plasma5-workspace-5.27.9-bp155.2.9.1<>,fjI%z FPoU[[ea8?Fד$~6]1>$j+_9~DHFHrqV|h|L,pr{Zcl]WдO}unJ4F?RN,8Hd/ؘ0nbN >xH*-3ΨDĴl% ^C.t$B_>|&U4Dyx,b>Mv$?vd ' K |L\\\ \ (<\ 9\  \ x\#\9\OO\a fqd*v **@Hg(u8|b9b:Hb>?@B FuGΌ\H\Il\X`fYfZ[\\] \\^W>bcsd$e)f,l.uD\vw\x"@\y3`zu0u@uDuuuuvCplasma5-workspace5.27.9bp155.2.9.1The KDE Plasma Workspace ComponentsThis package contains the basic packages for a Plasma workspace.fji01-armsrv1YSUSE Linux Enterprise 15openSUSEGPL-2.0-or-laterhttp://bugs.opensuse.orgSystem/GUI/KDEhttp://www.kde.org/linuxaarch64/sbin/ldconfig if [ -x /usr/bin/systemctl ]; then for service in plasma-gmenudbusmenuproxy.service plasma-kcminit-phase1.service plasma-kcminit.service \ plasma-krunner.service plasma-ksmserver.service plasma-ksplash-ready.service plasma-plasmashell.service \ plasma-xembedsniproxy.service plasma-baloorunner.service plasma-restoresession.service plasma-ksplash.service ; do if [ -e "/run/systemd/rpm/needs-user-preset/$service" ]; then /usr/bin/systemctl --global preset "$service" || : rm "/run/systemd/rpm/needs-user-preset/$service" || : fi done fi if [ $1 -eq 0 -a -x /usr/bin/systemctl ]; then # Package removal, not upgrade /usr/bin/systemctl --global disable plasma-gmenudbusmenuproxy.service plasma-kcminit-phase1.service plasma-kcminit.service \ plasma-krunner.service plasma-ksmserver.service plasma-ksplash-ready.service plasma-plasmashell.service \ plasma-xembedsniproxy.service plasma-baloorunner.service plasma-restoresession.service plasma-ksplash.service || : fi/sbin/ldconfig/ d:05`_0 %`z`OӸRV(] ߠ.%(s]W@t~Hg@~(A$vA8fqgEhp[`8$8(88m08>l8i`8DPNJ(JhKMAXaxXBS`?>(2()X>H839E@)fH00(`9>;h3`86D2}Xr0Q Y0^IX9>07?zOEuXE@m](M bF5Qh##@dPŘOXu`h +5h 5/H<740Km`D0@><(kp|HF e94XDHDN5#@ -5*C E7*(K~LSpVH4?j9Y  /t &xYm  VQDDaroT' q Q  I V C Q A c A&  j  )juCMuq"  xB lFHI% dR^vTXz" rTJ >Pvc %#G leZ? 6  5A'b~i 0 |h 5wt F6yH a2XI<lDk Z C|>FOy+& /.=DI q5[2% * 5> <Zbb>bbnb|bbdbb b$bbjKc~;*aC}C}``e.e.6pa[!A!@&"R#!2"J ]#$2"2!";(7ujTJS%L} XUxEĊjD 9r>be=JEH f7 xJC3'S DSW(#}|`J9X :~|?=zW<Gl`90A )&M C#%Y  z"%S BQ # HJ:{'h& '>)v# -0&$bRf% $( Q J@ `D&/Y#7O+v~-,$wJ' Fx" h&&C.6< Y- )J (V2.Pu')*+((T( G +m(-k0a(dD kj ' Ir# W* ' Ir%)?o[3' D1 = A큤AAAAAAAAAAAAAAAAAAAAAA큤AAAA큤A큤A큤AA큤AA큤A큤A큤A큤A큤A큤A큤A큤AA큤AA큤큤A큤A큤A큤A큤A큤A큤큤A큤A큤AAA큤AA큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤AAAAA큤AA큤A큤AAAA큤A큤AAA큤AAAAA큤AAA큤AAA큤AAA큤AAA큤AAA큤AAA큤AAA큤AAA큤AAA큤AAA큤AAA큤AAA큤A큤AA큤AA큤A큤AA큤AA큤A큤A큤AA큤A큤AAAA큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤AA큤A큤A큤AA큤A큤A큤A큤AAAA큤AAA큤A큤AAA큤A큤AAA큤A큤AAA큤A큤A큤AAA큤A큤AAA큤A큤AAA큤A큤AAA큤A큤AAA큤A큤AAA큤AAA큤AAA큤A큤AAA큤A큤AAA큤A큤A큤A큤AAAA큤AAA큤AAA큤AAA큤AAA큤AAA큤AA큤A큤A큤AAA큤A큤AAAA큤A큤AAA큤A큤A큤AAA큤A큤A큤AAA큤A큤A큤A큤A큤AA큤AA큤e7yfjfjue7ye7yfjfjnfjdfjfjfj+fjfjfjfjfjwfjfjfjHfjSfjfjfjfjPfj@fjfj3fjNfjLfjfj]fjvfjfje7yfj*fjfjKe7ye7yfje7yfjfjfjfjfjfjfjfjfje7ye7ye7yfjfj9fj7fj6fjofjRfjofjfjofjofjwfjfjfjfjBfj@c#c@c6@bbb@bb@b@b@bbbb=b1@bbq@bBb'E@b%bs@b@b afaa@a6a@abawaqV@an@aim@a^@aMaKaD@aC1aA@a.`@`E`@`"@`Ȗ@`P@`@`[`[`@```@`7@`lM@`P`>(`8`4@`3`.V`-@`%@` l`_T_k_k_0@_@_ _h_t@_@_@_@__~@_xg_q@_k8_h_cO_a@_R,@_N7_ @_c^4^^^@^@^@^2^>@^U@^0^0^g@^U @^K^B@^;^)^&^ P@^@^r]]ʞ])]@]@]]@]@]m]nU]fl]@1@]$] ]@\@\@\P\s@\}\N\\@\@\u*@\k\k\\\@n@\4[@[@[ @[@[[R@[@[@[Q@[s[`O@[L[E@[D[2*[(@[@[Z?Z@ZZZx@ZZ2@Z=Z@ZZ_@Z@ZtRZ\ZKt@Z%8Z"ZZ@Z@Y+@Y6YYYYcYo@YYYY@Y?@YaYm@Yf@YbYWYS@YRHYEY?Y6@Y.@Y-^Y(YR@Y@X:@X\Xh@XXXXf@XX@X@XN@XXXXXwoXtXdXbWX5X'@X$a@X&X@X@XX @X TX @XW@W@W@VVV@V=@V_VvVVy;@VpVl @Va@VUVO @VC-V?9@V*!@V'~@V#V Vf@VUYUpUU@U{@UUUx&Ug@U_@UXUD@U8U) UF@U@U @U @U@T!TOT,@TT@TcKT[bTG@Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fusion Future Fusion Future Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Moon Glass Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Christophe Giboudeaux Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fusion Future Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Christophe Giboudeaux Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Wolfgang Bauer Christophe Giboudeaux Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Michel Normand Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Hans-Peter Jansen Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Christophe Giboudeaux Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt Wolfgang Bauer Fabian Vogt Fabian Vogt Fabian Vogt Fabian Vogt fabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.deFabian Vogt fabian@ritter-vogt.defabian@ritter-vogt.desbrabec@suse.comfabian@ritter-vogt.deMarkus S Fabian Vogt fabian@ritter-vogt.defabian@ritter-vogt.deFabian Vogt fabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.deFabian Vogt fabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.demimi.vx@gmail.comfabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.dewbauer@tmo.atfabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.delbeltrame@kde.orgfabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.derbrown@suse.comfabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.dewbauer@tmo.atfabian@ritter-vogt.desmurf.anon@gmail.comfabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.dewbauer@tmo.atfabian@ritter-vogt.dewbauer@tmo.atwbauer@tmo.atwbauer@tmo.atwbauer@tmo.atfabian@ritter-vogt.dewbauer@tmo.atfabian@ritter-vogt.defabian@ritter-vogt.dewbauer@tmo.atfabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.delbeltrame@kde.orglbeltrame@kde.orgfabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.dedimstar@opensuse.orgfabian@ritter-vogt.defabian@ritter-vogt.dewbauer@tmo.atfabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.dewbauer@tmo.atfabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.detittiatcoke@gmail.comfabian@ritter-vogt.defabian@ritter-vogt.dewbauer@tmo.atfabian@ritter-vogt.defabian@ritter-vogt.dewbauer@tmo.atalarrosa@suse.comfabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.dealarrosa@suse.comfabian@ritter-vogt.defabian@ritter-vogt.dealarrosa@suse.comfabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.dealarrosa@suse.comfabian@ritter-vogt.defabian@ritter-vogt.dealarrosa@suse.comfabian@ritter-vogt.dewbauer@tmo.atfabian@ritter-vogt.defabian@ritter-vogt.defabian@ritter-vogt.dewbauer@tmo.atwbauer@tmo.athrvoje.senjan@gmail.comwbauer@tmo.atfabian@ritter-vogt.dehrvoje.senjan@gmail.comalarrosa@suse.comfabian@ritter-vogt.defabian@ritter-vogt.dehrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comwbauer@tmo.athrvoje.senjan@gmail.comfvogt@suse.comjengelh@inai.dehrvoje.senjan@gmail.comwbauer@tmo.athrvoje.senjan@gmail.comalarrosa@suse.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comwbauer@tmo.athrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comwbauer@tmo.athrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comwbauer@tmo.athrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comalarrosa@suse.comopensuse@cboltz.dealarrosa@suse.comalarrosa@suse.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comalarrosa@suse.comhrvoje.senjan@gmail.comlbeltrame@kde.orghrvoje.senjan@gmail.comwbauer@tmo.athrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.com- Add patch to fix a regression introduced by the preceding change (kde#487912, boo#1226110): * 0001-Fix-writing-ICEAuthority-file.patch- Add patches to fix ksmserver authentication (CVE-2024-36041, boo#1225774): * 0001-Authenticate-local-clients.patch * 0002-Remove-iceauth-dependency.patch- Add patch to fix the logout applet: * 0001-applets-lock_logout-use-PlasmaCore.IconItem.patch- Update to 5.27.9 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.27.9 - Changes since 5.27.8: * Do not consider icon changes excess notification creation * lockscreen: handle user switching also on nopassword page (kde#458951) * applets/lock_logout: add a11y properties and restore tooltip * runners/recentdocuments: Fix results being discarded when casing is different (kde#474782) * [plasmacalendarintegration] Fix selected regions are randomly reset to default (kde#472483) * libtaskmanager: test waylandtasksmodel- Update to 5.27.8 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.27.8 - Too many changes to list here - Drop patches, now upstream: * 0001-OSD-Fix-size-calculation-for-progress-value.patch * 0001-shell-avoid-potential-crash-when-previous-window-is-.patch * 0001-TriangleMouseFilter-check-intercepted-item-still-exi.patch * 0002-TriangleMouseFilter-also-check-optional-position-has.patch- Add patch to fix crash when opening windows (kde#473432) * 0001-TriangleMouseFilter-check-intercepted-item-still-exi.patch * 0002-TriangleMouseFilter-also-check-optional-position-has.patch- Add patch to fix crash when closing popup on Wayland (kde#473054) * 0001-shell-avoid-potential-crash-when-previous-window-is-.patch- Add patch to fix line wrapping of "100 %" in OSDs (kde#469576): * 0001-OSD-Fix-size-calculation-for-progress-value.patch- Update to 5.27.7 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.27.7 - Changes since 5.27.6: * libtaskmanager: fix unable to change order of launchers (kde#472812) * Reorder removals to ensure launcher url is deallocated after last use * Fix crash in LauncherTasksModel::Private::requestRemoveLauncherFromActivities (kde#472378) * libtaskmanager: skip empty appId when matching '*.appId.desktop' (kde#472576,kde#428559) * Do not write empty path to desktop file (kde#433304) * Fix crash in TasksModel::move (kde#472524) * kcm/region_language: fix enum order (kde#472108) * kcms/region_language: Read from $LANGUAGE in options model * kcms/region_language: Improve isSupportedLanguage detection * kcms/region_language: Chop off the UTF-8 codepoint again * kcms/region_language: Check if the language setting is default as well * kcms/region_language: Simplify the language settings read * kcms/region_language: Read the LANGUAGE environment variable for the default language value * TriangleMouseFilter: remove unnecessary return * TriangleMouseFilter: make `resendHoverEvents` actually work * TriangleMouseFilter: fix incorrect handling of hover events and inactive state (kde#467426) * TriangularMouseFilter: Filter event everytime when there was no movement at all * Improve responsiveness of triangular filter * shell: move `forceActiveFocus` to `PanelView` * applets/mediacontroller: use PauseAnimation to delay showing busy indicator * applets/mediacontroller: remove duplicate opacity animation * applets/notifications: add workaround for QTBUG-100392 (kde#468180) * Notifications: Also try X-SnapInstanceName for desktop file resolution * libtaskmanager: fix a potential leak- Mark org.kde.userfeedback.kcm as internal QML import- Update to 5.27.6 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.27.6 - Changes since 5.27.5: * applets/kicker: fix test error in testrunnermodel * kcms/krdb: Set X root window cursor * shell: make accent color optional, and enable accent color after slot connection (kde#470280) * libtaskmanager: fix copy leftover in document * runners/calculator: implement thread-safety in QalculateEngine::evaluate (kde#470219) * applets/batterymonitor: Fix wrong tooltip when plugged in but discharging (kde#470632) * applets/mediacontroller: add busy indicator for remote images * Widgetexplorer: Properly handle translations for applet categories (kde#460523) * wallpapers/image: resize svg wallpaper to requested size (kde#469294) * Klipper config: set UI state when loading the same way as when editing * holidaysevents: reload event data when config changes (kde#437654) * runners/services: Do not match categories for short queries (kde#469769) * components/calendar: reset label under Gregorian date when plugin list changes * components/calendar: use QHash::contains instead of QHash::count * applets/digital-clock: show today's sublabel in tooltip if there is one * applets/systemtray: fix highlight being on top of first column items (kde#456180) * applets/digital-clock: Fix localization for TimeZoneModel (kde#469196) * applets/digital-clock: Allow event titles to be wrapped * Export a new helper function that read Xft.dpi value * libtaskmanager: Fix appmenu caching (kde#422786)- Enabled KUserFeedback, since new KDE privacy policy now complies. See https://invent.kde.org/websites/kde-org/-/commit/71992cc8a177c959706088d02413c1a97f989749- Require cpp explicitly, xrdb doesn't do it anymore- Update to 5.27.5 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.27.5 - Too many changes to list here- Recommend filelight (boo#1210331)- Update to 5.27.4.1 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.27.4 - Changes since 5.27.3: * applets/systemtray: press and hold to open context menu for plasmoids * applets/digital-clock: reload timezone after saving in Datetime KCM (kde#467494) * components/keyboardlayout: Fix forced activation of vkbd * Create directory before installing session-local * applets/systemtray: fix menu key not working in SNI * Find PkgConfig before first call to pkg_check_modules * sddm-theme: Populate keyboard layouts menu only on first show * [dashboard] Skip task switcher * klipper: test bug 465225 * systemtraytest: take screenshot only when test fails * kcms/nightcolor: fix timing strings with narrow window widths * libtaskmanager: simplify `test_openCloseWindow`- Update to 5.27.3 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.27.3 - Changes since 5.27.2: * klipper: remove duplicate items when loading from history (kde#466236) * kcms/region_language: set LC_PAPER, not LC_PAGE (kde#467269) * Screenpool: avoid uniqueConnection with lambda * kcms/fonts: Enable change notifications for base fonts settings (forceFontDPI) * sddm-theme: Transfer the focus to the text field as we show the OSK (kde#466969) * appstreamtest: fix test failure * wallpapers/image: improve efficiency of ImageFinder * klipper: Make action menu Frameless (kde#466406) * dataengines/mpris2: tolerate non-standards compliant players like mpris-proxy (kde#466288) * klipper: History test passes now * klipper: Insert items before remove (kde#466041) * sddm: Focus something useful when switching between alternative login screens- Update to 5.27.2 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.27.2 - Changes since 5.27.1: * applets/systemtray: add test for xembed tray icon * libtaskmanager: consider current activity when computing first task index * libtaskmanager: test invalid preferred launchers are filtered out * libtaskmanager: use icon name directly when icon value does not contain period * kcms/users: Fallback to show username in title when real name isn't set * kcms/users: Limit connection scope to `this` * Add an action to remove the containments of a screen * libtaskmanager: filter out invalid preferred launcher tasks (kde#436667) * shell: Have the DesktopView::title include which output it should be on * kcms/color: Add highlight outline for color dots (kde#465800) * Lock screen: Prevent Escape key from displaying UI if it's currently hidden (kde#465920)- Update to 5.27.1 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.27.1 - Changes since 5.27.0: * sddm-wayland-session: Disable global shortcuts * kcms/users: Port Connections to modern syntax * Better screen removal handling (kde#465892) * applets/digital-clock: fix logic error in tooltip (kde#465873) * Fix search for DWD weather data engine * applets/mediacontroller: add test for interacting with MPRIS2 interface * kcms/region_language: Down highlight delegate on press * If the desktopview is not deleted, don'r emit screenRemoved (kde#465536) * set LANG if we have language to glibc locale mapping (kde#464983) * plasmacalendarintegration: Omit astronomical events from Holidays data (kde#465539) * shell: read thickness from default group * use KDE_INSTALL_LIBEXECDIR- Tarball got respun. Changes: * klipper: store QImage and construct QPixmap only when necessary (kde#465225, kde#465326, kde#464828, kde#465603) * shell: Ensure containments that belong to the current activity are not deleted prior to loading- Update to 5.27.0 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.27.0 - Too many changes to list here- Update to 5.26.90 * New feature release * For more details please see: * https://kde.org/announcements/plasma/5/5.26.90 - Too many changes to list here- Update to 5.26.5 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.26.5 - Changes since 5.26.4: * Fix time input bug caused by "or" in regex (kde#415028) * wallpapers/image: fix finding the real symlink target (kde#461940) * applets/systemtray: Fix copy-paste mistake (double assignment to width) * Fix building screenpooltest * Panel: Add floating margins to avoid overflowing content when floating (kde#462130) * find in system's path and sudo's path (kde#462127) * kcms/region_language: set fix scrolling in language sheet (kde#462057) * Revert "shell: Use the basic scene graph rendering loop on wayland" * Revert "shell: Don't force basic render loop for Plasma Mobile"- Update to 5.26.4.1 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.26.4 - Changes since 5.26.3: * Do not query all available image plugins when determining background type (kde#462308) * Install translated documentation from po/ too * Panel: Revert making the mask smaller by 1px (kde#460896) * Remove negative inset of plasmoid heading in notifications since there's no margin in those (kde#452347) * lockscreen: Consider info messages to be prompts (kde#454706) * Fix wrong example values, return correct paper size value * wallpapers/image: save last wallpaper in slideshow mode (kde#461490) * SystemDialog: Fix display when there is no component * applets/notifications: unload ListView when plasmoid is not expanded * applets/mediacontroller: avoid flashing application icon (kde#461496) * SystemDialog: Make sure the window has a Qt.Window type * Notifications: Explicitly uncheck paused button when switching to running state * shell: revert unrelated changes in d79a927a4c7a8b489b985a6ae94bd9d8f082db93 * [shell] Always call load after init (kde#439159) * applets/notifications: remove one unused import * applets/notifications: remove workaround for QTBUG-67007 * startkde/plasma-session: fix playing startup sound- Update the build constraints- Update to 5.26.3 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.26.3 - Changes since 5.26.2: * Notifications: Use String "0" for null percent * Revert apples/kicker: fix timer in triangular mouse filter (kde#461395) * runners/services: Do not parse exec of flatpaks (kde#461241) * kcms/regionandlanguage: convert ASCII unicode symbol to QChar (kde#460704) * startplasma-wayland: Don't set GDK_SCALE and GDK_DPI_SCALE (kde#443215) * runners/services: Do not match exec values of PWAs (kde#460796) * runners/servicerunner: increase match type when query exactly matches service name (kde#459516) * runners/recentdocuments: more fine-grained relevance and type assignment * runners/baloo: increase match type when query exactly matches file name * runners/locations: decrease match type when not a known existing file * wallpapers/image: always try to remove a path in `ImageBackend::removeSlidePath` (kde#461003)- Update to 5.26.2 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.26.2 - Changes since 5.26.1: * Revert "applets/notifications: allow screen reader to read notification body in FullRepresentation" (kde#460895) * runners/kill: Fix config group name mismatch (kde#460899) * [kcms/kcm_regionandlanguage] fix config not saved after clicking 'defaults' and 'save' (kde#460842) * disable automatic portal launching early on (kde#458865) * wallpapers/image: disable animated wallpaper on X11 * wallpapers/image: fall back to default wallpaper when url is empty (kde#460692) * systemtray: Avoid dbus calls after exit (kde#460814) * Save layout immediately after a resolution change triggered relayout * Remove unnecessary heuristic relayout function call * Use KeySequenceItem.captureFinished to notify a binding has been entered (kde#459322)- Update to 5.26.1 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.26.1 - Changes since 5.26.0: * fix is default locale check (kde#460418) * remove excess pages before pushing new pages * [applets/diskanddevices] Add xdg-activation support to device ations (kde#460268) * krdb: do not crash on file system problems * Make the panel's corner mask 1px smaller to avoid artifacts at the corners (kde#417511) * Handle multiple desktop files with different StartupWMClass (kde#358277) * Add scaling and rotation support to a blur behind desktop plasmoids * wallpapers/image: fix potential dead loop in PackageFinder * wallpapers/image: fix potential dead loop in ImageFinder * wallpapers/image: fix symlink not being found by ImageFinder (kde#460287) * Revert "wallpapers/image: Fix when used outside plasmashell" * wallpapers/image: Fix when used outside plasmashell * If an app is playing media but hasn't provided a title, say as much instead of "No media playing" (kde#456516) * wallpapers/image: reset `scale` to 1 to work around QTBUG-107458 * wallpapers/image: reduce the maximum allowed cost of QCache * wallpapers/image: fix side-by-side previews sometimes not showing * wallpapers/image: reduce preview cache insertion for single images- Use appmenu-gtk-module instead of unity-gtk-module on Leap 15.2+ (boo#1108846)- Update to 5.26.0 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.26.0 - Too many changes to list here- Update to 5.25.90 * New feature release * For more details please see: * https://kde.org/announcements/plasma/5/5.25.90 - Too many changes to list here - Drop patches, now upstream: * 0001-widgetexplorer-Don-t-recurse-into-applet-s-containme.patch - Refresh patches: * 0001-Ignore-default-sddm-face-icons.patch * 0001-Revert-No-icons-on-the-desktop-by-default.patch * 0001-Use-qdbus-qt5.patch- Add patch to fix widget explorer crash (kde#458829): * 0001-widgetexplorer-Don-t-recurse-into-applet-s-containme.patch- Update to 5.25.5 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.25.5 - Changes since 5.25.4: * kcms/users: don't let "Choose File…" text overflow (kde#458614) * [kcms/style] Fix setting to default and apply button enablement * kcms/users : Fix focus for new user input (kde#458377) * kcms/nightcolor: fix checks for manual timing errors * [kcms/style] Consider GTK theme setting when computing default state (kde#458292) * applets/kicker: fix app icon loading logic to better handle relative paths (kde#457965) * kcminit: Allow running modules by their name * Take the pluginId from the kpackage metadata (kde#457657) * applets/notifications: Fix displaying header progress indicator on different DPI (kde#435004) * [panelview] Avoid assert if max < min (kde#454064) * ScreenPool: Ensure that primaryScreenChanged is emitted always after screenAdded * [libtaskmanager] Fix null check for window (kde#456094,kde#457690) * lookandfeelmanager: Write colors before color scheme (kde#421745) * Fix appstream runner results appearing before apps/kcms (kde#457600) * [dataengines/weather/dwd] Check if jobs failed * [dataengines/weather/dwd] Properly detect empty reply (kde#457606) * applets/clipboard: press Ctrl+S to save in the edit page * applets/appmenu: do not update menu when panel gets focus (kde#455520) * Fix systemmonitor preferences being reset (kde#454004) * KRunner: Set location before showing (kde#447096)- Update to 5.25.4 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.25.4 - Changes since 5.25.3: * wallpaper/slideshow: shouldn't display "current" item in image list (kde#457327) * Disable toplevel fixed positions on Wayland * runners/helprunner: Fix launching of plasmasearch kcm with args * [kicker/kickoff] Fix urls for search results (kde#456984) * applets/icon: fix invalid `Accessible.description` * applets/devicenotifier: improve accessible properties * applets/batterymonitor: add accessible properties to slider * [FIX] Unable to remove manually added wallpaper (kde#457019) * kcms/colors: make sure the preview uses the right colours (kde#456648) * Don't break configuration when saving layouts * [Notifications] When there is no thumbnail available, use file icon as drag pixmap * [Notifications] Ignore stopped job in job aggregator * [applet/{analog,digital}-clock] Use `onPressed: wasExpanded = ...