h($`h@0`p   !  k$(@` c2 @/& & & & &$`<$`8: @ $`l$`L $`T@w즒 N`l``$`P`d $`X*` `p@f@  &  $@75  `=& ? $@* )$(@` !2 @& (`0`$`@$5 `h0@  j$@$ ̩5+ `n@? (5 0t`$50` `l` (@ $` @ $` "& 8 @? `` $@㿘?6 c`V U a?GbP![          @@@@ @ @ @ @ @@@@@@@@Ϯ##a@aN-@@`@?c?`c* ````````` ` ` ` ` ``@`@@@ @ @ @ @ @@@@@@@@8@ @`@!?߮##ߪ-@@c@?`(?`(@㿘 ?q!? # ވ߂##6`6 @#@&$8$c…8&?c8&. @ 0@`` 20@"@ (@ (0 `0@ / (`` ?/  0`(` @`(`(@(0`$ %@ " +`(``ښ``+`ڄ ((`0` ۆр 7@0  ) @ (0(@ `0(`0`7@ ) @    (@'''   '?  '") 0`@  @  `(`@ (@. (@ 2@ @" @(`@`0((` (@ 0 20\ *  (` n` (`0`(0 @B0 @<"'@@(`@  ((@ 0 @ @ . @. (`0`  `` (@ ( +(* (`'@$@80 t@ @ "07?HaP''? `? (@L'"&   @@   @2@(`(@@(`0` (@ 0 20 -@$%@ @ @րa΄}''!`* b       (@@ bp  @ 200)  ! @  ``㿘`1"p㿘`X `U8?bp@``(`@6 `(@0``(`@0`(@0``(`@0`(@0``(`@0(@0Ʋ`"8bp@6 `(`@`8f8` `2``2 㿘 $  2㾘;;n c  'x @`@(6>@ `, 4`< @"ɒ..6>@dvma_mapoutdvma_mapin%lx pgmap@ %lx L!%lx %x %lx %lx map-pagesobmem %lx L!boot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s node %x property %s length %d > %d Invalid controller number prom_mapin: length=%dprom_mapin: invalid maptype %dprom_iopen: "%s" error=%d no PROM root devicenamemakememarrmakememarr: hope version %d PROM is like version 2 memorymakememarr: cannot find "memory" nodeavailableregmakememarr: cannot get propertymakememarr: no memory founddevice_typeblocknetworkbytecompatiblesun4cpagesize %x l!sun4msun4dUnknown CPU type (compatible=`%s')%x mac-address drop swap 6 cmovexmit: not a network device Can't open device `%s' Can't open network device `%s' prom0promsdstxdxyfdie   2.11cannot open %s: %s >> OpenBSD BOOT %s can't figure out where we have been loadedbsddevice[%s]: boot: Booting %s Loading at physical address %lx /etc/random.seedCannot load %s: error=%d mmlseek phdr: %s read program headers+%s%lulseek textread text+%lulseek section headersread section headers [%s%ldlseek symbolsread symbols]read header failedread header shortELF=0x%lx bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d CD001@` nfsread: short packet, %d < %ld nfs_read: hit EOF unexpectantlynfs_open: must mount first. getport: %scallrpc: error = %d recvrpc: reject, astat=%d, errno=%d readudp: huge packet, udp len %ld sendudp: bad write (%d != %d)arpwhohas: overflowed arp_list! arp: no response for %sInput/output errorInvalid argumentbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorUnknown error: code %drarp: bad socket. %d No response for RARP request 0123456789abcdefsendrecv: short write! (%d < %d)exit1.2.30123456789abcdef|/-\     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O error@@ !1Aa  0@` #+3;CScs 99͌99ƨ9ư99ۀ9`9ٌ999\999`999:E9L9P989X:E9`9P99X:E:E:E:F:F:E:F:F/:e9 :V  :X :X 9':X$2:X(::X,B9$P9pc9r:X0x:X4:X89l:Y:Y:Yp:Y:V:XX:Xh:Y:XH99 &9d+9+999E9dU9b9q99T9499@9999999499|9p99 9999E9U9b9q9x99999p9L9@9d9999$9999T 9H9l99E9`U9b9q99P909|9<999999 9099x9l99 9999E9U9b9q9999999`9T9x99998999,9h 9\99("9h&:W09L:9H9[9ʹf9<n9\v9 ~:Y9:Z$:Z 99:Z(:Z@::ZX:L:::Z\:X :Zl :: ":>1:X<:XL:ZpV:Ag:ADy99P999T9 9X :cX:X99L:9ٌ:W :H :c :_ ! :c-9\89E:W N9W:W^9l :bz99:V9p99X9 :_h98:V :_l9\9ۀ 9 :bP 90%:,:(297:#`? :bHN:VV9a9g9ְq9{:x:V, :c::V$999 :c99ل :cP:9t9l:V9P :< :c9d):L1 :c: :_XJ9$V:W_9`l :_pr9:: 9:Wp9 9͌:V(::V  :bX::VL9 :_\9 :D-969D9O9@^9pd9`m9w9L9`:4:X:h9:,:@9:X9:9,9:\ :_t :dp:?9 :-95:$: :dA9K9T:V0d:Vj90{999  :^9ư:W :e: :bL98:X9X99 : :^p 9 !9 (90 -9 79 @9 H: R9 [ :d b9 j9 x9` 9 9( : 9 9 90 :At :e 9P 9 9 :^  :cT 9 9D )9d 29 B9 M98 Y9\ c :_x h :_` u9 9x 9 9 :7 : : 9t 9ƨ 9 :Vh :Wx 9 9 9t 9 9$ 9 (:"l =9 D:| I9P S9, Y9 i:V v:\ :_ :V 9\ 9 :@ 9` :^ : :_d :?X :a :8 :X 9 :| .text.data.bssbase_vapmap_map4sun4_mmu3lrcookiescookiepmap_extract4pmap_extract_srmmupmap_map_srmmuobmemopen_countnetif_prompv_putcharsun4_idprom.3002promdev_inusestringbuf.3114rootnode.3074dtabfilestore.3192promvecstore.3347saveechobootstore.3199getphysmemrelseekLstdLmul_shortwayLgot_resultLnot_really_bigLnot_too_bigLdo_single_divLend_regular_divideLend_single_divloopLsingle_divloopLdivloopL.1.16L.2.17L.3.19L.4.23L.4.21L.3.17L.4.19L.4.17L.2.15L.3.15L.4.15L.4.13L.3.13L.4.11L.4.9__lmulqshlzero.1907block_mapbuf_read_fileufs_close_internalread_inoderecvrpcarpsendarprecvebuf.2170sputcharsbuf_endsbufrarpsendrarprecvetherbuf.2916buf.2938numberpaniced.2170get_bytecheck_headergetLongsstoppos.2283syncsearchupdatewindowmake_crc_tablefirst.2581crc_table_emptycrc_tablegf2_matrix_timesgf2_matrix_squareputcharloadrandomprom_getpropdvma_allocprom0_iclose_remprom_ioctldomainnameinflateCopycd9660_writenet_openalloccd9660_readrnd_loadedprintfnameipprom_sihostnamelenelf32_execrpc_fromaddrrpc_portstrerrorcompatprom_findrootrpc_pmap_listsnprintfrpc_pmap_getcachehznodevether_sprintfnfs_readdir__qdivrembstartrarp_getipaddressnetdev_socknetif_debugcd9660_statcd9660_openprom_getidpromerrno.mulocloseintoagetsinflatebp_server_addrversionnetif_open_udivbp_whoaminfs_closeolseekpgshiftswapipmemcpynbpgdevopencd9660_seek.udivrootipsendethercd9660_readdirrpc_xidtwiddle.divgetsecsndevsprom_makememarrip_convertaddrmyipbp_getfilekprintnhostnameprom_bootdevicedvma_mapoutrootpathobp_strategydebugprom_getetheroreadlseek_rttarp_numbzeroufs_closepgofsetinflateSyncPointcputypnfs_root_nodeinflateGetHeaderfile_system_cd9660fdloadfilepromvecxdr_string_decodeinflateInit_nfs_opennet_mountrootprom0_recvprom_interpretfstatnfs_readnfs_writeprom0_strategyrpc_calladler32netmaskzcfreeinet_addrvprintfsendrecvdvma_initdonottwiddlegettickscloseallnfs_mountobp_xmitoopenbendbootfilecrc32nfs_statinflatePrimenoioctlreadgateipnetif_putpeekcharfile_system_ufsnfsysprom_nextsiblingstrncpyprom_initnet_closesocketsufs_seekarp_listfilespanicbp_server_portsendudpinflateResetmemcmp_uremxdr_inaddr_encodeinflateSyncfile_systemufs_readmemsetmainarp_replyufs_opengetcharinet_ntoanfs_seekifnamereadudpprom_findnodecd9660_closecngetcstrcmpzcallocsocktodescxdr_string_encodegetdevtypecrc32_combinedomainnamelenprom_open.urem.rempmap_extractrpc_pmap_nummmu_initxdr_inaddr_decodeobp_recvprom_getproplendvma_mapinprom0_closenetif_getdbufprom_boothowufs_readdirnullsysin_cksumprom0_xmitadler32_combinekdoprntexit_divufs_writestartfile_system_nfsbceaprom_getpropstring__moddi3arpwhohasufs_stat__muldi3netif_closeinflateSetDictionarystrlenopenreadether.umulprom_firstchild__data_startinflateEndrnddatadevswprom0_iopenobp_closeinflateInit2_dvma_freepmap_mapcloseprom_bootfileget_crc_tablefbufinflate_tablefreelistrpc_pmap_putcachefree