` idiom * Fix non-functional lockscreen due to bad cherry-pick (kde#456639) - Drop patches, now upstream: * 0001-Fix-non-functional-lockscreen-due-to-bad-cherry-pick.patch- Add patch to fix the lock screen (kde#456639): * 0001-Fix-non-functional-lockscreen-due-to-bad-cherry-pick.patch- Update to 5.25.3 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.25.3 - Changes since 5.25.2: * Guard against cursor theme changing in animation timer (kde#456526) * Fix "PanelSpacer::containmentGraphicObject()" plasmashell segfault (kde#450663) * Fix StatusNotifierItem MidClick (kde#456466) * kcms/lookandfeel: Set all defaults when saving the default package (kde#456275) * kcms/colors: Properly apply tinting to the window titlebar (kde#455395,kde#454047) * [kcms/icons] Pass parent window to ksycoca progress dialog * applets/kicker: Get rid of a separator just above title menu item (kde#449132) * Fix password field in lock screen not clearing after failed login attempt (kde#455227)- Update to 5.25.2 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.25.2 - Changes since 5.25.1: * shell: avoid crash after waking up from sleep (kde#455328) * Revert "Prevent panel going out of screen boundaries" * shell: refresh geometries of all `DesktopView` and `PanelView` when receiving `logicalDotsPerInchChanged` (kde#450443,kde#438114) * Avoid crash in plasma-session teardown (kde#454159) * kcms/colors: Fix window titlebar tinting in colorsapplicator (kde#455395) * kcms/feedback: Properly fit the items inside the layout (kde#455713) * Fix session restore + kwin interaction race (kde#442380) - Drop patches, now upstream: * 0001-shell-refresh-geometries-of-all-DesktopView-and-Pane.patch- Also use xprop-kde-full-session.desktop with systemd startup- Update to 5.25.1 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.25.1 - Changes since 5.25.0: * Fix checkbox not switching when choosing an accent color using color picker * kcms/fonts: Fix font hinting preview (kde#413673) * colorsapplicator: make accent-coloured titlebars more robust/foolproof * Klipper (classic widget): Fix a system tray menu memory leak * shell/scripting: call `flushPendingConstraintsEvents` in `setLocation` * Fix missing index validity check for cursortheme (kde#454829) * [KSystemActivityDialog] Fix loading default settings (kde#454566) * kcms/colors: Fix alternateBackgroundColor for Button not having accents * kcms/colors: Ensure that accent color dots always fit on narrow screens- Add patch to fix a multiscreen bug when PLASMA_USE_QT_SCALING=1 (kde#450443, https://invent.kde.org/plasma/plasma-workspace/-/merge_requests/1781) * 0001-shell-refresh-geometries-of-all-DesktopView-and-Pane.patch- Update to 5.25.0 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.25.0 - Too many changes to list here - Drop patches, now upstream: * 0001-startkde-Reload-systemd-on-Plasma-start.patch- Add patch to fix opensuse-welcome autostart disabling: * 0001-startkde-Reload-systemd-on-Plasma-start.patch- Update to 5.24.90 * New feature release * For more details please see: * https://kde.org/announcements/plasma/5/5.24.90 - Too many changes to list here - Drop patches, now upstream: * 0001-applets-appmenu-fix-top-level-menu-text-coloration.patch * 0001-kcms-desktoptheme-find-metadata.json-when-loading-Th.patch- Add patch to fix appmenu text with certain themes (kde#453348): * 0001-applets-appmenu-fix-top-level-menu-text-coloration.patch - Add patch to also show themes with a newer metadata format (kde#453830): * 0001-kcms-desktoptheme-find-metadata.json-when-loading-Th.patch- Update to 5.24.5 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.24.5 - Changes since 5.24.4: * [lookandfeel] Fix collapsed width of a volume/brightness OSD on a lock screen (kde#446185) * xdgactivation: Make sure we don't call setStartupId with an x11 token * Convert old-style Favorites resources in KActivities DB (kde#385814) * runners/baloo: Add missing category "text" to file search results * applets/digital-clock: Fix date drift (kde#452554) * systemtray: Fix race in DBusServiceObserver (kde#422111) * systemdialog: also consider buttonbox for dimensions * Fix not working applet with same compact/full representation when hiding * shell/scripting: Consider current activity in `desktopForScreen` (kde#452561) * Set a sane minimum size * SystemDialog: re-add removed public properties * kcm/colors: don't dull accent colour on dark themes in colorsapplicator (kde#442820) * wallpapers/image: Use onActivated instead of onCurrentIndexChanged * appmenu: Use existing menu in compact represenation (kde#438467) * Change the text color when appmenu is selected or hovered * Don't use forceActiveFocus to set search field focus * applets/clipboard: Don't forward input to filter if it's disabled * Avoid memory leaks by misusing HistoryItem::mimeData() * A better fix for BUG 431673 * Revert "Trim very long text strings in Klipper history view" * Revert "[klipper] Use full text for DBus return values" * Revert "Fix Klipper Actions content truncation" * Revert "klipper: Add FullTextRole to get untruncated text" * Revert "klipper: Add `testTrimmedText`" * Revert "applets/clipboard: Use FullTextRole in EditPage" * Revert "applets/clipboard: Use FullTextRole in SortFilterModel" * Revert "applets/clipboard: Generate QR code from full text"- Update to 5.24.4 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.24.4 - Changes since 5.24.3: * kcms/users: Adjust for padding in overlay sheet (kde#451031) * [Media Controller] Explicitly set slider "to" before setting "value" * [Notifications] Fix implicit size propagation in SelectableLabel * applets/kicker: Skip creating KService for non-desktop files or folders (kde#442970) * Fix sleep/suspend sometimes not working ... from ksmserver-logout-greeter, by making the DBus calls synchronous. * kicker/actionlist: Ensure we parse the args for the jumplist actions (kde#451418) * libtaskmanager: recompute active task when a task is removed * sddm/lockscreen: Fix weird behaviour * [Notifications] Limit notification heading line count- Update to 5.24.3 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.24.3 - Changes since 5.24.2: * kcms/colors: Implement radio button layouts better * kcms/colors: fix spacing between radio buttons and content * [Battery Monitor] Only show charge threshold hint for power supply batteries (kde#451161) * [Icons KCM] Give measure delegate a text * wallpapers: Sort BackgroundListModel by title * applets/digital-clock: Fix `Qt.formatDateTime` returns different date when minute changes (kde#436796) * applets/systray: align applet labels with differing line counts in hidden view (kde#438347) * Show panel config above other windows (kde#450794) * Use current accent colour to set ColorDialog object in colour picker * SystemDialog: Allow accepting the dialogs with the keyboard (kde#450223) * applets/systemtray: Do not open context menu on mouse pressed for SNI (kde#409768) * Revert "Fix overdraw on Wayland" * startkde: Forward stdout/stderr of started processes * SDDM theme: stop eliding people's names so aggressively (kde#450673) * applets/digital-clock: Word-wrap date string for desktop representation (kde#450632) * wrap completely the invariants timer in NDEBUG * ScreenPool as the source of truth of QScreen info * Always ensure there is an user selected (kde#450182) * Prevent panel going out of screen boundaries * applets/clipboard: Focus on text area when transition is done * applets/clipboard: Fix highlight after exiting edit mode - Drop patches, now upstream: * 0001-startkde-Forward-stdout-stderr-of-started-processes.patch - Restore compatibility with older kf5-filesystem- Replace %_libdir/libexec with %_libexecdir (boo#1174075)- Add patch to fix log output of some processes (boo#1196206): * 0001-startkde-Forward-stdout-stderr-of-started-processes.patch- Update to 5.24.2 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.24.2 - Changes since 5.24.1: * applets/clipboard: Focus on the search field for the first time opening the applet * applets/clipboard: Make Up/Down arrow keys work in ClipboardPage (kde#448811,kde#450040) * applets/panelspacer: Fix optimal size calculation (kde#431668) * Fix overdraw on Wayland * PanelView: Do not crash when the state is transitioning (kde#373461) * Fix launch kscreen kcm in font kcm. * Don't install two copies of kcm_fontinst * Lock/login themes: stop adjusting shadows based on color scheme (kde#449985) * Top-align lock/login/logout screen action buttons (kde#450238) * [kcms/user] Set interactive auth flag for more calls (kde#450122)- Update to 5.24.1 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.24.1 - Changes since 5.24.0: * Move to runtime check of valid font DPI (kde#449918) * applets/battery: adjust show/hide conditions for charge limits (kde#435931) * applets/systemtray: fix SNI context menu usage without libappindicator (kde#449870) * applets/notifications: Increase implicit size of standalone popup (kde#448383) * applets-digital/clock: Add workaround for QTBUG-83890 (kde#448387) * Clean up "empty" mimeType containg only whitespaces * dataengines/apps: Use KIO::ApplicationLauncherJob for starting KService * [containmentactions/applauncher] Use ApplicationLauncherJob instead of OpenUrlJob (kde#449900) * Desktop: Still show services with nodisplay=true set (kde#449243) * appstream runner: De-duplicate results from multiple sources (kde#448619) * Fix ksplash always using default theme. (kde#446966) * kcms/users: Fix missing template arguments before reply in FingerprintModel * De-duplicate 'Uninstall or manage addons' option in the context menu of Kickoff (kde#448564)- Update to 5.24.0 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.24.0 - Too many changes to list here - Drop patches, now upstream: * 0001-sddm-theme-Change-wallpaper-extension-so-that-it-poi.patch * 0001-systemdialogs-Remove-leftover-and-broken-components.patch * 0001-Make-SessionManagementScreen-a-FocusScope.patch * 0001-Fix-initial-focus-in-LockScreenUi.patch- Add patch to fix initial focus in SDDM (kde#447817): * 0001-Make-SessionManagementScreen-a-FocusScope.patch - Add patch to fix initial focus in the lockscreen: * 0001-Fix-initial-focus-in-LockScreenUi.patch- Update to 5.23.90 * New feature release * For more details please see: * https://kde.org/announcements/plasma/5/5.23.90 - Too many changes to list here - Rebase 0001-Use-qdbus-qt5.patch - Replace xprop-kde-full-session.desktop with autostart file: * 0001-Revert-Drop-setupX11-from-startplasma-waylandsession.patch * 0002-Revert-Drop-X11-root-properties-for-KDE-full-session.patch - Add patch to fix the upstream sddm theme background: * 0001-sddm-theme-Change-wallpaper-extension-so-that-it-poi.patch - Add patch to fix screen sharing dialog (kde#448423): * 0001-systemdialogs-Remove-leftover-and-broken-components.patch- Update to 5.23.5 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.23.5 - Changes since 5.23.4: * applets/systemtray: Follow panel opacity (kde#439025) * [webshortcutsrunner] Fix private browsing with some Firefoxes * [kcms/style] Don't call setNeedsSave when style config changes (kde#439297) * digital-clock: fix calendar popup contrast when opened from desktop (kde#446991) * [libnotificationmanager] Fix memory leak * [kcms/lookandfeel] Guard reading invalid first entry (kde#446100) * [Global Menu] Set translation domain * lookandfeel: Add missing check if list of files is empty (kde#439797) * [KSplash] Start with zero opacity * Fix Klipper Actions content truncation (kde#444365) * [klipper] Use full text for DBus return values (kde#446441)- Update to 5.23.4 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.23.4 - Changes since 5.23.3: * Lock & login screens: Use RTL-friendly arrows when in RTL mode * [logout-greeter] Set window class name (kde#444898,kde#444899) * systemtray: Connect to StatusNotifierWatcher before initializing QDBusPendingReply * systemtray: Check if a service is already added before processing QDBusReply (kde#443961) * baloosearchruner: Emit DBus error when baloo is disabled (kde#445342)- Update to 5.23.3 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.23.3 - Changes since 5.23.2: * fixed size hints to the osd * use implicit size to not cause binding loops (kde#422072) * wayland: don't create DesktopView for placeholder screen (kde#438839,kde#444801) * [startplasma] Detect systemd service in linked state * [Notifications] Fix grouping container side line * Disconnect watcher for xdgActivationTokenArrived (kde#444385) * interactiveconsole: Allow specifying mode from command line parameter- Update to 5.23.2 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.23.2 - Changes since 5.23.1: * Hide KRunner window when pressing escape (kde#444240) * [applets/clipboard] Fix selecting clipboard entries with Enter * Set Qt.ImhNoPredictiveText for text fields that act as search fields * [shell] Ignore placeholder screens - Add a version to BuildRequires: cmake(Breeze)- Add back X11 root window properties until firefox is adjusted (boo#1191825): * 0001-Revert-Drop-setupX11-from-startplasma-waylandsession.patch * 0002-Revert-Drop-X11-root-properties-for-KDE-full-session.patch- Update to 5.23.1 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.23.1 - Changes since 5.23.0: * [freespacenotifier] impr: no notification for ro filesystems * kcms/colors: Don't apply header accent colors to non-Header color schemes (kde#443786) * [kcms/colors] Notify global settings change after saving * krdb: Fix removal of Xft.dpi from Xresources (kde#350039) * sddm-theme: fix missing password field on "Other" page (kde#443737) * pipewire: Report DRM_FORMAT_MOD_INVALID when no modifiers are offered * [digital-clock] Do not assign undefined when agenda is not visible (kde#443380) - Drop patches, now upstream: * 0001-sddm-theme-fix-missing-password-field-on-Other-page.patch- Add patch to show password input on the "Other" page in SDDM (kde#443737): * 0001-sddm-theme-fix-missing-password-field-on-Other-page.patch- Update to 5.23.0 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.23.0 - Changes since 5.22.90: * Revert "xembed: adapt to changes in KNotifications" (kde#442758) * sddm-theme: Fix using mouse movements to show the UI * [systemtray] Check for menuItemFactory.object existence (kde#443377) * applets/devicenotifier: Remove applet list item animations * sddm-theme: Fix use of needsPassword and related button layout * [klipper] Fix shortcut of OK button in the clipboard content edit dialog (kde#400623) * Fix Kickoff context menu actions for System Settings results (kde#442522) * klipper: Fix reading from plasma on wayland * Fix build with gpsd 3.23.1 * Unbreak fontinst KCM (kde#442748) * Address regression in VT switching code (kde#442852) * libtaskmanager: Don't request dmabuf if not supported (kde#428284) * Port away from Kirigami.Units.devicePixelRatio * lookandfeel: don't nuke accent colour (kde#442812) * kcm/colors: Improve some bindings on accent colors * sddm-theme: fix default username font size * PipeWire: Include defines for older PipeWire versions * pipewire: Properly compare pipewire versions using QVersionNumber * [Klipper] Guard against broken data fetches * [Klipper] Handle incoming UTF-8 mime types (kde#424694) * PipeWire: Make sure thumbnails properly use dmabuf again * [shell/panel] Fix ability to type in textfield (kde#442557) - Drop patches, now upstream: * 0001-Fix-build-with-gpsd-3.23.1.patch * 0001-SVN_SILENT-made-messages-.desktop-file-always-resolv.patch * 0002-libtaskmanager-Don-t-request-dmabuf-if-not-supported.patch * 0002-shell-panel-Fix-ability-to-type-in-textfield.patch * 0003-SVN_SILENT-made-messages-.desktop-file-always-resolv.patch * 0004-PipeWire-Make-sure-thumbnails-properly-use-dmabuf-ag.patch * 0005-SVN_SILENT-made-messages-.desktop-file-always-resolv.patch * 0006-Klipper-Handle-incoming-UTF-8-mime-types.patch * 0007-Klipper-Guard-against-broken-data-fetches.patch * 0008-pipewire-Properly-compare-pipewire-versions-using-QV.patch * 0009-PipeWire-Include-defines-for-older-PipeWire-versions.patch * 0010-sddm-theme-fix-default-username-font-size.patch * 0011-Revert-xembed-adapt-to-changes-in-KNotifications.patch - Refresh 0001-Ignore-default-sddm-face-icons.patch - Add new key + signature to plasma.keyring- Add patch to fix build with gpsd: * 0001-Fix-build-with-gpsd-3.23.1.patch - Add patch to fix window thumbnails if dmabuf is not supported (kde#428284): * 0002-libtaskmanager-Don-t-request-dmabuf-if-not-supported.patch- Add patches from Plasma/5.23 branch: * 0001-SVN_SILENT-made-messages-.desktop-file-always-resolv.patch * 0002-shell-panel-Fix-ability-to-type-in-textfield.patch * 0003-SVN_SILENT-made-messages-.desktop-file-always-resolv.patch * 0004-PipeWire-Make-sure-thumbnails-properly-use-dmabuf-ag.patch * 0005-SVN_SILENT-made-messages-.desktop-file-always-resolv.patch * 0006-Klipper-Handle-incoming-UTF-8-mime-types.patch * 0007-Klipper-Guard-against-broken-data-fetches.patch * 0008-pipewire-Properly-compare-pipewire-versions-using-QV.patch * 0009-PipeWire-Include-defines-for-older-PipeWire-versions.patch * 0010-sddm-theme-fix-default-username-font-size.patch - Add patch to fix XEmbed context menus (kde#442758) * 0011-Revert-xembed-adapt-to-changes-in-KNotifications.patch- Update to 5.22.90 * New feature release * For more details please see: * https://kde.org/announcements/plasma/5/5.22.90 - Too many changes to list here - Refresh patches: * 0001-Revert-No-icons-on-the-desktop-by-default.patch * 0001-Use-qdbus-qt5.patch - Drop patches, now upstream: * Call-UnInhibit-with-correct-signature-in-powermanagement-dataengine.patch- Add upstream patch to fix a bug that would result in power management remaining inhibited even after un-inhibiting it in the UI: * Call-UnInhibit-with-correct-signature-in-powermanagement-dataengine.patch- Drop the unneeded baselibs.conf.- Update to 5.22.5 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.22.5 - Changes since 5.22.4: * [kcms/icons] Fix i18n usage * [kcms/icons] Clip ListView in popup * [applets/digitalclock] Let long timezones list scroll (kde#439147) * [applets/digital-clock] Fix header in RTL mode (kde#438083)- Update to 5.22.4 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.22.4 - Changes since 5.22.3: * systemtray: Let plasmashell handle visibility when configuring (kde#440263) * [applets/clipboard] Fix the alignment of delegate buttons (kde#437044) * Allow plasmashell to use both screenshot and screenshot2 * [Notifications] Set Plasma linkColor on notification label (kde#438366) * Add kde-baloo.service to Wants= * Prevent fractional positioning in systray HiddenItemsView * Set GDK scale explictily on wayland (kde#438971)- Update to 5.22.3 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.22.3 - Changes since 5.22.2.1: * [Media Player] Skip source if it doesn't exist (kde#439309) * Guard calls into layer shell (kde#439356) * xembed-sni-proxy: Add Menu property (kde#439229) * Assing first screen if `screen` is null (kde#438277)- No longer force GDK_BACKEND, kde-gtk-config deals with it meanwhile: * 0001-Set-GTK_BACKEND-x11-in-a-wayland-session.patch - Drop "Full Wayland" session, default in libqt5-qtbase changed- Update to 5.22.2.1 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.22.2 - Changes since 5.22.1: * Fix copy-paste error * [Notifications] Strip trailing slash for fallback URL path * [Notifications] Restore "details" reference * [Notifications] Avoid showing "0 seconds remaining" * Init ShellCorona after KDBusService (kde#408310)- Update to 5.22.1 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.22.1 - Changes since 5.22.0: * [applets/devicenotifier] Don't show empty header most of the time (kde#438351) * [kcms/autostart] Avoid empty application icon * [libtaskmanager/x11] Fix transient windows bug (kde#438222) * krunerglobalshortcuts: Fix migration from old component * Recent Documents: Fix missing actions for results (kde#437462) * [kcms/autostart] Keep capitalization of desktop file names (kde#438406) * Point bbcukmet to new location API BUG: 430643 (kde#430643) * krunnerglobalshortcuts: Prevent actions from becoming inactive * Fix kcmfontinst install destination (kde#436306) - Drop patches, now upstream: * 0001-krunnerglobalshortcuts-Prevent-actions-from-becoming.patch * 0001-krunerglobalshortcuts-Fix-migration-from-old-compone.patch * 0001-Fix-kcmfontinst-install-destination.patch- Add another patch to fix migration of krunner shortcuts from Plasma < 5.17 (boo#1187204): * 0001-krunerglobalshortcuts-Fix-migration-from-old-compone.patch- Add patch to fix migration of krunner shortcuts (kde#437364): * 0001-krunnerglobalshortcuts-Prevent-actions-from-becoming.patch- Add back patch which was mistakenly not part of the tarball: * 0001-Fix-kcmfontinst-install-destination.patch- Update to new 5.22.0 tarball: * [System Tray] Fix typo breaking sorting notification applet first (kde#438146)- Update to 5.22.0 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.22.0 - Too many changes to list here - Drop patches, now upstream: * 0001-Fix-kcmfontinst-install-destination.patch- Add patch to fix the font management KCM (kde#436306): * 0001-Fix-kcmfontinst-install-destination.patch- Update to 5.21.90 * New feature release * For more details please see: * https://kde.org/announcements/plasma/5/5.21.90 - Too many changes to list here - Drop patches, now upstream: * 0001-startkde-Reset-systemd-failed-units-on-login.patch- Add patch to unbreak some services after login (kde#429415): * 0001-startkde-Reset-systemd-failed-units-on-login.patch- Update to 5.21.5 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.21.5 - Changes since 5.21.4: * [applets/digital-clock] Fix "both pointSize and pixelSize defined" warning * [applets/digitalclock] Fix timezone filter * Add a -1 to make the mouse input not redirect to a margin pixel. (kde#413736) * Fix crash on drag-and-drop over panel (kde#398440) * [Notifications] Don't generate previews of zero size * krunner: Always set cursor position to end when focusing search field (kde#435604) * Don't extract QML as Java- Update to 5.21.4 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.21.4 - Changes since 5.21.3: * Make sure that *m_twinSpacer is iniitialized in panelspacer (kde#422914) * Comment was interpreted as part of Restart * [applets/digital-clock] Fix timezone placeholder message positioning * icons kcm: Clear pending deletions when Defaults button is clicked * Remove pointless widget (kde#434910) * krunner: Restore history related property and methods for compatibility with third party themes (kde#433173) * Make bottom frame again visible (kde#434645) * Fix color scheme preview (kde#434493) * save layout when corona startup is completed (kde#433799) * Klipper Waylandclipboard: force offer of specific mimetype to fix pasting to gtk applications- Update to 5.21.3 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.21.3 - Changes since 5.21.2: * [Image wallpaper] Make the Positioning combobox as equally wide as the other comboboxes * [Notifications] Emit dataChanged in setData call * [applets/devicenotifier] Manually bind width of list item * Re-add Force Font DPI spinbox on Wayland (kde#433115) * proper form factor filtering (kde#433983) * Pass Qt::MatchExactly when calling QAbstractItemModel::match for strings * Adapt more KCMs to using Kirigami.ActionToolbar for their footer actions * Fix query of StartPlasma::hasSystemdService (kde#433333) * [lookandfeel/ActionButton] Fix broken focus effect (kde#433755) * Use separate face controller for appearance config (kde#424458)- Update to 5.21.2 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.21.2 - Changes since 5.21.1: * KRunner: Handle escape key in history view more gracefully (kde#433723) * [Notifications] Don't change tooltip when paused * locations runner: Fix empty list on invalid shell quotes * [applets/devicenotifier] Add placeholder icon when no device icon exists (kde#433534) * [kcms/icons] Collapse buttons if the row is too wide for the display * Do not start faulty coronas - Drop patches, now actually upstream: * 0001-locations-runner-Fix-empty-list-on-invalid-shell-quo.patch- Add back patch for fix which didn't make it into 5.21.1: * 0001-locations-runner-Fix-empty-list-on-invalid-shell-quo.patch- Update to 5.21.1 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.21.1 - Changes since 5.21.0: * Fix case in logout applet config key (kde#433320) * calculatorrunner: Fix mixed hex+decimal calculations (kde#431362) * Fix font installation * locations runner: Fix absolute filepath + arguments (kde#433053) * Enforce SESSION_MANAGER is exported before plasmashell is started * libtaskmanager: Allow to launch executables (kde#433148) * Move ksmserver's ksplash notifying to ksmserver (kde#432364) * Handle closeSession being called concurrently * [libkworkspace] Interim fix for the logout issue (kde#432460) * fixup! [keyboard applet] fix TypeError garbage in log - Drop patches, now upstream: * 0001-locations-runner-Fix-absolute-filepath-arguments.patch * 0001-locations-runner-Fix-empty-list-on-invalid-shell-quo.patch * 0001-libkworkspace-Interim-fix-for-the-logout-issue.patch - Drop workaround, no longer needed: * 0001-ksmserver-Enable-debug-output-by-default.patch- Add patch to fix krunner crash caused by mismatched quotes: * 0001-locations-runner-Fix-empty-list-on-invalid-shell-quo.patch- Add patch to fix starting applications with arguments from krunner (kde#433053): * 0001-locations-runner-Fix-absolute-filepath-arguments.patch- Add patch to fix race on logout (kde#432460): * 0001-libkworkspace-Interim-fix-for-the-logout-issue.patch- Update to 5.21.0 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma/5/5.21.0 - Changes since 5.20.90: * fix restore size when float is used * show colors,icons and plasma style in plamo * [Notifications] Escape HTML in destUrl and fileName * [Notifications] When application responds to cancel request, stop kill timer * Fix condition for executable folders (kde#432653) * ksmserver: Filter out services with NoDisplay=true * Fix wallpaper paths in org.kde.slideshow package * Revert "Use subseq matching for service runner" (kde#431609,kde#432339) * [Notifications] Property is supposed to be "ProcessedItems" * remove phone specific wallpaper config ui * [applets/digital clock] Unbreak the time zone config dialog * Set add panel as an explicit menu of a panel action (kde#432250) * Wallpaper config: fix property imageModel that was missing in delegate (kde#431961) * Make ksmserver's lock screen detection automatic * [systemd] Move kwin to "wants" * [applets/systemmonitor] fix not hiding the title on vertical panels * [applets/digital clock] Restore scroll-to-change-displayed-timezone (kde#431977) * Don't crash if the panelview is not ready * [Notifications] Re-evaluate unread count when a notification is "read" * [keyboard applet] fix TypeError garbage in log * Fix condition for windowed widgets standalone mode (kde#432032) - Add patch to either get more info or work around logout not working sometimes (kde#432460): * 0001-ksmserver-Enable-debug-output-by-default.patch- Update to 5.20.90 * New feature release * For more details please see: * https://kde.org/announcements/plasma/5/20.90/ - Too many changes to list here - Refresh patches: * 0001-Revert-No-icons-on-the-desktop-by-default.patch * 0001-Set-GTK_BACKEND-x11-in-a-wayland-session.patch * 0001-Use-qdbus-qt5.patch- Add _constraints with min 4GB disk space to avoid build failure- Update to 5.20.5 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma-5.20.5 - Changes since 5.20.4: * Recent Documents Runner: Strip trailing slash in subtext * [applets/systemtray] Fix missing expander arrow (kde#430569) * [Notifications] Check popup being null * move keyboard positioning in the keyboard itself (kde#427934)- RPM got fixed, so use %fdupes on TW again- Add compatibility with qml-autoreqprov- Update to 5.20.4 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma-5.20.4 - Changes since 5.20.3: * Fix Environment Canada weather domain. * Fix build with newer Qt * fix: Font files, kfontview and thumbnailer crash on Wayland (kde#401031) * Readd searching for breeze decoration (kde#429298) * [Notifications] Check pause button when job is paused * The cursor previews are in a layout * Revert "Use new simpler way to disable session management in services" * [Tab switcher] Fix binding loop that spams the log (kde#410984)- Update to 5.20.3 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma-5.20.3 - Changes since 5.20.2: * Fix missing "Switch User" button on lockscreen with systemd 246 (kde#427777) * [applets/devicenotifier] Fix regression with expand (kde#428379) * Fix edge case for tilde and ENV command * [lookandfeel] Fix switching to a different user session * [libkworkspace] Fix if getCurrentSeat needs to fallback to old approach (kde#423526) * Fix SystemEntries not updating correctly (kde#427779) * [applets/icon] Handle non-Applications URLs again (kde#427797) * [System Tray] Fall back to tool tip title if no title is set- Update to 5.20.2 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma-5.20.2 - Changes since 5.20.1: * [plasma-session] Fix application lifespan (kde#422948) * Sync OSD properties (kde#425908) * [applets/systemtray] Fixes for vertical and huge panel (kde#428158,kde#428127,kde#428198) * [applets/systemtray] Make highlight wider (kde#427638) * Fix tile expansion in ShellRunner (kde#427824)- Require pipewire in plasma5-session-wayland- Drop workaround for old powerdevil - 5.20.1.1 is actually still 5.20.1, set the macro that way- Update to 5.20.1.1 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma-5.20.1 - Changes since 5.20.0: * [applets/devicenotifier] Don't offer to unmount non-removable devices (kde#427176) * [applets/systemtray] Fix icon size for 24px panels (kde#427690) * Make Prison a required dependency * [notifications] Fix margins of close button timeout indicator (kde#425911) * [Notifications] Also check transient parent for whether it's a dialog * Revert "krdb: Call xrdb with -nocpp" to fix gitk runtime errors - Drop patches, now upstream: * 0001-Revert-krdb-Call-xrdb-with-nocpp-to-fix-gitk-runtime.patch- Generate plasmafullwayland.desktop by editing plasmawayland.desktop - Make plasma5-session-wayland arch-dependent as it contains %{_libdir} - Add BuildRequires for pipewire and libdrm- Don't use %fdupes -s, kpackage doesn't like it and so this broke the slideshow wallpaper- Add patch to fix startup of some applications (mostly Tk): * 0001-Revert-krdb-Call-xrdb-with-nocpp-to-fix-gitk-runtime.patch- Update to 5.20.0 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma-5.20.0 - Too many changes to list here - Drop patches, now upstream: * 0001-applets-devicenotifier-Don-t-open-popup-for-already-.patch * 0001-Improve-handling-of-lifecycle-methods-in-retain-prio.patch- Add patch to avoid popup on login (kde#426990): * 0001-applets-devicenotifier-Don-t-open-popup-for-already-.patch- Mark powerdevil 5.19.0 as recent enough as workaround for boo#1176474- Add patch to fix krunner on wayland: * 0001-Improve-handling-of-lifecycle-methods-in-retain-prio.patch- Copy icon for org.kde.kcolorschemeeditor.desktop - Clean up .spec file and remove obsolete workarounds- Update to 5.19.90 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma-5.19.90 - Too many changes to list here - Refresh patches: * 0001-Ignore-default-sddm-face-icons.patch * 0001-Use-qdbus-qt5.patch - Drop patches, now upstream: * 0001-Port-applets-to-use-PlasmaExtras.PlaceholderMessage.patch * 0001-ksmserver-Use-UpdateLaunchEnvJob-to-sync-SESSION_MAN.patch * 0001-sddm-theme-lockscreen-Fix-login-button-size.patch- Add patch to fix login button appearance with KF 5.74: * 0001-sddm-theme-lockscreen-Fix-login-button-size.patch- apply 0001-ksmserver-Use-UpdateLaunchEnvJob-to-sync-SESSION_MAN.patch, that fixes the broken session restore- Update to 5.19.5 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma-5.19.5 - Changes since 5.19.4: * [logout screen] Set implicit widths on OK and Cancel buttons * KDisplayManager: Work without $DISPLAY set- Update to 5.19.4 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma-5.19.4 - Changes since 5.19.3: * emit countChanged when we get a new source model * [wallpaper] Avoid using pluginId for indexing package indexes (kde#423987) * Revert "Fix broken ENV variables for detailed settings" (kde#423995) * [applet/systemtray] Regression: all applets in config are shown as disabled * hide face config button if the face can't config * Only open KCM in systemsettings if it can be displayed (kde#423612)- Update to 5.19.3 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma-5.19.3 - Changes since 5.19.2: * [wallpaper] Save the package name in configuration not a URL * Theme shouldn't inherit (kde#423747) * [applet/systemtray] Load config defaults from main.xml (kde#423561) * [applets/systemtray] Fix context menu misplaced (kde#421275) * [startkde] Block plasma-session exiting until startup sound completes (kde#422948) * [mediacontroller] Use half the samples for better performance with swrast * [applets/mediaplayer] Make size of the standalone plasmoid similar to that of the system tray (kde#422736) * Fix broken ENV variables for detailed settings (kde#417070,kde#176650) * set proper formFactors to faces * better propagate size hints * Fix DBus service used in shutdown interface (kde#423391) - Drop patches, now upstream: * 0001-mediacontroller-Use-half-the-samples-for-better-perf.patch * 0001-Fix-DBus-service-used-in-shutdown-interface.patch- Add patch to speed up artwork shader compilation in VMs (boo#1172763): * 0001-mediacontroller-Use-half-the-samples-for-better-perf.patch- Add patch to fix power actions (kde#423391): * 0001-Fix-DBus-service-used-in-shutdown-interface.patch- Update to 5.19.2 * New bugfix release * For more details please see: * https://kde.org/announcements/plasma-5.19.2 - Changes since 5.19.1: * [Notifications] Support description where only a value is set (kde#423218) * Fix case of monitored service in startplasma's shutdown (kde#422870) * Fix faint outline for notification timeout indicator with newer charts (kde#423079) * [applets/appmenu] Listen to more signals to ensure that appmenu applet can reliably catch the active window changing (kde#422786,kde#422260) * Fix KRunner positioning on X11 with High DPI and Qt scaling on Plasma (kde#422578) * [lock screen] Stop timer when interacting with media controls (kde#422707)- Add patch to fix label appearance (kde#422684): * 0001-Port-applets-to-use-PlasmaExtras.PlaceholderMessage.patch- Update to 5.19.1 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.19.1.php - Changes since 5.19.0: * Fix race in loading DBus activatable applets * [applets/systemtray] Fix SNI "Always shown" restore (kde#422837) * center align battery icon in compact representation (kde#421038) * Fix actions for application search results * Fix desktop actions for recently used applications * Fix absolute icon paths * Make hidden plasmoids vertically centered in the System Tray popup applet (kde#422685) * Make KRunner KCM open in System Settings (kde#421427) * Guard QQmldebuggingEnabled by an env var (kde#422228) * fix confirmLogout setting for SessionManagement- Update to 5.19.0 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.19.0.php - Changes since 5.18.90: * appstreamrunner: do case insensitive comparisons * Fix many results when query starts with = * [notifications] don't widen the notifications on the mobile * Kicker fix KRunner prepare/teardown method calls * Bookmarks Runner: Fix extraction of firefox profile (kde#418526) * [applets/systemtray] Fix configuraiton read on Plasma start * [applets/systemtray] Consistent name/icon in System Tray settings (kde#421561) * [applets/systemtray] Lazy initialize SystemTray model (kde#420993) * [applets/mediacontroller] Icon for Playing/Paused * [applets/mediacontroller] Don't use Album Art for icon (kde#420197) * Remove useless double line * Make system tray impossible to resize again * Revert "[applets/batterymonitor] Collapse inhibitions list properly" * [Battery Monitor] Fix ScrollView anchoring * [Notifications] Restore item spacing * [Notifications] Don't take updated time into account for sorting * [Kicker] Fix jump list actions in RunnerMatchesModel- Update to 5.18.90 * New feature release * For more details please see: * https://www.kde.org/announcements/plasma-5.18.90.php - Too many changes to list here - Drop patches, now upstream: * 0001-Stop-multiplying-duration-values.patch- Add patch to fix animations with Frameworks 5.70: * 0001-Stop-multiplying-duration-values.patch- Update to 5.18.5 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.18.5.php - Changes since 5.18.4.1: * [Notifications] Don't show do not disturb end date beyond 100 days * [systemtray] Fix SNI icon not rendering (kde#419305) * [KRunner] Watch config with KConfigWatcher * [Notifications] Have checkIndex check if the index is valid * [Notifications] Fix typo * Fix warning about connecting to a null sender, favoritesModel can be null * Fix variable assignment * [Notifications] Don't reverse() Array * use the decoded url for launcherPosition (kde#418483)- Update to 5.18.4.1: * Version fixed- Update to 5.18.4 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.18.4.php - Changes since 5.18.3: * [runners/recentdocuments] disable executables or .desktop files (kde#419310) * [applets/digital-clock] Fix inappropriately high QtQuick version * [applets/systemtray] Clear item from shown/hidden list when disabling entry (kde#419197) * [applets/digital-clock] Fix date sizing in vertical panel (kde#417852) * [VirtualDesktopInfo] Connect to rowsChanged singal (kde#408783) * Fix systemtray configuration- Update to 5.18.3 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.18.3.php - Changes since 5.18.2: * [gmenu-dbusmenu-proxy] Fix radio button state detection * [gmenu-dbusmenu-proxy] Pass action "target" in invocation * Degrade qCInfo to qCDebug * Demote jump list actions to PossibleMatches * ItemContainer: disconnect signals in destructor (kde#417603)- Update to 5.18.2 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.18.2.php - Changes since 5.18.1: * Use appropriate icon for unconfigured applets' "Configure..." buttons * [applets/systemtray] Clip ListView in config * [kcms/feedback] Increase default window height a bit more (kde#417747) * fix activity runner - Build the KUserFeedback KCM- Update to 5.18.1 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.18.1.php - Changes since 5.18.0: * [kcms/feedback] Improve default kcmshell window size (kde#417747) * Extract messages from header files as well (Thanks to Victor Ryzhykh) * Remove downloadNewWhat usage * Don't delay ksplash until the entire slideshow is loaded * [Notifications] Only let details label grow, never shrink (kde#417489) * [libtaskmanager] Fix shared VirtualDesktopInfo::Private tied to the 1st creator (kde#415200) * [Background Finder] Create a valid invocation token * Replace plasma.kde.org with kde.org/plasma-desktop- Update tarball, now with updated preview images- Update to 5.18.0 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.18.0.php - Changes since 5.17.90: * tooltips always have normal color group * Fix typo * [Notifications] Don't dodge notification popups * [Notifications] Fixup setSourceModel * [SNI] Fix race condition in item registration (kde#416652) * [Notifications] Fix typo * Shut up * [System Tray] Initially set correct category for plasmoids (kde#416947) * [Task Manager] Remove strict URL handling (kde#385727) * [context menu] Remove last traces of "Lock Widgets" action from UI (kde#416578) * Remove unused includes * Port plasma-workspace to autoconfig.kde.org * [sddm-theme] Fix broken wallpaper loading * [Notifications] Fix action button size * search for a default wallpaper in lookandfeel * [startkde] Export LC_TIME again (kde#416670) * [Notifications] Set transient parent for file menu (kde#387597) * [SystemTray] Fix model update in settings (missing icon) (kde#416400) * [SystemTray] Remove scrollbar paddings * Runner/Windows make the window finding more reliable (kde#414804) * Kicker/RecentDocuments display place's icon when resource matches one * [Notifications] When there is only a reply action, show reply field right away * [Notifications] Send reply text as targeted signal * Also disable automatic scaling on Qt >= 5.14 (kde#415421) * add includes needed for compiling with qt 5.13 - Drop patches, now upstream: * 0001-Set-QT_AUTO_SCREEN_SCALE_FACTOR-0-for-Qt-5.14-as-wel.patch- Replace %make_jobs with %cmake_build- knewstuff-imports is needed for several KCMs- Update to 5.17.90 * New feature release * For more details please see: * https://www.kde.org/announcements/plasma-5.17.90.php - Too many changes to list here - Drop patches, now upstream: * 0001-Add-suffix-to-the-wayland-session-s-name.patch * lazy-sddm-theme.patch - Refresh patches: * 0001-Use-qdbus-qt5.patch- Add patch to fix/workaround scaling issues Qt 5.14.0 (kde#415421, boo#1160624): * 0001-Set-QT_AUTO_SCREEN_SCALE_FACTOR-0-for-Qt-5.14-as-wel.patch- Update to 5.17.5 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.17.5.php - Changes since 5.17.4: * Fix build with gpsd 3.20 (kde#425939) * [Notifications] Don't show DrKonqi notifications in history * Revert "Add Meta+Space as a default shortcut to activate KRunner" * [Notifications] Release all cookies when service unregisters * Revert "[sddm-theme] Fix initial focus after SDDM QQC2 Port" (kde#414875) * Keep at least one system monitor alive * Use the right value of EnableMagicMimeActions * [sddm-theme] Fix initial focus after SDDM QQC2 Port- Update to 5.17.4 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.17.4.php - Changes since 5.17.3: * [sddm-theme] Fix initial focus after SDDM QQC2 Port * [XembedSNIProxy] Send all container windows to background on KWin restart (kde#357443) * [XembedSNIProxy] If available, always use 32-bit color. (kde#356937) * Port to non-deprecated KWindowSystem::setMainWindow overload * Fix broken multimedia control on lockscreen (kde#414487) * NET::StaysOnTop -> NET::KeepAbove (since 5.0)- Update to 5.17.3 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.17.3.php - Changes since 5.17.2: * Fix binding loop in lockscreen media controls (kde#413087) * update panel shadows when background hints are changed * [Slideshow] Reenable other modes * Make env in plasma-sourceenv.sh call portable- Update to 5.17.2 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.17.2.php - Changes since 5.17.1: * [wallpapers/image] Randomise new batches of images in the slideshow (kde#413463) * [wallpapers/image] Seed random number generator * [Lock Screen] Don't use black shadows with black text (kde#413537) * clear the cells before relayouting the items (kde#413019)- Update to 5.17.1 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.17.1.php - Changes since 5.17.0: * [Windows Runner] Gather window again when running result (kde#412386) * [startplasma] Pass actual variable to kapplymousetheme * Fix slideshow crashing in invalidate() (kde#413018) * Fix reading environment variables with newline (kde#413130) * [Media Controller] Multiple artists support (kde#405762) * [gmenu-dbusmenu-proxy] Don't create ~/.gtkrc-2.0 * [Notifications] Also consider enabled and connected for screen to be checked against * [Notifications] Don't bind model inside headerItem * [XembedSNIProxy] Do not crash on null pointer (kde#409652) * [XembedSNIProxy] Scale only big icons (kde#366047) * [XembedSNIProxy] Check size in each update() (kde#358240) - Remove patches, now upstream: * 0001-Fix-reading-environment-variables-with-newline.patch * 0001-gmenu-dbusmenu-proxy-Don-t-create-.gtkrc-2.0.patch- Add patch to fix reading environment variables with newline (boo#1154345, kde#413130): * 0001-Fix-reading-environment-variables-with-newline.patch- Add patch to fix race on startup (kde#412970): * 0001-gmenu-dbusmenu-proxy-Don-t-create-.gtkrc-2.0.patch- Update to 5.17.0 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.17.0.php - Changes since 5.16.90: * [Notifications] Report effective Inhibited state on DBus * Fix erroneous conversion to signed int * [startplasma] don't set QT_AUTO_SCREEN_SCALE_FACTOR with Qt >= 5.14 * [Notifications] Dodge Plasma dialogs * Link explicitly to Qt5Widgets, in case KWindowSystem doesn't anymore * [Notifications] Add spacing after positioning popup for bottom panel * Remove some spacing on lockscreen that was causing elements to get cut off on small displays (kde#410801) * [Kicker] Add guards for appletInterface * Fix version for Plasma/5.17 * Fix the appstream qt detection in cmake (kde#412069) * It depends against 5.62 now- Adjust plasmafullwayland.desktop to upstream changes: the session is started by the startplasma-wayland executable now, the startplasmacompositor script doesn't exist anymore- Update to 5.16.90 * New feature release * For more details please see: * https://www.kde.org/announcements/plasma-5.16.90.php - Too many changes to list here - Refresh patches: * 0001-Add-suffix-to-the-wayland-session-s-name.patch * 0001-Set-GTK_BACKEND-x11-in-a-wayland-session.patch * lazy-sddm-theme.patch - Replace 0001-Rename-qdbus-in-startkde.patch with 0001-Use-qdbus-qt5.patch- Update to 5.16.5 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.16.5.php - Changes since 5.16.4: * [Notifications] Elide application label on the left * [Notifications] Group only same origin and show it in heading * [Notifications] Implement JobViewV3 * Replicate Shift+Enter for action invocation for history as well (kde#411350) * libtaskmanager: fix launch url for startup info with pathless desktop file * [weather] [envcan] Add additional current condition icon mappings * [weather] [envcan] Thunderstorm is a current condition, the XML also seems to have whitespaces so strip those off * Tell AppStream generators not to index Klipper .desktop files * [Notifications] Bring back dismissed progress in case of crash * Add missing include (QJsonArray) to fix compilation with Qt 5.13 * [lockscreen] Fit album art to defined geometry * Fix compilation * Add missing include * [notifications] Change default icon to notification-inactive * [MPRIS Data Engine] Ignore non-standards compliant players * [applets/notifications] Try to not have the notification count numbers overflow the icon * [Notifications] Workaround NativeRendering with non-integer scaling * Bind SQL parameters in firefox bookmarksrunner support- Change 0001-Set-GTK_BACKEND-x11-in-a-wayland-session.patch to not override GDK_BACKEND if already set - Add a new plasmafullwayland.desktop which overrides use of X11 backends of GTK and Qt- Update to 5.16.4 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.16.4.php - Changes since 5.16.3: * [Notifications] Keep new delegate hidden until room has been cleared- Update to 5.16.3 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.16.3.php - Changes since 5.16.2: * Keep Klipper notifications out of notification history (kde#408989) * [Notifications] Print warning about missing identification only if both are missing * [Notifications] Ignore excess spam (kde#409157)- Update to 5.16.2 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.16.2.php - Changes since 5.16.1: * [Notifications] Swap configure and clear buttons in full representation header (kde#409140) * do not use long deprecated QString::toAscii * print a warning when invoking the scripting API's sleep() * [Notifications] Don't keep non-configurable notifications in history * [Notifications] Make popup placement more resilient * [Notifications] Don't show remaining time when job is paused * [Notifications] Let plasmashell be the only true owner of notification and job tracker services (kde#408250) * [Klipper] Always restore the last clipbboard item * Handle Gimp 2.10 * Set translation domain * [interactiveconsole] Fix initial load selection (kde#408787) * [Notifications] Read BAMF_DESKTOP_FILE_HINT from environment * Make the icon applet use the same shadow settings as desktop icons- Update to 5.16.1 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.16.1.php - Changes since 5.16.0: * [Powerdevil runner] Make Sleep/Suspend command work again (kde#408735) * PanelView: align setting of masks with how it's done for dialogs/tooltips * [sddm-theme] Style the session and keyboard layout selectors to be more Breeze (kde#408702) * [Notifications] Resolve X-Flatpak-RenamedFrom- Update to 5.16.0 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.16.0.php - Too many changes to list here - Drop patches, now upstream: * 0001-Don-t-assign-a-QtObject-to-a-model.patch - Refresh lazy-sddm-theme.patch- Add patch to workaround crash with Qt 5.12.3 (kde#407220, QTBUG-75900): * 0001-Don-t-assign-a-QtObject-to-a-model.patch- Update to 5.15.90 * New feature release * For more details please see: * https://www.kde.org/announcements/plasma-5.15.90.php - Too many changes to list here - Refresh patches: * 0001-Rename-qdbus-in-startkde.patch * 0001-Revert-No-icons-on-the-desktop-by-default.patch * 0001-Set-GTK_BACKEND-x11-in-a-wayland-session.patch * lazy-sddm-theme.patch- Update to 5.15.5 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.15.5.php - Changes since 5.15.4: * [Widget Explorer] Continue using a trash can icon for "Uninstallable" category * Show accurate checked state for system monitor configuration pages- Fix typos in Groups.- Update to 5.15.4 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.15.4.php - Changes since 5.15.3: * Fix prior commit that broke the build * Change default Klipper behavior to accept images * [service runner] throw out kde3 "compat" code (kde#383287) * [KSplashQML] Register DBus before loading the splash theme * [notifications] Prevent subpixel font placement- Fix wording - Changed dependecy status of sounds package from Required to Recommended because Plasma load just fine without it.- Edit 0001-Set-GTK_BACKEND-x11-in-a-wayland-session.patch: * Allow overriding GDK_BACKEND in .config/plasma-workspace/env- Update to 5.15.3 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.15.3.php - Changes since 5.15.2: * [Task Manager] Fix sorting of tasks on last desktop in sort-by-desktop mode * [notifications] Lift up notification content if one line of body text droops (kde#404407) * [OSD] Fix animation stutter * [shell] Show kactivies warning only on error- Update to 5.15.2 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.15.2.php - Changes since 5.15.1: * [weather] envcan: Fix typo in lowercase icon lookup string * Don't show entries with NoDisplay=true with the applauncher containmentaction * improve screen filtering for global menu applet (kde#404500) - Drop patches, now upstream: * 0001-Don-t-show-entries-with-NoDisplay-true-with-the-appl.patch- Add patch to honour NoDisplay in the applauncher containmentaction (boo#1125901): * 0001-Don-t-show-entries-with-NoDisplay-true-with-the-appl.patch- Update to 5.15.1 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.15.1.php - Changes since 5.15.0: * [ksmserver] Restore legacy sessions (kde#404318) * Exclude kuiserver from session management * [Digital Clock] Fix 24h tri-state button broken in port to QQC2 (kde#404292) * Harmonize usage of HAVE_X11, using #if and #cmakedefine01 everywhere * [weather dataengine] bbc,envcan,noaa: fix day/night calculation for observe * [weather dataengine] envcan: fix forecast icons to match "ice pellets" * Fix System Tray popup interactivity after echanging item visiblity (kde#393630)- Update to 5.15.0 * New feature release * For more details please see: * https://www.kde.org/announcements/plasma-5.15.0.php - Changes since 5.14.90: * weather dataengine] noaa: another forecast string found in use * [kio_applications] Fix last dir item being shown twice * Revert string change on stable branch * [image wallpaper] Show wallpaper title/filename on grid view delegates * With software rendering, use outlines instead of shadows on login & lock screen (kde#398317) * Update Breeze Look and Feel theme previews * [plasmawindowed] Pick up KQuickAddons::QtQuickSettings * weather dataengine] noaa: support more "Slight Chance *" forecast strings * [weather dataengine] Remove duplicated condition/forecast strings * StatusItemNotifier: fix overlays by name with icons by name * [weather dataengine] noaa: add another forecast string found in use * [weather dataengine] bbc: use night icons for forecast "Tonight" * Reload virtual desktop name on change * Useful error output when shell loading is aborted due to kactivitymanagerd not being activatable * [applets/appmenu] Show placeholder when configuring and empty (kde#403232) * [applets/appmenu] Set iconSource properly * Handle ShutdowntypeDefault in KSMserver legacy code (kde#403466) * [Analog Clock] Port config window to QQC2 and use Kirigami FormLayout * [wallpapers/image] Port wallpaper plugins (mostly) to QQC2 (kde#400549) * [build] Search for kirigami as a runtime dependency- Update to 5.14.90 * New feature release * For more details please see: * https://www.kde.org/announcements/plasma-5.14.90.php - Too many changes to list here - mkfontdir and xset not required anymore - Remove patches, now upstream: * 0001-Set-XDG_SESSION_TYPE-wayland-in-startplasmacomposito.patch- Update to 5.14.5 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.14.5.php - Changes since 5.14.4: * [weather dataengine] envcan: fix typo in forecast string "Mainly sunny" * [weather dataengine] envcan: support also "Partly cloudy" forecast * [weather dataengine] bbc: adapt to changed strings for same day in forecast * [weather dataengine] noaa: add more forecast strings found in use * [weather dataengine] Remove duplicated condition/forecast strings * [weather dataengine] envcan: support also "Mainly cloudy" forecast * [weather dataengine] noaa: use https over http * [weather dataengine] noaa: fix unknown icon for Flurries * [kuiserver] Debug-- * [kuiserver] Avoid double warning on terminated jobs * Don't exec() hint about deactivating URL grabber (kde#363771) * Set error if a kjob host disappears from kuiserver with active jobs- Update to 5.14.4 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.14.4.php - Changes since 5.14.3: * [DBusMenuImporter] Don't call removeAction() to avoid an empty QMenu (kde#399975) * [Baloo Runner] Filter duplicates and prefer specific type matches * [clipboard] Limit length of clipboard text item visualisation- Add David Edmundson's key to plasma.keyring - Update to 5.14.3 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.14.3.php - Changes since 5.14.2: * Only use wl-shell for the ksmserver greeters on Qt < 5.12 (kde#399918)- Update to 5.14.2 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.14.2.php - Changes since 5.14.1: * Plasmashell freezes when trying to get free space info from mounted remote filesystem after losing connection to it (kde#397537) * [Lock Screen] Do not try to unlock when unvisible (kde#395671) * KRunner: remove no longer existant and unused column from SQL query (kde#398305)- Don't require plasma-nm5, recommend it only - Add mkfontdir requires- Update to 5.14.1 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.14.1.php - Changes since 5.14.0: * Fix build with gpsd 3.18 * [Global Menu Applet] Fix menu layout option being always disabled * [Device Notifier] Auto-hide popup after device is unmounted * [Slideshow Wallpaper] Fix translation of context menu actions- Update to 5.14.0 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.14.0.php - Changes since 5.13.90: * Fallback to in-process prompt if logout prompt fails * [Slideshow] increase default interval from 10 seconds to 15 minutes * [Media Controller] Emit moved() signal when seeking with keyboard shortcuts * [Hotplug Engine] Update actions at runtime and listen for added/removed * Move correct indices in the manual sort map when getting a move() call for group children * [Notifications] Store "Open..." action in history (kde#398732) * Set gtk-modules to auto-load appmenu-gtk-module * Revert "Set gtk-modules to auto-load appmenu-gtk-module" * Revert "Update version number for 5.14.80" * Klipper: Do not insert secret data into history- Add xset, xsetroot and xrdb Requires- Add tarball signature and keyring containing keys of release managers Jonathan Riddell and Bhushan Shah- Update to 5.13.90 * New feature release * For more details please see: * https://www.kde.org/announcements/plasma-5.13.90.php - Too many changes to list here- Update to 5.13.5 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.13.5.php - Changes since 5.13.4: * [MPRIS Data Engine] Avoid blocking calls in media shortcuts handling (kde#397685) * [Solid Device Engine] Don't update free space info for inaccessible storage devices * [Notifications Engine] Guard "this" (kde#397105) * [Service Runner] Look up relative entryPaths * [Desktop Scripting ConfigGroup] Add more nullptr checks * Use 1 instead of true for gtk-shell-shows-menubar (kde#397087)- Update to 5.13.4 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.13.4.php - Changes since 5.13.3: * Fix blocky text on splash screen when using non-integer scale factor * Disable script execution over DBus when scripting console is disabled * [Notifications Engine] Never group notifications with URLs (kde#396741)- Also split off gmenudbusmenuproxy to allow for Recommends - plasma-framework-private is no more - Improve description of xembedsniproxy- move xembedsniproxy to own subpackage- Update to 5.13.3 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.13.3.php - Changes since 5.13.2: * Don't block startplasma sending DBus call to KSplash * [Places Runner] Add place category as subtext * [Places Runner] Fix opening search and timeline URLs * [Places Runner] Fix opening devices - Refresh 0001-Rename-qdbus-in-startkde.patch- Update to 5.13.2 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.13.2.php - Changes since 5.13.1: * Remove unused entry X-KDE-DBus-ModuleName from kded plugins' metadata- Update to 5.13.1 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.13.1.php - Changes since 5.13.0: * None- Update to 5.13.0 * New feature release * For more details please see: * https://www.kde.org/announcements/plasma-5.13.0.php - Changes since 5.12.90: * [Slideshow Wallpaper] Ignore hidden files and folders (kde#394882) * [Global Menu Applet] Open menu on press * Weigh matching services by relating data used in query to their menuids * Add mappings for VirtualBox * Remove legacy Wine hack-around from rules rc. (kde#393787) * Calendar widget: fix resize- Update to 5.12.90 * New feature release * For more details please see: * https://www.kde.org/announcements/plasma-5.12.90.php - Too many changes to list here - Add patch to add default desktop icons: * 0001-Revert-No-icons-on-the-desktop-by-default.patch - Remove patches, now upstream: * 0001-Add-a-button-to-clear-the-notification-history.patch * 0001-Call-KLocalizedString-setApplicationDomain-after-Q-A.patch * 0002-Add-platform-detection-to-KWorkspace-library-to-adju.patch * 0003-No-longer-export-QT_QPA_PLATFORM-env-variable-to-the.patch- Remove runtime dep on update-desktop-files- Update to 5.12.5 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.12.5.php - Changes since 5.12.4: * [ksmserver] Use QUrl::fromUserInput to construct sound url (kde#392725) * [Image Wallpaper] Fix auto transform for blurred fill (kde#393498) * sddm-theme: Focus the password field if enter pressed in the username field * [Notifications] Always scroll to the top when opening (kde#391646) * [ContextMenu Containment Action] Fix checking for KIOSK (kde#393329) * [Power Management Engine] Fix kiosk restriction for lockscreen (kde#393331) * [weather dataengine] envcan: fix forecast terms to match "ice pellets" * [weather dataengine] bbc: handle and ignore condition "Not Available" * [weather dataengine] bbc: handle and skip visbility "--" * [OSD] Enforce plain text * [weather] BBCUKMET: add missing "thundery showers" * [weather] BBCUKMET: add missing "light rain showers"/"heavy rain showers" * [weather dataengine] Fix BBC provider to adapt to change RSS feed (kde#392510) * KDE logout screen background color fix (kde#382264) * fix: Klipper notifications visually broken since plasma 5.12 (kde#390375) * [notifications applet] Fix two qml warnings about assigning [undefined] - Remove patches, now upstream: * Fix-weather-engine-BBC-provider.patch- Add patch to avoid listing all users over NIS: * lazy-sddm-theme.patch- Add patch to add a clear button to the notification history (kde#386068): * 0001-Add-a-button-to-clear-the-notification-history.patch- Add Fix-weather-engine-BBC-provider.patch to adapt the BBC weather engine provider to changes in the RSS feed that broke it (kde#392510)- Don't require plasma5-workspace in plasma5-workspace-devel, it pulls in a lot of unnecessary requirements and can cause build loops- Update to 5.12.4 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.12.4.php - Changes since 5.12.3: * [notifications applet] Fix two qml warnings about assigning [undefined] * Remove long-time deprecated Encoding=UTF-8 from desktop format files * [Run Command] Pass "event" to runCurrentIndex * Move to KRunner's second results item with a single keypress (kde#392197) * Pass proper click coordinates to SNI ContextMenu calls * libdbusmenu-qt: Remove nonexistant actions directly from the menu * Set a transient parent for SNI context menus * [DeviceNotifications Engine] Never show safely remove message when mounting (kde#391180) * Use dbus-run-session instead of dbus-launch --exit-with-session * [System Tray] Fix hiding applets with HiddenStatus * [Notifications] Remove NoAccessNetworkAccessManagerFactory * Improve By Desktop sorting for task groups (kde#384747) * Use separate config group for each wallpaper plugin * Fix duplicated [Desktop Entry] sections in two menu directory files - Remove patches, now upstream: * 0001-Use-dbus-run-session-instead-of-dbus-launch-exit-wit.patch- Add patches to not set QT_QPA_PLATFORM in a wayland session: * 0001-Call-KLocalizedString-setApplicationDomain-after-Q-A.patch * 0002-Add-platform-detection-to-KWorkspace-library-to-adju.patch * 0003-No-longer-export-QT_QPA_PLATFORM-env-variable-to-the.patch * 0001-Set-XDG_SESSION_TYPE-wayland-in-startplasmacomposito.patch - Set GDK_BACKEND=x11 to work around GTK3 bugs: * 0001-Set-GTK_BACKEND-x11-in-a-wayland-session.patch - Add a suffix to the wayland session's name: * 0001-Add-suffix-to-the-wayland-session-s-name.patch - Apply upstream patches before downstream patches- Add upstream patch to fix starting a wayland session from gdm and lightdm: (boo#1085772): * 0001-Use-dbus-run-session-instead-of-dbus-launch-exit-wit.patch- Update to 5.12.3 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.12.3.php - Changes since 5.12.2: * [media controller applet] Support MPRIS services where CanPause==false * [mpris2 dataengine] Fix media key handling to match MediaPlayer2.Player * [media controller applet] Fix JS error on no xesam:url data set * [mediacontroller applet] Remove de-funct "General" configuration page * Fix the userswitcher when using the mouse for switching (kde#391007) * Adapt to further nullpointers from prison- Update to 5.12.2 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.12.2.php - Changes since 5.12.1: * Fix favicons in firefox bookmarks runner (kde#363136) * Remove uninstalled themerc files for no longer existing Qt themes * Have all krunner plugin desktop files prefixed with "plasma-runner-" - Refreshed patches: * 0001-Rename-qdbus-in-startkde.patch- Update to 5.12.1 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.12.1.php - Changes since 5.12.0: * Improve appearance of the logout dialog on wayland * Fix Breeze LnF theme data for window decoration * Fix dupe handling in requestAddLauncherToActivities; improve unit test * [Notifications] Let clear entry also clear history * [LauncherTasksModel] Support applications: URLs in requestOpenUrls * [appstream runner] Add missing Messages.sh file and set TRANSLATION_DOMAIN- Update to 5.12.0 * New feature release * For more details please see: * https://www.kde.org/announcements/plasma-5.12.0.php - Changes since 5.11.95: * [Notifications] Fix grouping * Make sure device paths are quoted * Add license header to test * Revert "Set GTK scaling env vars" (kde#389523) * Revert "Replace bc with awk" * Sanitise notification HTML * Add missing find_dependency calls to libs' CMake config files * Fix krunner's alt+f2 on wayland (kde#385693) * Further improve quality of images in notifications (kde#385097) * Fix autohide panels on wayland (kde#377838) * Improve quality of images in notifications (Bug 385097) (kde#385097) * [Notifications] Unset Heading default height (kde#381154) * [Notifications] Unset Heading default height (kde#381154) * [Notifications] Put history into a ListView (kde#389132) * [Notifications] Disable history check box when notifications are disabled * [PanelView] Also requestActivate config dialog * Require KDE Frameworks 5.42 * [Calculator Runner] Fix unused variable warning * [Calculator Runner] Move action check outside of ifdef- Update to 5.11.95 * New feature release * For more details please see: * https://www.kde.org/announcements/plasma-5.11.95.php - Too many changes to list here - Adjust 0001-Rename-qdbus-in-startkde.patch- Update to 5.11.5 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.11.5.php - Changes since 5.11.4: * [widgetexplorer] Fix trying to show deleted dialog * Remove i18n() calls from iconSource names * [widgetexplorer] Make sure KNS download dialog is destroyed * [weather] NOAA ion: Show some icons for "Hot" and "Cold" forecasts (kde#365715) * [weather] NOAA ion: update link in comments- Only recommend, not require, kio-extras5- Add explicit BuildRequires for xrender and xtst- Update to 5.11.4 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.11.4.php - Changes since 5.11.3: * Dict Engine: cache available dicts * Dict engine: remove two redundant lines * Dict engine: remove double quotes around dictionary descriptions. * [weather] ion template: remove bogus translation strings * Preserve the order in dbus menu when doing action reusing. * Be more explicit about Qt5::Widgets dependencies- Replace references to /var/adm/fillup-templates with new %_fillupdir macro (boo#1069468)- Update to 5.11.3 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.11.3.php - Changes since 5.11.2: * DictEngine: set a scheme for the URLs, otherwise webengine won't handle them * Align logout screen action buttons to the top (kde#371249) * Sync xwayland DPI font to wayland dpi- Update to 5.11.2 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.11.2.php - Changes since 5.11.1: * Sync xwayland DPI font to wayland dpi * Dict Engine: various cleanups * Dict Engine: improve error handling.- Add #!BuildIgnore to break the kwin5 -> kdialog dep chain which results in pulling in kdebase4-runtime on 42.2- Update to 5.11.1 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.11.1.php - Changes since 5.11.0: * [LauncherTasksModel] Try resolving absolute path to applications: URL before adding launcher * [Task Tools] Treat applications: and respective absolute path equal in launcherUrlsMatch (kde#385594) * [StartupTasksModel] Try resolving startup application id to applications: URL * Fix "postEvent: null receiver" warning due to nullptr->deleteLater() * Remove compilation flag for non-existing source file * Revert "Remove pointless data copy in lockscreen delegate" - Remove patches, now upstream: * fix-switch-user.patch- Add fix-switch-user.patch to fix being unable to switch users from the Switch User screen- Update to 5.11.0 * New feature release * For more details please see: * https://www.kde.org/announcements/plasma-5.11.0.php - Changes since 5.10.95: * update selected wallpaper when adding from file browser * Stop setting the QQC1 style in startkde * Fix another test failure. * Fix test failure after favorites URL mangling refactoring. * [PowerDevil Runner] Obliterate traces of power profiles * [TasksModel] Use std::acumulate on the QHash directly * remove extra executable bits * Don't set QQC Style in startkde * Unhide autohidden panel when using global menu (kde#384861) * Use a separate config value for Wayland font DPI- Remove the fix related to a knotifications bug (boo#1046458): * bug is fixed upstream (knotifications 5.38.0)- Update to 5.10.95 * New feature release * For more details please see: * https://www.kde.org/announcements/plasma-5.10.95.php - Too many changes to list here - Remove patches, now upstream: * plasma5-workspace/0001-Don-t-search-for-and-link-to-libcln-when-using-libqa.patch * plasma5-workspace/applauncher-allow-to-show-apps-by-name.patch * plasma5-workspace/logoutdialog-honor-Offer-shutdown-options.patch - Move plasma5-session into here - Convert kde-plasma.desktop session file to link to avoid duplicate entries in display managers - Add AppStreamQt BuildReq- Add patch to fix build with qalculate 2.0: * 0001-Don-t-search-for-and-link-to-libcln-when-using-libqa.patch- Update to 5.10.5 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.10.5.php - Changes since 5.10.4: * Fix QSortFilterProxyModelPrivate::updateChildrenMapping crash in libtaskmanager (kde#381006) * [Notifications] Clean up States * Don't change fillMode of image just before deleting it * Disable kuiserver debug output by default; make it appear in kdebugsettings. * [Battery Monitor] Fix icon size for InhibitionHint (kde#383213) * [Notifications] Improve mouse handling (kde#382263) * Use correct easing type values (kde#382834) * Prefer using https for kns providers * Improve unittest for renaming desktop icons * [AppMenu Applet] Pass "ctx" as context instead of "this" (kde#382386) * [Klipper ModelTest] Fix build * [TasksModel] Use LauncherUrlWithoutIcon in move method * [LauncherTasksModel] Emit dataChanged for LauncherUrlWithoutIcon on sycoca change- Fix more uses of qdbus in 0001-Rename-qdbus-in-startkde.patch- Remove Recommends on sni-qt to not pull in Qt4 unconditionally (sni-qt supplements packageand(plasma5-workspace:libqt4) now)- Recommend libqt5-qtvirtualkeyboard as the default lockscreen theme has a button to open it- Require libqt5-qdbus and libqt5-qtpaths instead of the full libqt5-qttools package which also contains development tools (boo#988808)- Update to 5.10.4 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.10.4.php - Changes since 5.10.3: * Fix compilation with current cmake (git branch release). * [Notification Item] Enforce PlainText for summary * [Notifications] Check for corona to avoid crash (kde#378508) * [Windowed Widgets Runner] Fix launching widget * [lookandfeel/lockscreen] Fix state handling when clicking the keyboard's own hide button (kde#381833) - Remove patches, now upstream: * Notifications-Check-for-corona-to-avoid-crash.patch- Add Notifications-Check-for-corona-to-avoid-crash.patch to prevent a Plasma crash when removing a panel that has a system tray with the Notifications applet (boo#1046500, kde#378508)- Add logoutdialog-honor-Offer-shutdown-options.patch to make the logout dialog respect the "Offer shutdown options" setting and hide "Reboot" and "Shutdown" if disabled (boo#1008844)- Add applauncher-allow-to-show-apps-by-name.patch to provide an option to display application names instead of the generic names in the desktop containment's application launcher mouse action (kde#358423, boo#974513)- Delete org.kde.plasma.Notifications.service, this causes problem for KDE applications when they are being run on a different desktop or remotely via ssh (boo#1046458)- Update to 5.10.3 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.10.3.php - Changes since 5.10.2: * [xembedsniproxy] Free windowAttributes in every case * Use KRun::runApplication when possible; split out and share more code. * Use KRun::runApplication, add missing KActivities::notifyAccessed calls. (kde#381500) * [AppMenu Applet] Workaround Connections bug in Qt >= 5.8 (kde#375535) * [AppMenu Applet] Wire up DBusMenuImporter::actionActivationRequested (kde#376726) * fix attachment signals * [xembedsniproxy] Fix memleak and possible crash - Remove patches, now upstream: * xembedsniproxy-fix-possible-crash.patch - Use %kf5_find_htmldocs- Add xembedsniproxy-fix-possible-crash.patch to fix a possible crash- Update to 5.10.2 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.10.2.php - Changes since 5.10.1: * [Icon Applet] Repopulate if URL didn't change (kde#380922) * Fix binding loop in ClipboardItemDelegate * Squelch warning.- Update to 5.10.1 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.10.1.php - Changes since 5.10.0: * Fix testing when the test has qml syntax errors * Fix variable name and logic * Only enable MPRIS global shortcuts on demand (kde#380526) * Small fix on test helper * [xembedsniproxy] Fix check whether to use XTest (kde#362941,kde#375017) * dont' crash if we don't have a launcherTasksModel * don't show logout when kauthorized doesn't want it (kde#380344) * [TaskGroupingProxyModel] Use LauncherUrlWithoutIcon * Always add data sources in SystemMonitorEngine::sourceRequestEvent() (kde#380209) - Remove patches, now upstream: * xembedsniproxy-fix-using-XTest.patch * 0001-dont-crash-if-we-don-t-have-a-launcherTasksModel.patch- Add xembedsniproxy-fix-using-XTest.patch to fix clicking on system tray icons of certain applications, mainly GTK3 and Java (boo#1026999, kde#362941, kde#375017)- Add patch to fix crash with active-window-control plasmoid: * 0001-dont-crash-if-we-don-t-have-a-launcherTasksModel.patch- Update to 5.10.0 * New feature release * For more details please see: * https://www.kde.org/announcements/plasma-5.10.0.php - Changes since 5.9.95: * Always add data sources in SystemMonitorEngine::sourceRequestEvent() (kde#380209) * Fix co-installability with other DBus activated notification services * We should not forget the launchers that are not currently shown * remove useless debug * don't check for panel visible during startup * [Weather] Fix term used for thunderstorm in bbcukmet data db * [Weather] Add missing strings from bbcukmet data db * [Weather] Remove duplicated/bad strings from bbcukmet data db * [Weather] Fix lookup of bbcukmet translations strings, stored in lowercase * [Weather] Fix term used for thunderstorm in bbcukmet data db * [Weather] Add missing strings from bbcukmet data db * [Weather] Remove duplicated/bad strings from bbcukmet data db * [Weather] Fix lookup of bbcukmet translations strings, stored in lowercase- Update to 5.9.95 * New feature release * For more details please see: * https://www.kde.org/announcements/plasma-5.9.95.php - Too many changes to list here - Remove patches, now upstream: * change-kioremote-severity.patch * 0001-Some-UI-fixes-for-logout-dialog.patch * revert-autostart-krun.patch- Add upstream patch revert-autostart-krun.patch: * Fix Plasma start if a non existent executable was supplied as autostart script / program- Update to 5.9.5 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.9.5.php - Changes since 5.9.4: * Update the ungrab mouse hack for Qt5.8 * use KProcess instead of QProcess to launch apps in ksmserver * launch autostart apps in ksmserver using KRun, not QProcess (kde#369391, kde#370528) * recognize the WM even if given with a full path * Don't remove other applets in SystemTray::cleanupTask * [Media Controller] Enforce PlainText format * [Media Controller] Enforce PlainText format * Fix off-by-one. * [Media Controller] Use double for length instead of int (kde#377623) * When deleting the panel the notifications applet is in, the containment is being destroyed but the corona is still there and rightfully emits availableScreenRectChanged. This will cause us to crash when we try to access the no-longer existing containment. * Fix losing wallpaper selection when clicking "Apply". * Correctly handle when a new primary screen displaces the old * Fix TasksModel.anyTaskDemandsAttention not updating on window closure. (kde#378254) * [Windowed Widgets Runner] Fix mimeDataForMatch * Connect aboutToHide signal from QMenu to relevant libdbusmenu-qt slot (kde#375053) * [Calculator Runner] Use "approximate" approximation mode (kde#277011) * [OSD] Allow disabling OSD through config file- No longer generate org.kde.plasma.private.systemtray.appdata.xml manually, bug fixed in kpackage meanwhile- Add patch to fix some logout UI issues: * 0001-Some-UI-fixes-for-logout-dialog.patch- Remove empty files in %_kf5_appstreamdir- Update to 5.9.4 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.9.4.php - Changes since 5.9.3: * do not add debugger button unless it is meant to be visible * manage mouse events when out of the window (kde#377545) * don't emit availableScreenRectChanged when quitting * try proper order of corona()->availableScreenRect() (kde#377298) * [Notifications] Keep popup opened during drag * Ignore NoDisplay=true .desktop entries when matching by Name. * Preview Centered wallpaper as PreserveAspectFit (kde#375675) * Only activate kded Appmenu signals if menus are in the window decoration * Open the correct submenu in kwin menu when activating the Appmenu with a shortcut * try harder to make the selected wallpaper visible- Provide dbus(org.freedesktop.Notifications): plasmashell implements the Notifications interface.- Update to 5.9.3 * New bugfix release * For more details please see: * https://www.kde.org/announcements/plasma-5.9.3.php - Changes since 5.9.2: * Remove deprecated --shut-up start flag * Fix another regression with rearranging launchers in an activities world. * [Media Controller] Round button size for play button * try harder to make the selected wallpaper visible * [Logout Screen] Show suspend button only if supported * Map StartupWMClass for Chrome apps instead of RegExp'ing the name * [kioslave/remote] Fix broken kded module * Port to QMultiHash. * Only remove + announce if leader change actually occured, avoid excessive loop. * Fix crash. * [Notifications] Never manually hide() the NotificationPopup * Add comment laying out goals. * Fix crash when switching activities. * Tweak alphabetic (default) sort behavior. - Remove patches, now upstream: * 0001-Fix-another-regression-with-rearranging-launchers-in.patch- Add patch to fix regression in Plasma 5.9: * 0001-Fix-another-regression-with-rearranging-launchers-in.patch- drkonqi can use konsole again, the problems there are fixed- Update to 5.9.2 * New feature release * For more details please see: * https://www.kde.org/announcements/plasma-5.9.2.php - Changes since 5.9.1: * TaskManager: add icon to cache after painfully querying it over XCB/NETWM. * Pass args to DataEngine superclass constructor * turn the NotificationItem in a MouseArea * [DesktopView] show() ConfigView when it is already opened * Match QtQuick import to minimum Qt version * [Clipboard plasmoid] Fix line breaks * [System Tray] Part Revert "Trigger context menu on press" as this breaks xembedsniproxy * Rename Application Menu to Global Menu to avoid conflict * [kioslave/remote] Fix porting bugs * [Icon Applet] More sensible minimum height * make services disqualification much stricter * [System Tray Containment] Drop useless Q_INVOKABLE from .cpp file * [System Tray Containment] Ungrab mouse before opening context menu - Remove patches, now upstream: * 0001-make-services-disqualification-much-stricter.patch- Add workaround for boo#1024326, kde#376394: * Copy org.kde.plasma.systemtray.appdata.xml to org.kde.plasma.private.systemtray.appdata.xml to fix missing summary- Update to 5.9.1 * New feature release * For more details please see: * https://www.kde.org/announcements/plasma-5.9.1.php - Changes since 5.9.0: * [User Switcher] Ungrab keyboard before trying to lock the screen * react to config change * [System Tray Containment] Drop useless Q_INVOKABLE from .cpp file * [System Tray Containment] Ungrab mouse before opening context menu * [AppMenu Applet] Map from scene after mapping from global * Fix memory leak in Appmenu when using compact menu * [Appmenu Applet] Check whether buttonGrid has a window before calling mapToGlobal * [Digital Clock] Take into account timezone label width for applet size * [KRunner] In doubt use primary screen for view position * Drop legacy fixup rule for VirtualBox. * fix isOutputRedundant logic * fix isOutputRedundant logic * When swapping Wallpapers, save the config to file, not just to propertymap - Remove patches, now upstream: * 0001-When-swapping-Wallpapers-save-the-config-to-file-not.patch * 0002-fix-isOutputRedundant-logic.patch - Add patch to fix 5.9.0 regression: * 0001-make-services-disqualification-much-stricter.patch- Add cmake(KF5Prison) build requirement to enable the clipboard's barcode generation feature- Bump required KF5 version to 5.29 - Add upstream patch to fix some multiscreen issues: * 0002-fix-isOutputRedundant-logic.patch- Update to 5.9.0 * New feature release * For more details please see: * https://www.kde.org/announcements/plasma-5.9.0.php - Add upstream patch to fix kde#375532: * 0001-When-swapping-Wallpapers-save-the-config-to-file-not.patch - Changes since 5.8.95: * [Icon Applet] Use KIO::statJob to work with remote URLs * Fix group parents not appearing when disabling inline grouping. * [Image Wallpaper] Provide fallback for thumbnail size of no "plasmoid" around * only reset the model after componentComplete() * [lookandfeel] Breeze window decoration * Fix "Unpin" for tasks pinned to specific activities. * applets/icon: Set i18n domain (patch by Victor) * use Q_FOREACH in this branch * Corona::screenGeometryChanged on qscreen resized * add #include for old Qt versions * Replace std::bind with lambda. * try to put annotations before parameters definition * fix dbus xml compilation * guard against menu being deleted whilst updating * Hide menu if the menu disappears off DBus * Don't re-evaluate the model constantly whilst looping through windows * Generate DBusMenu Interface for libdbusmenuqt * pre-load the first layer of sub menus * Signal which menu has updated in libdbusmenu-qt * Don't hide applet when it needs configuring * Don't load menu when switching window focus to the desktop * Keep AppletMenu as small as possible * Fix calling KWindowSystem::windowType without fetching the type * Enable Edit Action in plasmoid mode * Fix mapToGlobal * Show "All Widgets" even when showSpecialFilters=false. * [Icon Applet] Rename open() to run() to fix compilation on 32-bit- Update to 5.8.95 (Plasma 5.9 Beta) * New feature release * For more details please see: https://www.kde.org/announcements/plasma-5.8.95.php - Changes: * See https://www.kde.org/announcements/plasma-5.8.5-5.8.95-changelog.php#plasma-workspace - Remove patches, now upstream: * 0001-better-clean-up-of-duplicate-containments.patch - Workaround made unnecessary by upstream commits: * add-tray-icon-cache.patch- Add experimental patch to fix some dangling duplicate containments in the -appletsrc: * 0001-better-clean-up-of-duplicate-containments.patch- Require also the main package from the devel package. This is required to get the required layouts for the servicetypes.- Update to 5.8.5 * New bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.8.5.php- Update to 5.8.4 * New bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.8.4.php - Remove patches, now upstream: * 0001-taskmanagerrulesrc-Add-Rewrite-Rule-for-Google-chrom.patch * 0002-make-sure-all-outputs-are-known.patch * 0003-Sync-app-config-in-sync-with-applets-config.patch * 0004-Avoid-connecting-to-screen-changed-signals-twice.patch * 0005-Load-screenpool-at-the-same-time-as-we-connect-to-sc.patch * Look-for-both-json-and-desktop-metadata.patch * keep-wallpaper-aspect-ratio-wallpaper-on-screen-resolution-change.diff * plasma5-workspace.spec * use-nearest-aspect-ratio-available-wallpaper.diff- Add Look-for-both-json-and-desktop-metadata.patch to fix adding a panel or plasmoid with the new json metadata files- Backport several commits for better multiscreen handling: * 0001-taskmanagerrulesrc-Add-Rewrite-Rule-for-Google-chrom.patch * 0002-make-sure-all-outputs-are-known.patch * 0003-Sync-app-config-in-sync-with-applets-config.patch * 0004-Avoid-connecting-to-screen-changed-signals-twice.patch * 0005-Load-screenpool-at-the-same-time-as-we-connect-to-sc.patch * kde#372099,kde#371858,kde#371991,kde#371819,kde#371734 * boo#1003438- Introduce new _plasma5_bugfix global for more fine-tuned dependencies- Call qtpaths with an absolute path in startkde to make sure the system one is used (boo#1004769)- Add use-nearest-aspect-ratio-available-wallpaper.diff to improve the selection of wallpapers keeping the same (or as similar as possible) aspect ratio (boo#990257). Include the latest changes submitted upstream to work better with QUAD HD screen resolutions.- Update to 5.8.3 * New bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.8.3.php - Remove upstream patches: * fix-sddm-theme-logic.diff * remove-sddm-graphicaleffects-dep.patch- Remove Requires again, backport import removal * remove-sddm-graphicaleffects-dep.patch- Add Requires: libqt5-qtgraphicaleffects as used by the sddm theme- Added fix-sddm-theme-logic.diff so sddm offers the text entry boxes by default (instead of an empty user list) when the userlist model is empty (boo#1003742)- Update to 5.8.2 * New bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.8.2.php- Update to 5.8.1 * New bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.8.1.php - Removed upstream patches: * 0001-save-the-containment-only-aftyer-switch.patch - Remove copyrighted picture (kde#370490)- Add keep-wallpaper-aspect-ratio-wallpaper-on-screen-resolution-change.diff: * Chooses a new preferred background image when the screen resolution is changed to keep the correct aspect ratio (boo#990257). Also check for division by zero.- Add 0001-save-the-containment-only-aftyer-switch.patch: * Without this it would always change back to the folderview after login (boo#1003399)- Add Source: URL back- Update 0001-Ignore-default-sddm-face-icons.patch to not break all .face.icon (boo#1001364)- Add add-tray-icon-cache.patch (kde#356479): * High load due to animated tray icons- Add 0001-Ignore-default-sddm-face-icons.patch (boo#1001364): * The default SDDM face icons are too dark to be used with the default backgrounds- Update to 5.8.0 * New LTS feature release * For more details please see: https://www.kde.org/announcements/plasma-5.8.0.php - Remove patches (now upstream): * 0001-wait-before-creating-the-panel.patch * fix-breeze-sddm-theme-with-many-users-2.patch * fix-wallpaper-not-having-correct-aspect-ratio.diff- Add fix-breeze-sddm-theme-with-many-users-2.patch: Makes the breeze theme in sddm show username/password directly instead of a user list when there's more than N users in the system where N is defined in sddm.conf, under the Theme section, in the UsersThresholdToDisableAvatars variable.- Add 0001-wait-before-creating-the-panel.patch to work around race condition for panel transparency (boo#1000109)- Add change-kioremote-severity.patch to avoid filling the home folder with useless log messages (boo#997173)- Added fix-wallpaper-not-having-correct-aspect-ratio.diff . The previous algorithm to choose a wallpaper preferred the ones with the closest area giving preference to downscaling over upscaling. This patch changes that to use that algorithm first only in wallpapers with the same aspect ratio as the screen and then using the old algorithm as fallback if no wallpaper has the same aspect ratio (boo#990257)- Use %{_plasma5_version} like other packages - Remove patch plasmashell-disable-windowclosing-on-logout.patch * now upstream - Fix self-obsoletion- Move german docs to lang subpackage again- Update to 5.7.95 (Plasma 5.8 Beta) * New LTS feature release * For more details please see: https://www.kde.org/announcements/plasma-5.7.95.php - Removed patches: Configuration-option-for-System-Tray-icon-size.patch Use-iconName-instead-of-icon-in-all-runners.patch add-separate-autostart-file-for-klipper.patch fix-breeze-sddm-theme-with-many-users.patch require-qt56.diff- Update to 5.7.5 * New bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.7.5.php- Update to 5.7.4 * New bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.7.4.php - Refresh plasma5-workspace.spec- Add Use-iconName-instead-of-icon-in-all-runners.patch to fix problems in KRunner caused by QIcon not being thread-safe (boo#994983, kde#355122, kde#356957)- Use xterm to install the debug packages in drkonqi, konsole doesn't handle the -e parameter correctly currently (boo#990353, kde#366793)- Adjust filelist for the plasmoid appdata, installed with KF > 5.25.0- Add add-separate-autostart-file-for-klipper.patch to prevent klipper from autostarting in e.g. GNOME (boo#993334)- Remove 0001-Workaround-kde-362531.patch as fixed in kwindowsystem- Update to 5.7.3 * New bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.7.3.php - Drop upstreamed patches: 0002-don-t-try-to-load-layout-before-kamd-starts.patch 0006-Treat-IsDemandingAttention-as-IsOnAllVirtualDesktops.patch 0007-apparently-containment-can-be-null.patch 0010-Properly-registering-existing-activities-before-load.patch 0001-check-harder-to-include-only-desktops-in-desktops.patch- Added fix-breeze-sddm-theme-with-many-users.patch again. This is still needed since upstream dropped the planned changes on the login breeze theme from the 5.7 release.- Add 0001-Workaround-kde-362531.patch as a workaround for kde#362531- Remove 0005-Missing-method-for-activity-deletion-from-plasma-scr.patch Not only unnecessary, but also reverted by later patch.- Added patches from upstream: 0002-don-t-try-to-load-layout-before-kamd-starts.patch 0005-Missing-method-for-activity-deletion-from-plasma-scr.patch 0006-Treat-IsDemandingAttention-as-IsOnAllVirtualDesktops.patch 0007-apparently-containment-can-be-null.patch 0010-Properly-registering-existing-activities-before-load.patch 0001-check-harder-to-include-only-desktops-in-desktops.patch- Update to 5.7.2 * New bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.7.2.php- Added Configuration-option-for-System-Tray-icon-size.patch from upstream- Update to 5.7.1 * New bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.7.1.php- Use the new %kf5_find_lang macro to create the file list for the lang package - Remove rpmlintrc file, it is not needed any more now- Update to 5.7.0 * New feature release * For more details please see: https://www.kde.org/announcements/plasma-5.7.0.php - Drop create_kdehome.patch and fix-breeze-sddm-theme-with-many-users.patch - Add require-qt56.diff: we know our Qt package has the right patch, so we don't need to depend on 5.6.1- Add missing Requires: in branding subpackage (boo#968427)- Run fdupes to compact duplicate files- Update to 5.6.4 * New bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.6.4.php - Drop upstreamed patches: digitalclock-fix-show-seconds.patch and kuiserver5_qApp.patch- Add digitalclock-fix-show-seconds.patch: Fixes displaying seconds in the digital clock which was broken with certain locales ("C" e.g.)- Update to 5.6.3 * New bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.6.3.php- Don't apply plasmashell-disable-windowclosing-on-logout.patch in SLE12 since Qt 5.5.1 in SLE12 is not patched to support the new session management API from 5.6.0 .- Update to 5.6.2 * New bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.6.2.php- Update to 5.6.1 * New bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.6.1.php - Drop upstreamed xembedsniproxy-avoid-ghost-entry.patch- Update to 5.6.0 * New feature release * For more details please see: https://www.kde.org/announcements/plasma-5.6.0.php- Added xembedsniproxy-avoid-ghost-entry.patch from upstream: prevents an empty icon being shown when e.g. fcitx is running (boo#954623, kde#358719)- Update to 5.5.5 (boo#968966) * Bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.5.5.php - Drop upstreamed fix-session-switch.patch and reset-the-model-on-list-always-shown-hide-change.patch- Update plasmashell-disable-windowclosing-on-logout.patch to upstream version (but apply it for Qt >= 5.5.1)- Added fix-session-switch.patch (kde#356945, boo#967538)- Added plasmashell-disable-windowclosing-on-logout.patch: prevent plasma from closing too early on logout resulting in an unusable desktop if the logout is cancelled (boo#955280, kde#349805)- Added kuiserver5_qApp.patch (boo#965922)- Added reset-the-model-on-list-always-shown-hide-change.patch (kde#357627, kde#352055)- Update to 5.5.4: * Bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.5.4.php - Drop xembedsniproxy-check-for-null-geometry.patch, upstreamed- Add xembedsniproxy-check-for-null-geometry.patch: fixes an xembedsniproxy crash (boo#954623, kde#355463, kde#358227)- Update to 5.5.3: * Bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.5.3.php- Update to 5.5.2: * Bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.5.2.php- Update to 5.5.1: * Bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.5.1.php - Drop upstreamed patches: 0001-notifications-Check-if-the-popup-is-visible-before-u.patch 0002-notifications-Move-reading-globalConfig-from-ctor-to.patch 0003-Make-comment-section-of-the-timezones-configuration-.patch 0004-notifications-Fix-default-notification-position-sett.patch 0001-Forward-mouse-enter-and-leave-events-on-feathered-ed.patch kde355684.patch use-old-connect-syntax.patch- Update to 5.5.0: * For more details please see: https://dot.kde.org/2015/12/08/plasma-55-beautiful-new-artwork - Move to cmake(...) BuildRequires where possible - Drop no longer needed fix-wayland-requirement.patch and rb125743.patch - Added patches from upstream: 0001-notifications-Check-if-the-popup-is-visible-before-u.patch 0002-notifications-Move-reading-globalConfig-from-ctor-to.patch 0003-Make-comment-section-of-the-timezones-configuration-.patch 0004-notifications-Fix-default-notification-position-sett.patch 0001-Forward-mouse-enter-and-leave-events-on-feathered-ed.patch kde355684.patch use-old-connect-syntax.patch- Rebased fix-breeze-sddm-theme-with-many-users.patch in preparation for 5.5.0- add dependency on xprop (called by /usr/bin/startkde)- Renamed userlist model property from UsersThresholdToDisableAvatars to disableAvatarsThreshold as in the patch finally accepted by sddm developers.- Adds patch fix-breeze-sddm-theme-with-many-users.patch: Makes the breeze theme in sddm show username/password editlines instead of a user list when there's more than N users in the system where N is defined in sddm.conf, under the Theme section, in the UsersThresholdToDisableAvatars variable. This patch together with patches in sddm fix bnc#953778- Update to 5.4.3 (boo#955068): * For more details please see: https://www.kde.org/announcements/plasma-5.4.3.php- Make sure users have pam_unix module in place so the screenlocker works when upgrading from openSUSE < 12.3 (boo#931296)- Try to fix wrong image scaling in kspash (boo#950799): rb125743.patch- Move sddm theme to upstream branding subpackage, so we can have branded sddm theme (boo#950796)- Let XEmbed icons appear in plasma, i.e. require xembed-sni-proxy package (boo#913339)- Add fix-wayland-requirement.patch that reduces the requirement of wayland 1.3 in CMakeLists.txt to 1.2 for SLE12 since the 1.2 version in SLE12 is patched to include the needed features from 1.3- Update to 5.4.2: * For more details please see: https://www.kde.org/announcements/plasma-5.4.2.php - Drop fix-logout-button-sizing.patch, upstreamed- Add fix-logout-button-sizing.patch: Upstream fix to ensure that logout/shutdown and cancel buttons on the logout screen have all the same size.- Update to 5.4.1: * For more details please see: https://www.kde.org/announcements/plasma-5.4.1.php- Add an explicit conflict with kio-extras5 < 15.08.0. Some files from kio-extras5 have been moved to plasma5-workspace in 5.4, this should prevent a possible file conflict. (boo#944656)- Update to 5.4.0: * For more details please see: https://www.kde.org/announcements/plasma-5.4.0.php- Update to 5.3.95 aka 5.4 beta: This release of Plasma brings many nice touches for our users such as much improved high DPI support, KRunner auto-completion and many new beautiful Breeze icons. It also lays the ground for the future with a tech preview of Wayland session available. We're shipping a few new components such as an Audio Volume Plasma Widget, monitor calibration tool and the User Manager tool comes out beta. * For more details please see: https://www.kde.org/announcements/plasma-5.3.95.php - Drop 0003-Remove-export-of-QT_PLUGIN_PATH.patch, upstreamed- Added patches from upstream to resolve baloo SiC in 5.13.0: use-the-filepath-as-the-unique-id-of-the-match.patch and Baloo-Result-header-is-no-longer-installed.patch- Update to 5.3.2: * Bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.3.2.php - Drop patches merged upstream: 0001-Bugzilla-Integration-Look-for-the-mappings-file-in-t.patch 0002-Reuse-the-existing-Notify-method-for-Notification-s-.patch 0003-notifications-Make-sure-the-Open.-button-on-finished.patch 0004-notifications-Optimize-sending-the-notification-data.patch 0005-Fix-launcher-sorting-the-by-activity-sorting-strateg.patch 0001-Unbreak-Undo-notifications-on-Plasmoid-removal.patch- Use %version instead of no longer existing %{_plasma5_branding_version} for branding provides/requires- Added patches from upstream: 0001-Bugzilla-Integration-Look-for-the-mappings-file-in-t.patch 0002-Reuse-the-existing-Notify-method-for-Notification-s-.patch (kde#342605) 0003-notifications-Make-sure-the-Open.-button-on-finished.patch 0004-notifications-Optimize-sending-the-notification-data.patch 0005-Fix-launcher-sorting-the-by-activity-sorting-strateg.patch (kde#348324) 0001-Unbreak-Undo-notifications-on-Plasmoid-removal.patch (kde#345149)- Update to 5.3.1: * Bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.3.1.php - Drop patches merged upstream: 0001-Disable-indeterminate-animation-for-suspended-jobs.patch 0003-notifications-Replace-apos-with-as-apos-is-not-suppo.patch 0004-Match-window-switch-dialog-borders-with-addwidgets-s.patch 0005-Manually-keep-track-of-jobs-sources.patch 0006-Fix-running-applet-calculation.patch 0008-Only-restart-Timer-when-the-dialog-is-visible.patch 0009-check-for-model-existence.patch 0010-Fix-a-crash-in-PowermanagementEngine-populateApplica.patch 0011-notifications-Always-check-first-if-the-dispatch-tim.patch 0012-notifications-Clear-notification-from-show-queue-if-.patch- Require kscreen5, kactivities5 and kio-extras5 instead of just recommending, they are essential enough that all users have it installed- Added patches from upstream: 0001-Disable-indeterminate-animation-for-suspended-jobs.patch, 0003-notifications-Replace-apos-with-as-apos-is-not-suppo.patch (kde#346710), 0004-Match-window-switch-dialog-borders-with-addwidgets-s.patch (kde#345614), 0005-Manually-keep-track-of-jobs-sources.patch (kde#346673), 0006-Fix-running-applet-calculation.patch, 0008-Only-restart-Timer-when-the-dialog-is-visible.patch, 0009-check-for-model-existence.patch (kde#346870), 0010-Fix-a-crash-in-PowermanagementEngine-populateApplica.patch, 0011-notifications-Always-check-first-if-the-dispatch-tim.patch and 0012-notifications-Clear-notification-from-show-queue-if-.patch (kde#342605)- Update to 5.3 Final: * For more details please see: https://www.kde.org/announcements/plasma-5.3.0.php - Drop 0001-delete-the-views-before-containments.patch, merged upstream - Only conflict with kdebase4-workspace < 5.3.0- Update to 5.2.95 aka 5.3 beta: * New feature release * For more details please see: https://www.kde.org/announcements/plasma-5.2.95.php - Update required Qt version to 5.4.0 - Update required KF5 version to 5.8.0 - Added kxmlrpcclient5-devel, libKF5NetworkManagerQt-devel and pkgconfig(xi) BuildRequires - Added 0001-delete-the-views-before-containments.patch from upstream, (kde#345758) - Drop patches merged upstream: 0001-Fix-one-pixel-gap-between-screenedge-and-right-place.patch and 0001-Workaround-the-lockscreen-password-field-focus-issue.patch- Added 0001-Fix-one-pixel-gap-between-screenedge-and-right-place.patch (kde#339323, kde#340549, boo#924074)- Add 0001-Workaround-the-lockscreen-password-field-focus-issue.patch (kde#344823)- Update to 5.2.2: * Bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.2.2.php - Drop patches merged upstream: 0001-digital-clock-Invert-the-JS-timezone-offset-values.patch, 0002-Set-aboutData-for-plasmashell.patch, 0005-lookandfeel-Make-sure-the-OSD-is-not-bigger-than-1-3.patch, 0006-Add-missing-import.patch, 0007-Don-t-set-mode-here-otherwise-default-will-not-work.patch, 0009-libtaskmanager-Use-the-icon-loaded-from-config-file-.patch, 0010-Take-Shown-and-Hidden-status-in-account-when-showing.patch, 0011-Fix-displaying-label1-in-job-notifications.patch and 0012-Show-pause-stop-buttons-in-jobs-notification-only-fo.patch- Add pkgconfig(libqalculate) BuildRequires- Add patches from upstream: 0001-digital-clock-Invert-the-JS-timezone-offset-values.patch, 0002-Set-aboutData-for-plasmashell.patch, 0005-lookandfeel-Make-sure-the-OSD-is-not-bigger-than-1-3.patch, 0006-Add-missing-import.patch, 0007-Don-t-set-mode-here-otherwise-default-will-not-work.patch (kde#344701), 0009-libtaskmanager-Use-the-icon-loaded-from-config-file-.patch, 0010-Take-Shown-and-Hidden-status-in-account-when-showing.patch (kde#344795), 0011-Fix-displaying-label1-in-job-notifications.patch and 0012-Show-pause-stop-buttons-in-jobs-notification-only-fo.patch- Update to 5.2.1: * Bugfix release * For more details please see: https://www.kde.org/announcements/plasma-5.2.1.php- Added kglobalaccel-devel BuildRequires - kglobalaccel5 daemon moved to kglobalaccel Framework- Update to 5.2 Final: * For more details please see: https://www.kde.org/announcements/plasma-5.2.0.php- Update to 5.2 Beta aka 5.1.95: * Undo changes to Plasma desktop layout * Smarter sorting of results in KRunner * Breeze window decoration theme adds a new look to your desktop and is now used by default * New white mouse cursor theme for Breeze. * New plasma widgets: 15 puzzle, web browser, show desktop * Over 300 bugs fixed throughout Plasma modules. * For more details please see: https://www.kde.org/announcements/plasma-5.1.95.php * Use the correct path for ksyncdbusenv, boo#912565 - Harden external libs requires for the libs subpackage - Use exact version for plasma5-workspace-libs Requires - Bump KF5 Requires to 5.6.0 - Bump (Build)Requires of other Plasma 5 components to same version - Add wayland-devel BuildRequires - Drop no longer relevant obsoletes - Require oxygen5-sounds, boo#912317 - Drop 0001-LocationRunner-Convert-case-insensitive-path-to-a-pr.patch and 0002-Baloo-Runner-Lower-relevance-because-krunner-does-no.patch, merged upstream- Update to 5.1.2: * Bugfix release * Make the OSD timeout shorter * Fix ui files * Fix lockscreen theme fallback * Add the next wallpaper action when necessary, kde#341089 * Revert i18n changes cherry-picked from master * Only play indeterminate animation when plasmoid is expanded * Refactor JobDelegate * Don't leave a gap when label1 is not visible * Don't emit a Job finished notification if the message would be empty * Finish cleanup and remove unused config.ui remnant * When no percentage is exposed over the dataengine make the progress bar indeterminate * Cleanup Jobs code and remove dead code * Alleviate the annoyance of Job Finished notifications, kde#340068 * Escape ampersands in notifications * Replace \n with * Fix dialog minimum height (always add the margins afterwards), kde#341218 * Also take the title label into account when calculating the dialog size * Enforce StyledText in notifications * Hide popup when opening configure dialog * Fix notification configure button * Fix binding loops and make popup even more compact * Cleanup Loaders * Cleanup Notifications code * Move duplicated code from NotificationDelegate and NotificationPopup into a new NotificationItem * Make sure lock screen package name does not overlap highlight rectangle * Actually save the kscreensaver config * fix resetting and reverting to default values * Fix qml warnings in splash kcm * Separator for Keywords is ; * Hopefully fix shell resizing in VirtualBox * Take into account the primary screen can be redundant * Delayed primaryOutput processing needs to be delayed * Also set minHeight in vertical panels. kde#340896 * Fix and future-proof security in Dr Konqi. kde#337742 * Fix hiding the SNI when avail space goes up again * Make the SNI just Active when free space raised * Find messages in QML as well * For more details please see: https://www.kde.org/announcements/plasma-5.1.2.php - Drop 0001-BUG-337742-REVIEW-120431.-Fix-and-future-proof-secur.patch, merged upstream- Added 0001-BUG-337742-REVIEW-120431.-Fix-and-future-proof-secur.patch from upstream (kde#337742)- Update to 5.1.1: * Bugfix release * Panel jumps around less when resizing/controlling (kde#339207, kde#337382) * Redeclare missing properties from Containment, kde#337743 * Make apply button work correctly, kde#339946 * Remove bypasswindowmanagerhint, kde#339848 * Signal availableScreenRectChanged on type change, kde#339412 * Create the corona on heap, kde#340191 * Remove shutdown option from screen locker, kde#339453 * Remove uneeded code to stop alt+f4 killing the window, kde#338360 * For more details please see: https://www.kde.org/announcements/plasma-5.1.1.php- Added 0001-LocationRunner-Convert-case-insensitive-path-to-a-pr.patch (kde#333395) and 0002-Baloo-Runner-Lower-relevance-because-krunner-does-no.patch, make sure that applications are shown as top results in krunner - Recommend lang subpackage - Relax dependancies to plasma-framework private parts, and fix a blip moment, typo in package name/bin/sh/bin/sh/bin/shkde-user-managerkde-user-manager-langplasma5-workspace-branding-upstreamplasma5-workspace-zsh-completioni01-armsrv1 1718269844  !"#$%&'()*+,-./0123456789:<=?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      "#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJBLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|v~vw     !"#$%&'()*+,-./0123456789:;<=>?@ABCDCFCHCJCLCNCPCRCTCVCXCZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"$%&'()*+,-./012345789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./012345&7'()*<,-./ABCDEFGHIJKLMNOPQ[^bcdefghijklmenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenenen5.27.9-bp155.2.9.15.27.95.27.9-bp155.2.9.15.27.9-bp155.2.9.15.27.45.27.95.27.9101000010000000000015.27.95.27.95.27.95.27.9        !"##"$$"%%"&''&())(*****+*(,,(--(..(//(00&122&34444444443555536676388399"::;;;;;;;;;;;;;;;;;;;<=========>>>>>>>?@ABBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBCDEFFFFFFFFFFFFFFEGHHGIIGJJJJJJGKKKKKKGLLLGMMMMGNNNNNNNGOOGPPPPPPGQQGRRESSSSTUVWXYYZ[[\]^_<````````<abcdeeeecfggggAhijk<lmllnoooppppppppppp<qrs<tuvwxuyz{u|}~~~uuuuuuuuuu<<<A                    !"#$#%%"!&'('))))))****&!+,-,.......////+0111111<2344444455555555556657774484449:;<=klipper.desktoporg.kde.plasmashell.desktopxprop-kde-full-session.desktopplasmanotifyrctaskmanagerrulesrckcminitkcminit_startupkcolorschemeeditorkde-systemd-start-conditionkfontinstkfontviewklipperkrunnerksmserverksplashqmllookandfeeltoolplasma-apply-colorschemeplasma-apply-cursorthemeplasma-apply-desktopthemeplasma-apply-lookandfeelplasma-apply-wallpaperimageplasma-interactiveconsoleplasma-shutdownplasma_sessionplasma_waitfornameplasmashellplasmawindowedstartplasma-waylandstartplasma-x11systemmonitorbaloorunnerkauthfontinstfontinst_helperfontinst_x11kfontprintksmserver-logout-greeterplasma-changeiconsplasma-dbus-run-session-if-neededplasma-sourceenv.shplasma-baloorunner.serviceplasma-core.targetplasma-gmenudbusmenuproxy.serviceplasma-kcminit-phase1.serviceplasma-kcminit.serviceplasma-krunner.serviceplasma-ksmserver.serviceplasma-ksplash-ready.serviceplasma-ksplash.serviceplasma-plasmashell.serviceplasma-restoresession.serviceplasma-workspace-wayland.targetplasma-workspace-x11.targetplasma-workspace.targetplasma-xembedsniproxy.servicekrunnerglobalshortcutskrunnerhistoryplasmashell-5.27-use-panel-thickness-in-default-grouplibkfontinst.so.5libkfontinst.so.5.27.9libkfontinstui.so.5libkfontinstui.so.5.27.9pluginskf5kdedappmenu.socolorcorrectlocationupdater.sodesktopnotifier.sofreespacenotifier.soksysguard.soktimezoned.soplasma_accentcolor_service.sosoliduiserver.sostatusnotifierwatcher.sokioapplications.sodesktop.sokio_fonts.sokrunnercalculator.sohelprunner.sokcmskcm_krunner_kill.sokrunner_appstream.sokrunner_bookmarksrunner.sokrunner_kill.sokrunner_placesrunner.sokrunner_powerdevil.sokrunner_recentdocuments.sokrunner_services.sokrunner_sessions.sokrunner_shell.sokrunner_webshortcuts.sokrunner_windowedwidgets.solocations.sopartskfontviewpart.sothumbcreatorfontthumbnail.sokpackagepackagestructureplasma_layouttemplate.soplasma_lookandfeel.soplasma_shell.soplasma_wallpaper.sowallpaper_images.sophonon_platformkde.soplasmaappletsorg.kde.plasma.appmenu.soorg.kde.plasma.calendar.soorg.kde.plasma.icon.soorg.kde.plasma.notifications.soorg.kde.plasma.panelspacer.soorg.kde.plasma.private.systemtray.soorg.kde.plasma.systemmonitor.soorg.kde.plasma.systemtray.socontainmentactionsplasma_containmentactions_applauncher.soplasma_containmentactions_contextmenu.soplasma_containmentactions_paste.soplasma_containmentactions_switchactivity.soplasma_containmentactions_switchdesktop.soplasma_containmentactions_switchwindow.sodataengineion_bbcukmet.soion_dwd.soion_envcan.soion_noaa.soion_wettercom.soplasma_engine_activities.soplasma_engine_applicationjobs.soplasma_engine_apps.soplasma_engine_clipboard.soplasma_engine_devicenotifications.soplasma_engine_dict.soplasma_engine_executable.soplasma_engine_favicons.soplasma_engine_filebrowser.soplasma_engine_geolocation.soplasma_engine_hotplug.soplasma_engine_keystate.soplasma_engine_mouse.soplasma_engine_mpris2.soplasma_engine_notifications.soplasma_engine_packagekit.soplasma_engine_places.soplasma_engine_powermanagement.soplasma_engine_soliddevice.soplasma_engine_statusnotifieritem.soplasma_engine_systemmonitor.soplasma_engine_time.soplasma_engine_weather.sogeolocationproviderplasma-geolocation-gps.soplasma-geolocation-ip.sokcminitkcm_fonts_init.sokcm_style_init.sokcmssystemsettingskcm_autostart.sokcm_colors.sokcm_cursortheme.sokcm_desktoptheme.sokcm_feedback.sokcm_fonts.sokcm_icons.sokcm_lookandfeel.sokcm_nightcolor.sokcm_notifications.sokcm_regionandlang.sokcm_style.sokcm_users.sosystemsettings_qwidgetskcm_fontinst.soplasmacalendarpluginsholidaysHolidaysConfig.qmlholidaysevents.soqmlorgkdecolorcorrectlibcolorcorrectplugin.soqmldirholidayeventshelperpluginlibholidayeventshelperplugin.soqmldirnotificationmanagerlibnotificationmanagerplugin.soqmldirplasmalookandfeelliblookandfeelqmlplugin.soqmldirprivateappmenulibappmenuplugin.soqmldircontainmentlayoutmanagerBasicAppletContainer.qmlConfigOverlayWithHandles.qmlPlaceHolder.qmllibcontainmentlayoutmanagerplugin.soprivateBasicResizeHandle.qmlqmldirdigitalclocklibdigitalclockplugin.soqmldirkickerlibkickerplugin.soqmldirmediacontrollerlibmediacontrollerplugin.soqmldirsessionslibsessionsprivateplugin.soqmldirshelllibplasmashellprivateplugin.soqmldirwallpapersimagelibplasma_wallpaper_imageplugin.soqmldirworkspacecalendarCalendarToolbar.qmlDayDelegate.qmlDaysCalendar.qmlInfiniteList.qmlMonthMenu.qmlMonthView.qmlMonthViewHeader.qmllibcalendarplugin.soqmldircomponentsBadgeOverlay.qmlBatteryIcon.qmlKeyboardLayoutSwitcher.qmlqmldirdialogsSystemDialog.qmlexamplestest.qmlqmldirkeyboardlayoutlibkeyboardlayoutplugin.soqmldirtrianglemousefilterlibtrianglemousefilterplugin.soqmldirtaskmanagerlibtaskmanagerplugin.soqmldirkcm_autostart.desktopkcm_colors.desktopkcm_cursortheme.desktopkcm_feedback.desktopkcm_fontinst.desktopkcm_fonts.desktopkcm_icons.desktopkcm_lookandfeel.desktopkcm_nightcolor.desktopkcm_notifications.desktopkcm_regionandlang.desktopkcm_style.desktopkcm_users.desktoporg.kde.kcolorschemeeditor.desktoporg.kde.kfontview.desktoporg.kde.klipper.desktoporg.kde.plasmashell.desktoporg.kde.plasmawindowed.desktoporg.kde.systemmonitor.desktopconfig.kcfgcolorssettings.kcfgcursorthemesettings.kcfgfeedbacksettings.kcfgfontssettings.kcfgfreespacenotifier.kcfgiconssettingsbase.kcfglaunchfeedbacksettings.kcfglookandfeelsettings.kcfgstylesettings.kcfgorg.kde.KSplash.serviceorg.kde.LogoutPrompt.serviceorg.kde.Shutdown.serviceorg.kde.fontinst.serviceorg.kde.krunner.serviceorg.kde.plasma.Notifications.serviceorg.kde.runners.baloo.serviceorg.kde.fontinst.serviceorg.kde.fontinst.confdesktop-directorieskf5-development-translation.directorykf5-development-webdevelopment.directorykf5-development.directorykf5-editors.directorykf5-edu-languages.directorykf5-edu-mathematics.directorykf5-edu-miscellaneous.directorykf5-edu-science.directorykf5-edu-tools.directorykf5-education.directorykf5-games-arcade.directorykf5-games-board.directorykf5-games-card.directorykf5-games-kids.directorykf5-games-logic.directorykf5-games-roguelikes.directorykf5-games-strategy.directorykf5-games.directorykf5-graphics.directorykf5-internet-terminal.directorykf5-internet.directorykf5-main.directorykf5-more.directorykf5-multimedia.directorykf5-network.directorykf5-office.directorykf5-science.directorykf5-settingsmenu.directorykf5-system-terminal.directorykf5-system.directorykf5-toys.directorykf5-unknown.directorykf5-utilities-accessibility.directorykf5-utilities-desktop.directorykf5-utilities-file.directorykf5-utilities-peripherals.directorykf5-utilities-pim.directorykf5-utilities-xutils.directorykf5-utilities.directoryHTMLenPolicyKit-kdeauthdialog_1.pngauthdialog_2.pngauthdialog_3.pngauthdialog_4.pngauthdialog_5.pngauthdialog_6.pngauthorization.docbookauthorization_1.pngauthorization_2.pngauthorizationagent.docbookhowitworks.docbookindex.cache.bz2index.docbookintroduction.docbookkcontrolautostartindex.cache.bz2index.docbookcolorsindex.cache.bz2index.docbookcursorthemecursor-size.pngget-new-stuff.pngindex.cache.bz2index.docbooklaunch-feedback.pngmain.pngdesktopthemedetailsedit-delete.pngedit-undo.pngget-new-theme.pngindex.cache.bz2index.docbookmain.pngfontinstedit-delete.pngindex.cache.bz2index.docbookfontsadjust-all.pngindex.cache.bz2index.docbookmain.pngiconsedit-delete.pngedit-undo.pngget-new-theme.pngindex.cache.bz2index.docbookmain.pnguse-of-icons.pngkcmstyleindex.cache.bz2index.docbooklookandfeelcomponent-chooser_1.pngcomponent-chooser_2.pngget-new-stuff.pngindex.cache.bz2index.docbookmain.pngnotificationsindex.cache.bz2index.docbookscreenlockerindex.cache.bz2index.docbookklipperindex.cache.bz2index.docbookklipper-widget.pngscreenshot.pngfonts-package.pngkfontview.pngfonts-package.pngkfontview.pngfonts-package.pngkfontview.pngpreferences-desktop-color.svgfonts-package.pngkfontview.pngklipper.svgfonts-package.pngkfontview.pngfonts-package.pngpreferences-desktop-font-installer.svgzkconf_updatedelete_cursor_old_default_size.pldelete_cursor_old_default_size.updicons_remove_effects.updkrunnerglobalshortcuts2.updkrunnerhistory.updplasmashell-5.27-use-panel-thickness-in-default-group.updstyle_widgetstyle_default_breeze.plstyle_widgetstyle_default_breeze.updkfontinsticonshicolor16x16actionsaddfont.pngfont-disable.pngfont-enable.pngfontstatus.png22x22actionsaddfont.pngfont-disable.pngfont-enable.pngfontstatus.pngkglobalaccelorg.kde.krunner.desktopkioservicemenussetaswallpaper.desktopkio_desktopDesktopLinksHome.desktopdirectory.desktopdirectory.trashknotifications5devicenotifications.notifyrcfreespacenotifier.notifyrcphonon.notifyrccolorschemes.knsrcgtk_themes.knsrcicons.knsrckfontinst.knsrclookandfeel.knsrcplasma-themes.knsrcplasmoids.knsrcwallpaper-mobile.knsrcwallpaper.knsrcwallpaperplugin.knsrcxcursor.knsrckonqsidebartngvirtual_foldersservicesfonts.desktopkpackagekcmskcm_autostartcontentsuimain.qmlkcm_colorscontentsuimain.qmlkcm_cursorthemecontentsuiDelegate.qmlLaunchFeedbackDialog.qmlmain.qmlkcm_desktopthemecontentsuiHand.qmlThemePreview.qmlmain.qmlkcm_feedbackcontentsuimain.qmlkcm_fontscontentsuiFontWidget.qmlmain.qmlkcm_iconscontentsuiIconSizePopup.qmlmain.qmlkcm_lookandfeelcontentsuiMoreOptions.qmlSimpleOptions.qmlmain.qmlkcm_nightcolorcontentsuiLocationsFixedView.qmlNumberField.qmlTimeField.qmlTimingsView.qmlmain.qmlkcm_notificationscontentsuiApplicationConfiguration.qmlPopupPositionPage.qmlScreenPositionSelector.qmlSourcesPage.qmlmain.qmlkcm_regionandlangcontentsuiAdvancedLanguageSelectPage.qmlmain.qmlkcm_stylecontentsuiEffectSettingsPopup.qmlGtkStylePage.qmlmain.qmlkcm_userscontentsuiChangePassword.qmlChangeWalletPassword.qmlCreateUser.qmlDebouncer.qmlFingerprintDialog.qmlFingerprintProgressCircle.qmlPicturesSheet.qmlUserDetailsPage.qmlhand-imagesbase.svgbase.svg.licenseleft-index-finger.svgleft-index-finger.svg.licenseleft-little-finger.svgleft-little-finger.svg.licenseleft-middle-finger.svgleft-middle-finger.svg.licenseleft-ring-finger.svgleft-ring-finger.svg.licenseleft-thumb.svgleft-thumb.svg.licensepalm.svgpalm.svg.licenseright-index-finger.svgright-index-finger.svg.licenseright-little-finger.svgright-little-finger.svg.licenseright-middle-finger.svgright-middle-finger.svg.licenseright-ring-finger.svgright-ring-finger.svg.licenseright-thumb.svgright-thumb.svg.licensemain.qmlkrunnerdbuspluginsplasma-runner-baloosearch.desktopkservices5ServiceMenusinstallfont.desktopkservicetypes5plasma-layouttemplate.desktopkstylethemesqtcde.themercqtcleanlooks.themercqtgtk.themercqtmotif.themercqtplastique.themercqtwindows.themerckxmlgui5kfontviewkfontviewpart.rckfontviewui.rcplasma5-workspaceBSD-2-Clause.txtBSD-3-Clause.txtCC0-1.0.txtGPL-2.0-only.txtGPL-2.0-or-later.txtGPL-3.0-only.txtLGPL-2.0-only.txtLGPL-2.0-or-later.txtLGPL-2.1-only.txtLGPL-2.1-or-later.txtLGPL-3.0-only.txtLGPL-3.0-or-later.txtLicenseRef-KDE-Accepted-GPL.txtLicenseRef-KDE-Accepted-LGPL.txtMIT.txtmetainfoorg.kde.breeze.desktop.appdata.xmlorg.kde.breezedark.desktop.appdata.xmlorg.kde.breezetwilight.desktop.appdata.xmlorg.kde.color.appdata.xmlorg.kde.image.appdata.xmlorg.kde.plasma.activitybar.appdata.xmlorg.kde.plasma.analogclock.appdata.xmlorg.kde.plasma.appmenu.appdata.xmlorg.kde.plasma.battery.appdata.xmlorg.kde.plasma.calendar.appdata.xmlorg.kde.plasma.clipboard.appdata.xmlorg.kde.plasma.devicenotifier.appdata.xmlorg.kde.plasma.digitalclock.appdata.xmlorg.kde.plasma.lock_logout.appdata.xmlorg.kde.plasma.manage-inputmethod.appdata.xmlorg.kde.plasma.mediacontroller.appdata.xmlorg.kde.plasma.notifications.appdata.xmlorg.kde.plasma.systemmonitor.appdata.xmlorg.kde.plasma.systemmonitor.cpu.appdata.xmlorg.kde.plasma.systemmonitor.cpucore.appdata.xmlorg.kde.plasma.systemmonitor.diskactivity.appdata.xmlorg.kde.plasma.systemmonitor.diskusage.appdata.xmlorg.kde.plasma.systemmonitor.memory.appdata.xmlorg.kde.plasma.systemmonitor.net.appdata.xmlorg.kde.plasma.systemtray.appdata.xmlorg.kde.slideshow.appdata.xmlplasmaavatarsArtist Konqi.pngBookworm Konqi.pngBoss Konqi.pngBug Catcher Konqi.pngCard Shark Konqi.pngHacker Konqi.pngJournalist Konqi.pngKatie.pngKonqi.pngMechanic Konqi.pngMessenger Konqi.pngMusician Konqi.pngOffice Worker Konqi.pngPC Builder Konqi.pngScientist Konqi.pngTeacher Konqi.pngVirtual Reality Konqi.pngphotosAir Balloon.pngAir Balloon.png.licenseAstronaut.pngAstronaut.png.licenseBooks.pngBooks.png.licenseBrushes.pngBrushes.png.licenseBulb.pngBulb.png.licenseCar.pngCar.png.licenseCat.pngCat.png.licenseChameleon.pngChameleon.png.licenseCocktail.pngCocktail.png.licenseDog.pngDog.png.licenseFish.pngFish.png.licenseGamepad.pngGamepad.png.licenseOwl.pngOwl.png.licensePancakes.pngPancakes.png.licenseParrot.pngParrot.png.licensePencils.pngPencils.png.licenseShuttle.pngShuttle.png.licenseSoccer.pngSoccer.png.licenseSunflower.pngSunflower.png.licenseSushi.pngSushi.png.licenselook-and-feelorg.kde.breeze.desktopcontentscomponentsActionButton.qmlBattery.qmlClock.qmlSessionManagementScreen.qmlUserDelegate.qmlUserList.qmlVirtualKeyboard.qmlVirtualKeyboard_wayland.qmlWallpaperFader.qmlanimationRejectPasswordAnimation.qmlRejectPasswordPathAnimation.qmlartworkREADME.txtlogout_primary.svgzrestart_primary.svgzshutdown_primary.svgzdefaultsdesktopswitcherDesktopSwitcher.qmllayoutsorg.kde.plasma.desktop-layout.jslockscreenLockOsd.qmlLockScreen.qmlLockScreenUi.qmlMainBlock.qmlMediaControls.qmlNoPasswordUnlock.qmlconfig.qmlconfig.xmllogoutLogout.qmlLogoutButton.qmltimer.jsosdOsd.qmlOsdItem.qmlpreviewsdesktopswitcher.pngfullscreenpreview.jpglockscreen.pngloginmanager.pngpreview.pngruncommand.pngsplash.pnguserswitcher.pngwindowdecoration.pngwindowswitcher.pngsplashSplash.qmlimagesbusywidget.svgzkde.svgzplasma.svgzsystemdialogSystemDialog.qmlwindowswitcherWindowSwitcher.qmlmetadata.jsonorg.kde.breezedark.desktopcontentsdefaultslayoutsorg.kde.plasma.desktop-layout.jspreviewsfullscreenpreview.jpgpreview.pngmetadata.jsonorg.kde.breezetwilight.desktopcontentsdefaultslayoutsorg.kde.plasma.desktop-layout.jspreviewsfullscreenpreview.jpgpreview.pngmetadata.jsonnightcolorworldmap.pngplasmoidsorg.kde.plasma.activitybarcontentsuimain.qmlmetadata.jsonorg.kde.plasma.analogclockcontentsconfigconfig.qmlmain.xmluiHand.qmlanalogclock.qmlconfigGeneral.qmlmetadata.jsonorg.kde.plasma.appmenucontentsconfigconfig.qmlmain.xmluiMenuDelegate.qmlconfigGeneral.qmlmain.qmlmetadata.jsonorg.kde.plasma.batterycontentsconfigmain.xmluiBatteryItem.qmlBrightnessItem.qmlCompactRepresentation.qmlInhibitionHint.qmlPopupDialog.qmlPowerManagementItem.qmlPowerProfileItem.qmllogic.jsmain.qmlmetadata.jsonorg.kde.plasma.calendarcontentsconfigconfig.qmlmain.xmlimagesmini-calendar.svgzuiconfigGeneral.qmlmain.qmlmetadata.jsonorg.kde.plasma.clipboardcontentsconfigmain.xmluiBarcodePage.qmlClipboardItemDelegate.qmlClipboardPage.qmlDelegateToolButtons.qmlEditPage.qmlImageItemDelegate.qmlMenu.qmlTextItemDelegate.qmlUrlItemDelegate.qmlclipboard.qmlmetadata.jsonorg.kde.plasma.devicenotifiercontentsconfigmain.xmluiDeviceItem.qmlFullRepresentation.qmlmain.qmlmetadata.jsonorg.kde.plasma.digitalclockcontentsconfigconfig.qmlmain.xmluiCalendarView.qmlDigitalClock.qmlMonthMenu.qmlTooltip.qmlconfigAppearance.qmlconfigCalendar.qmlconfigTimeZones.qmlmain.qmlmetadata.jsonorg.kde.plasma.iconcontentsconfigmain.xmluimain.qmlmetadata.jsonorg.kde.plasma.lock_logoutcontentsconfigconfig.qmlmain.xmluiConfigGeneral.qmldata.jslockout.qmlmetadata.jsonorg.kde.plasma.manage-inputmethodcontentsuimanage-inputmethod.qmlmetadata.jsonorg.kde.plasma.mediacontrollercontentsuiAlbumArtStackView.qmlCompactRepresentation.qmlExpandedRepresentation.qmlmain.qmlmetadata.jsonorg.kde.plasma.notificationscontentsuiCompactRepresentation.qmlDraggableDelegate.qmlDraggableFileArea.qmlEditContextMenu.qmlFullRepresentation.qmlJobDetails.qmlJobItem.qmlNotificationHeader.qmlNotificationItem.qmlNotificationPopup.qmlNotificationReplyField.qmlSelectableLabel.qmlThumbnailStrip.qmlglobalGlobals.qmlPulseAudio.qmlqmldirmain.qmlmetadata.jsonorg.kde.plasma.panelspacercontentsconfigmain.xmluimain.qmlmetadata.jsonorg.kde.plasma.private.systemtraycontentsappletCompactApplet.qmlconfigconfig.qmlmain.xmluiConfigEntries.qmlConfigGeneral.qmlCurrentItemHighLight.qmlExpandedRepresentation.qmlExpanderArrow.qmlHiddenItemsView.qmlPlasmoidPopupsContainer.qmlSystemTrayState.qmlitemsAbstractItem.qmlItemLoader.qmlPlasmoidItem.qmlPulseAnimation.qmlStatusNotifierItem.qmlmain.qmlmetadata.jsonorg.kde.plasma.systemmonitororg.kde.plasma.systemmonitor.cpucontentsconfigfacepropertiesmetadata.jsonorg.kde.plasma.systemmonitor.cpucorecontentsconfigfacepropertiesmetadata.jsonorg.kde.plasma.systemmonitor.diskactivitycontentsconfigfacepropertiesmetadata.jsonorg.kde.plasma.systemmonitor.diskusagecontentsconfigfacepropertiesmetadata.jsonorg.kde.plasma.systemmonitor.memorycontentsconfigfacepropertiesmetadata.jsonorg.kde.plasma.systemmonitor.netcontentsconfigfacepropertiesmetadata.jsoncontentsconfigconfig.qmlmain.xmluiCompactRepresentation.qmlFullRepresentation.qmlconfigConfigAppearance.qmlConfigSensors.qmlFaceDetails.qmlmain.qmlmetadata.jsonorg.kde.plasma.systemtraycontentsuimain.qmlmetadata.jsonservicesactivities.operationsapplicationjobs.operationsapps.operationshotplug.operationsmodifierkeystate.operationsmpris2.operationsnotifications.operationsorg.kde.places.operationsorg.kde.plasma.clipboard.operationspackagekit.operationspowermanagementservice.operationssoliddevice.operationsstatusnotifieritem.operationswallpapersorg.kde.colorcontentsconfigmain.xmluiconfig.qmlmain.qmlmetadata.jsonorg.kde.imagecontentsconfigmain.xmluiImageStackView.qmlThumbnailsComponent.qmlWallpaperDelegate.qmlconfig.qmlmain.qmlmediacomponentAnimatedImageComponent.qmlBaseMediaComponent.qmlBlurComponent.qmlStaticImageComponent.qmlmetadata.jsonorg.kde.slideshowcontentsconfigmain.xmluiImageStackView.qmlSlideshowComponent.qmlThumbnailsComponent.qmlWallpaperDelegate.qmlconfig.qmlmain.qmlmediacomponentAnimatedImageComponent.qmlBaseMediaComponent.qmlBlurComponent.qmlStaticImageComponent.qmlmetadata.jsonorg.kde.fontinst.policykcm_regionandlang.categorieskcmusers.categoriesklipper.categorieslibnotificationmanager.categoriesmyproject.categoriesplasma-workspace.categoriessddmthemesbreezeBackground.qmlKeyboardButton.qmlLogin.qmlMain.qmlSessionButton.qmlcomponentsActionButton.qmlBattery.qmlClock.qmlSessionManagementScreen.qmlUserDelegate.qmlUserList.qmlVirtualKeyboard.qmlVirtualKeyboard_wayland.qmlWallpaperFader.qmlanimationRejectPasswordAnimation.qmlRejectPasswordPathAnimation.qmlartworklogout_primary.svgzrestart_primary.svgzshutdown_primary.svgzdefault-logo.svgfaces.face.iconmetadata.desktoppreview.pngtheme.confsolidactionstest-predicate-openinwindow.desktopzshsite-functions_plasmashell/etc/xdg/autostart//etc/xdg//usr/bin//usr/lib//usr/lib/kauth//usr/lib/systemd/user//usr/lib64/kconf_update_bin//usr/lib64//usr/lib64//usr/lib64/qt5//usr/lib64/qt5/plugins//usr/lib64/qt5/plugins/kf5//usr/lib64/qt5/plugins/kf5/kded//usr/lib64/qt5/plugins/kf5/kio//usr/lib64/qt5/plugins/kf5/krunner//usr/lib64/qt5/plugins/kf5/krunner/kcms//usr/lib64/qt5/plugins/kf5/parts//usr/lib64/qt5/plugins/kf5/thumbcreator//usr/lib64/qt5/plugins/kpackage//usr/lib64/qt5/plugins/kpackage/packagestructure//usr/lib64/qt5/plugins/phonon_platform//usr/lib64/qt5/plugins/plasma//usr/lib64/qt5/plugins/plasma/applets//usr/lib64/qt5/plugins/plasma/containmentactions//usr/lib64/qt5/plugins/plasma/dataengine//usr/lib64/qt5/plugins/plasma/geolocationprovider//usr/lib64/qt5/plugins/plasma/kcminit//usr/lib64/qt5/plugins/plasma/kcms//usr/lib64/qt5/plugins/plasma/kcms/systemsettings//usr/lib64/qt5/plugins/plasma/kcms/systemsettings_qwidgets//usr/lib64/qt5/plugins/plasmacalendarplugins//usr/lib64/qt5/plugins/plasmacalendarplugins/holidays//usr/lib64/qt5/qml//usr/lib64/qt5/qml/org//usr/lib64/qt5/qml/org/kde//usr/lib64/qt5/qml/org/kde/colorcorrect//usr/lib64/qt5/qml/org/kde/holidayeventshelperplugin//usr/lib64/qt5/qml/org/kde/notificationmanager//usr/lib64/qt5/qml/org/kde/plasma//usr/lib64/qt5/qml/org/kde/plasma/lookandfeel//usr/lib64/qt5/qml/org/kde/plasma/private//usr/lib64/qt5/qml/org/kde/plasma/private/appmenu//usr/lib64/qt5/qml/org/kde/plasma/private/containmentlayoutmanager//usr/lib64/qt5/qml/org/kde/plasma/private/containmentlayoutmanager/private//usr/lib64/qt5/qml/org/kde/plasma/private/digitalclock//usr/lib64/qt5/qml/org/kde/plasma/private/kicker//usr/lib64/qt5/qml/org/kde/plasma/private/mediacontroller//usr/lib64/qt5/qml/org/kde/plasma/private/sessions//usr/lib64/qt5/qml/org/kde/plasma/private/shell//usr/lib64/qt5/qml/org/kde/plasma/wallpapers//usr/lib64/qt5/qml/org/kde/plasma/wallpapers/image//usr/lib64/qt5/qml/org/kde/plasma/workspace//usr/lib64/qt5/qml/org/kde/plasma/workspace/calendar//usr/lib64/qt5/qml/org/kde/plasma/workspace/components//usr/lib64/qt5/qml/org/kde/plasma/workspace/dialogs//usr/lib64/qt5/qml/org/kde/plasma/workspace/dialogs/examples//usr/lib64/qt5/qml/org/kde/plasma/workspace/keyboardlayout//usr/lib64/qt5/qml/org/kde/plasma/workspace/trianglemousefilter//usr/lib64/qt5/qml/org/kde/taskmanager//usr/share/applications//usr/share//usr/share/config.kcfg//usr/share/dbus-1/services//usr/share/dbus-1/system-services//usr/share/dbus-1/system.d//usr/share//usr/share/desktop-directories//usr/share/doc//usr/share/doc/HTML//usr/share/doc/HTML/en//usr/share/doc/HTML/en/PolicyKit-kde//usr/share/doc/HTML/en/kcontrol//usr/share/doc/HTML/en/kcontrol/autostart//usr/share/doc/HTML/en/kcontrol/colors//usr/share/doc/HTML/en/kcontrol/cursortheme//usr/share/doc/HTML/en/kcontrol/desktopthemedetails//usr/share/doc/HTML/en/kcontrol/fontinst//usr/share/doc/HTML/en/kcontrol/fonts//usr/share/doc/HTML/en/kcontrol/icons//usr/share/doc/HTML/en/kcontrol/kcmstyle//usr/share/doc/HTML/en/kcontrol/lookandfeel//usr/share/doc/HTML/en/kcontrol/notifications//usr/share/doc/HTML/en/kcontrol/screenlocker//usr/share/doc/HTML/en/klipper//usr/share/icons/hicolor/128x128/mimetypes//usr/share/icons/hicolor/16x16/apps//usr/share/icons/hicolor/16x16/mimetypes//usr/share/icons/hicolor/22x22/apps//usr/share/icons/hicolor/22x22/mimetypes//usr/share/icons/hicolor/32x32/apps//usr/share/icons/hicolor/32x32/mimetypes//usr/share/icons/hicolor/48x48/apps//usr/share/icons/hicolor/48x48/mimetypes//usr/share/icons/hicolor/64x64/apps//usr/share/icons/hicolor/64x64/mimetypes//usr/share/icons/hicolor/scalable/apps//usr/share/kconf_update//usr/share/kfontinst//usr/share/kfontinst/icons//usr/share/kfontinst/icons/hicolor//usr/share/kfontinst/icons/hicolor/16x16//usr/share/kfontinst/icons/hicolor/16x16/actions//usr/share/kfontinst/icons/hicolor/22x22//usr/share/kfontinst/icons/hicolor/22x22/actions//usr/share/kglobalaccel//usr/share//usr/share/kio//usr/share/kio/servicemenus//usr/share/kio_desktop//usr/share/kio_desktop/DesktopLinks//usr/share//usr/share/knotifications5//usr/share/knsrcfiles//usr/share/konqsidebartng//usr/share/konqsidebartng/virtual_folders//usr/share/konqsidebartng/virtual_folders/services//usr/share/kpackage//usr/share/kpackage/kcms//usr/share/kpackage/kcms/kcm_autostart//usr/share/kpackage/kcms/kcm_autostart/contents//usr/share/kpackage/kcms/kcm_autostart/contents/ui//usr/share/kpackage/kcms/kcm_colors//usr/share/kpackage/kcms/kcm_colors/contents//usr/share/kpackage/kcms/kcm_colors/contents/ui//usr/share/kpackage/kcms/kcm_cursortheme//usr/share/kpackage/kcms/kcm_cursortheme/contents//usr/share/kpackage/kcms/kcm_cursortheme/contents/ui//usr/share/kpackage/kcms/kcm_desktoptheme//usr/share/kpackage/kcms/kcm_desktoptheme/contents//usr/share/kpackage/kcms/kcm_desktoptheme/contents/ui//usr/share/kpackage/kcms/kcm_feedback//usr/share/kpackage/kcms/kcm_feedback/contents//usr/share/kpackage/kcms/kcm_feedback/contents/ui//usr/share/kpackage/kcms/kcm_fonts//usr/share/kpackage/kcms/kcm_fonts/contents//usr/share/kpackage/kcms/kcm_fonts/contents/ui//usr/share/kpackage/kcms/kcm_icons//usr/share/kpackage/kcms/kcm_icons/contents//usr/share/kpackage/kcms/kcm_icons/contents/ui//usr/share/kpackage/kcms/kcm_lookandfeel//usr/share/kpackage/kcms/kcm_lookandfeel/contents//usr/share/kpackage/kcms/kcm_lookandfeel/contents/ui//usr/share/kpackage/kcms/kcm_nightcolor//usr/share/kpackage/kcms/kcm_nightcolor/contents//usr/share/kpackage/kcms/kcm_nightcolor/contents/ui//usr/share/kpackage/kcms/kcm_notifications//usr/share/kpackage/kcms/kcm_notifications/contents//usr/share/kpackage/kcms/kcm_notifications/contents/ui//usr/share/kpackage/kcms/kcm_regionandlang//usr/share/kpackage/kcms/kcm_regionandlang/contents//usr/share/kpackage/kcms/kcm_regionandlang/contents/ui//usr/share/kpackage/kcms/kcm_style//usr/share/kpackage/kcms/kcm_style/contents//usr/share/kpackage/kcms/kcm_style/contents/ui//usr/share/kpackage/kcms/kcm_users//usr/share/kpackage/kcms/kcm_users/contents//usr/share/kpackage/kcms/kcm_users/contents/ui//usr/share/kpackage/kcms/kcm_users/contents/ui/hand-images//usr/share//usr/share/krunner//usr/share/krunner/dbusplugins//usr/share/kservices5//usr/share/kservices5/ServiceMenus//usr/share//usr/share/kservicetypes5//usr/share/kstyle//usr/share/kstyle/themes//usr/share/kxmlgui5//usr/share/kxmlgui5/kfontview//usr/share/licenses//usr/share/licenses/plasma5-workspace//usr/share//usr/share/metainfo//usr/share/plasma//usr/share/plasma/avatars//usr/share/plasma/avatars/photos//usr/share/plasma/look-and-feel//usr/share/plasma/look-and-feel/org.kde.breeze.desktop//usr/share/plasma/look-and-feel/org.kde.breeze.desktop/contents//usr/share/plasma/look-and-feel/org.kde.breeze.desktop/contents/components//usr/share/plasma/look-and-feel/org.kde.breeze.desktop/contents/components/animation//usr/share/plasma/look-and-feel/org.kde.breeze.desktop/contents/components/artwork//usr/share/plasma/look-and-feel/org.kde.breeze.desktop/contents/desktopswitcher//usr/share/plasma/look-and-feel/org.kde.breeze.desktop/contents/layouts//usr/share/plasma/look-and-feel/org.kde.breeze.desktop/contents/lockscreen//usr/share/plasma/look-and-feel/org.kde.breeze.desktop/contents/logout//usr/share/plasma/look-and-feel/org.kde.breeze.desktop/contents/osd//usr/share/plasma/look-and-feel/org.kde.breeze.desktop/contents/previews//usr/share/plasma/look-and-feel/org.kde.breeze.desktop/contents/splash//usr/share/plasma/look-and-feel/org.kde.breeze.desktop/contents/splash/images//usr/share/plasma/look-and-feel/org.kde.breeze.desktop/contents/systemdialog//usr/share/plasma/look-and-feel/org.kde.breeze.desktop/contents/windowswitcher//usr/share/plasma/look-and-feel/org.kde.breezedark.desktop//usr/share/plasma/look-and-feel/org.kde.breezedark.desktop/contents//usr/share/plasma/look-and-feel/org.kde.breezedark.desktop/contents/layouts//usr/share/plasma/look-and-feel/org.kde.breezedark.desktop/contents/previews//usr/share/plasma/look-and-feel/org.kde.breezetwilight.desktop//usr/share/plasma/look-and-feel/org.kde.breezetwilight.desktop/contents//usr/share/plasma/look-and-feel/org.kde.breezetwilight.desktop/contents/layouts//usr/share/plasma/look-and-feel/org.kde.breezetwilight.desktop/contents/previews//usr/share/plasma/nightcolor//usr/share/plasma/plasmoids//usr/share/plasma/plasmoids/org.kde.plasma.activitybar//usr/share/plasma/plasmoids/org.kde.plasma.activitybar/contents//usr/share/plasma/plasmoids/org.kde.plasma.activitybar/contents/ui//usr/share/plasma/plasmoids/org.kde.plasma.analogclock//usr/share/plasma/plasmoids/org.kde.plasma.analogclock/contents//usr/share/plasma/plasmoids/org.kde.plasma.analogclock/contents/config//usr/share/plasma/plasmoids/org.kde.plasma.analogclock/contents/ui//usr/share/plasma/plasmoids/org.kde.plasma.appmenu//usr/share/plasma/plasmoids/org.kde.plasma.appmenu/contents//usr/share/plasma/plasmoids/org.kde.plasma.appmenu/contents/config//usr/share/plasma/plasmoids/org.kde.plasma.appmenu/contents/ui//usr/share/plasma/plasmoids/org.kde.plasma.battery//usr/share/plasma/plasmoids/org.kde.plasma.battery/contents//usr/share/plasma/plasmoids/org.kde.plasma.battery/contents/config//usr/share/plasma/plasmoids/org.kde.plasma.battery/contents/ui//usr/share/plasma/plasmoids/org.kde.plasma.calendar//usr/share/plasma/plasmoids/org.kde.plasma.calendar/contents//usr/share/plasma/plasmoids/org.kde.plasma.calendar/contents/config//usr/share/plasma/plasmoids/org.kde.plasma.calendar/contents/images//usr/share/plasma/plasmoids/org.kde.plasma.calendar/contents/ui//usr/share/plasma/plasmoids/org.kde.plasma.clipboard//usr/share/plasma/plasmoids/org.kde.plasma.clipboard/contents//usr/share/plasma/plasmoids/org.kde.plasma.clipboard/contents/config//usr/share/plasma/plasmoids/org.kde.plasma.clipboard/contents/ui//usr/share/plasma/plasmoids/org.kde.plasma.devicenotifier//usr/share/plasma/plasmoids/org.kde.plasma.devicenotifier/contents//usr/share/plasma/plasmoids/org.kde.plasma.devicenotifier/contents/config//usr/share/plasma/plasmoids/org.kde.plasma.devicenotifier/contents/ui//usr/share/plasma/plasmoids/org.kde.plasma.digitalclock//usr/share/plasma/plasmoids/org.kde.plasma.digitalclock/contents//usr/share/plasma/plasmoids/org.kde.plasma.digitalclock/contents/config//usr/share/plasma/plasmoids/org.kde.plasma.digitalclock/contents/ui//usr/share/plasma/plasmoids/org.kde.plasma.icon//usr/share/plasma/plasmoids/org.kde.plasma.icon/contents//usr/share/plasma/plasmoids/org.kde.plasma.icon/contents/config//usr/share/plasma/plasmoids/org.kde.plasma.icon/contents/ui//usr/share/plasma/plasmoids/org.kde.plasma.lock_logout//usr/share/plasma/plasmoids/org.kde.plasma.lock_logout/contents//usr/share/plasma/plasmoids/org.kde.plasma.lock_logout/contents/config//usr/share/plasma/plasmoids/org.kde.plasma.lock_logout/contents/ui//usr/share/plasma/plasmoids/org.kde.plasma.manage-inputmethod//usr/share/plasma/plasmoids/org.kde.plasma.manage-inputmethod/contents//usr/share/plasma/plasmoids/org.kde.plasma.manage-inputmethod/contents/ui//usr/share/plasma/plasmoids/org.kde.plasma.mediacontroller//usr/share/plasma/plasmoids/org.kde.plasma.mediacontroller/contents//usr/share/plasma/plasmoids/org.kde.plasma.mediacontroller/contents/ui//usr/share/plasma/plasmoids/org.kde.plasma.notifications//usr/share/plasma/plasmoids/org.kde.plasma.notifications/contents//usr/share/plasma/plasmoids/org.kde.plasma.notifications/contents/ui//usr/share/plasma/plasmoids/org.kde.plasma.notifications/contents/ui/global//usr/share/plasma/plasmoids/org.kde.plasma.panelspacer//usr/share/plasma/plasmoids/org.kde.plasma.panelspacer/contents//usr/share/plasma/plasmoids/org.kde.plasma.panelspacer/contents/config//usr/share/plasma/plasmoids/org.kde.plasma.panelspacer/contents/ui//usr/share/plasma/plasmoids/org.kde.plasma.private.systemtray//usr/share/plasma/plasmoids/org.kde.plasma.private.systemtray/contents//usr/share/plasma/plasmoids/org.kde.plasma.private.systemtray/contents/applet//usr/share/plasma/plasmoids/org.kde.plasma.private.systemtray/contents/config//usr/share/plasma/plasmoids/org.kde.plasma.private.systemtray/contents/ui//usr/share/plasma/plasmoids/org.kde.plasma.private.systemtray/contents/ui/items//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor.cpu//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor.cpu/contents//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor.cpu/contents/config//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor.cpucore//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor.cpucore/contents//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor.cpucore/contents/config//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor.diskactivity//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor.diskactivity/contents//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor.diskactivity/contents/config//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor.diskusage//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor.diskusage/contents//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor.diskusage/contents/config//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor.memory//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor.memory/contents//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor.memory/contents/config//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor.net//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor.net/contents//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor.net/contents/config//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor/contents//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor/contents/config//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor/contents/ui//usr/share/plasma/plasmoids/org.kde.plasma.systemmonitor/contents/ui/config//usr/share/plasma/plasmoids/org.kde.plasma.systemtray//usr/share/plasma/plasmoids/org.kde.plasma.systemtray/contents//usr/share/plasma/plasmoids/org.kde.plasma.systemtray/contents/ui//usr/share/plasma/services//usr/share/plasma/wallpapers//usr/share/plasma/wallpapers/org.kde.color//usr/share/plasma/wallpapers/org.kde.color/contents//usr/share/plasma/wallpapers/org.kde.color/contents/config//usr/share/plasma/wallpapers/org.kde.color/contents/ui//usr/share/plasma/wallpapers/org.kde.image//usr/share/plasma/wallpapers/org.kde.image/contents//usr/share/plasma/wallpapers/org.kde.image/contents/config//usr/share/plasma/wallpapers/org.kde.image/contents/ui//usr/share/plasma/wallpapers/org.kde.image/contents/ui/mediacomponent//usr/share/plasma/wallpapers/org.kde.slideshow//usr/share/plasma/wallpapers/org.kde.slideshow/contents//usr/share/plasma/wallpapers/org.kde.slideshow/contents/config//usr/share/plasma/wallpapers/org.kde.slideshow/contents/ui//usr/share/plasma/wallpapers/org.kde.slideshow/contents/ui/mediacomponent//usr/share/polkit-1/actions//usr/share/qlogging-categories5//usr/share/sddm//usr/share/sddm/themes//usr/share/sddm/themes/breeze//usr/share/sddm/themes/breeze/components//usr/share/sddm/themes/breeze/components/animation//usr/share/sddm/themes/breeze/components/artwork//usr/share/sddm/themes/breeze/faces//usr/share//usr/share/solid//usr/share/solid/actions//usr/share/zsh//usr/share/zsh/site-functions/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protectionobs://build.opensuse.org/openSUSE:Maintenance:18411/openSUSE_Backports_SLE-15-SP5_Update/fdb1d44e6793855bbb6f4060d57b85bc-plasma5-workspace.openSUSE_Backports_SLE-15-SP5_Updatedrpmxz5aarch64-suse-linux   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~UTF-8 Unicode textASCII textELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=e36e9246c38b8749ac6ad0f15c1bd66fd036e909, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=c1adf42608aca2b4dddd1931f9e9af1de31f12d0, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=bf74ea67131b54aa9cf5c8db66cfd42309273a8f, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=52fb2a388a0b65897b0b0af28ba36de56fa5b8a1, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=9f2e67298aac352baefc21e2cbf03b977326d95b, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=18760401410ff617171902511b3b1adb9c7fac4c, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=ff73f326c4767aa54c0bcf0bf75aa4a183f0b3dd, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=141c6a7b7ef65f7f0018f11f35622f7ab62c19cb, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=54f0a2e87bf80854a63026513ea17d993255e6ec, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=678223a257d01b5157d31c387c8db693760c916d, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=3310677b5b16cdc89cf7962d7583ac1d48c24a96, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=a18a56673596a2db104762c3e069eb5074bb243f, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=7c730ea56754d956c33fe8111eb62fb42e4e3830, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=d30de09d81a9887d50d727ea9cba407fea83aba0, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=874ef8297f4cc155445965d5250e15906cdef4f8, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=e5547df89877f62d1e1512d81b8245bb10ede020, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=799e51dc8cbb7ab6f592dcb7c29bf1170950f4e8, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=c96133ab183540b57813b693e5df27ec41a87070, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=e45c244c3911fdb37bdc2422994d17e005a2292a, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=7ed4dab3ada5f28187d642d95f8fed21e1ef9193, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=7cfa47fca5b751cef65b21a756e2e3ae4aac0a4f, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=2e5649f6587f2d597ee95286427d43411ab13775, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=575be47bcedddb12fe5452d07c0e51db848f9e58, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=36bbcd3a130dad0d6c85e94aeb630430eb1b6552, for GNU/Linux 3.7.0, not strippeddirectoryELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=d0ea8d5bc591b1e06d5a0598a4e8aac6827d0bdf, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=2197f195f9c99c91afc2c2a13d9929e5e6d723ca, for GNU/Linux 3.7.0, not strippedPOSIX shell script, ASCII text executableELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=7728c9376f2af8b2dd12027122df9166b969f4fa, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=390f795809768fd0f6f304377ab6a44dee05083e, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=6dac019a8160456701530edacc42dfd9b20ca80d, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=ce4f7ca61a0671cd10f00742355eaf515a7585ee, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=74c2b142990d7f269f3d79df998eb3fd51d7978a, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=97b8ec7c5ff681b90ff0f60f072a93a04732dc27, for GNU/Linux 3.7.0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=262ad65398278eeaa6c545425ec7f8c8580faa17, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2f3398cbe240448280d540b44a7e3623f80bba97, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=363ecdc8abde368a63d9ca4b59924ed7641fa51a, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=751353a6361b88d56558c5224d0ede1b9d59c726, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=413327faf082cb71aec4a52c778b529d444ee297, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=67aa1999dd1e2bbb6434985d9987520ed85b2733, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3c0031bfc3042b6cdaf8e051d8278e102370a685, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=65da13eb16df5f00858ca7b6fe052f692ca00648, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9864740e20123420585565aad427f1185fadef18, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3b73c0f95d000d3025462bfcdcd71d2415343bdc, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=47126cd0442b0ea9503c1e37cd09b028118f6150, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=650cb674e9f4b71d3d20afca2d73e2502e895a58, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=997efbd2443a2f686abcd3ea248272dcfb75b61d, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=749a27414c6bae44acd4bc5ee6b2537080679976, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d8d5086d88df14feba6beb97674463e220a88f38, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=93e60c15523a751a7c8cdb098c7002a14f1d39c1, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=440c7e2349fbf88d4e2c0658a5ef2fc8d287743d, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a2e2ac4dc1aa0c1b5a94504e6fdab0f640c283d7, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c5d172aa290af3087d1f690f25dcbd1eb1efa8ac, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9b3d5231c7349dfcc088f8ec4c252e7bd96ec4e0, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d60c64f6fa4f1e26df65c58a43116a85d5d93cc8, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d02929d70b906102ba2d09f097e1dd8c0b3cc729, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ebd6af7c10e236aa503b6ffc0b477a42161c7901, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=73a17bd873643b591d09f370a31190c662737602, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=24db163cc7015e9eac4458a17c407fcabed11afb, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a18b6c030ff5a3ba2c9bd4a7b9082a7fd776a8ec, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=7df89ecd721ecbf4697a70e09878657795e48747, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=96e45ce7269dec3d36cfde6c040899e55dd4f06b, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d808600dd077a124b0ce55166bef38233c2821a8, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1b1d22e3a698dc043d1a7b6541e104b16d1f6817, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a7a53c8f572c8d3063e76e15827decbf18db0f79, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=83bd0e7868cab1cbba250a9f1fb0ae60c4648b9b, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1f92dd6881a1e1a82972b34d3de9123c40603e4e, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f1c7d95592118289c7442fe1fbdbab7e3e7017a5, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=12d9e1217dfffba8bdf1c9fc174ef3bbb6e26da4, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=90279289262552861ed9653144a32fe5c658f0a5, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=949182c2953a33fce0399a7ad67d9be9aebc8b34, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4efa4bb1658291e0adf30801318a40dcfc1079cb, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1ae8756de43fd8313db9d1133c8d985aa1fb2131, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a6f4cb177e489c863639398bff1a47a2f31ece17, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c8d113aee4aa600d2366d429a35e78dbbe64a0c7, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=42d836a79be539d75109e93ad84e7fbb7760f94e, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=7fe78c99d5d3ea38aab723e4a08e0212563c618e, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3c2dd12836f2ed761a0521aab0be4bb1570fa9cb, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2b04e583a2a0988e9a18b7bf882c42a4451b5530, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c5b0682a341e40884fd66853650220a599c30b69, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ffeb50d56af4ed7d007a6e4327f3d39b57f7bb26, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ccfc2bbfd7a21e9c21fb326df9ed3e6cc4dee848, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4ff7bb8604d46e84c450aed354f50a7c7977d2c7, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=15ac15b539a209f68c2ee1c3646ca8324683215a, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=628bb9f38940c50a2e094bfe462d41e505638cac, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=88b63f38fa3149f291879f49c3de355e1fbab632, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=25a4a0c56f1c97227bfad1733f0aeb313573d09b, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d825678ce86804d0490ddf608a21594910378380, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1262eb510f16b46ba28c4a1bf54bd743c5464a93, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c595e66be2444cdcef88cd067a0f3ae0cac2ae0d, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9550087cce38096d33e7e02347d8f418af8b3c5d, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ac47a9db5326973f5eafa6d4e8f2ab2bd2022413, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=41dcc16504134ef377f9369d8a4c1f0794628209, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e93aa4e4b77c9ec8127401ba269a5b5d6d3183d7, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=67407e31a9b4190a88a9d2cc890db0a922e8a88b, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=31e99e7a4419350a1df89f900bfab0829729b65e, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d0e900b96580837937553edb694aa825409bb0e5, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1396f904e08da5d67a11ce323526b15a8da548aa, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3fbe1905d4de8b1c3d61376f3343ebec4b1d5de6, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, BuildID[sha1]=b6047ef7f282901f8257b70bb132da5b7740a549, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=176fca3f04b7e90793a1602a8af9f31ea76deba9, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=fee1517df344eb29cc80a5eca642d71394a257bf, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=dcbc8bedf32318bdb2619d9f74fea61d0ab3d71d, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=6dadeb5ec095743985d95282e1e5ca138a6f91ae, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f011e5cc6d0f286d5d46f65b1d20f9e4effa8761, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=961feaa53a526050829b63aa58ee3f0fd338ce40, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e1b1b216029ea219c4fe6d8115022b6477a6407c, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=55a96c161c4b567b6723b88441ba3f8c0b80cccf, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=bdba915fff251451556ee72ab7dbe604e8a4ee5c, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a96218d36e9e0c95e22313437b7d839c5f51150b, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3657f762b03fd926a8a1b1211d3888840a16b2ea, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e1e42c1a0ab63f3f52d42c78e187d3f86dfd0815, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1969eeb689c92999201955b89f06cb402e6c1ce1, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a703d657acd6c2518743bc537a706d1237c1cf45, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=b506a66306a0acf86e3b3ff0c9f62a4377f7704c, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=30e131a4275561e8bc47b130ee04c0474fd31c89, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=5c40c2dc41d1fb4b1bc77e71787f3ca8a2a2723f, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=96803152483ff3081ae5cc36a523912d9ffbfaad, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=745090c5b10f6a719f3d437356126a5bbae66d00, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a3a0ed3f55163706908033e897d800718a946591, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=ac35d05213a4fbc705b76342e23ae43b09febe59, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=eabaa730e86265ab108b06d0b3837c084ada9a73, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=db0103a8da6d901828a8d7297ef94e830ee7d7fa, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=12364b63280c8791d097e197a367e285d4a71530, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9cd4688f221d1299c9088f1b2149959475a39c10, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=8eb1d7b008f4db5ca95011fcfb3254a4e19d1af5, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=742a80990d8fbbf24f3aa03bbd2f5da994b409fc, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=43e4d7199ded57de6469a1700017539c417bb9ae, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (GNU/Linux), dynamically linked, BuildID[sha1]=2bd96e99dc37ef31dbd6bc35389088a8c4690ad3, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f80ad3a527275ca1fcbf4f437b5876400144994d, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c41248829ba1dc482f9014562a64daab13880e58, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=19c5606ede73a6631612b6d268838e4abab764a9, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=18707d3d50361d9a47164dddbb17b48bb2d7f081, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=5740a7ee3f310b46910eb6ed9d81d7a1d7bb38ec, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=fbfc4d762c60939d3344422239c98bf11fe4038c, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3ed5d5972706a29f6be20688c87fad93bfcb7ba7, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9bd402657ec7674eb24be6476765fa8cdfc02da6, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a655039037f3372fc22cb23fee9b99e25af5ba5e, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=195427d725a9957cc6934b2e17aa1142bd1dcc32, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0dbbfa4e70b646c3aaedc0c0796047e42e201e3c, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d3c36e29b270753b86743b8f1e9a312b0e7b40ab, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=842bfab640b0c09eeb920d8f6dc4bc096486802e, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=218e3238abbcad7307e904c97dfc62b247f6697a, not strippedASCII text, with very long linesELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=58d87640a73a16d71192148d4a0888f8cda92b66, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=67c66abddb2a51724c7cf83ed1ee8d9d9f6cbf21, not strippedELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e1b6a6d43f2dfe030e550a65ce41b5e1951aa26d, not strippedKDE config file, UTF-8 Unicode textXML 1.0 document, ASCII textexported SGML document, ASCII textPNG image data, 514 x 393, 8-bit/color RGB, non-interlacedPNG image data, 429 x 301, 8-bit/color RGB, non-interlacedPNG image data, 442 x 327, 8-bit/color RGB, non-interlacedPNG image data, 429 x 337, 8-bit/color RGB, non-interlacedPNG image data, 429 x 324, 8-bit/color RGB, non-interlacedHTML document, ASCII textPNG image data, 814 x 547, 8-bit/color RGB, non-interlacedPNG image data, 438 x 556, 8-bit/color RGB, non-interlacedHTML document, UTF-8 Unicode text, with very long lines (bzip2 compressed data, block size = 500k)XML 1.0 document, ASCII text, with very long linesPNG image data, 320 x 295, 8-bit/color RGB, non-interlacedPNG image data, 922 x 699, 8-bit/color RGBA, non-interlacedPNG image data, 390 x 272, 8-bit/color RGB, non-interlacedPNG image data, 1150 x 859, 8-bit/color RGBA, non-interlacedPNG image data, 22 x 22, 8-bit/color RGBA, non-interlacedPNG image data, 838 x 703, 8-bit colormap, non-interlacedPNG image data, 1162 x 863, 8-bit colormap, non-interlacedPNG image data, 633 x 609, 8-bit colormap, non-interlacedPNG image data, 1028 x 722, 8-bit colormap, non-interlacedPNG image data, 402 x 213, 8-bit/color RGBA, non-interlacedPNG image data, 556 x 205, 8-bit/color RGBA, non-interlacedPNG image data, 555 x 453, 8-bit/color RGBA, non-interlacedPNG image data, 445 x 446, 8-bit colormap, non-interlacedPNG image data, 192 x 116, 8-bit colormap, non-interlacedPNG image data, 128 x 128, 8-bit/color RGBA, non-interlacedPNG image data, 16 x 16, 8-bit/color RGBA, non-interlacedPNG image data, 32 x 32, 8-bit/color RGBA, non-interlacedSVG Scalable Vector Graphics imagePNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedPNG image data, 64 x 64, 8-bit/color RGBA, non-interlacedSVG Scalable Vector Graphics image (gzip compressed data, from FAT filesystem (MS-DOS, OS/2, NT))Perl script text executablePNG image data, 15 x 16, 8-bit/color RGBA, non-interlacedUTF-8 Unicode text, with very long linesXML 1.0 document, UTF-8 Unicode textPNG image data, 599 x 599, 8-bit/color RGBA, non-interlacedPNG image data, 600 x 600, 8-bit/color RGBA, non-interlacedPNG image data, 651 x 651, 8-bit/color RGBA, non-interlacedPNG image data, 649 x 649, 8-bit/color RGBA, non-interlacedPNG image data, 800 x 800, 8-bit/color RGBA, non-interlacedPNG image data, 512 x 512, 8-bit/color RGBA, non-interlacedPNG image data, 512 x 512, 8-bit/color RGB, non-interlacedC source, ASCII textASCII text, with no line terminatorsSVG Scalable Vector Graphics image (gzip compressed data, was "restart_primary.svg", last modified: Wed Oct 1 22:09:37 2014, from Unix)SVG Scalable Vector Graphics image (gzip compressed data, was "shutdown_primary.svg", last modified: Tue Sep 2 03:57:27 2014, from Unix)emptyJPEG image data, JFIF standard 1.01, aspect ratio, density 1x1, segment length 16, baseline, precision 8, 1920x1080, frames 3PNG image data, 600 x 337, 8-bit/color RGBA, non-interlacedPNG image data, 300 x 169, 8-bit/color RGB, non-interlacedSVG Scalable Vector Graphics image (gzip compressed data, was "busywidget.svg", last modified: Tue Sep 7 14:47:24 2021, from Unix)PNG image data, 2521 x 1260, 8-bit/color RGBA, non-interlacedPNG image data, 1920 x 1080, 8-bit/color RGBA, non-interlaced%0L`1]i!?Vl~ !;LZr-@Qk&BR_ly *@Pd~ *8bt"0FXly  0 B i  1 S \ i x y * + 9 : O P k l       ! # % ' ) + - / 1 3 > @ B D F L W _ d l n r z     # + - / 1 3 5 7 9 ; = ? A C E G I K M O Q S U W Y [ ] _ b g k o s u x z ~  !*18;BEKNRY`gmr{ %,56=BFHOUX`djqtyz  $&'(),29<?DHLPRUW[] (&,   0    !*      &')" .!               RRYRRRRWRyR[RR(R/RXRZRVRRxRRRyRRRRWR[RmROR'R(R/RNR%RlRZRVRRxRRRRRRyRWR%RVRRxRRRyRRRRoRWR[RmRYRsRR2R0RRNRlR5R%R(RXR/RnRZRVRRxRRRyR[RRRRmRWR@RPRlR*R%R/R(RZRVRRxRRRYRoRyRRRRR[RWRmR7R=RHR*RERKR$RORPR,RMR0R'R&R%R-RNR/R(RXRlRRRnRZRVRRxRRRbRyRRRRmRdR[RWRYRDRMRR+RcRaR7R)R*R/R%RXRORlRZR(RVRRxRRRoRdR[RRRRmRyRYRWRRRRPR,R=RsRrRRwRcR7R5RORHR*R/R(RNRlR%RXRnRZRVRRxRRRRRRYRyRdRWR[RFRRUR?RcR%RXRORZRVRRxRRRRYRRRRRRoRyR[RWRRsR'R-R&R/ROR(R%RXRnRZRVRRRxRRRYRmRRRRRRoRyR[RWRRsRtRuR'R&R/RORlR(R%RXRnRZRVRRxRRRyR[RmRRRRWRCR'R/R%R(RlRZRVRRxRRRRbRoRYRyRmRRRRRRR[RWR3R;RRtRuRFR?RaR0R2R7RHR'R-R&RR%RXR/R(RlRnRZRsRVRRRxRRRYRRRyRWR/RXRVRRxRRRyRYRRRR[RmRWRJR?R5RORPRKR'R%RlRZRXR(R/RVRRxRRRRRRyRWRYRRXRVRRxRRRRRRR[RyRYRWR=RR3R?R7RHRRR'R-R&R%R(RXRZRVRRRxRRRYRRRRyRWRXRVRRxRRRoRRRRjRyRdRbRYR[RWRmRDRRFRMRRRTRRRCR=R+R?RIR)RPR,RcRHR*RaRiR&RORlR%RXR/R(RnRZRVRRxRRRbRRRRyRmRdRWR[RDRCR=RPR?RcRaR/R*R(RlR%RZRVRRxRRRRRRRyR[RYRWR=RR3R?R7RHRRR'R-R&R%RXR(RZRVRRRxRRRRRRRyR[RYRWRsR=RR3R?R7RHRRR'R-R&R%RXR(RZRVRRRxRRRRRR[RyRYRWRmRRPRR(R%RXR/RORlRZRVRRxRRR[RyRmRRRRWRYR!R8R7R5RlRZR/R(RXRVRRxRRRRRRYRyRWRqRR RpR(RXRVR}RRxRRRRRRYRyRWRqRR RpR(RXRVR}RRxRRRRyR`RRRRoR[RWRmRRR_R0R/RlR(RsRnRZRVRRxRRRoRRRRbRdRWRyR[RYRRFRsRUR?RcRaROR/R%RXRnRZRVRRxRRRyRmRWRRRR8R0R&RlR%R(RVRRxRRR[RRRyRmRWRPR,RlR%RZRVRRxRRRRRWRyRR%RVRRxRRRRRWRyR%RVRRxRPRRRYRyRqRWR}R/RXRpRVRRxRPRRRRRyRoR[RWRsRvRRR~R%R}R/RnRZRVRRxRRRkRoRyRRRR\R[RmRWRYRMRORRiR*R(RXRlRZRVRnRRxRRRRRRyRYRWRzRCR*R%R(RXRVRRxRRRRRRyRWR5R%R*R(RVRRxRRRRRRYRyRmRWR'R7R=R&R5RHR*R/R(R%RXRlRVRRxRRRyRmRWR[RRRRYR*RPR,R/R(RXRlRZRVRRxRRRRRRyRYRWR(R*R%RXRVRRxRRRRYRyRoR[RRRRRRWRRsR'R-R*R&R/ROR%RXR(RnRZRVRRRxRRR[RyRRRRWRmRYRIRLRORNR*R/RXR(RlRZRVRRxRRRRRRyRYRWR*R(RXRVRRxRRRRRRyRWR5RHR/RVRRxRRRRRRyRYRWR5R/R%RXRVRRxRRRRRRyRYRWRRR5RXR/RVRRxRRRmRRyR[RWRRRRRGRR5R/R(RlRZRVRRRxRRRmR[RRRRWRyRGR7RlR/RZR(RVRRxRR[RRyRRRRWRmR$R'RlR%R/R(RZRVRRxRRRRRRyRWR[RGRRHR/RZR(RVRRxRRRqR[RRRRRRyRfRWReRGR7R5RHR"R/R%RpR(RZRVRRxRRR[RyRmRRRRWRGRRlR R%R/R(RZRVRRxRR[RRRRRyRWR6RGR=RIR7R/R(RZRVRRxRRRRRRyRYRWRGRRXR/R(RVRRxRRR[RyRmRRRRWRRGR8R7R5R/R(RlRZRVRRxRRRRRRyRWRGR=R7R5RHR(R/RRVRRxRRRRRRYRWRyRGRRNR/R%RXR(RVRRxRRR[RmRyRWRRRRGR=R7R/R(R%RlRZRVRRxRRRYRmR[RyRRRRWRGR8R7RHR/R%R(RlRZRXRVRRxRRRRRRyRWRGRCR/R(RVRRxRRRRRRyRWRGR=R8R7R5RHR/R(RVRRxRRRyRRRR[RWRmRYR@RPRRR2RRNRlR5R%R/R(RXR}RZRVRRxRRR[RRRRWRyRR7RR(RZRVRRxRRRRRRyRWR?R/R(RVRRxRRRRRRyRWR?R/R(RVRRxRRRRRRyRWR?R/R(RVRRxRRRRRRyRWR?R/R(RVRRxRRRRRRyRWR?R/R(RVRRxRRR[RRRRyRWRR5R=R(R%RZRVRRxRRRyRmRdR[RRRRWRYRCRcRORlRXR(RZRVRRxRRRRRRyRWRCR(RVRRxRRRyR[RRRRWRmRCRR8R7R5RHR=R/R%R(RlRZRVRRxRRRyRbRYRRRR[RWRmRdRDRCR=RcRaR8R7ROR5RHR,R'R%R/R(RXRlRZRVRRxRRRRRRRyRWRDRCR(RVRRRxRRRdRRRRmRyRjR[RWRYRCRPRcR0R&R%R(RNRORXRlRiRZRVRRRxRRRbRRRRyRdRWRCR+R=RSR7RHRcR(R%RaRVRRxRRRRRRWRyRdRCRPRcR%R(RVRRxRRR[RyRmRWRRRRCR7RHR/R%RlR(RZRVRRxRRR[RyRmRYRRRRWRRCRPRR,R7RHR/R%RXR(RlRZRVRRxRRRmR[RRRRWRyRCRlR(RZRVRRxRRR[RRRRWRyRmRCRR(RlRZRVRRxRRRmRRRRyRWRCRR(RlRVRRxRRRyRmR[RRRRWRCRR/R%R(RlRZRVRRxRRRRRRyRWRRCR5R(R/RVRRxRRRRRRyRWRRCR5R(R/RVRRxRRRRRRyRWRRCR5R(R/RVRRxRRRRRRyRWRRCR5R(R/RVRRxRRRRRRyRWRRCR5R(R/RVRRxRRRRRRyRYRWRCRR/R(RXRVRRxRRRRRRyRWRRCR/R(RVRRxRRRRRRyRWRCR7RHR(RVRRxRRRYRoRyRRRRR[RWRmRCRERKRMRRR=RPR,R8R7ROR5RHR$R0R'R&R-RnRNRlR%R(RXR/RZRVRRxRRRRRRyR[RWRCRR=RIR/RZR(RVRRxRRR^RRRRyRWRCR/R(R]RVRRxRRRRRRyRWRCR(RVRRxRRRRRRyR[RWRCR5R(RZRVRRxRRRRRRyRWRCR(RVRRxRRRRRRyRWRRCR9R(RVRRxRRRRRRyRWRCR=R8RIR7RHR/R%R(RVRRxRRRRRRyRWRCR-R(RVRRxRRRyR[RWRRRRoRmRCRsRuRlR(RnRZRVRRxRRRmRyR[RRRRWRYRCRPR,R/R%R(RXRlRZRVRRxRRR[RRRRyRWR>RRCRHR/R(RZRVRRxRRRRRRyRYRWRCR(RXRVRRxRRRRRRyRWRCR6RIR(RVRRxRRR[RRRRRyRYRWRCR1RRIRHR(R/RXRZRVRRxRRRRRRyR^RWRCR=RIR5R]R/R(RVRRxRRRyRRRRmRWR[RYRCR0ROR(RXRlRZRVRRxRRRRRRyRWRCRR(RVRRxRRRYRRRRRyRWRCR/RXR(RVRRRxRRR^RRRRyRWRRCRHR]R(RVRRxRRRRRRyRWRR(RVRRRxRRRRRRWRyR^RR9R%R(R]RVRRxRRR[RbRdRmRRRRyRWRFRR8R5RHRcRaR/R(R%RlRZRVRRxRRRbRRdRYRRRRyR[RWR3R;RFRR5RcRaR'R-R&R(R/ROR%RXRZRVRRRxRRRmRYRbRdRRRRRoRyR[RWR3R;RFRRtRuR5RcRaRRR/RNR&R%RlRXR(RnRZRVRsRRxRRRbR[RYRRRRyRWR3RCRFR5RaR'R/R&R(R%RXRZRVRRxRRRbRRRRyRWR3RFRTRaR(R&R%RVRRxRRRbRYRyRdRRRRoRWRqR[RR3RFRcRaRRRNR&RpR/ROR(R%RXRvR}RsR~RRnRZRVRRRxRRRbRYRmRRRRhRyR[RWR3RFR8R0RgR5R&RlRZR%RaR/RR(RXRVRRxRRRbRRmRyRYRRRRoR[RWR3R;RRtRuRFR?RaR0R2R7RHR'R-R&RR%RXR/R(RlRnRZRsRVRRRxRRR[RbRYRRRRyRWR3RFR&R%R(RaRZRXRVRRxRRRdRbRyR[RRRRmRWR3RFR>RRcRaR,RHR/R(R%RlRZRVRRxRRRYRbRyRRRRRRRWRFRaR/R(R&R%RXRVRRxRRRbRyRYRdR[RRRRmRWR3RFRRcRPRaR5RR'R&R/R(R%RXRlRZRVRRxRR|RRmRbRRRRRRdRyR[RWRYRFRLR{R(R/RcRaRlRZRXRVRRxRRRRRRoRyR[RqRWRmRYRP)P?P)P@P)PAP)PBP)PCRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RRRRRRRRRRRRR RRRRRRRRRRRRR RRRRRRRRRRRRRRRRRRRR RRRRRRRRRRRRR RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR1p$Ayfilelightkio-extras5libqt5-qtvirtualkeyboardoxygen5-soundsphonon4qt5-backendsystemsettings55.27 utf-89be98a348966dba9ed02facc229d56e69eafdd9a94d2d77de39c8a17f5089ef8?07zXZ !t/P7]"k%nQey#}84\N.$MZ0e.2ԇ:VQ흳q wUp.&L69&;C .238XH4K!S~ \ kZH#H{%5&:h @f>cCkUJ/lrIsжxQfɅ®bi#I h`?fmc`IYz#~T̛Y{ "A*mX7w/D?~CQ#y*2agmfi>vXZ!a`l6RסOۑŢW]T f!gԗ\ mPk5gOCJʋ E݄`->kEw,cr55Xi3xxgxJ_%č8G+脥zBIz915{U1fh8S»T-I<+ɯ L`k|0M,?-& k04̪+;6 $II˨ro4RvL@^"?TJ>y[Mh2[HicV*I%]pzښV{bbQ3  n XHm+EVq8 sA3wU?8fUEqgEY2T xE'A~h{ΰx9`=Lwǭ# :sąy>0XlxSmsY&o'ThNS aZP{'d􇛟N"u D MZs.bC43C $]KĹPxwJe"3 ulb10J+|^aEGC`ݯ,Fn+oH.4ºe=Vd-#)\s#s˖sk}__FX 7 ~$ '"~/Ѻ5ƩC4f E 9!/'\d>M{8ڬ+,gh* ٭2sbmBԫsqM8?6Җ]kt9.`Ce x3e 1V%G3~>c h(07RB/駏Y(ڝO0c MVBh<6wZc-&:< e ̡7想O`-=1oJ 2v-b<șshq)ᨓрg8X#P̅33v5loOٻ⦴x+JqRA6mHc9:*t-T!¸SqG1}W4 |!?Mh]$QأsFy">{O\$ṔK]@I/<ϧꁲ$WvJ586.g%l×!![:H4nT@ovKQs^&$U!Ɠ[c@|3dF[ A_#JXRMzp7ZMSQGg}3baZ0),zRқZ_g~2$9?-pbP9}r?jd~Vf/Ļ0Z>2nM7`wC3(a z uB?osBa}R?@3>/j]JZ_>qbX|-sGZFVb&Bd'>>&B֞Li._t́^xCa["4zFjW}T,~wt'ػ6[[7C{Gt-ꦐa:Pũw|5;Yc#.D-cN&jڢGDmza{ߒ@e&hh(ɩTj#Lş, 3b'ή f8Abҟ`\P_@Pmݮw˫a%H?JR0Ԥs iS.!uʖus_kl  jkL_\pC~<2rmf G:N6p8H!Ф#v[{mn7c0-T;{ȮL5i7>bJ~P]2rR8x%޶F 8'Bnl;+ һ!iT2  FEqQ@UblqW+g)kw5d'6;S|{[O~RPpz'~K 6I ZyTbOz-λPGҰs6J,}ݘ/c#uuD (4u*eNGk8glMKK4ep7R:tm,UmV⚺kjX+x3f:z TOEf8]-xW 6~bz[ż<N薒>PGۙ1+4[Gb n=nL=L>Ep7`Gǰ6S7[K@zyt,*Odwƀi;%weU*1LNQ H)rB{ kmKS84z)|j8o7mf<&m8OURnRI g1R-i.ͼ={3c8ݯsE(COj}FN,:Ş[^oW4p^MX=5Bˌl%R6,"~Ԣ峲fJ査71ƒ!I踶gIwse?ofX8{> HUf!VlL2SC*/n?"n[z!dzPÙڧFjjvA`uX<Ar1Z夤Cxz fw)=Y9),ʢH,"kcl&\q4~"w5l)0LfJ/7X y/>!=r& Bh !gB)3R,R\>Œ97Mt]pjEx}uvjh :S蜺F^U0"&8N< +qNzO7^>(O^y[pvgQ ;(~ˉȄL3 AU3Az,8FehEryO k. [;I'$rS4ABW,2u : ϩqVsk_>nE!!_ :nVȐY{Ω[Lylަv^ѳs jÖY2i 9A' nܵŸ؛~j\yƺr_g[&BIx=GFa#\ɼWcT?ai- ħv#ƒlxdj0У3hbM=d:}/+oO÷5^EJV,ns+f=2oOwy1y?44Pc6LzLإPk3U ICe0qacHYs"%Y[p$CH4: R[`F%?m5}Y$IɻBUSo蔳5qWs!BSr7(ͯ1J$7HAI=ܨW WKDe; Q_vf1{LO @|@n'4>JŖ:qf~|Och4=9R >voK\$kZzFe^QF%x]ThIj9$l6-?@ӿ(7 Փ0xu֎7ꚞJϧ; D JgA=gIFjF<Kg-R~<7xkqhf{+},V۬ ,Մ,Ivãn՝qāxs^ky5?) ߉ c帑宼ж"@)AO\Mˎ)2Ư 0h"WCȺqƣBnfp_p.O$=Cf,,]kYW`nQe' sg16Q37סmJ'@ۺb,_koAfj'H:f+yJ;Jp-y(g3,`Rg2_3}ڍ>%@~k0< yReo@7>@3je0jq' Sx;v,hj6 ޕK Q&hy oq BX7cml6EBL~ l\Νy s,]"W򅙹 6m%esK8)2hϸV WCfv$P=eQ_M:Ή(EF-C°9A0֧ZSSϬN+9cV;\D$;Bo‘3v2 Hrqy~l|_d e/Xa4뒚 sm>N5>6/ ÜNjÛ1i`l7{E$sd+d-PB+/cy)QPBql+zeŒ#c%;;*~JϴbK* Ϸi7m#ax 1[e3o4VAo 3 ϙke H|%k$RX$]F=qpt{}'i Uy"7 ̐j]0Ѳ,A թ 6bԶ:!0AJ~;kS g8T0wl1f n;CDc;Q ŚfӉ 0t,p"#l,/OYrܵ4H(xNOnhv5zdb9dA=f{5he1}Ā͹D&ǎy5jDž+ɯn1GoWOBH/rL&y.bJI"3GA^>z $67@PNGZڴ@1%}(H.v.@%=aS`P4¯l6!~D(O}~Vrv%qk˅Zya|Nf?q];jF#==6Elchw:~ GKLs}.LMa \m Rȶ\T)*~u+[n- 6%ͣgJg$%HyA qLls?FJ*v CںB`=dcrl\.|J8C;%ix (-T'G${BƒQN!vMu''u<:b`~+Tj2_oS@ eI5i:ɉa v%AauA$zwN"F N9 kXW>n]RЁ28Y^7{ hGӃi\wk( Ɇ3y¯-nZ 遅Ƶ}],qM_2YwꉱWG`gFӌ[h&+|ũ , 3S{mQ2k>vii6Ieڶe:У}ձ^MQVm w> qdW@GRkxsj1R_ʕK3g| s3gJXaG @س>|JJΊƨ @Ҡ?$o3ץ2alӳq?UPQ=7I0[=.D[@j@ ,-ݨ>8hYh9aWߨG"4." *D:hrHVwTo'%].gt]TL 4X[![nh v׊&Hҧ">\T'-ZzP¿aJeW< kiS<5o( gsO#|HT]|(`ٹYyc12p98ۓz[=O5ɫ5iO糽#*}Ž/]ؼP;j9ÆLvfUgL)'}u?ӽțBxbڜ|GE5s)!ktA㴱ο@fN=B`}V8\C7=G\DLZo 1yF6"GyChZ#յ%h8olr|{Oq4V,5 +@! }sRgjрatͪr*p4|A Qb7ܧ0oߡ'w赗ݺ#BryT>R/4V>:3hBL$4`w`A)>.lE)1-`l.$|wK7Jffywq3$X޾1{xx^2$+iًI.aam0 )j}2~l*c3o;ƿPUS/;PX>j'ּȐε\1g >Θ{^ȿسH;C{bSۑ8y˥}Q6Ļv7*sE-1[:YAyK,BE6~&RD bx}t9چJ4a,jY[r?ȸ3^ΰTh4; l]Prb`Bi7qDIA+f<%ytUR$e12jZ:6a3KkOKPt-0[9|,IoH1FRb?h#-֒AjiL쵍R sGrXD=Gng|._~T2; ljYKK'Ɵ1-OvlpSr롅}| <ӱPlAL7ۑU-a蕜U<:n vj\o=S $'B:Ł׶JkM툏8Ej |~"W"tDON̽o#Cfڕ@@;xuxC'₋XUR~?&G9yPDz28Ə]Wh(c@7Yb(%?ܔT -3PYݲj$c$lB201e٫SRnf%@ԡKŊqg2nH'œV3b/wѬѩ잇4~m(YP'\ϩXQ3ڻEF -t= bYDӨ!>-/Oyܻ9{DJߢ#׹'#"8 ֒B &O4j:]đ%@gLmN`+FZ*gT?eϧPNDF~8B)4as" W<Dz1Hߋz~:|a3"4㍵2]ca?{Ӑ0mD&]2ƣh yxI6 ,Ų4/L*tZtZ|Ċ@31 g_qjd*hҎ`P+~q/#ԙ!6ñhr}յlb ?:ORWSv} {e j#i y>5M#'<䢘AiI^PFy<62O>TE'#S,4V}J$P4&&ΨGF6BLډ|*;6"S`zRѶe?-6(,yu:`̓0w0^͖}JI^UVOB<l[$:-!I~9wGA9ݲPKm:N,aEӥsγ8IJ2V]q#$o–5f3)Pn~BfG^. ]xy%K(.Zcz;xi-sf!oXc*tӯm 6Tޒ}D|!,ͣQ0jԷUglH56Ȳ wEPPޯ3JF{?=7"poYaN|W {ŷ[IA[D$~E2xW9fC]6`g%wy=DYՈ~Zu^,SIJZԪ LCA Bխ]POoXRB,o/CBZxooϰ{9 YZ